5EKOA

Crystal structure of mapk13 complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
341
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 13
publication title First comprehensive structural and biophysical analysis of MAPK13 inhibitors targeting DFG-in and DFG-out binding modes.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 341
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ekoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ekoA01
4EH2A 4DCEA 4RWKA 1W82A 3UIXA 4FKOA 4C58A 4YJUA 3V5QA 2XKFA 4ANBA 2C1BA 4JDKA 1TQIA 4Z3VA 2EXMA 4I4EA 4H3BA 3DJ7A 5DYJA 2PHKA 4XV9A 4U3YA 3RHXA 5FWKK 4MNFA 4X6RA 2BCJA 4KINA 5AP1A 4Z16A 3MH1A 4FKTA 5EOLA 5JRSA 4S2ZA 3S00A 4OTFA 3BZ3A 4CFXA 2QKRA 3C0IA 1H01A 1PHKA 3FLSA 3DPKA 2IG7A 4X6QC 4Y85A 4F7JA 1JAMA 2XNEA 3RPOA 5KBQA 4ZSGA 2P55A 3L9NA 4L45A 4RG0A 5DPVA 4J8NA 1WBPA 4D5HA 3QCSA 4QPAA 4KNBA 5LCKA 4IAYA 2XKEA 4XRLA 5FDXA 4B9DA 3ZC6A 4O0VA 4RQVA 4D4YA 2OJFE 4E4NA 1B6CB 4O6EA 3OEZA 1JNKA 4JLCA 5AP6A 3ERKA 3PUPA 3A61A 4XG8A 4FV6A 5CVHA 4DFUA 2ZDTA 4YGAA 2G2IA 2GS6A 4QMZA 1JSVA 3G15A 2R7BA 1DAWA 4C4EA 2X6EA 3DLZA 3O8PA 4QMWA 5IDNA 3VS5A 3N4UA 5IPJA 3ZDUA 5BUEA 2O65A 2FSOX 5HGIA 1R3CA 4AS0A 3QRIA 3CS9A 4FVRA 2ZM3A 2ZB0A 3BE9A 1KSWA 1R0EA 2C0IA 3OBJA 3PIYA 3BGZA 4G3CA 5C8MA 2HYYA 4D55A 4BIDA 5AAGA 3HMIA 4ORKA 4GJ2A 4LV8A 2QOKA 4BTMA 2UVXA 2FVDA 2XRUA 3FLYA 4NYEA 4QP1A 2BZKB 3GU4A 3OTUA 5TO8A 3GVUA 4FG7A 4NCTC 1S9JA 4G9RA 3JVSA 4DN5A 4RLLA 3WZUA 3ZSIA 4GMYA 4OBOA 3PVGA 3BHYA 5CSWA 3T8OA 5IF1A 3RP9A 3RPRA 2LGCA 2ITYA 2VTMA 3MPTA 2BZHB 3NNWA 3ULIA 4DLIA 3QXPA 1YQJA 3GB2A 4LG4A 4N0SA 4DITA 4J1RA 3GU6A 2IW9A 4C3RA 4BWKA 4RWIA 1ZZ2A 2B9HA 2R9SA 3QKLA 2ZMDA 5EW3A 4FKWA 4FZDB 3LM5A 2IZSA 4FKVA 2CMWA 1ZYLA 2WU6A 4I23A 3QTUA 5CZIA 4EYMA 3CY2A 4H1JA 4DFXE 5BX0A 4TXCA 1MUOA 2R3RA 4M0ZA 4E4MA 2J5EA 5T68A 2C0TA 2XYNA 3BYSA 3FYKX 4C34A 4XBUA 4XBRA 3ZFXA 3HV7A 2FH9A 4NT4A 5CVFA 4CGAA 4I92A 1O9UA 2VO6A 4K11A 2IVUA 4IH8A 4ZTHA 2XYUA 1KE9A 4C4FA 2YWVA 1BMKA 3BQCA 1TQPA 1H28A 2XNBA 3HRCA 4ZJIA 5EHLA 3CJFA 3FQSA 4O2PA 5CZHA 4B0GA 2YISA 3GC0A 3TZ8A 2I0YA 5E8UA 5BVDA 5IA2A 1ND4A 2OFVA 5AM6A 4BF2A 2VUWA 1IASA 2GQSA 3AGLA 2IVVA 3NCZA 3NUNA 5CALA 2YERA 3FC1X 1YDRE 3QA8A 4TYIA 4IX5A 3UYSA 4P5QA 3Q4TA 5GJGA 1JBPE 2BHEA 4JR7A 2PUIA 3HMPA 3NYOA 4FTLA 3BU5A 4OLIA 4EH3A 1X8BA 3VIDA 1BX6A 4RVMA 3Q6WA 4YC6A 5IQBA 5D7AA 1IR3A 1SVHA 2XM8A 3QCXA 3QQUA 3PSBA 2RIOA 1OKZA 4YJPA 1W98A 4ONAA 4BBEA 3TJCA 1PW2A 3IW7A 3LFDA 2QG5A 5DNRA 4M3QA 4X2KA 4MQ2A 4YTFA 4DEBA 4AGWA 3G2FA 4TWCA 4NM5A 5HIDA 5J5SA 5DR2A 3BHUA 3LLTA 5CAVA 4ACCA 4GH2A 2W4KA 4E73A 5BUJA 3OWKA 3FPQA 1RJBA 3E3PA 4IWOA 4U45A 5DBXA 3UIUA 4BY9E 2R0IA 2WMBA 3FKOA 2JKMA 3PXZA 3QQLA 4F6WA 4DG0E 3ZCLA 2A0CX 4FYNA 3EWHA 3WBLA 2C6DA 4EOMA 4EWHA 5CS6A 4LUEA 5LVPA 4CG9A 4PP7A 1JKKA 1JVPP 4FKJA 3TN8A 5GIOE 2R7IA 3LJ1A 5J7HA 3BHTA 4YJVA 2BALA 3DK6A 3MFUA 1H08A 5HE3A 2PZIA 4A9TA 4EOIA 2WQEA 3ZYAA 1YXXA 4O7ZA 2XMYA 3OTVA 4RJ8A 5J9LA 4IX4A 1E1VA 4IMYA 5EQEA 2Z7SA 3HP2A 4GFMA 2BFXA 1K2PA 3VS1A 4GUEA 3MH0A 3PP1A 3WF7A 3NUXA 4LGGA 4MBLA 5EG3A 2HOGA 1FMKA 5BYZA 4S31A 3PA4A 4PTEA 3BYOA 4D9TA 3BLHA 1SNXA 2QHMA 5HD7A 4NK9A 1JKLA 4M97A 3VQHA 4G3EA 1WMKA 4GG5A 4IJ9A 1PXLA 4ZMEA 2XA4A 4MXYA 4BCPA 4CMTA 5C8KA 3CY3A 4ARKA 4NM7A 2PULA 3QL8A 4YLKA 5HNIX 5M44A 3BU6A 2V7OA 2CGUA 4CCBA 3LMHA 1OPKA 1PRYA 2UZBA 4HYIA 3LAUA 4YJTA 4O0WA 3ORXA 2W0JA 3HA8A 4X3FB 4LMNA 3MN3A 1OL1A 4O0UA 1Y91A 5AV0A 4AAAA 2QOQA 4JDHA 4DYMA 3LXNA 4YHJA 5CVGA 2HY81 3E8CA 4ZTLA 4XP3A 1Q8ZA 4MQ1A 4QO9A 4CRLA 2GHLA 3D9VA 1IA9A 4EH6A 2C5OA 3NAXA 5KHXA 3Q2MA 1YXUA 4I21A 3FYJX 3WI6A 4JDJA 3FI4A 2PUUA 4IFCA 4QPSA 3EFWA 4EZ5A 5KX8A 3DFAA 4BCKA 2QQ7A 2G9XA 2ITWA 2PVNA 3M1SA 4AFJA 2EWAA 2YAAA 3ELJA 3FQHA 1YWVA 3I0OA 3F3VA 4FTAA 4QYHA 4ZXTA 1ERKA 2ONLA 3NX8A 5JFVA 3VN9A 5M4CA 4O22A 3DAEA 3OXIA 4J97A 4DT9A 2VTRA 2UZDA 3TKIA 2PYWA 3HRFA 3ZLYA 3FZSA 4EH5A 2DQ7X 3VBTA 3A7JA 2VTPA 3DZOA 3K5VA 1W83A 3COHA 3FKLA 4HNFA 3TKUA 5JN2A 3RVGA 2GPHA 2YM4A 2I0EA 3KCFA 5L2QA 1U54B 4EEVA 4JT3A 4I0TA 4QMUA 4C57A 4YUQA 1M7QA 5GJDA 4Q9SA 3VJNA 2XKCA 3COIA 4F70A 4WUNA 4X3FA 4DLJA 4YHFA 1ZYCA 2VGPA 4KAOA 2XIZA 3FJQE 3L9PA 4XV1A 3KY2A 3VJOA 5CWZA 5IA0A 3TUCA 3U6IA 1W84A 3WARA 5FRIA 3POOA 4APCA 2G2HA 5TOZA 3UOKA 2J6MA 4WNKA 5HQ0A 4PPBA 3Q9WA 4QMLA 2REIA 5A3XA 5M56A 4BCOA 2VTLA 4LRKA 4TWPA 3UO4A 4BDKA 2ITUA 2WKMA 3BGPA 4C3PA 1ZWSA 2WTDA 4H58A 2FGIA 2CNUA 4ZSAA 3ZM9A 3A4PA 3GCQA 4IZAA 4MKCA 2VO3A 1XO2B 2YIXA 1UU7A 3C5UA 3PXQA 3IW5A 4N70A 3UG1A 3AG9A 4BBMA 5J95A 5HVKA 5HO6A 4YURA 2F57A 1OM1A 4YLLA 3UNJA 4A9RA 3A8XA 2V55A 2QURA 4FTRA 2W1EA 2YN8A 4IB5A 3AMBA 5IA3A 3ORTA 1U59A 4EHEA 2PVJA 5FLFA 4I93A 3FZOA 4YO6A 4MF1A 4PMPA 2GS7A 2PVMA 1CM8A 4ZJJA 4X2NA 3W33A 4II5A 3N51A 5FEDA 3QRJA 5IKWA 4YU2A 5DG5A 4HPUE 2PZ5A 5FTQA 3NAYA 4ZSEA 3EL8A 2XIRA 4XP0A 4M8TA 3F2RA 3R7OA 3RAWA 4O38A 1J7UA 2VO7A 2XCKA 4ENYA 4OBPA 4X0MA 3OVVA 3HRBA 3NZ0A 4QQTA 3FMKA 5T6KA 3A8WA 3EJ1A 4C59A 2HZIA 3CC6A 4YMJA 3IPHA 1GIHA 2XNMA 1UU9A 2C68A 5E4HA 3TUBA 4FL3A 3LQ5A 2GNHA 3OUNB 3LFBA 4O82A 3KU2A 3DBCA 2OZOA 1P4OA 4EK8A 2VWZA 4FTIA 4ANSA 4P2KA 3VBYA 3PIXA 3KRWA 2EU9A 3R9OA 2B0QA 4BI1A 2WELA 4PTCA 3CGOA 4AZFA 3G33A 2QO2A 3Q32A 5HX6A 3KF4A 5FXSA 3GNIB 2YCRA 3ODYX 4XOZA 5K0KA 4GFOA 5I9ZA 3P79A 3QZHA 3FMDA 1P14A 2GNFA 4OBQA 1OMWA 4KB8A 3Q9ZA 2O64A 4S30A 5EW8A 2XZSA 1DM2A 3MIYA 3R1NA 3R7GA 5FTGA 2AC5A 4KS7A 4QNAA 3PJCA 2V5QA 4Y72A 5FEEA 4BDCA 1XBCA 4JXFA 3UYTA 2B52A 4CTCA 3UOHA 1KE6A 2EVAA 3F61A 5AADA 3V5WA 1A48A 1URWA 4OGRA 5M06A 3AC4A 5JGAA 3VWAA 4R3RA 1CKIA 5K5NA 4WG3A 2BKKA 2C6TA 4X2GA 1FINA 5EH0A 2O2UA 4WIHA 3TM0A 4G3DA 4MX9A 3ZBXA 3C13A 4I6BA 5IEYA 5ACKA 3EQHA 4QMTA 4ZP5A 2GHGA 4BN1A 2GNGA 2BTSA 3JUHA 1VYZA 4RVLA 4AW5A 2YA9A 5E1EA 3FWQA 4BDGA 3DB6A 4UMTA 4F0GA 4HGSA 4N57A 4PPCA 3CR0A 5C27A 1WVYA 4QMYA 1SM2A 4EUTA 5LOHA 4FGRA 3I5NA 3CJGA 4FT0A 4QMXA 4NCTA 3LXKA 4JQ7A 4WA9A 4XG3A 1XH8A 4KSPA 4LGHA 3A2CA 4I94A 4EOKA 3SKCA 5ANGA 4C38A 1K3AA 2QCSA 3GBZA 3NR9A 4J96A 4RX8A 2XP2A 3EQDA 3IQ7A 4AX8A 2WAJA 4D58A 3R30A 3F3TA 3G5DA 2EB2A 3H0ZA 2YDJA 3O7LB 4PTGA 1BI8A 3MTFA 4CFVA 2C5XA 5KNJA 3AD6A 3GGFA 4FKUA 3C0GA 3ZO3A 1QPDA 2XK7A 3ALNA 2NNWB 2FSMX 4G16A 4ASDA 4C36A 4FTJA 1Q8YA 1RW8A 3TIZA 3WE8A 3QFVA 3HV3A 4DBXA 3DBFA 1CSNA 3JYAA 3NUUA 3PWDA 3DDPA 4EQUA 2J0KA 4DH3A 4O0YA 4PDYA 4YNOA 3R9DA 5JZNA 2PUPA 3Q96A 1KV1A 4CRSA 3OCTA 4O7VA 4UMPA 4HVIA 2VTJA 1H25A 4FSMA 4IM3A 1QL6A 4BHNA 2XBAA 3ZOSA 3U87A 3BYVA 5A4QA 5CAUA 3AGMA 2QC6A 4IZ5A 4M67A 4CQGA 2ETMA 4ACDA 3IK3A 5J79A 5HO8A 5KMOA 4A9SA 4XRJA 3R9RA 4GS6A 3VUMA 4GFGA 4I1ZA 5HIEA 4E4XA 2OIBA 5EKNA 2X8DA 3HZTA 3JPVA 2QHNA 4EQMA 5EM7A 3OT8A 3AC2A 4HCTA 3UO6A 4D9UA 3HKOA 3H9FA 4E26A 5FTOA 3H4JA 5EYDA 1ZYJA 3K5UA 4IAAA 4X7QA 5LVOA 2UZWE 3KXNA 3WYXA 1OIYA 3D2KA 4IDTA 4QTAA 2FA2A 4TTHB 4JS8A 5ANDA 1OPLA 4FSNA 4R7IA 4EOPA 3N4VA 3THBA 2ITPA 2G01A 3MTLA 3C4ZA 4FX3A 3AT2A 3LFFA 3CTJA 3EYHA 1ZYDA 3ORZA 3QU0A 4ZLZA 3RINA 2VX0A 1M2RA 3EKNA 3ZLWA 5A4LA 3VRYA 1OL7A 1Q3DA 2EB3A 1ZMWA 5HICA 4W8EA 4AUAA 3K54A 3ZLSA 2XIKA 5I9XA 2QNJA 3IDCA 3OY3A 4O91A 1R0PA 5TE0A 3ORMA 3OHTA 3Q52A 3DQXA 4YTHA 4CZTA 4CEGA 5HX8A 2C6EA 3V5LA 3ZEWA 4NFNA 3BQRA 2IWIA 2WTKB 2ZAZA 4FKSA 4NUSA 3LZBA 4I22A 3NIEA 4TY1A 5L6WL 1H24A 2Q0NA 3NCGA 4BCHA 2OIDA 2QOHA 2XS0A 4FSYA 2RG5A 4IWQA 4WBOA 3VS3A 5KMKA 1H0WA 4RGJA 3UZPA 1YOLA 4E8AA 5HORA 4R78A 3CLYA 4I5HA 5I9WA 4HW7A 3EN4A 1Y57A 2F49A 4CKRA 5AMNA 2BTRA 2W9ZB 2H9VA 5CQWA 5IH6A 1E1XA 3GC7A 2CN8A 3O7LD 4N6ZA 3AD4A 2CNQA 2R3GA 1NT2A 3BEAA 3A99A 1UWJA 2ZB1A 4RA4A 4YO4A 3L8SA 3VUGA 2ITNA 3DBEA 4ZSJA 1XQZA 5TKDA 3WZJA 5EI2A 5HLPA 2PPQA 3KXMA 4EI4A 3HEGA 4U6RA 5IMEA 3Q3BA 4UYNA 2ONLC 4ANMA 4CLJA 2JFLA 5B7VA 4DG2E 2J51A 4FV7A 3ULZA 1IAHA 2CGWA 3LFCA 2G2FA 2UW9A 2X8EA 3QD2B 4C4IA 1PMEA 2W1DA 5AP5A 3I6UA 5HU3A 2RFDA 2B9IA 4JBOA 5HBEA 3QQFA 3RWQA 2ERZE 4HJOA 4DFLA 4EK4A 4RC2A 3QKMA 4I0SA 3R7IA 3VULA 3PPZA 2YJSA 3VW6A 3C4XA 5H8EA 2E2BA 4F9YA 4IAIA 3PWYA 1STCE 3NNUA 4X3FC 2UV2A 4GL9A 3G6HA 3RPSA 1UNGA 5LMBA 2A19B 5L2WA 4BGGA 4F4PA 3F6XA 3S4QA 4BYIA 4CNHA 4NIFB 3K3IA 3R7YA 4U41A 2CKEA 3I0QA 5F20A 3ACKA 3HMNA 4RRVA 3SW4A 3V01A 4D1SA 4BIEA 3NIZA 4J95A 4L68A 3DXPA 5EYKA 1J1CA 1UWHA 2J90A 3F3UA 4C2VA 1KWPA 2YM5A 3MPAA 4KSQA 3FXWA 4PY1A 1WBOA 2OSCA 4EOJA 3E8EA 3QAME 4FZFB 4Y46A 2AC3A 5CSPA 2JKQA 3TV7A 3PG1A 3P7AA 4MNEB 5CT0A 1YDTE 5BMSA 4U0IA 3QCQA 1AD5A 3NRMA 3FXXA 4IC7A 3AOXA 4WRSA 5AIRA 5CEIA 4NTTA 4QQ5A 3U6JA 2BIKB 1ZOHA 2F4JA 2JIIA 3KRRA 3MI9A 2I0VA 3M2WA 5CT7A 4X2JA 2CLXA 5F1ZA 4ZY5A 4HGTA 3BI6A 4FICA 4KBCA 3TV4A 2Y4IB 4AN2A 5KUPA 4RJ5A 2E9VA 1XH6A 5DLSA 4PNIA 1JSUA 3DJ6A 4CFUA 2ZV9A 4MBJA 5E8TA 5C4KA 2C5NA 4FT9A 3OCSA 2QD9A 5EQPA 2GMXA 2IO6A 4YSJA 3UIBA 2GNJA 3ZZWA 4A4LA 4ZTMA 2OXXA 1Y8GA 4E6CA 3QYZA 4F9BA 3WF8A 1PMUA 3F2AA 1YVJA 4CKJA 4M13A 3D94A 3NUSA 1VR2A 3EFLA 5AUYA 2GDOA 4Z55A 4NIFA 3ETAA 4IW0A 3U4WA 3FQEA 1VYWA 3V5JA 3CCNA 4QTBA 3H30A 2UZVA 1H8FA 5L8LA 1PYEA 3OOGA 4DH1A 2QLUA 3LOKA 2H34A 5I9YA 3UVQA 4A4XA 2O3PA 2C5VA 4JQEA 5FXRA 4EWQA 5BVNA 4KIQA 5JQ8A 4F64A 4FKPA 4CYIA 2XJ1A 2PMIA 3ORNA 2PMOX 3R1YA 4FMQA 5CANA 3TNPC 3UG2A 2HZNA 3B2TA 5CEKA 4MNEA 1U4DA 3R2YA 4BYJA 4KIOA 4K6ZA 5K4IA 3OT3A 4EC9A 2R3FA 4TYJA 3H0YA 1P4FA 3KVWA 2JDVA 5HG7A 4BCNA 3UPZA 4L3JA 4JG8A 5AR3A 2UVZA 3FXZA 4DHFA 5IA4A 2RFEA 4Z7HA 5CEMA 2OJJA 2WMUA 4H36A 3QGYA 5EI8A 2VWBA 4F0FA 2YCQA 4IJPA 3NNXA 5I4NA 3CGFA 1WVXA 4TYGA 2PUNA 3IDBA 4QP8A 4CXAA 3P1AA 3DKCA 4KBAA 1J1BA 4YNEA 4AP7A 1UA2A 1OPJA 1U46A 2HENA 4ZMFA 3LE6A 1Y8YA 2BIYA 1BYGA 3DNEA 3GCPA 5M55A 1P5EA 4AZSA 2OZAB 3DJ5A 4YHTA 3AMYA 4O84A 2UW7A 3EZVA 3ZZEA 5KMMA 1H26A 3I1AA 3MB6A 4LRJA 4D4RA 5IA1A 1OVEA 4GT5A 1LUFA 3GCVA 4BCJA 4AT4A 3REPA 3UVPA 4DGLC 5CAQA 5HU9A 3UZTA 3ZMMA 1OUKA 3ID6C 2Y7JA 3GI3A 2Z7QA 4EZ7A 3U8WA 1DAYA 1DI9A 3NSZA 3TZ9A 5FP5A 4BC6A 4CMOA 2EUFB 5IMXA 4QRCA 3W2CA 2YITA 4IM2A 5DR6A 3UNZA 5J7BA 5HG9A 1OITA 1WBVA 2PZPA 1CKJA 3RCJA 5LQFA 1I09A 5HTIA 3V3VA 5A9UA 4RIYB 3ENHA 3R1SA 2J0LA 3QQKA 1NVRA 1XH7A 2CDZA 4M15A 5CF5A 4EBVA 4DGOA 3DB8A 2BPMA 4XG6A 4UX9A 4WT6A 3OFMA 3UGCA 3ZSHA 4FTMA 1PYXA 2VO0A 5HCXA 1PF8A 1A9UA 1LR4A 2WZJA 3BV3A 5B2KA 1XWSA 4RC4A 4MHAA 1CMKE 3QGWA 3RNYA 4WKQA 2WTJA 4WHZA 2H8HA 3DBDA 4DEEA 4G1WA 3VBWA 4UWYA 2WMXA 3BRBA 2G15A 1YI4A 3DNDA 3P08A 4QPMA 5ANOA 3R04A 1WZYA 4GIIA 4H1MA 4BKYA 5KKRB 3F5GA 4XG7A 1SVEA 1QPCA 3HECA 3GFWA 2R3JA 3OZ6A 5KMJA 3UO5A 3KGAA 2GTNA 4M84A 2QONA 3IECA 5CXHA 4FG8A 4AWIA 1H4LA 3F9NA 3PLAE 3ZSGA 2YACA 2UW3A 4CV8A 3UIMA 3KK9A 2XK8A 4O1PA 2PE0A 1M2QA 2QO9A 2XRWA 3LXPA 3F5UA 3HGKA 3O17A 3PA5A 4MTAA 2CKPA 1ZMUA 3RK5A 4GW8A 2ETKA 1ZOGA 2ITQA 1IRKA 5CX9A 3RPVA 3EN5A 4RIYA 1UU8A 3R9NA 3T3VA 4DH5A 5AR2A 3A7FA 1PXJA 3HX4A 3E92A 3PRFA 2GU8A 3OROA 4C62A 2QLQA 3IW4A 4N6YA 3ZU7A 5CSVA 4XOYA 4F1TA 4JVGA 1Q4LA 3W55A 2ZJWA 3LLAA 2YABA 3V5TA 5DN3A 3FMHA 3LFAA 5AM7A 3ATTA 1WCCA 3TXOA 3RHKA 3CQEA 4V01A 3ZBFA 4ZJVA 2X39A 3QTQA 3LQ3A 4DFBA 4XX9A 3SGCA 3BBWA 4M68A 4QP2A 3OS3A 2ZV8A 2WTWA 3RNIA 2NRUA 1HCLA 1YI3A 2WMWA 3ZO1A 2VWXA 3LQ8A 2C30A 1J7LA 5AX3A 4RC3A 3FHRA 4Q5HA 3VO3A 1Q5KA 3TTIA 4AF3A 3KA0A 3NYXA 2CCIA 4Z7GA 4FKLA 4QMVA 3MPMA 5E9EA 3PZHA 1XH5A 2NP8A 5DRDA 5AP3A 5EQYA 4UALA 2IVTA 2PVFA 3H9OA 4NEUA 4C4JA 3DQWA 4F7LA 5AA9A 2QVSE 5BPYA 5IEVA 3EN6A 4FV0A 4H39A 4BHZA 3GT8A 4FT3A 1V0PA 4BGQA 5KMLA 5AA8A 3E93A 2R3QA 1VEBA 3FLWA 5CLPA 3OC1A 3QTZA 5CAOA 1FGIA 3UJGA 4L43A 2O5KA 4CYJA 3EQRA 4NJ3A 5DT0A 3R1QA 3R2BA 4ZY6A 3FMLA 3UQGA 2PK9A 4FA2A 4D1ZA 5IA5A 2YLEA 2CJMA 1L3RE 4HYUA 3W10A 5F9EA 2RF9A 3SA0A 2YDKA 3VRZA 3PY0A 4W9WA 3I4BA 2R3MA 1OIQA 4ASZA 3LXLA 4APPA 5FEQA 1A06A 3NW6A 2R3NA 3LHJA 4UMUA 1R78A 3CKWA 2VV9A 1WAKA 4JBQA 4IVDA 4EZ3A 3KXZA 4FV9A 4FKGA 2G1TA 1APME 5H3QA 5IQFA 4RVTA 2VWVA 3B8QA 4TW9A 5CF4A 2WTIA 3P7BA 2VN9A 3G0FA 4QP3A 3DS6A 4J7BA 4RIOA 3GOPA 5CASA 5E8VA 5LJJA 4M69B 4XH6A 4YTIA 3UE4A 4A07A 3LMIA 1FGKA 3FY2A 3NWWA 1JSTA 4WD5A 5BVKA 1OL2A 3HNGA 4WNMA 2YIQA 2HAKA 1S9IA 2XUUA 2NRYA 3PXKA 2WTKC 1OKWA 4O96A 4G17A 5AP7A 5GZ8A 4QP7A 4KD1A 5EDPA 3GEQA 3PIZA 4XLIA 5ETCA 3NUPA 4AZTA 3OCBA 3WIGA 3QUEA 4TNBA 3TL8A 4QTEA 3PDTA 2FSLX 1G3NA 1OBDA 3P4KA 4FK3A 1Z9XA 4PRJA 5AR5A 3GUBA 4MYGA 4YZMA 2CGXA 4CKIA 2W1GA 3Q04A 5DT3A 5EYMA 5LXMA 1MQBA 2VWWA 2OXYA 1J3HA 2FB8A 2WNTA 4TKSA 3V6SA 2YDIA 2VTTA 2WD1A 1WVWA 2YCFA 4UXLA 2B54A 4KRCA 5LMAA 4GSBA 4LQMA 1XH9A 4XJ0A 4G34A 3ORKA 3W2SA 3TT0A 4D2SA 1WBNA 4EHZA 3GOKA 3EOCA 4RVKA 3F69A 4RFZA 4OTWA 3R28A 4L46A 3O2MA 2J7TA 3FAAA 2SRCA 4FSZA 2JIVA 4MBIA 5GZ9A 1TKIA 3VHKA 3OBGA 4JNWA 3GP0A 4LMUA 4QYEA 4C2WA 4GU6A 3S3IA 4E1ZA 5C1QB 3EFJA 1YRPA 2HY0A 3RM6A 2JLDA 5DGZA 4ACGA 4JIAA 4AT5A 2IN6A 2PVHA 4D2TA 4UEUA 4BB4A 2WTCA 3G6GA 4DEGA 3R9HA 4I41A 3IO7A 4V04A 2C0OA 2X81A 2GNIA 1Q3WA 2C69A 5AV4A 2VGOA 2JAVA 3GU8A 4QTDA 3B2WA 4KUJA 2HWOA 2UZOA 2PZRA 2X2MA 4JX7A 3O71A 1WBSA 2X0GA 2B53A 4Y95A 5CSXA 4GJ3A 2WOUA 2GS2A 5IU2A 1BLXA 1YXSA 5G1XA 5IEXA 4Z9LA 3W8LA 2R64A 1O6LA 2VAGA 4HOKA 3BKBA 1Q8TA 4U79A 3CPBA 3IS5A 5ETIA 5LMKC 2WPAA 3S0OA 5IQAA 4FV8A 4FTTA 3CE3A 3QTWA 4EJ7A 3CSVA 1YXVA 1JPAA 2IZUA 3KXXA 3MVHA 4JIKA 4I6FA 2BDFA 2GHMA 1UVRA 4IC8A 3BBTB 2BDJA 3KXGA 3PJ1A 1OIRA 4TWNA 2B9FA 3A7GA 3KK8A 4FT5A 4DEDA 4U40A 3ZUVA 4FR4A 2YIRA 5HHWA 4DTAA 5JSMA 2J4ZA 2HXLA 4EK6A 2VZ6A 5LVLA 1OIUA 4FEXA 4NL0A 1NW1A 5L8KA 5GINE 3CQUA 2XJ0A 2WHBA 4V0GB 1URCA 3LCTA 5K3YA 5HO7A 2ITVA 2QI8A 4ZZOA 2ITXA 3QCYA 3EB0A 4M14A 5AUWA 3GQIA 2WFYA 3V04A 4O2ZA 2Y4IC 2R3LA 3HUCA 3ZFMA 2ITZA 2UZLA 3EQPA 1BI7A 4KBKA 3P7CA 5AR7A 3GCSA 3K3JA 3ET7A 4F08A 1U54A 5DR9A 4R1YA 4BICA 3NNVA 3U4UA 5HE1A 3ZTXA 3CQWA 3JR1A 1YDSE 4R1VA 4WSQA 3MVLA 4USFA 3LMGA 3U54A 4PMTA 5DOSA 1MRUA 4FL1A 3SXSA 4MD7E 3ZS5A 3E63A 5TT7A 4UMQA 4W4WA 2Y8OA 1ZY4A 2YWPA 5HVYA 4BWXA 3BELA 3QRKA 2GFCA 3NMUF 2J9MA 2GQRA 2ZM4A 1UNHA 3OWJA 4UN0C 4IAKA 5H2UA 3LPBA 4FZ7A 4MXZA 4KIKB 4ZLOA 3MY1A 4X2FA 2BR1A 3F88A 5HZNA 2C1AA 3GFEA 4AACA 4YJQA 3FPMA 2VD5A 5DRBA 3VS4A 1BL6A 4E20A 5A6NA 4FNWA 4I4FA 1MRYA 3MV5A 3SQQA 3WOWA 1YWRA 2KTYA 5D12A 4AW2A 3R7EA 3TEIA 5L6PA 3PYYA 1WBWA 3R7UA 5IQHA 4AZWA 3RI1A 5I9UA 3JXWA 3RWPA 5AUZA 4O83A 3C4FA 4NKSA 4BDIA 4FSRA 3COKA 3S2PA 4YC3A 4Q9ZA 5M09A 2X2LA 4EH4A 3WF9A 5A54A 5HBJA 3G90X 3NPCA 3HDMA 2YM7A 3K2LA 1H07A 3Q4CA 5BYYA 1Q24A 3D5XA 4RSSA 5EHOA 2I1MA 5KZ0A 5KMNA 3KC3A 4ENXA 3KULB 4XG2A 5AUTA 3CD8A 4UWBA 3C1XA 3E3BX 2PSQA 3FI8A 3LKMA 4EJNA 4JAIA 3D0EA 3EQBA 3EYGA 3KN6A 1OGUA 3JY0A 4YZDA 3W8QA 3L8PA 2PWLA 3QTXA 4FIJA 4CMUA 2DWBA 3BGQA 4ERWA 3BHVA 3QX2A 4M0YA 3IW8A 4KWPA 4L52A 5HBHA 1KE7A 4JX3A 3FUPA 1M17A 4YR8A 2PZYA 4FKIA 5L3AA 3FKNA 3R01A 3WYYA 3TCPA 4AA5A 5IH5A 1W0XC 5A46A 4CD0A 3MFSA 4KIKA 4RX9A 1FVRA 2XKDA 3RKBA 4OTGA 4YJSA 4MWIA 2ERKA 4AZEA 4ALWA 4TYHB 2UZUE 3MS9A 4NFMA 1YHSA 2OJ9A 5IQGA 4XUFA 3SC1A 2E9PA 3D7TB 2Y0AA 2ZDUA 4TRLA 2XJ2A 3NW5A 2BILB 4FV1A 3VS2A 1SMHA 4GIHA 4GK3A 3QC4A 5E8YA 5M57A 3ZEPA 1GZOA 4JRVA 1YHVA 4MXAA 4E5BA 2A2AA 2OLCA 2W9FB 3RZBA 3Q4UA 2QKWB 4QQCA 5FDPA 4JI9A 5DEWA 2PL0A 1ZXEA 3Q4ZA 3FZRA 2OKRA 4ZEGA 2JDSA 3DT1A 4BRXA 2PVRA 3Q5IA 4DG3E 4NZWB 3TACA 4DF3A 3KULA 3UNKA 1PXNA 3PFQA 4FIGA 5KKRC 2X9EA 5JFXA 4S33A 2WB8A 5M53A 4L8MA 3IOPA 5HKMA 4IX3A 5E7RA 4O6LA 1JKSA 5J9ZA 4NWMA 3FLQA 4P5ZA 3ZONA 5KHWA 3CEKA 4EH9A 5C4LA 1Q62A 4Q5EA 4MH7A 3E7OA 5DVRA 4K9YA 3TV6A 4FEVA 3VBVA 3G51A 3JY9A 3PE1A 1NXKA 4L7SA 3Q5ZA 4ZZMA 4BTFA 4ANQA 5AIKA 3A7IA 4PDOA 4LOQA 5FG8A 5B0XA 4L01A 3RAHA 4FUYA 4W4YA 3VUHA 2WXVA 3F5PA 5FQDC 5ACBC 5A6OA 4WOVA 3MVJA 3DKFA 4XMOA 2NO3A 3D7TA 5L2SA 3N4TA 3D14A 4I5PA 3NDMA 4JG7A 2JITA 3RZFA 3VW8A 5CF6A 1FQ1B 4A06A 2UZNA 2W7XA 4AGCA 2H96A 3N9XA 3VF9A 4XG9A 4BR3A 3RJCA 2YJRA 1H0VA 5DHJA 3T9TA 3P0MA 3R22A 4BDBA 3DA6A 4BKJA 4QQJA 5LVMA 4PUZA 2VWYA 4QD6A 5I9VA 3FMNA 3GU7A 4TT7A 2YFXA 4Q2AA 2WIPA 3VBQA 3O8UA 2QOFA 3CKXA 3AT3A 3P9JA 4R3CA 3T9IA 5H8BA 4E6AA 5E1SA 3QZFA 2YAKA 3CXWA 5J87A 3E62A 4AQCA 1CTPE 4FF8A 3PA3A 2HZ0A 3FZTA 4FV3A 1JQHA 4L53A 4GYGA 1MRVA 3CIKA 1P2AA 4RWLA 4RWJA 2Y9QA 4FIFA 3NW7A 3TUDA 3Q9YA 5L6OA 5EHYA 3NVMB 1NVSA 1OECA 3QUDA 5JT2A 4L67A 4TPTA 4LYNA 4I3ZA 5KE0A 3HUBA 3UC3A 2J0IA 3IGOA 4LV5A 4Y5HA 4XS2A 4QYGA 2PMNX 3S1HA 1Q8WA 2Y6MA 5IQIA 4IZ7A 3PPKA 2JBOA 2V7AA 4GK4A 4CLIA 4F0IA 4D2PA 3RAIA 5C01A 2WMVA 3MIAA 3MVMA 2VX3A 3AT4A 4GU9A 1ZYSA 5IZFA 3Q53A 4MWHA 3HAMA 5L8JA 4D0WA 2PMLX 3LW0A 3OOMA 3CBLA 4PF4A 4A9YA 3D5UA 3PXRA 4XP2A 5BQ0A 3QXOA 5HLWA 2CHLA 3QLGA 3S95A 4CZUA 1OL6A 2R5TA 2CPKE 2RGPA 3P5KA 3G9LX 2J0JA 3UOJA 5IDPA 3SRVB 2B7AA 3QHWA 2YIYA 4QMMA 4YJOA 5H8GA 3BU3A 2XB7A 3PY1A 5JZJA 2OK1A 1PY5A 4P90A 4ZS0A 4CFFA 3ZO2A 3TDVA 3F7ZA 2PU8A 1QMZA 3JVRA 2EXCX 3IG7A 5EYCA 4HYSA 3I79A 5LWNA 4ANNA 1JLUE 5DE2A 2P0CA 4JBPA 3ODZX 4E4LA 1YOJA 5CY3A 4K33A 5CEOA 3OXTA 4GKIA 4FTUA 3BE2A 3PLSA 4OT6A 2BHHA 3O23A 4BI2A 3R83A 5A14A 1PKGA 2XK9A 3SDJA 2JKOA 4MEDA 1JWHA 2PVKA 3G9NA 1LPUA 3QA0A 4JJRA 4IIRA 1M2PA 2XVDA 3POZA 5AV3A 3QTRA 2XNPA 4UV0A 4AE9A 4IANA 1AGWA 4NSTA 2ZYBA 3KMWA 4WUAA 5CI7A 5JQ5A 3IDPA 2UW8A 3LCKA 3VUTA 2C6MA 3FMJA 5AP4A 3MW1A 3DXNA 1FMOE 3TIYA 3PTGA 4BCMA 3U51A 3MWUA 2J0MB 3MA6A 4E5AX 5GIPE 1OB3A 1WFCA 4PX6A 5G6VA 3SV0A 2C6IA 4QMSA 2UW4A 4AXAA 5LVNA 4IWPA 4RX5A 1PKDA 4V05A 3ROYA 3VUDA 3ZO4A 1QPJA 4CV9A 4ZAUA 2BRMA 4HVGA 3QC9A 4YLJA 3Q60A 4ZK5A 3SRVA 3ZUUA 4M7IA 4ANLA 3ORPA 4R6VA 2I0HA 3C51A 1M7NA 4R5YA 4BVUA 2WMSA 3R73A 4H05A 2P33A 3LFEA 4YZNA 3WE4A 2JEDA 2VWUA 5EM5A 4AU8A 4R7BA 3OCGA 1T46A 2OIQA 4FV5A 3ZH8A 3LFNA 2A1AB 4O7YA 3SVVA 5CAPA 2W06A 3LIJA 3A62A 3UQFA 4LL5A 5GHVA 5HIBA 3UDBA 4F65A 2WQMA 3B8RA 3GENA 5FP6A 2C47A 2VTHA 4BFMA 3R8PA 5JH6A 4IE9A 5BVWA 1IEPA 3FDNA 5HNGA 5HE2A 3VS0A 3W2OA 4FT7A 2F7EE 3MH3A 4FTQA 5HD4A 3DGKA 3PP0A 3E8NA 3VAPA 2XCHA 4R7HA 2BRGA 3AXWA 5AUUA 5CXZA 4CCUA 4HVHA 5FBOA 4AA0A 4ZY4A 1ZLTA 3BEGA 3R6XA 3C4CA 3R21A 2BMCA 5CENA 2RL5A 4IADA 4F7NA 3D4QA 3UBDA 4KABA 5CI6A 5E8ZA 1XKKA 4BZDA 2Z7RA 1L8TA 3FV8A 4F1OA 5LMKA 1QPEA 3KVXA 3MY0A 3ZRLA 4YJRA 4CFNA 2UVYA 4IAFA 2JDOA 5E8XA 1XBAA 4B6LA 3D15A 3ORIA 4IAZA 1FVTA 4BI0A 4HVDA 5M07A 2OJIA 3GCUA 3L8VA 5EM6A 4K2RA 3VQUA 2JFMA 1VZOA 2BRNA 2IVSA 3E7VA 4QMQA 2UW6A 2JD5A 2YM8A 3PJ3A 3EMGA 2ZV7A 4WSYA 3ZFYA 2B1PA 1H1WA 2GFSA 2OFUA 4C0TA 4RLKA 2OBJA 4USEA 3BLQA 1BKXA 3ZUTA 3NYNA 2QO7A 2IJMA 2GQGA 3O8TA 4RJ6A 2BZIB 2JGZA 4DGMA 4F7SA 3KREA 5CU6A 4E6DA 4CFMA 3BWFA 1PXOA 1U5QA 2R2PA 3AC3A 3BLRA 1XH4A 3MESA 3DAKA 3FZPA 4UY9A 4E5WA 2F7ZE 3A60A 3MYGA 4HYHA 4U81A 4YBKA 5BUIA 5JFWA 5J5TA 4OAUC 3E5AA 3HV5A 4DINA 5HI2A 4OTPA 4FVQA 3SOAA 3D7ZA 3NGAA 4HNIA 5D9HA 5FGKA 5AUVA 3SXFA 2X4FA 1XHAA 3PY3A 4W9XA 3L8XA 3UQCA 5JMSA 2Y4PA 3FL4A 3LFQA 1H27A 4I5MA 4QP9A 2W1CA 3VNTA 2XH5A 4LFIA 3OWPA 3IOKA 5DA3A 3AC8A 5BVOA 5I5ZA 2OXDA 1GIIA 4FEQA 4X21A 3CPCA 4AN9A 5AEPA 4XEYA 3C50A 3H9RA 2DS1A 2HW7A 3COMA 4K8AA 2A27A 4EKKA 2C6OA 5C8NA 4I20A 4AE6A 4BZNA 5HG5A 4HCUA 4L42A 4BGHA 1E9HA 4C8BA 4B8MA 2EXEA 2VNWA 4EC8A 5CEPA 3F3WA 4BDFA 3C5IA 2C3KA 3VVHA 5BMMA 4LOPA 4JRNA 3FY0A 3F66A 2OF4A 4HGLA 4RA5A 3HDNA 5GNKA 4D2WA 1GY3A 2J5FA 3EKKA 4QT1A 4R5SA 4BDHA 4B4LA 3C0HA 5FBNC 4ALUA 4S34A 5CU4A 5ANKA 3SLSA 3WZDA 5DMZA 3HMOA 3OF0A 2P2HA 1W7HA 2XM9A 3KF7A 3QYWA 4B99A 5FM3A 4RIWB 4O0SA 4PL5A 1V0OA 5LARA 4DH7A 2V0DA 2R3HA 4RJ4A 3ANRA 4AG8A 4JOAA 4IB1A 5DH3A 5CQUA 3U9CA 3FMMA 2XIXA 3QZGA 2CN5A 2X1NA 3LM0A 3R71A 2ACXA 1Z5MA 4QMOA 1IAJA 1U5RA 2WMAA 3P78A 4XCUA 2OZAA 3D5VA 2QR7A 4RJ3A 3FI2A 1GNGA 4AN3A 4C33A 4AZVA 4RFMA 4F9WA 4NKAA 2W17A 4L9IA 3V6RA 2PVLA 4ZS4A 4YBJA 4P4CA 1Q8UA 2ZM1A 3OW4A 2X4ZA 5CYIA 2VTOA 3QX4A 4EH7A 3BV2A 4FUXA 1FBNA 4YSMA 2DUVA 4EORA 2O63A 1YKRA 4N4SA 5KBRA 5GZAA 5A4TA 4LOOA 2F9GA 4XNEA 1CKPA 4O7NA 1LEZA 3EZRA 3LCSA 4J99A 4RPVA 2W1IA 1DS5A 4CTBA 3UTOA 3FZ1A 2XIYA 3TNIA 3EHAA 4AOJA 4L6QA 1CDKA 5HCYA 3RAKA 3IONA 4LI5A 5KMIA 3LVPA 4OUCA 2YM3A 2QOBA 2WIHA 5E8WA 3OWLA 5FD2A 3WIKA 4AW0A 4ZOGA 1ZARA 3GC9A 4RIWA 3L9MA 4YPSA 4L3PA 3KKVA 5HE0A 1PJKA 4PNKA 3P86A 2YIWA 2CLQA 3FI3A 1KE5A 3ITZA 4KA3A 5AR4A 4BDEA 2PE2A 4C61A 4EOLA 4DFZE 4R3PA 1QCFA 5A4CA 5FM2A 5HLNA 5M4IA 2C5YA 1AQ1A 4IACA 5AP2A 4BIBA 3IKAA 3TNHA 2IZTA 3ZDIA 1YWNA 2R0UA 1RE8A 5DIAA 3ATSA 4W8DA 2ESMA 3C4EA 3BX5A 1REKA 2GSFA 3KRLA 3JS2A 4O0XA 2DYLA 2OI4X 2X8IA 3PJ8A 3VS7A 4MD8E 5BYLA 4IHPA 2X9FA 2C4GA 4HPTE 2BAJA 4MAOA 2O8YA 2PTKA 1K9AA 1M52A 4R8QA 4O7TA 2E9OA 1G8AA 3SAYA 3VUIA 4FTOA 3OXZA 4O21A 1O6YA 4CQEA 4O7RA 4EBWA 3WZEA 3I6WA 4PP9A 1J7IA 2QG7A 4F9CA 3KN5A 2YHVA 4ZLYA 3FBVA 4O7SA 3VF8A 2R3PA 1IA8A 4ZTRA 3QRUA 4BZOA 4DA5A 3TNWA 1KV2A 3MBLA 3T3UA 4IM0A 3R8MA 4G3GA 5D41A 4DEIA 2ITOA 4IVCA 4U5JA 1FPUA 4FOCA 5DEYA 5HTCA 5I0BA 5JKGA 3R02A 1REJA 4QOXA 2HIWA 3E8DA 4EL9A 1SVGA 3QTIA 4Y5QA 2BRBA 4YPDA 2LAVA 3QD4A 3DLSA 2BKZA 4J53A 4A7CA 1KOAA 3I7BA 4F09A 4LRMA 4WO5A 4G2FA 3LFSA 4H3QA 1I44A 3DY7A 4O7WA 2Z2WA 5ETAA 2BROA 3MJ2A 4F99A 5CU3A 4LM5A 5D10A 5JGDA 4UB7A 4XV3A 3V8TA 4EKLA 2BUJA 1RDQE 3F82A 2XEZA 2YM6A 4L3LA 5KZIA 3I5ZA 4KKEA 3QD0A 3QRTA 4F9AA 3E64A 4IDVA 2OICA 2X2KA 5AAFA 4QTCA 1OUYA 1GZNA 3EQIA 4NM0A 3PVBA 3OY1A 3QQJA 4GKHA 2F7XE 1BUHA 4TNDA 4OTHA 3EIDA 2FUMA 4FYOA 3BYMA 4ZTSA 4OTRA 4G3FA 4C4HA 4FZ6A 3ROCA 4BDDA 5M4FA 3DV3A 5CEQA 3PG3A 1SZMA 3DTWA 4U44A 3FHIA 3C9WA 5C03A 2CCHA 4PWNA 4RQKA 2Z7LA 3LJ0A 3SXRA 4ACHA 3EQCA 4FV4A 3RALA 2VTQA 2BAQA 4C37A 4G6NA 2E9UA 4ANOA 3U9NA 4D1XA 3EN9A 5F4NA 3SHEA 5JRQA 3AD5A 4YC8A 4GYIA 4JQ8A 4DFNA 2P4IA 4TWOA 3I60A 1T45A 3R8LA 5BVFA 5IQEA 3MJ1A 4BCIA 3HL7A 2C6LA 2V62A 3VC4A 4A4OA 5E90A 2OW3A 3KCKA 4ACMA 4QMNA 5M08A 2VTSA 2W5BA 4HZSA 4KKGA 4MXCA 5CSHA 4F63A 2B55A 4MD9E 4BWPA 1SNUA 2RFSA 5ANIA 3BHHA 3KRJA 3TNQB 1Q41A 4DAWA 1JOWB 4IQ6A 4FTNA 1H1RA 4F1MA 3QALE 2QU6A 4FSWA 4U80A 2BRHA 3BIZA 3FSKA 4CG8A 2XNGA 4K77A 4L44A 4BTKA 5H9BA 4M69A 3MY5A 4WNPA 3UVRA 3H10A 5CU0A 4KS8A 2FYSA 4D28A 4UXQA 1W8CA 1V1KA 5AR8A 5C26A 4AOTA 4KRDA 4OR5A 4OAVB 2JKKA 5CTPA 2J50A 3P23A 4GV1A 3MA3A 2VX1A 2PE1A 5HVJA 4BTJA 2VTNA 1G5SA 3HLLA 3RK9A 2AUHA 5HTBA 3AMAA 2VTIA 3UZRA 4UZHA 3FC2A 1H1PA 1VJYA 3L1SA 4G5PA 3A7HA 3ANQA 2W1HA 3QUPA 1OKVA 3MGYA 4DGGA 2OH4A 2I7QA 1H1SA 2IW6A 4CFWA 4PPAA 4ALVA 4FKQA 5AV2A 2BZJA 4MK0A 4NW6A 3C7QA 1RQQA 3OUKA 5ANEA 4ZIMA 5LWMA 4FG9A 2XK4A 2I6LA 1MP8A 3VHEA 3UMWA 4CT1A 2B9JA 1H1QA 3OG7A 3QQHA 1ZMVA 2C3LA 3FL5A 3LCOA 5ETFA 4U3ZA 1F5QA 2QODA 3QBNA 4MF0A 4IVBA 2CKOA 3I81A 5LCJA 3PSDA 2ZVAA 3ZXTA 4QP6A 3UPXA 2ITTA 3DXQA 3DKOA 3KFAA 2JDRA 4FZAB 4O0RA 5K4JA 4F6SA 3TWJA 4DCAA 3W18A 4DTKA 1YW2A 3NS9A 1KOBA 3HV6A 1YXTA 2HELA 2HWPA 3R63A 1GJOA 2F2CB 3ZXZA 4EYJA 2AYPA 4JAJA 3Q6UA 4EQCA 1Q99A 4D4SA 4FV2A 2IW8A 4JL9A 3PZEA 4J8MA 4L00A 5B2MA 3CTHA 3QWKA 3V8WA 3RBWA 1H00A 2W96B 4H3PA 4MVFA 5HEZA 3TKHA 1UKIA 5DI1A 4PQNA 4RMZA 3IW6A 5DWRA 3G0EA 4JR3A 4WRGA 4YJNA 5IH4A 3D5WA 4RIXB 4K1BA 4G6LA 3GXLA 5AX9A 4AOIA 4AFEA 4J52A 4EUUA 1NVQA 5IISA 1LP4A 4MXXA 4S32A 4FEUA 2QOCA 2XNNA 3V51A 2HZ4A 4QYFA 2J2IB 2Q0BA 3RPYA 3KEXA 4L7FA 3QLFA 3SW7A 5EK7A 3QTSA 1TQMA 4I0RA 4NH1A 4UMRA 2GNLA 3W2QA 3BPRA 4FNXA 5DFPA 1F3MC 2VWIA 4GUBA 4DGNA 3FEGA 4IXPA 4NTSA 3O51A 5JK3A 4EK3A 3TG1A 4U8ZA 5IUGA 5J1VA 2VNYA 1LEWA 4DFYA 2QOIA 5HG8A 5JFSA 4V0GA 4A9UA 4Y83A 3MFRA 3SX9A 2IZRA 1XR1A 2Z60A 1UNLA 2WU7A 4YZBA 2NPQA 4GCJA 4I5CA 4ITIA 4RT7A 3WF6A 2YZAA 4JBVA 3BYUA 4AT3A 1Y6AA 3AC1A 2CNVA 4RX7A 5D1JA 2B4SB 1FOTA 3QQGA 1PXKA 1GZ8A 4LUDA 4D2VA 4O81A 2ZOQA 2RFNA 4C02A 4FIIA 3DKGA 2UZEA 3NEWA 4W4XA 1G8SA 3DBQA 4RIXA 4NU1A 4FVPA 4JDIA 4HVSA 4BL1A 2HCKA 3CD3A 3NYVA 4OT5A 3ZM4A 4KKHA 5HOAA 4E93A 3R00A 4IFGA 4WNOA 3VUKA 4Y8DA 3ZRKA 4G9CA 2BAKA 4FIEA 2QU5A 4U9AA 4FNZA 3V8SA 3EQFA 2OGVA 3DTCA 4HCVA 3R0TA 1PMVA 2VU3A 3AC5A 4LL0A 3R8UA 1HOWA 3KRXA 4P7EA 4U42A 4ZZNA 2FSTX 4AGDA 5A4EA 1IG1A 4EONA 3PJ2A 3EFKA 2JBPA 5EOBA 3ZC5A 1OL5A 2OH0E 4DBNA 5KCVA 4TL0A 2I40A 3F3ZA 4DTBA 3LJ2A 4BBFA 3EN7A 2WMTA 4NJDA 2W1ZA 4GT3A 4PV0A 4GVJA 2W4JA 4AA4A 4UZDA 4YP8A 4CVAA 4OW8A 3DOGA 5L2IA 4AW1A 3MB7A 3OD6X 3E87A 3MSSA 2BVAA 4FSTA 4YZCA 5ANJA 2ZMCA 2PY3A 2P2IA 3E88A 4GG7A 4EH8A 4ERKA 5EFQA 5IQCA 4F6UA 1GOLA 2R4BA 3HVCA 5L2TA 3O50A 4NW5A 4O86A 1Q61A 4GEOA 3NUAA 4HGEA 3DDQA 4DH8A 2XBJA 3PVWA 2BDWA 1ZY5A 3SG8A 2Q83A 4EK5A 3EQGA 4PMSA 3NVKI 5I3RA 2QOOA 4ZSLA 4FL2A 3I7CA 4DEAA 3TDWA 3RM7A 1OKYA 1PXIA 2X7GA 1UV5A 5HNBA 2O0UA 3RGFA 2WGJA 1GAGA 2RSVA 2UW5A 3PPJA 2Z02A 3ENMA 3TJDA 1DI8A 4RZVA 1YOMA 2C3IB 2OU7A 4XLVA 5TR6A 3QD3A 5BNJA 3EH9A 3D2IA 3O0GA 3KMUA 2RG6A 4ASXA 1GIJA 2CGVA 1PXPA 5M4UA 3EL7A 3RCDA 2XK6A 3GU5A 2OO8X 1ATPE 5D11A 2HW6A 4UBAA 3UOLA 2R3OA 4GK2A 2WQNA 1YHWA 4K0YA 4MCVA 2HK5A 2YEXA 4BCFA 1M14A 4TYHA 2XF0A 3TTJA 1J91A 1SYKA 1B39A 3MH2A 3R8VA 1UKHA 5AUXA 5CNOA 5K0XA 2Z8CA 5E92A 4D4VA 1KE8A 1YI6A 4B8LA 3W16A 4EHVA 3DFCB 5M51A 3PSCA 4IWDA 4NM3A 1KUTA 4PL3A 3W2PA 4TYEA 3UP7A 5GJFA 4CSVA 4RZWA 3R7VA 3RK7A 5EI6A 3OEFX 4I24A 2CSNA 3UMXA 5EM8A 4E7WA 3GQLA 1TVOA 3DCVA 3FMEA 4PL4A 4IBMA 2HXQA 4FOBA 5HCZA 3Q2JA 4ITJA 5FXQA 5CNNA 1OZ1A 2CKQA 2X7FA 4I6QA 4QNYA 5AFVA 3BWJA 3QHRA 5J8IA 3RMFA 4FEWA 2E9NA 3QWJA 4QYYA 5JGBA 3PE2A 2H6DA 2BFYA 4JG6A 2WEIA 3CTQA 4XHKB 4FTKA 4IEBA 4FI1A 4Y73A 3F5XA 2W5HA 3M42A 4FODA 1MQ4A 1ZRZA 4GVAA 4DC2A 3AQVA 3Q9XA 4C7TA 4BDAA 2X6DA 5J9YA 2QR8A 3F2NA 3NLBA 5EW9A 3TI1A 4O7LA 5EDRA 3KMMA 4OTQA 3PVUA 4I6HA 4PDSA 3TZ7A 5B2LA 3SG9A 2OWBA 1OBGA 3VS6A 2WMRA 2IPXA 3VBXA 2XK3A 3HMMA 2WOTA 3NUYA 4M66A 3WF5A 4LGDA 3HYHA 5IUHA 4XV2A 4DEHA 5CF8A 2UW0A 1FVVA 2WEVA 2F2UA 4G6OA 5FUTA 3OP5A 1ZAOA 3FLNC 1WBTA 5TF9A 5HESA 4DT8A 4O1OA 5T3QA 1O6KA 4FBXA 4IX6A 3ZLXA 3DK3A 2W5AA 3OMVA 4R77A 2W1FA 4FGBA 5K9IA 5E8SA 3PRIA 4X3JA 3DU8A 4U43A 4IZYA 4UWCA 4PDPA 2Y6OA 4BKZA 2OJGA 2C6KA 1R1WA 4ZTNA 4K18A 3KL8A 2C3JA 4OTDA 4QP4A 4EOQA 4M12A 1Y6BA 2UUEA 3KXHA 4WG5A 2JIUA 2W05A 2YLFA 3C4WA 1XJDA 1EH4A 3O96A 2OG8A 4FNYA 4IB3A 4OTIA 2JDTA 4RFYA 2GTMA 1NA7A 2A4LA 2YCSA 3PXFA 4WG4A 5E91A 4FE2A 2GCDA 5L4QA 3HA6A 3LCDA 3IGGA 1JKTA 1PMNA 4FSUA 3SD0A 4D5KA 4EOOA 4E3CA 2WMQA 3HAVA 4YZ9A 3U55A 2W99B 3U6HA 3DAJA 3ALOA 5BVEA 3MFTA 5C9CA 4GRBA 5F94A 3UP2A 1ZZLA 3A4OX 4WBBB 3MDYA 4ID7A 2QOLA 5JEBA 2OF2A 5KO1A 4G31A 3DK7A 2JC6A 5AV1A 4W4VA 3F7WA 4AGUA 3II5A 4G5JA 5I3OA 4UYAA 1B38A 1ZOEA 3QZIA 5F95A 3WILA 3ZHPC 4D2RA 4ITHA 1XBBA 4DE4A 2R3KA 3HP5A 4J98A 2FO0A 4O27B 2W4OA 5EDQA 5IUIA 4E6QA 5K5XA 4FC0A 2WQOA 3FSFA 3ZRMA 2YZLA 1NY3A 4QMPA 4D0XA 2JAMA 4C4GA 2P3GX 4FIHA 3L9LA 3DZQA 2UZTA 1HCKA 2R3IA 4YTCA 4RJ7A 3QKKA 4FSQA 2WO6A 1BL7A 5CU2A 3RTPA 3D83A 2ZV2A 3KQ7A 1V0BA 4MXOA 5D7VA 5IG1A 4FK6A 3PXYA 3QF9A 4XG4A 3W2RA 3FE3A 1Z57A 4KIPA 3WZKA 3ACJA 3OW3A 5AP0A 4U97A 2X7OA 3W1FA 5ITAA 2VTAA 3UC4A 4GT4A 3W32A 4BCQA 3KB7A 2XEYA 2ETRA 3V5PA 5AJQA 1GZKA 5IQDA 3ORLA 5AWMA 4C35A 2XNOA 3H3CA 4FTCA 4ASEA 2KULA 4J71A 4IVAA 4ZTQA 4CZYB 3CP9A 1UU3A 4RBLA 1PXMA 3BCEA 4XYFA 4C3FA 4CT2A 4TZRA 5DT4A 4TN6A 4EHGA 4EOSA 5ICPA 3UODA 1OI9A 4B7TA 4BDJA 4U7ZA 4IB0A 3R8ZA 4USDA 3SOCA 3TZMA 5J1WA 4O0TA 4BCGA 4HZRA 2WTVA 2PVYA 3FLZA 5AAEA 4PMMA 3M11A 2RKUA 2WQBA 5EKOA 4FKRA 2VRXA 1R39A 3HV4A 3GC8A 1F0QA 1Q97A 2V22A
chains in the Genus database with same CATH superfamily
4EH2A 4DCEA 4RWKA 4JMQA 1W82A 3UIXA 4FKOA 4C58A 4YJUA 3V5QA 2XKFA 4ANBA 2C1BA 4JDKA 1TQIA 4Z3VA 2EXMA 4I4EA 4H3BA 3DJ7A 3KIOC 5DYJA 2PHKA 4XV9A 4U3YA 3RHXA 5FWKK 4MNFA 4X6RA 2BCJA 4KINA 5AP1A 4Z16A 3MH1A 4FKTA 5EOLA 5JRSA 4S2ZA 3NFFB 3S00A 4OTFA 3BZ3A 4CFXA 2QKRA 3C0IA 1H01A 1PHKA 3FLSA 3DPKA 2IG7A 4DHIB 4X6QC 4Y85A 4F7JA 1JAMA 2XNEA 3RPOA 5KBQA 4ZSGA 2P55A 3L9NA 4L45A 4RG0A 5DPVA 4J8NA 1WBPA 4D5HA 3QCSA 4QPAA 4KNBA 5LCKA 4IAYA 2XKEA 4XRLA 5FDXA 4B9DA 3ZC6A 4O0VA 4RQVA 4D4YA 2OJFE 4E4NA 1B6CB 4O6EA 3OEZA 1JNKA 4JLCA 5AP6A 3ERKA 3PUPA 3A61A 4XG8A 4FV6A 5CVHA 4DFUA 2ZDTA 4YGAA 2G2IA 2GS6A 4QMZA 1JSVA 3G15A 2R7BA 1DAWA 4C4EA 2X6EA 3DLZA 3O8PA 4QMWA 5IDNA 3VS5A 3N4UA 5IPJA 3ZDUA 5BUEA 2O65A 2FSOX 5HGIA 1R3CA 4AS0A 3QRIA 3CS9A 4FVRA 2ZM3A 4FJVA 2ZB0A 3BE9A 1KSWA 1R0EA 2C0IA 3OBJA 3PIYA 3BGZA 4G3CA 5C8MA 2HYYA 4D55A 4BIDA 5AAGA 3HMIA 4ORKA 4GJ2A 4LV8A 2QOKA 4BTMA 2UVXA 2FVDA 2XRUA 3FLYA 4NYEA 4QP1A 2BZKB 3GU4A 3OTUA 5TO8A 3GVUA 4FG7A 4NCTC 1S9JA 4G9RA 3JVSA 4DN5A 4RLLA 3WZUA 3ZSIA 4GMYA 4OBOA 3PVGA 3BHYA 5CSWA 3T8OA 5IF1A 3RP9A 3RPRA 2LGCA 2ITYA 2VTMA 3MPTA 2BZHB 3NNWA 3ULIA 4DLIA 3QXPA 1YQJA 3GB2A 4LG4A 4N0SA 4DITA 4J1RA 3GU6A 2IW9A 4C3RA 4BWKA 4RWIA 1ZZ2A 2B9HA 2R9SA 3QKLA 2ZMDA 5EW3A 4FKWA 4FZDB 3LM5A 2IZSA 4FKVA 2CMWA 1ZYLA 2WU6A 4I23A 3QTUA 5CZIA 4EYMA 3CY2A 4H1JA 4DFXE 5BX0A 4TXCA 1MUOA 2R3RA 4M0ZA 4E4MA 2J5EA 5T68A 2C0TA 2XYNA 3BYSA 3FYKX 4C34A 4XBUA 4XBRA 3ZFXA 3HV7A 2FH9A 4NT4A 5CVFA 4CGAA 4I92A 1O9UA 2VO6A 4K11A 2IVUA 4IH8A 4ZTHA 2XYUA 1KE9A 4C4FA 2YWVA 3W0OA 1BMKA 3BQCA 1TQPA 1H28A 2XNBA 3HRCA 4ZJIA 5EHLA 3CJFA 3FQSA 4O2PA 5CZHA 4B0GA 2YISA 3GC0A 3TZ8A 2I0YA 5E8UA 5BVDA 5IA2A 1ND4A 2OFVA 5AM6A 4BF2A 2VUWA 1IASA 2GQSA 3AGLA 2IVVA 3NCZA 3NUNA 5CALA 2YERA 3FC1X 1YDRE 3QA8A 4TYIA 4IX5A 3UYSA 4P5QA 3Q4TA 5GJGA 1JBPE 2BHEA 4JR7A 2PUIA 3HMPA 3NYOA 4FTLA 3BU5A 4OLIA 4EH3A 4MUQA 1X8BA 3VIDA 1BX6A 4RVMA 3Q6WA 4YC6A 5IQBA 5D7AA 1IR3A 1SVHA 2XM8A 3QCXA 3QQUA 3PSBA 2RIOA 1OKZA 4YJPA 1W98A 4ONAA 4BBEA 3TJCA 1PW2A 3IW7A 3LFDA 2QG5A 4QDVA 5DNRA 4M3QA 4X2KA 4MQ2A 4YTFA 1G8KA 4DEBA 4AGWA 3G2FA 4TWCA 4NM5A 5HIDA 5J5SA 5DR2A 3BHUA 3LLTA 5CAVA 4ACCA 4GH2A 2W4KA 4E73A 5BUJA 3OWKA 3FPQA 1RJBA 3E3PA 4IWOA 4U45A 5DBXA 3UIUA 4BY9E 2R0IA 2WMBA 3FKOA 2JKMA 3PXZA 3QQLA 4F6WA 4DG0E 3ZCLA 2A0CX 4FYNA 3EWHA 3WBLA 2C6DA 4EOMA 4EWHA 5CS6A 4LUEA 5LVPA 4CG9A 4PP7A 1JKKA 1JVPP 4FKJA 3TN8A 5GIOE 2R7IA 3LJ1A 5J7HA 3BHTA 4YJVA 2BALA 3DK6A 3MFUA 1H08A 5HE3A 2PZIA 4A9TA 4EOIA 2WQEA 3ZYAA 1YXXA 4O7ZA 4AXFA 2XMYA 3OTVA 4RJ8A 5J9LA 4IX4A 1E1VA 4IMYA 5EQEA 2Z7SA 3HP2A 4GFMA 2BFXA 1K2PA 3VS1A 4GUEA 3MH0A 3PP1A 3WF7A 3NUXA 4LGGA 4MBLA 5EG3A 2HOGA 1FMKA 5BYZA 4S31A 3PA4A 4PTEA 3BYOA 4D9TA 3BLHA 1SNXA 2QHMA 5HD7A 4NK9A 1JKLA 4M97A 3VQHA 4G3EA 1WMKA 4GG5A 4IJ9A 1PXLA 4ZMEA 2XA4A 4MXYA 4BCPA 4CMTA 5C8KA 3CY3A 4ARKA 4NM7A 2PULA 3QL8A 4YLKA 5HNIX 5M44A 3PUFC 3BU6A 2V7OA 2CGUA 4CCBA 3LMHA 1OPKA 1PRYA 2UZBA 4HYIA 3LAUA 4YJTA 4O0WA 3ORXA 4I6LA 2W0JA 3HA8A 4X3FB 4LMNA 3MN3A 1OL1A 4O0UA 1Y91A 5AV0A 4AAAA 2QOQA 4JDHA 4DYMA 3LXNA 4YHJA 5CVGA 2HY81 3E8CA 4ZTLA 4XP3A 1Q8ZA 4MQ1A 4QO9A 4CRLA 2GHLA 3D9VA 1IA9A 4EH6A 2C5OA 3NAXA 5KHXA 3Q2MA 1YXUA 4I21A 3FYJX 3WI6A 4JDJA 3FI4A 2PUUA 4IFCA 4QPSA 3EFWA 4EZ5A 5KX8A 3DFAA 4BCKA 2QQ7A 2G9XA 2ITWA 2PVNA 3M1SA 4AFJA 2EWAA 2YAAA 3ELJA 3FQHA 1YWVA 3I0OA 3F3VA 4FTAA 4QYHA 4ZXTA 1ERKA 2ONLA 3NX8A 5JFVA 3VN9A 5M4CA 3W0MA 4O22A 3DAEA 3OXIA 4J97A 4DT9A 2VTRA 2UZDA 3TKIA 2PYWA 3HRFA 3ZLYA 3FZSA 4EH5A 2DQ7X 3VBTA 3A7JA 2VTPA 3DZOA 3K5VA 1W83A 3COHA 3FKLA 4HNFA 3TKUA 5JN2A 3RVGA 2GPHA 2YM4A 2I0EA 3KCFA 5L2QA 1U54B 4EEVA 2A98A 4I0TA 4JT3A 4QMUA 4C57A 4YUQA 1M7QA 5GJDA 4Q9SA 3VJNA 2XKCA 3COIA 4F70A 4WUNA 4X3FA 4DLJA 4YHFA 1ZYCA 2VGPA 4KAOA 2XIZA 3FJQE 3L9PA 4XV1A 3KY2A 3VJOA 5CWZA 5IA0A 3TUCA 3U6IA 1W84A 3WARA 5FRIA 3POOA 4APCA 2G2HA 5TOZA 3UOKA 2J6MA 4WNKA 5HQ0A 4PPBA 3Q9WA 4QMLA 2REIA 5A3XA 5M56A 4BCOA 2VTLA 4LRKA 4TWPA 3UO4A 4BDKA 2ITUA 2WKMA 3BGPA 4C3PA 1ZWSA 2WTDA 4H58A 4AXDA 2FGIA 2CNUA 4ZSAA 3ZM9A 3A4PA 3GCQA 4IZAA 4MKCA 2VO3A 1XO2B 2YIXA 1UU7A 3C5UA 3PXQA 3IW5A 4N70A 3UG1A 3AG9A 4BBMA 5J95A 5HVKA 5HO6A 4YURA 2F57A 1OM1A 4YLLA 3UNJA 4A9RA 3A8XA 2V55A 2QURA 4FTRA 2W1EA 2YN8A 4IB5A 3AMBA 5IA3A 3ORTA 1U59A 4EHEA 2PVJA 5FLFA 4I93A 3FZOA 4YO6A 2AEGA 4MF1A 4PMPA 2GS7A 2PVMA 1CM8A 4ZJJA 4X2NA 3W33A 4II5A 3N51A 5FEDA 3QRJA 5IKWA 4YU2A 5DG5A 4HPUE 2PZ5A 5FTQA 3NAYA 4ZSEA 3EL8A 2XIRA 4XP0A 4M8TA 3F2RA 3R7OA 3RAWA 4O38A 1J7UA 2VO7A 2XCKA 4ENYA 4OBPA 4X0MA 3OVVA 3HRBA 3NZ0A 4QQTA 3FMKA 5T6KA 3A8WA 3EJ1A 4C59A 2HZIA 3CC6A 4YMJA 3IPHA 1GIHA 2XNMA 1UU9A 2C68A 5E4HA 3TUBA 4FL3A 3LQ5A 2GNHA 3OUNB 3LFBA 4O82A 3KU2A 3DBCA 2OZOA 1P4OA 4EK8A 2VWZA 4FTIA 4ANSA 4P2KA 3VBYA 3PIXA 3KRWA 2EU9A 3R9OA 2B0QA 4BI1A 2WELA 4PTCA 3CGOA 4AZFA 3G33A 2QO2A 3Q32A 5HX6A 3KF4A 5FXSA 3GNIB 2YCRA 3ODYX 4XOZA 5K0KA 4GFOA 5I9ZA 3P79A 3QZHA 3FMDA 1P14A 2GNFA 4OBQA 1OMWA 4KB8A 3Q9ZA 2O64A 4S30A 5EW8A 2XZSA 1DM2A 3MIYA 3R1NA 3R7GA 5FTGA 2AC5A 4KS7A 4QNAA 3PJCA 2V5QA 4Y72A 5FEEA 4BDCA 1XBCA 4JXFA 3UYTA 2B52A 4CTCA 4F78A 3UOHA 1KE6A 2EVAA 3F61A 4AQKA 5AADA 3V5WA 1A48A 1URWA 4OGRA 5M06A 3AC4A 5JGAA 3VWAA 4R3RA 1CKIA 5K5NA 4WG3A 2BKKA 2C6TA 4X2GA 1FINA 2X0QA 5EH0A 2O2UA 4WIHA 3TM0A 4G3DA 4MX9A 3ZBXA 3C13A 4I6BA 5IEYA 5ACKA 3EQHA 4QMTA 4ZP5A 2GHGA 4BN1A 2GNGA 2BTSA 3JUHA 1VYZA 4RVLA 4AW5A 2YA9A 5E1EA 3FWQA 4BDGA 3DB6A 4UMTA 4F0GA 4HGSA 4N57A 4PPCA 3CR0A 5C27A 1WVYA 4QMYA 1SM2A 4EUTA 5LOHA 4FGRA 3I5NA 3CJGA 4FT0A 4QMXA 4NCTA 3LXKA 4JQ7A 4WA9A 4XG3A 1XH8A 4KSPA 4LGHA 3A2CA 4I94A 4EOKA 3SKCA 5ANGA 4C38A 1K3AA 2QCSA 3GBZA 3NR9A 4J96A 4RX8A 2XP2A 3EQDA 3IQ7A 4AX8A 2WAJA 4D58A 3R30A 3F3TA 3G5DA 2EB2A 3H0ZA 2YDJA 3O7LB 4PTGA 1BI8A 3MTFA 4CFVA 2C5XA 5KNJA 3AD6A 3GGFA 4FKUA 3C0GA 3ZO3A 1QPDA 2XK7A 3ALNA 2NNWB 2FSMX 4AAYA 4G16A 4ASDA 4C36A 4FTJA 1Q8YA 1RW8A 3TIZA 3WE8A 3QFVA 3HV3A 4DBXA 3DBFA 1CSNA 3JYAA 3NUUA 3PWDA 3DDPA 4EQUA 2J0KA 4DH3A 4O0YA 4PDYA 4YNOA 3R9DA 5JZNA 2PUPA 3Q96A 1KV1A 4CRSA 3OCTA 4O7VA 4UMPA 4HVIA 2VTJA 1H25A 4FSMA 4IM3A 1QL6A 4BHNA 2XBAA 3ZOSA 3U87A 3BYVA 5A4QA 5CAUA 3AGMA 2QC6A 4IZ5A 4M67A 4CQGA 2ETMA 4ACDA 3AKKA 3IK3A 5J79A 5HO8A 5KMOA 4A9SA 4XRJA 3R9RA 4GS6A 3VUMA 4GFGA 4I1ZA 5HIEA 4E4XA 2OIBA 5EKNA 2X8DA 3HZTA 3JPVA 2QHNA 4EQMA 5EM7A 3OT8A 3AC2A 4HCTA 3UO6A 4D9UA 3HKOA 3H9FA 4E26A 5FTOA 3H4JA 5EYDA 1ZYJA 3K5UA 4IAAA 4X7QA 5LVOA 2UZWE 3KXNA 3WYXA 1OIYA 3D2KA 4IDTA 4QTAA 2FA2A 4TTHB 1VLRA 4JS8A 5ANDA 1OPLA 4FSNA 4R7IA 4EOPA 3N4VA 3UDTA 3THBA 2ITPA 2G01A 3MTLA 3C4ZA 4FX3A 3AT2A 3LFFA 3CTJA 3EYHA 1ZYDA 3ORZA 3QU0A 4ZLZA 3RINA 2VX0A 1M2RA 3EKNA 3ZLWA 5A4LA 3BLAA 3VRYA 1OL7A 1Q3DA 2EB3A 1ZMWA 5HICA 4W8EA 4AUAA 3K54A 3ZLSA 3TYKA 2XIKA 5I9XA 2QNJA 3IDCA 3OY3A 4O91A 1R0PA 5TE0A 3ORMA 3OHTA 3Q52A 3DQXA 4YTHA 4CZTA 4CEGA 5HX8A 2C6EA 3V5LA 3ZEWA 4NFNA 3BQRA 2IWIA 2WTKB 2ZAZA 4FKSA 4NUSA 3W0SA 3LZBA 4I22A 3NIEA 4TY1A 5L6WL 1H24A 2Q0NA 3NCGA 4BCHA 2OIDA 2QOHA 2XS0A 4FSYA 2RG5A 4IWQA 4WBOA 3VS3A 5KMKA 1H0WA 4RGJA 3UZPA 1YOLA 4E8AA 5HORA 4R78A 3CLYA 4I5HA 5I9WA 4HW7A 3EN4A 1Y57A 2F49A 4CKRA 5AMNA 4QEBA 2BTRA 2W9ZB 2H9VA 5CQWA 5IH6A 1E1XA 3GC7A 2CN8A 3O7LD 4N6ZA 3AD4A 2CNQA 2R3GA 1NT2A 3BEAA 3A99A 1UWJA 2ZB1A 4RA4A 4YO4A 3L8SA 3VUGA 2ITNA 3DBEA 4ZSJA 1XQZA 5TKDA 3WZJA 5EI2A 5HLPA 2PPQA 3KXMA 4EI4A 3HEGA 4U6RA 5IMEA 3Q3BA 4UYNA 2ONLC 4ANMA 4CLJA 2JFLA 5B7VA 4DG2E 2J51A 4FV7A 3ULZA 1IAHA 2CGWA 3LFCA 2G2FA 2UW9A 2X8EA 3QD2B 4C4IA 1PMEA 2W1DA 5AP5A 3I6UA 5HU3A 2RFDA 2B9IA 4JBOA 5HBEA 3QQFA 3RWQA 2ERZE 4HJOA 4DFLA 4EK4A 4RC2A 3QKMA 4I0SA 3R7IA 3VULA 3PPZA 2YJSA 3VW6A 3C4XA 5H8EA 2E2BA 4F9YA 4IAIA 3PWYA 1STCE 3NNUA 4X3FC 2UV2A 4GL9A 3G6HA 3RPSA 1UNGA 5LMBA 2A19B 5L2WA 4BGGA 4F4PA 3F6XA 3S4QA 4BYIA 4CNHA 4NIFB 3K3IA 3R7YA 4U41A 2CKEA 3I0QA 5F20A 3ACKA 3HMNA 4RRVA 3SW4A 3V01A 4D1SA 4BIEA 3NIZA 4J95A 4L68A 3DXPA 5EYKA 1J1CA 1UWHA 2J90A 3F3UA 4C2VA 1KWPA 2YM5A 3MPAA 4KSQA 3FXWA 4O4FA 4PY1A 1WBOA 2OSCA 4EOJA 3E8EA 3QAME 4FZFB 4Y46A 2AC3A 5CSPA 2JKQA 3TV7A 3PG1A 3P7AA 4MNEB 5CT0A 1YDTE 5BMSA 4U0IA 3QCQA 1AD5A 3NRMA 3FXXA 4IC7A 3AOXA 4WRSA 5AIRA 5CEIA 4NTTA 4QQ5A 3U6JA 2BIKB 1ZOHA 2F4JA 2JIIA 3KRRA 3MI9A 2I0VA 3M2WA 5CT7A 4X2JA 2CLXA 5F1ZA 4ZY5A 4HGTA 3BI6A 4FICA 4KBCA 3TV4A 2Y4IB 4AN2A 5KUPA 4RJ5A 2E9VA 1XH6A 5DLSA 4PNIA 1JSUA 3DJ6A 4CFUA 2ZV9A 4MBJA 5E8TA 5C4KA 2C5NA 4FT9A 3OCSA 2QD9A 5EQPA 2GMXA 2IO6A 4YSJA 3UIBA 2GNJA 3ZZWA 4A4LA 4ZTMA 2OXXA 1Y8GA 4E6CA 3QYZA 4F9BA 3WF8A 1PMUA 3F2AA 1YVJA 4CKJA 4M13A 3D94A 3NUSA 1VR2A 3EFLA 5AUYA 2GDOA 4Z55A 4NIFA 3ETAA 4IW0A 3U4WA 1XMLA 3FQEA 1VYWA 3V5JA 3CCNA 4QTBA 3H30A 2UZVA 1H8FA 5L8LA 1PYEA 3OOGA 4DH1A 2QLUA 3LOKA 2H34A 5I9YA 3UVQA 4A4XA 2O3PA 2C5VA 4JQEA 5FXRA 4EWQA 5BVNA 4KIQA 5JQ8A 4F64A 4FKPA 4CYIA 2XJ1A 2PMIA 3ORNA 2PMOX 3R1YA 4FMQA 5CANA 3TNPC 3UG2A 2HZNA 3B2TA 5CEKA 4MNEA 1U4DA 3R2YA 4BYJA 4KIOA 4K6ZA 5K4IA 3OT3A 4EC9A 2R3FA 4TYJA 3H0YA 1P4FA 3KVWA 2JDVA 5HG7A 4BCNA 3UPZA 4L3JA 4JG8A 5AR3A 2UVZA 3FXZA 4DHFA 5IA4A 2RFEA 4Z7HA 5CEMA 2OJJA 2WMUA 4H36A 3QGYA 5EI8A 2VWBA 4F0FA 2YCQA 4IJPA 3NNXA 5I4NA 3CGFA 1WVXA 4TYGA 2PUNA 3IDBA 4QP8A 4CXAA 3P1AA 3DKCA 4KBAA 1J1BA 4YNEA 4AP7A 1UA2A 4BJJB 1OPJA 1U46A 2HENA 4ZMFA 3LE6A 1Y8YA 2BIYA 1BYGA 3DNEA 3GCPA 5M55A 1P5EA 4AZSA 2OZAB 3DJ5A 4YHTA 3AMYA 4O84A 2UW7A 3EZVA 3ZZEA 5KMMA 1H26A 3I1AA 3MB6A 4LRJA 4D4RA 5IA1A 1OVEA 4GT5A 1LUFA 3GCVA 4BCJA 4AT4A 3REPA 3UVPA 4DGLC 5CAQA 5HU9A 3UZTA 3ZMMA 1OUKA 3ID6C 2Y7JA 3GI3A 2Z7QA 4EZ7A 3U8WA 1DAYA 1DI9A 3NSZA 3TZ9A 5FP5A 4BC6A 4CMOA 2EUFB 5IMXA 4QRCA 3W2CA 2YITA 4IM2A 5DR6A 3UNZA 5J7BA 5HG9A 1OITA 1WBVA 2PZPA 1CKJA 3RCJA 5LQFA 1I09A 5HTIA 3V3VA 5A9UA 4RIYB 3ENHA 3R1SA 2J0LA 3QQKA 1NVRA 1XH7A 2CDZA 4M15A 5CF5A 4EBVA 4DGOA 3DB8A 2BPMA 4XG6A 4UX9A 4WT6A 3OFMA 3UGCA 3ZSHA 4FTMA 1PYXA 2VO0A 5HCXA 1PF8A 1A9UA 1LR4A 2WZJA 3BV3A 5B2KA 1XWSA 4RC4A 4BJJA 4MHAA 1CMKE 3QGWA 3RNYA 4WKQA 2WTJA 4WHZA 2H8HA 3DBDA 4DEEA 4G1WA 3VBWA 4UWYA 2WMXA 3BRBA 2G15A 1YI4A 3DNDA 3P08A 4QPMA 5ANOA 3R04A 1WZYA 4GIIA 4H1MA 4BKYA 5KKRB 3F5GA 4XG7A 1SVEA 1QPCA 3HECA 3GFWA 2R3JA 3OZ6A 5KMJA 3UO5A 3KGAA 2GTNA 4M84A 2QONA 3IECA 3NFGB 5CXHA 4FG8A 4AWIA 1H4LA 3F9NA 3PLAE 3ZSGA 2YACA 2UW3A 4CV8A 3UIMA 3KK9A 2XK8A 4O1PA 2PE0A 1M2QA 2QO9A 2XRWA 3LXPA 3F5UA 3HGKA 3O17A 3PA5A 4MTAA 2CKPA 1ZMUA 3RK5A 4GW8A 2ETKA 1ZOGA 2ITQA 1IRKA 5CX9A 3RPVA 3EN5A 4RIYA 1UU8A 3R9NA 3T3VA 4DH5A 5AR2A 3A7FA 1PXJA 3HX4A 3E92A 3PRFA 2GU8A 3OROA 4C62A 2QLQA 3IW4A 4N6YA 3ZU7A 5CSVA 4XOYA 4F1TA 4JVGA 1Q4LA 3W55A 2ZJWA 3LLAA 2YABA 3V5TA 5DN3A 3FMHA 3LFAA 5AM7A 3ATTA 1WCCA 3TXOA 3RHKA 3CQEA 4V01A 3ZBFA 4ZJVA 2X39A 3QTQA 3LQ3A 4DFBA 4XX9A 2XANA 3SGCA 3BBWA 4M68A 4QP2A 3OS3A 2ZV8A 2WTWA 3RNIA 2NRUA 1HCLA 1YI3A 2WMWA 3ZO1A 2VWXA 3LQ8A 2C30A 1J7LA 5AX3A 4RC3A 3FHRA 4Q5HA 3VO3A 1Q5KA 3TTIA 4AF3A 3KA0A 3NYXA 1W2DA 2CCIA 4Z7GA 4FKLA 4QMVA 3MPMA 5E9EA 3PZHA 1XH5A 2NP8A 5DRDA 5AP3A 5EQYA 4UALA 2IVTA 2PVFA 3H9OA 4NEUA 4C4JA 3DQWA 4F7LA 5AA9A 2QVSE 5BPYA 5IEVA 3EN6A 4FV0A 4H39A 4BHZA 3GT8A 4FT3A 1V0PA 4BGQA 5KMLA 5AA8A 3E93A 2R3QA 1VEBA 3FLWA 5CLPA 3OC1A 3QTZA 5CAOA 1FGIA 3UJGA 4L43A 2O5KA 4CYJA 3EQRA 4NJ3A 5DT0A 3R1QA 3R2BA 4ZY6A 3FMLA 3UQGA 2PK9A 4FA2A 4D1ZA 5IA5A 2YLEA 2CJMA 1L3RE 4HYUA 3W10A 5F9EA 2RF9A 3SA0A 2YDKA 3VRZA 3PY0A 4W9WA 3I4BA 2R3MA 1OIQA 4ASZA 3LXLA 4APPA 5FEQA 1A06A 3NW6A 2R3NA 3LHJA 4UMUA 1R78A 3CKWA 2VV9A 1WAKA 4JBQA 4IVDA 4EZ3A 3KXZA 4FV9A 4FKGA 2G1TA 1APME 5H3QA 5IQFA 4RVTA 2VWVA 3B8QA 4TW9A 5CF4A 2WTIA 3P7BA 2VN9A 3G0FA 4QP3A 3DS6A 4J7BA 4RIOA 3GOPA 5CASA 5E8VA 5LJJA 4M69B 4XH6A 4YTIA 3UE4A 4A07A 3LMIA 1FGKA 3FY2A 3NWWA 1JSTA 4WD5A 5BVKA 1OL2A 3HNGA 4WNMA 2YIQA 2HAKA 1S9IA 2XUUA 2NRYA 3PXKA 2WTKC 1OKWA 4O96A 4G17A 5AP7A 5GZ8A 4QP7A 4KD1A 5EDPA 3GEQA 3PIZA 4XLIA 5ETCA 3NUPA 4AZTA 3OCBA 3WIGA 3QUEA 4TNBA 3TL8A 4QTEA 3PDTA 2FSLX 1G3NA 1OBDA 3P4KA 4FK3A 1Z9XA 4PRJA 5AR5A 3GUBA 4MYGA 4YZMA 2CGXA 4CKIA 2W1GA 3Q04A 5DT3A 5EYMA 5LXMA 1MQBA 2VWWA 2OXYA 1J3HA 2FB8A 2WNTA 4TKSA 3V6SA 2YDIA 2VTTA 2WD1A 1WVWA 2YCFA 4UXLA 2B54A 4KRCA 5LMAA 4GSBA 4LQMA 1XH9A 4XJ0A 4G34A 3ORKA 3W2SA 3TT0A 4D2SA 1WBNA 4EHZA 3GOKA 3EOCA 4RVKA 3F69A 4QDEA 4RFZA 4OTWA 3R28A 4L46A 3O2MA 2J7TA 3FAAA 2SRCA 4FSZA 2JIVA 4MBIA 5GZ9A 1TKIA 3VHKA 3OBGA 4JNWA 3GP0A 4LMUA 4QYEA 4C2WA 4GU6A 3S3IA 4E1ZA 5C1QB 3EFJA 1YRPA 2HY0A 3RM6A 2JLDA 5DGZA 4ACGA 4JIAA 4AT5A 2IN6A 2PVHA 4D2TA 4UEUA 4BB4A 2WTCA 3G6GA 4DEGA 3R9HA 4I41A 3IO7A 4V04A 2C0OA 2X81A 2GNIA 1Q3WA 2C69A 5AV4A 2VGOA 2JAVA 3GU8A 4QTDA 3B2WA 4KUJA 2HWOA 2UZOA 2PZRA 2X2MA 4JX7A 3O71A 1WBSA 2X0GA 2B53A 4Y95A 5CSXA 4GJ3A 2WOUA 2GS2A 5IU2A 1BLXA 1YXSA 5G1XA 5IEXA 4Z9LA 3W8LA 2R64A 1O6LA 2VAGA 4HOKA 3BKBA 1Q8TA 4U79A 3CPBA 3IS5A 5ETIA 5LMKC 2WPAA 3S0OA 5IQAA 4FV8A 4FTTA 3CE3A 3QTWA 4EJ7A 3CSVA 1YXVA 1JPAA 2IZUA 3KXXA 3MVHA 4JIKA 4I6FA 2BDFA 2GHMA 1UVRA 4IC8A 3BBTB 3W0RA 2BDJA 3KXGA 3PJ1A 1OIRA 4TWNA 2B9FA 3A7GA 3KK8A 4FT5A 4DEDA 4U40A 3ZUVA 4FR4A 2YIRA 5HHWA 3W0QA 4DTAA 5JSMA 2J4ZA 2HXLA 4EK6A 2VZ6A 5LVLA 1OIUA 4FEXA 4NL0A 1NW1A 5L8KA 5GINE 3CQUA 2XJ0A 2WHBA 4V0GB 1URCA 3LCTA 5K3YA 5HO7A 3W0NA 2ITVA 2QI8A 4ZZOA 2ITXA 3QCYA 3EB0A 4M14A 5AUWA 3GQIA 2WFYA 3V04A 4O2ZA 2Y4IC 2R3LA 3HUCA 3ZFMA 2ITZA 2UZLA 3EQPA 1BI7A 4KBKA 3P7CA 5AR7A 3GCSA 3K3JA 3ET7A 4F08A 1U54A 5DR9A 4R1YA 4BICA 3NNVA 3U4UA 5HE1A 3ZTXA 3CQWA 3JR1A 1YDSE 4R1VA 4WSQA 3MVLA 4USFA 3LMGA 3U54A 4PMTA 5DOSA 1MRUA 4FL1A 3SXSA 4MD7E 3ZS5A 3E63A 5TT7A 4DHZA 4UMQA 4W4WA 2Y8OA 1ZY4A 2YWPA 5HVYA 4BWXA 3BELA 3QRKA 2GFCA 3NMUF 2J9MA 2GQRA 2ZM4A 1UNHA 3OWJA 4UN0C 4IAKA 5H2UA 3LPBA 4FZ7A 4MXZA 4KIKB 4ZLOA 3MY1A 4X2FA 2BR1A 3F88A 5HZNA 2C1AA 3GFEA 4AACA 4YJQA 3FPMA 2VD5A 5DRBA