5EKOA

Crystal structure of mapk13 complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
341
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title First comprehensive structural and biophysical analysis of MAPK13 inhibitors targeting DFG-in and DFG-out binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 13
total genus 103
structure length 341
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ekoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ekoA01
3ODYX 1OPLA 3GB2A 5HTCA 3GU4A 1Q4LA 4FNYA 2YAAA 4LG4A 4FG7A 1J7LA 4II5A 5IQGA 4F6UA 4UMRA 2IVTA 5IKWA 4UYAA 3EN6A 3R9RA 1IA9A 2G9XA 5L2WA 3O2MA 2Z60A 4IFGA 3NAXA 2H96A 3LMIA 1I09A 3VBTA 2F57A 3KN5A 5CT0A 2VX3A 4C35A 4NKAA 2YCQA 4S30A 2HZ0A 3I0QA 1S9JA 2O0UA 4U9AA 4G9RA 2B52A 2CGXA 3DGKA 4ZZMA 3RMFA 4JBVA 2A27A 3CE3A 3GC8A 2HYYA 3GOPA 5CTPA 2W99B 4BIEA 1QCFA 2HW7A 4WNPA 3VWAA 5J7HA 4FOBA 1OIRA 4J8NA 4M69B 2ITTA 4QRCA 4R3CA 3NYXA 4J96A 4L7FA 5FEDA 4MXYA 3CTJA 5M4IA 5LVMA 3I81A 3PG3A 4QT1A 3VUIA 4PMTA 4QPSA 3V8TA 2W96B 3ZOSA 5F20A 3RK5A 4CCUA 4I5PA 4JRNA 2CNUA 4DGOA 5HO6A 3CQUA 2IPXA 3LE6A 4GV1A 4IEBA 2FSMX 3CEKA 3O0GA 5ANDA 3EFJA 4U3ZA 5K3YA 1U4DA 5JFSA 1XH5A 2JEDA 1UNHA 2W1ZA 3FXWA 1VEBA 3MIYA 3NDMA 4U43A 4D1XA 4TW9A 5EK7A 4DFXE 3O50A 4M84A 5H8BA 4BHNA 2XP2A 5CNOA 3F3TA 4MF0A 3NW5A 3HV7A 2JDRA 2XIXA 2GPHA 4C2VA 3PRFA 2UUEA 3IOPA 4IAFA 3COKA 3MFRA 4FEVA 4D1SA 3HMMA 2CNVA 2V55A 4KSQA 4FSNA 3RWPA 1JNKA 1H28A 1XH9A 1PMUA 2F2UA 2OG8A 3BELA 3BQCA 5GHVA 4W8DA 3F66A 3LJ1A 3F5UA 2ERZE 4HZRA 3QRJA 3QUDA 3ENHA 3UVPA 1HCKA 4QMZA 1OL2A 3ANRA 3QWKA 4C2WA 3F88A 3QGWA 4C59A 4O7SA 3AD4A 5KMIA 3NIEA 3QTIA 5AMNA 3VF8A 2WTJA 3FWQA 1NXKA 2HXLA 3S00A 2BDWA 3GGFA 2YCRA 5CSXA 4GUBA 5C8KA 3VS7A 3SA0A 4AA4A 3UE4A 1V0PA 4NKSA 4D4RA 4ZY6A 4AOTA 3PVWA 5LVNA 4OAVB 4YSJA 1WVYA 2HW6A 4D4YA 4I22A 2UZEA 3DK7A 4GKHA 3POZA 2JAVA 2VWWA 4JIKA 3UP2A 2UZUE 3LW0A 4FNXA 5HE1A 4ANBA 4XLIA 4FTKA 2PZ5A 3ALNA 4I20A 4GH2A 3TM0A 2PL0A 4JBPA 5A4TA 5HLPA 3QA8A 1PF8A 2R3NA 3K54A 4WNKA 3MPMA 3RPSA 5AP6A 2W1HA 4BWXA 4QO9A 4QP9A 4O6LA 4M7IA 4DCEA 3GC0A 3F2RA 3BEAA 5FTQA 5M09A 2IVSA 3AC1A 2HOGA 3E7OA 4UWBA 5IQCA 2F7EE 3HX4A 2VX0A 4M12A 3RNYA 4BDJA 4EHVA 4CFUA 1M14A 4WSQA 5B2LA 1R3CA 3DNEA 3W32A 2A4LA 4IFCA 1GOLA 4CMTA 5IA4A 2GTNA 2WTKC 4AFEA 2NPQA 2RIOA 3KMWA 4FKQA 4JNWA 5JK3A 3U9NA 3MVLA 2PVKA 3A4PA 1KE8A 4AU8A 3FL4A 4PRJA 4XRLA 4EH5A 5DR6A 3LFQA 3LFAA 3A7HA 3BX5A 3JS2A 3ZDUA 3BKBA 3FYJX 3B2TA 2IO6A 4MAOA 4V0GB 5AUWA 3FMDA 1J3HA 4LUDA 1JBPE 3O8PA 2BILB 4RC3A 3EQDA 4UMQA 3ZYAA 2QLUA 4DBNA 2NNWB 2DYLA 3KMUA 4NTTA 4XV9A 4NM7A 2J0MB 3RPYA 3CBLA 2VTRA 2NRUA 2ZDTA 3G2FA 4FIFA 4ANMA 3QGYA 3WYXA 5HVJA 3FQSA 4AE6A 4EORA 3C9WA 2FSOX 1UA2A 3FLSA 4S33A 5A9UA 4G6LA 3DBEA 3Q5IA 5FP6A 2X6EA 3K5UA 3LKMA 3VF9A 1YXVA 3SD0A 4CZUA 4JX3A 4PDPA 2J5FA 4LUEA 3U55A 5E92A 3TN8A 2E9NA 3OUNB 3ZFMA 2YEXA 1XBAA 5BYYA 4EYMA 2XYUA 5EH0A 3ODZX 2YIYA 5IA1A 4G3FA 1OL1A 2Y8OA 3H3CA 4FKSA 3UGCA 4F0IA 5IDPA 1G3NA 3BYSA 4IAZA 5HI2A 5KBRA 1WVWA 4KABA 3ORKA 4XYFA 5AR8A 2R3GA 5D7VA 4AZWA 3DB8A 4BGQA 4FTTA 1I44A 3AGLA 4GL9A 4XJ0A 5HCZA 4B99A 5HU3A 3WZJA 3ENMA 3UC3A 3NUUA 4NJ3A 3ZO4A 2QCSA 3Q53A 4FSZA 4HVSA 4BRXA 4CT2A 4PNKA 1QPEA 4E6DA 3EWHA 1H26A 3HV6A 3T3UA 4OGRA 3IQ7A 3MA6A 5HIEA 3L9LA 2P2HA 2OFUA 4WO5A 3EHAA 4CNHA 2W1GA 4U81A 3FZPA 4R3RA 5ANOA 4D2WA 4BF2A 4BZNA 4EEVA 1Q8TA 4GJ2A 3W2RA 2OH4A 2JBOA 4EUUA 4K18A 1NVSA 5LARA 3O7LD 2UZBA 3R7UA 1TKIA 2CCHA 3FHRA 5E8SA 3QZGA 5IF1A 5BYLA 2ESMA 2XCHA 3QQHA 4UY9A 3VHEA 4NCTA 4I93A 4IM3A 3RAHA 3VIDA 4ALWA 1YWVA 3CC6A 3U6HA 4QP7A 3LFNA 4RVKA 2YM8A 3F7ZA 3TTJA 4EH8A 1REKA 3PSCA 4AGCA 5M44A 4YJTA 4F7JA 3KQ7A 1WBVA 2ITNA 3A7IA 4A7CA 4YJUA 5CU3A 4BDHA 3MTLA 4V05A 5HTIA 4AGDA 2XBJA 2H8HA 3DPKA 4CEGA 3DJ6A 4R1VA 4H3BA 4PDYA 5KMMA 2I0HA 2VWZA 3FYKX 1GNGA 4FKPA 3HLLA 4FSWA 4KKEA 5ACBC 3N4UA 3VW6A 4Y85A 5E4HA 4FT9A 4XHKB 1ZYSA 2CGUA 4XV2A 1YWRA 3IDCA 2X7OA 3DT1A 3K5VA 1IG1A 3E3PA 3OTUA 3T9TA 4G3CA 3E7VA 5TO8A 4B8LA 3R8VA 1UU3A 3HRFA 5C27A 4MNEB 1Q62A 4OLIA 1P14A 4JQ7A 4ACGA 4B7TA 5FD2A 4EK4A 4B0GA 3EN9A 3MWUA 5LVLA 3QBNA 4AZVA 3FMMA 2WEIA 4DGGA 2R0UA 4ZLZA 3SXRA 4AZSA 1WZYA 4L6QA 2XM9A 1YDTE 2Z7QA 3GBZA 3SOCA 2C5NA 1YDSE 5LMBA 2BAKA 2ITPA 4U45A 1YXTA 5IQAA 4DFBA 1SVGA 3FL5A 3R71A 5KZIA 4B4LA 4C4JA 2R3FA 4DAWA 1WFCA 1SYKA 1G8SA 2YDIA 3V5PA 1CTPE 3WF7A 4CFFA 3H10A 2OIDA 2WGJA 3FPQA 4FGBA 1OBGA 2BTSA 1JAMA 4RX7A 2GQGA 1SNUA 3W2QA 3BLHA 4JAJA 4IJ9A 5AV0A 3IW5A 4U5JA 4F08A 3Q52A 3A7JA 3EQGA 4GIIA 1JKSA 3QQGA 2V62A 3DZQA 4HYUA 5HEZA 2OXDA 5AP1A 3UC4A 3AG9A 3QTQA 4FE2A 4CGAA 2R3HA 4HPUE 1OIYA 4O0SA 4EHEA 5CEOA 2E9OA 5DT4A 3KY2A 3DCVA 5IUIA 1WBNA 2QKWB 3MH2A 3PYYA 4GFOA 5CZHA 4QMSA 2H6DA 4ZY5A 3NVMB 1YHWA 2EXEA 3MJ2A 3BV3A 4GUEA 1P4OA 4FIJA 4KBKA 4QYFA 4LYNA 3VUMA 4AXAA 3GQIA 1WBTA 4JOAA 3C51A 4ZTLA 3E3BX 2W4KA 4FKIA 5T68A 3V3VA 3JXWA 3ZTXA 2QG7A 4ASZA 1P2AA 4UMPA 3PJ2A 3R9DA 3TTIA 4FV3A 5I0BA 2WOUA 2XKDA 4K33A 4D0WA 4KRDA 4IVDA 3SV0A 3SXSA 1XQZA 4MBJA 3W55A 5L4QA 3ZFYA 4BCIA 2UV2A 5LVPA 5K9IA 3PJCA 4LRMA 5EI8A 3RBWA 3LLAA 3DZOA 5HHWA 5A6NA 3QXPA 4U0IA 4K2RA 2OU7A 4I41A 2PWLA 2PUIA 2LGCA 4ANSA 3PXYA 4BZDA 4YZCA 2C1AA 2X1NA 5DVRA 5AUZA 3C0IA 4CRLA 4LM5A 3R8LA 1PXLA 5H2UA 3ZCLA 4RFYA 3F2AA 2A0CX 4AA0A 5HG5A 1SM2A 4WIHA 2J7TA 4FNZA 1PXPA 4ALVA 1OUYA 5HVKA 4AS0A 3MESA 1G8AA 4RJ8A 2WMUA 4PL5A 3D2KA 4FYNA 3LCDA 4ZAUA 4L00A 4KIKB 4AZFA 3VVHA 4ONAA 4EWHA 1EH4A 1H1SA 4DEGA 1XO2B 4CT1A 4YSMA 3ZUVA 5A4LA 5K5XA 3I5ZA 3FY0A 1H25A 4QP3A 2V22A 3D7TA 2FYSA 2WTVA 3QFVA 5L8KA 3HDMA 3VBVA 2VAGA 4EBWA 1WBOA 3QC9A 4GYGA 4IZYA 5BVFA 1IASA 4C37A 3M1SA 3ZRMA 3KCFA 5GZAA 2X7FA 4EZ7A 3TDVA 2PMNX 2QU5A 3IECA 5EOBA 5IH6A 3Q6WA 4X3JA 2UZNA 2P4IA 5HZNA 1VYWA 1OL6A 4YC8A 3F61A 5KX8A 4QYEA 2ZDUA 2XUUA 3CLYA 4EKKA 4QPMA 5BQ0A 3QTRA 1XHAA 4E8AA 2UW0A 3F2NA 3DKCA 4HNIA 1ZAOA 2OIBA 5JFWA 4N0SA 5EM8A 5AM6A 4OUCA 5FUTA 5F95A 4D2PA 4FTJA 3EL8A 1WVXA 3PLSA 3QAME 3D5WA 4JBQA 4IWQA 2CKPA 2IG7A 5E1EA 2VRXA 3D2IA 5DG5A 4BR3A 4YZNA 5EQPA 2B9JA 3DAEA 5HIBA 4FSYA 4FT3A 3LOKA 3NW7A 1V1KA 2X8IA 1P4FA 2W0JA 3NNUA 3BEGA 5CU4A 4HZSA 4FZDB 5CX9A 5EM6A 3E8DA 3CIKA 1QPCA 5EQYA 1OZ1A 4Q5HA 5CSHA 3W2PA 2ZAZA 4FVQA 1H1PA 1Y6BA 4YHTA 4GK2A 5TKDA 3TG1A 5IEVA 3U6IA 4QP8A 2X2LA 4AE9A 3MH0A 1VJYA 5HG8A 1OKYA 4X0MA 4BDDA 4FEWA 4BYIA 4M97A 3LMGA 2A1AB 4FT7A 5CXHA 4V04A 3F7WA 4YJPA 5K0XA 2XNEA 3PE1A 1UNLA 3BIZA 3KXNA 4RX9A 5HNBA 5HCXA 4DEDA 4E4XA 3G0EA 3QUPA 1OM1A 2RFDA 4IX4A 3L9NA 4RRVA 4YNOA 1U59A 3KXGA 3GU7A 3VNTA 4HOKA 3UIUA 3TKUA 4EK3A 4UWYA 1YOJA 3EN7A 1VR2A 1KE9A 4M13A 5JZNA 3OCSA 3QTSA 5ETFA 5HX8A 5K4JA 3DJ7A 4R7IA 3BQRA 3UPZA 4O0RA 4AN3A 4EH9A 4UV0A 2H34A 2WU6A 3EQFA 4FICA 3UOKA 3VO3A 5AAEA 2Y4PA 5HICA 5IDNA 1NVRA 4W8EA 2NRYA 4AAAA 3QTWA 4FI1A 2Z7SA 3MVHA 4XG2A 3H30A 2HWOA 2OJGA 1FVTA 2BDJA 2QONA 2JD5A 2X9FA 2G2IA 3TNQB 3C13A 3OS3A 3EQCA 4AZTA 3NWWA 4G3EA 4W9WA 2UW6A 1SVEA 2V7AA 3DOGA 3G33A 4I4EA 3V5QA 5BVWA 4F7LA 1OB3A 4R8QA 3DV3A 2ITWA 4A07A 4ERKA 3A60A 2VX1A 4RX5A 1YI3A 3TI1A 2ITXA 5CF5A 4FX3A 4I4FA 4KBAA 3FZRA 2VWVA 4RIYB 1PRYA 4NJDA 4DEIA 3COHA 4IWOA 3K3IA 2VGOA 2OJFE 2PZPA 3FMHA 4KB8A 3AC5A 5CAVA 4TZRA 1WMKA 3RALA 4AA5A 1W84A 2V0DA 3QX4A 5AUTA 5DH3A 4LV8A 1P5EA 1PMEA 2RFEA 3BV2A 3S95A 4ORKA 3F9NA 3NS9A 1YKRA 4HVGA 3EFLA 3FMNA 4X6RA 4A4XA 3ITZA 4FZ7A 4K9YA 4QP1A 2W05A 4NM3A 5CASA 4NZWB 1FGIA 1XH4A 4IW0A 4P5QA 2ETKA 2X4ZA 1YDRE 2CLXA 3ID6C 3QTZA 4NEUA 4IZAA 2O63A 3QWJA 4FV7A 3I6WA 4KNBA 4YJQA 4I6FA 2OF4A 4FVPA 3D5XA 3EYGA 3UZRA 4GVJA 4FV4A 3KXMA 4ASEA 5CU2A 2R3MA 2XCKA 4XBUA 2YCSA 3W18A 4JS8A 4M0YA 4ZTQA 5BNJA 4RJ3A 5AX9A 3VBXA 3QRUA 1KV2A 4JQEA 2BMCA 4PTGA 3TJCA 3UG2A 1JLUE 3W2OA 3D7ZA 4TN6A 5J9ZA 5HG9A 1YHSA 2PVLA 2C0TA 2Y6OA 2GU8A 2R3OA 3KRJA 4TWPA 4YHFA 1LP4A 5K0KA 2XJ2A 3DNDA 1UWHA 2GSFA 4FEUA 3R1SA 4TY1A 2W9ZB 2X4FA 3FLNC 3N4VA 4E26A 4IVBA 2B9FA 1FQ1B 4GSBA 4W4VA 3P7CA 5FDXA 1DI8A 1RJBA 1O9UA 4PY1A 2OXYA 4O7TA 1JKKA 3OY1A 4TNBA 2C47A 2VU3A 3P79A 2XJ0A 4FG8A 4RWIA 4TYIA 3I7BA 3NSZA 4E93A 1MP8A 2W5BA 3IW7A 5AR5A 3IW4A 4R1YA 3H0YA 1MRVA 2C6IA 3AC2A 4Y83A 4JBOA 5HO7A 2QOFA 5B2KA 3ZC5A 4BB4A 5I5ZA 4WA9A 4XUFA 3T3VA 4XOYA 2QR7A 3QF9A 3F3UA 4F1OA 3PSDA 2IZSA 2UW9A 3IO7A 1ZY4A 3OTVA 3VBYA 4I24A 5DLSA 4O2ZA 3PIZA 1Q41A 4M14A 2R3IA 3DBCA 3GCUA 5CEPA 3P7AA 1XBBA 3LCOA 4L3LA 3OBJA 5D11A 4PDSA 5D10A 4ZZNA 3MS9A 2XK4A 5G1XA 2PE2A 3HKOA 3ROCA 3NUPA 2WNTA 3F82A 3KK9A 3LFFA 3P4KA 4OT6A 4X2JA 5C03A 3TNIA 5KNJA 4JLCA 2VWUA 2OXXA 4DITA 5CSVA 2F4JA 5DIAA 4D4VA 4YPDA 3VC4A 3QLFA 3DXQA 4DCAA 1FVRA 4RPVA 4FUYA 4CZYB 3UZPA 3LPBA 3F3ZA 3GCVA 2I0VA 4WRGA 4PMSA 3R00A 5E8UA 3Q9WA 3R0TA 2YFXA 3HMIA 3TKIA 4O86A 3FPMA 1ZRZA 2E9VA 2J0JA 2YN8A 4IH8A 4HVIA 5JT2A 3HZTA 3BYMA 1DS5A 3ZLYA 3QD0A 5J1WA 3PXQA 5J5SA 3VUGA 4FL1A 2IW8A 3M11A 4ZLYA 2VGPA 5TOZA 2QQ7A 5HE3A 2WEVA 3R28A 2EB2A 1U46A 2W7XA 2W5AA 2IW6A 3MFSA 3PG1A 5E8TA 2E9PA 4DFYA 1GJOA 1Q97A 3CS9A 3NZ0A 2FVDA 4AN2A 4BZOA 3L8XA 5AV4A 4H05A 4P4CA 2R5TA 3GC7A 3ZZWA 3FI4A 4C38A 2J0KA 3PJ1A 5H8EA 1PXKA 3RGFA 3WARA 4IM2A 2QU6A 3Q04A 4D55A 5CSWA 4J8MA 5T3QA 2VTSA 4QMNA 2F9GA 4F1MA 4HYIA 4Y46A 5JMSA 4FTNA 2G15A 2B7AA 5KHWA 2JLDA 3SOAA 3U4UA 5J7BA 3UIBA 1E1XA 4EOPA 3UTOA 2JBPA 5CXZA 3G0FA 3Q5ZA 4EHGA 5H9BA 3BGPA 2CJMA 3R7OA 1F0QA 5CEMA 3PXKA 4KA3A 4CZTA 4EOSA 4CD0A 3WYYA 4H3PA 2ZJWA 3FSKA 3V6SA 4D5HA 2PVJA 4BY9E 1Y8YA 4PTCA 4LOOA 4LV5A 1G5SA 5HIDA 4IWDA 1O6KA 3FKOA 3MFUA 2X81A 1JOWB 3LHJA 4UZDA 4I94A 1OGUA 3U8WA 3QCQA 3TL8A 4UALA 3VUTA 5HE0A 1B39A 2BUJA 2ZM3A 5M53A 2KULA 5CAUA 4RFZA 4HGEA 3MVMA 4IM0A 4XP2A 4N6ZA 3E8CA 4RWKA 4OTPA 4ACCA 3HV5A 4GG5A 4QMTA 3W2CA 4FTAA 1PKDA 5TE0A 4B6LA 3AMAA 2R7IA 3BHTA 4FOCA 4ZS0A 3R7IA 2YIWA 3AMBA 1IEPA 2B1PA 1LPUA 3N51A 4S31A 4D5KA 2I7QA 4BGHA 3B2WA 3C5IA 4CG9A 2QOCA 2UVXA 4RGJA 4ENXA 5FTGA 3FV8A 4A9SA 3P08A 3P5KA 3PWYA 3ELJA 3D0EA 3BE2A 3ZMMA 4MXCA 4DEHA 3PPJA 5A4EA 3GOKA 3BYOA 1ZOGA 3LCSA 4YU2A 4FZFB 4CYJA 4YO6A 2QODA 4FZAB 3ORNA 4BCPA 4AACA 3LJ2A 4PUZA 2JIIA 1UU8A 1MQBA 1M2PA 1Q3WA 3COMA 3UOLA 4HVHA 3W1FA 2JDSA 5FWKK 4C61A 5AA9A 2ONLA 3PY1A 4XMOA 3QA0A 3HDNA 4R5YA 4GU6A 4O0VA 3ZXTA 4CLIA 3LXKA 4XS2A 3MV5A 4D2SA 3ETAA 4FV2A 4DGMA 4BCGA 4N70A 3P78A 3KN6A 4QQCA 2HAKA 3GP0A 4AW0A 3VJNA 3QTUA 4IJPA 2ERKA 2AUHA 5D41A 4AFJA 3MPTA 4G9CA 4FK3A 4NFMA 3LXNA 2JDTA 4IAYA 1DAYA 4QMMA 4MK0A 1H0VA 3KCKA 4DEBA 3EYHA 1Y6AA 3FKLA 4WOVA 1OPKA 4U3YA 4C0TA 3R63A 4FTMA 4BBEA 2BHHA 4AWIA 1YI6A 4F7NA 4I21A 2JIVA 3KMMA 1XH7A 4EH2A 4FGRA 2UW7A 1VZOA 2XK6A 1Z5MA 4BDKA 4O2PA 4CQGA 3PPKA 3P1AA 3QQKA 4FTUA 1H1QA 3FC2A 3LQ8A 4HGLA 5FEQA 3R30A 2JDOA 4TYEA 4C57A 1U54B 3FZTA 2ETMA 3D7TB 2OWBA 3KB7A 4LGDA 5CY3A 3OW4A 4CXAA 4OW8A 4BIDA 5L2SA 3V5TA 4BTFA 3JVRA 4QOXA 3TWJA 4DLJA 5BVNA 5DT3A 4EH7A 2QURA 1ZYDA 2OW3A 4XG8A 5EYDA 2JFMA 1YOLA 3IKAA 4P7EA 2Q83A 4MHAA 1MQ4A 2XKEA 2NP8A 4FIIA 4O84A 4FKRA 3BWJA 4JJRA 3S1HA 2VTAA 4ITJA 4PQNA 3DKOA 5AP7A 3F3WA 5LVOA 1WBSA 3DY7A 4BICA 4FKOA 2Q0BA 2Y4IC 3P9JA 4M69A 3H9RA 3OBGA 5CQWA 4USEA 1SNXA 4YTFA 2VTHA 2FUMA 2CPKE 1OITA 4G3GA 4U7ZA 4YURA 2XK3A 5JGDA 2W06A 4FTOA 3ZM9A 4MXXA 4TRLA 1ZYLA 3DTWA 3FUPA 3PP0A 4Q2AA 3UPXA 3NYVA 5FXSA 4DBXA 2XKCA 4EH3A 1A06A 5CU0A 5ETIA 5C4KA 4BYJA 5AEPA 4W9XA 4J52A 5C9CA 4CLJA 4APCA 4C4GA 3FMJA 3V5WA 4HGSA 5E8YA 4FT0A 4DG0E 5A4CA 1DI9A 4MNFA 4DT8A 4EC8A 2BHEA 4RQKA 4XG7A 1QPDA 4WUNA 3GENA 4X3FA 4FEXA 4BWKA 4U42A 3R2YA 5BMMA 5HG7A 2IVUA 4YJOA 4J71A 5F94A 3MTFA 4A9YA 1ZMWA 2REIA 3WBLA 2UVYA 3UOJA 2VTNA 2C3KA 4BI2A 3CY2A 4YJSA 4DGLC 1XJDA 1M2RA 2ZV9A 3OFMA 3COIA 3P23A 3E63A 3HAMA 1J7IA 1GZOA 2BCJA 4IX3A 4ACMA 4E4MA 5DRDA 1HOWA 4I0RA 4JR3A 3KRRA 4QD6A 3FXZA 3R7VA 2UZOA 4PPBA 3OVVA 4AGWA 4EYJA 3UYSA 4D28A 2UW5A 3FLYA 1O6YA 1KE5A 4RVLA 5DFPA 3HA6A 2JFLA 2OK1A 4XX9A 2R3LA 3LFEA 4AT3A 2C6OA 3SGCA 3E62A 5KKRB 1MRUA 4IMYA 3EH9A 4AOJA 2CGVA 4ENYA 2C4GA 1L8TA 2IJMA 3Q2MA 4GJ3A 4CFVA 5EW9A 4AP7A 5HX6A 5EYCA 3Q9XA 2X39A 4RWJA 3SW4A 4Z9LA 3HECA 4RX8A 3TNPC 4LOPA 2VO7A 5CWZA 4OTGA 5L6OA 1Y57A 4U6RA 4X6QC 5CYIA 3EZRA 5GJFA 4ZSJA 4NL0A 2PTKA 2C3JA 5FDPA 2GDOA 3ACJA 4EUTA 5FG8A 3FZOA 4G16A 3HL7A 4M68A 4PL3A 1JSUA 3TXOA 2BKZA 4U40A 4EQMA 3MH1A 3RHXA 3TUCA 3N9XA 4G5JA 1PW2A 3UNJA 4U44A 2B55A 2YDKA 2PZRA 3TZ9A 2QOKA 4WBBB 3R83A 4BC6A 3SHEA 1HCLA 4RJ4A 3TDWA 3ZU7A 2W1FA 4KIKA 3DK3A 4YUQA 1U54A 3ORMA 4YGAA 5IPJA 4NWMA 5LQFA 3FXXA 4KIOA 4HCTA 1ZXEA 4TTHB 1FVVA 1M7NA 4E1ZA 4BBFA 4EI4A 1H4LA 5CI7A 4CKJA 3OXIA 3MGYA 5M4FA 3CTQA 2WFYA 3RCDA 4O7LA 1AQ1A 2O64A 5IA2A 3Q4UA 3KEXA 5EQEA 4FSUA 5HU9A 2HZNA 4I5HA 5I9VA 3NNWA 5KZ0A 3NUNA 2X8EA 2VN9A 3PA4A 3QZIA 3RAIA 4ERWA 4RLKA 3MYGA 4FUXA 5HNGA 3GC9A 4BDGA 4IC8A 4I0SA 4V0GA 3ZH8A 4N6YA 2X2MA 3BU3A 3C5UA 4K77A 2WIPA 4YBJA 4C62A 2CNQA 5TR6A 2XK8A 3C4XA 3H9OA 3JY9A 3PUPA 4KINA 4EOQA 2OSCA 4ZS4A 3IDBA 3D9VA 3DJ5A 4H1MA 4LRKA 3IK3A 5JKGA 4XRJA 4DFNA 2FB8A 4QYHA 3A7GA 2XK7A 2XNPA 2GHGA 1YQJA 2WPAA 4K1BA 3QQUA 2BRMA 1URWA 2YITA 4BCHA 2XNGA 3Q96A 4C4HA 4QTEA 5C1QB 2PYWA 4EONA 3NR9A 4F09A 2E9UA 4IVCA 3WF6A 1M52A 2PVNA 4IBMA 4BTJA 5GINE 3QQFA 3GFEA 3DXPA 3ORPA 4QMWA 5A6OA 4IB1A 5IQIA 4BI0A 3MA3A 4LL0A 5CT7A 4Z16A 3HP2A 3BBTB 3CPBA 4HW7A 4QYYA 1CKIA 4G6NA 4E7WA 4O21A 2C0OA 2R3QA 1W83A 2QI8A 3QHWA 4IB3A 4C33A 1PXNA 2OICA 4R3PA 4R5SA 1KE7A 1R0EA 3KF7A 4ZEGA 4C58A 2WMVA 1YHVA 1BI8A 3ZBFA 4DFLA 4GK4A 4HPTE 5KO1A 3ZLWA 3UYTA 3SLSA 2F2CB 3OEZA 3WF5A 4GW8A 3Q4CA 4FKLA 4GRBA 3HMPA 4TYJA 3IG7A 3GT8A 1FMOE 2X9EA 4ZJJA 5GZ8A 4QP4A 5AP3A 2ZV8A 4LMUA 4OTFA 2XEZA 3I5NA 1OIUA 4RIXA 5F1ZA 3TT0A 4BCOA 5JQ8A 3PRIA 3R2BA 2JKKA 2G2HA 2OJIA 3CKWA 3LQ3A 4L46A 3VS1A 4C4EA 4DYMA 4MXAA 2C6EA 3QZHA 2VD5A 2VO6A 1UU9A 4FT5A 3T9IA 4LMNA 4MD9E 2WQEA 1OKVA 4OTHA 3ZM4A 4GFMA 4AF3A 2DWBA 4G31A 4TL0A 3BYVA 4CCBA 5L3AA 5AV2A 5CAOA 3A2CA 4HVDA 4CV9A 2BPMA 3GU6A 3IGGA 2WTDA 5AM7A 3R8PA 2VNWA 3DTCA 3QD4A 4AW1A 4MYGA 5CI6A 4BCNA 3BI6A 4Y8DA 1GIHA 5HORA 1XH6A 4CMOA 4UYNA 5A4QA 4RJ6A 3KULB 2I1MA 3EFKA 3RZFA 2QC6A 3QTXA 4RIWB 3OWPA 5E8WA 1ZARA 1NW1A 5A14A 4LGGA 4AT5A 3D14A 1BYGA 4E5WA 4I0TA 4FKUA 1KOBA 2Z7LA 5GJDA 3UMXA 3RPVA 3R9NA 5IEXA 5EW8A 1H0WA 3ORTA 3QU0A 4F0FA 3B8RA 3ZC6A 3C7QA 5L2QA 2FH9A 2ITYA 2W9FB 5AP4A 4OTWA 4RVMA 4FSMA 4G34A 4KBCA 2CLQA 2PZYA 1KE6A 5EDQA 3UBDA 3AD5A 4DEEA 3THBA 3QKLA 3A7FA 3U4WA 3DKFA 5CZIA 4MWIA 2PE1A 4E20A 1FMKA 4CV8A 4MXZA 2BRHA 3SX9A 1OI9A 4ID7A 3HMOA 5E8VA 4RC4A 2XNBA 2OLCA 2BROA 1BUHA 3CGFA 3VS3A 4DG2E 2BIKB 1YOMA 4OT5A 3QD2B 2VUWA 2Y4IB 5CNNA 4D9UA 4WD5A 2QHMA 3LIJA 2FSTX 4GK3A 2QLQA 4DTAA 4OR5A 3O7LB 2CHLA 4DG3E 2Z8CA 5C4LA 3Q9ZA 4KD1A 2ZMCA 3D83A 4FZ6A 4WHZA 4QMLA 3SXFA 4GCJA 4JG7A 4CTBA 3IPHA 1LUFA 2PUUA 2WB8A 3IW8A 4O82A 4GT5A 1W7HA 3VULA 4NSTA 2J4ZA 1H24A 1JKTA 4DT9A 5KMOA 4KRCA 3DBDA 4YJVA 1PXJA 4KKGA 2UZWE 4WT6A 3FLWA 4XG3A 3DU8A 2OFVA 5LXMA 3VUHA 3QUEA 4U97A 4RIXB 4PV0A 5EM7A 3Q4TA 5H8GA 5KMLA 3LXPA 3OP5A 3R9OA 4EWQA 4GT3A 4L8MA 4O83A 2C6TA 3C4FA 3V5JA 4EZ3A 4X7QA 4A9UA 4Y5HA 3NMUF 3FMEA 5IU2A 3EZVA 3FZ1A 2YZLA 2C69A 5J79A 3LXLA 3ANQA 2UVZA 4XP3A 1BMKA 1PHKA 4FL2A 5BUIA 5DYJA 5CALA 2WMBA 3QRIA 3KXXA 3E92A 2ITOA 2YIQA 2UW3A 3OWJA 4GFGA 3A61A 5DOSA 3A4OX 4ZSGA 4JDJA 5JRSA 4YO4A 1E9HA 5HD4A 3OHTA 3QRKA 2YIXA 3NYOA 3FI8A 2R64A 1OECA 2IWIA 5FGKA 3O17A 4WBOA 3JPVA 3EIDA 4WG4A 4M67A 4L67A 5AJQA 5EI6A 4ACDA 4L68A 3POOA 4ASDA 2IN6A 4I92A 2EB3A 4RWLA 4O1PA 1MRYA 2WZJA 3F6XA 3NYNA 3FE3A 1PJKA 2ITZA 4QP2A 3VN9A 3UNKA 2BZKB 3PFQA 3QRTA 3UODA 5LMKA 3NUYA 4XLVA 2YM7A 4JG6A 4QTCA 5HE2A 5IQEA 2Z7RA 4Z7HA 4OBOA 4J99A 3UJGA 3WZDA 3I79A 2Y9QA 4AUAA 2HCKA 1AD5A 2HZ4A 4CFXA 2BRGA 2C6DA 4FTLA 5AIKA 5I4NA 1YW2A 3MN3A 4O0UA 3LMHA 4ZXTA 2YWVA 5ETAA 1H27A 4GU9A 1UV5A 3AC4A 3OF0A 4HCUA 2CSNA 1X8BA 4CFMA 4Z7GA 2OO8X 2C5YA 2VWXA 3PVGA 4LRJA 4XCUA 1YXSA 3SKCA 3ZSHA 4AG8A 1YI4A 5DHJA 5EKOA 3V04A 3W8QA 3ZO3A 2GNLA 4UZHA 4BKYA 1F3MC 4DGNA 3RPRA 5IG1A 2QG5A 2XRWA 3R21A 4ZIMA 1O6LA 3Q32A 3UIXA 1OKWA 2HIWA 1Z9XA 3OG7A 4RG0A 4WKQA 3UO6A 1W0XC 5B7VA 3IOKA 1W82A 1RW8A 4ZJIA 1CM8A 2HELA 1IAHA 3F5GA 3NAYA 4P5ZA 5EDRA 4PP7A 2W1CA 5CENA 4O6EA 5EI2A 4NFNA 3KL8A 4NW6A 4O27B 5L8LA 3DB6A 4FIGA 5JSMA 5DBXA 1ATPE 2BRNA 2VWYA 4XNEA 4O7RA 4I3ZA 2O2UA 3NGAA 3S4QA 4UMTA 5TF9A 4JDIA 4O0YA 1CSNA 1DAWA 1GAGA 3UMWA 4X2NA 5IH5A 1ZYCA 1BL6A 4M66A 5B2MA 3C1XA 1UWJA 4IDTA 5M57A 4RIOA 1IAJA 4O96A 5J5TA 4BDAA 5CANA 2IZTA 1F5QA 3GEQA 4EL9A 3PVUA 4IX5A 4MBLA 1OBDA 4DEAA 2XMYA 4FV9A 2XJ1A 4FKWA 4KIPA 1WBPA 1YXUA 2I40A 5M56A 3GNIB 2PE0A 3CPCA 2OBJA 2VTJA 1ZMVA 2J0IA 3VW8A 5L6PA 4DTBA 4FTRA 3TV6A 4JQ8A 5J9YA 5M06A 2WELA 2R0IA 5M51A 3E5AA 4PNIA 4E5BA 2BFYA 2QOBA 3V6RA 5KHXA 4C3FA 4X3FB 2GS6A 5LCJA 4QMYA 2PVMA 1FINA 3JUHA 4M3QA 2O3PA 3P7BA 1H1RA 4IB0A 3CXWA 4EJ7A 5AP0A 2DUVA 1URCA 2JIUA 2ZM4A 3E93A 3NRMA 3OCTA 5DWRA 3GXLA 5J95A 1PYXA 3C4CA 2OI4X 4BN1A 4DH1A 4RIYA 2ETRA 3PPZA 4IQ6A 4ITIA 2E2BA 3KXHA 3EQHA 5EW3A 3BHHA 5D12A 4PMPA 4ZLOA 2IZRA 3QCSA 4ITHA 4JI9A 5E9EA 2QVSE 2QOIA 2VWBA 3HNGA 3R7GA 1UVRA 3OY3A 4EOOA 3NIZA 1NY3A 3UIMA 5DI1A 4C36A 3NNXA 2EU9A 4H39A 3FQEA 2HY0A 3RINA 4JVGA 4E4LA 3W8LA 5IMEA 5E91A 2H9VA 4CTCA 4A06A 5CVHA 2JKMA 5TT7A 3AC8A 4IHPA 4QNAA 4BCJA 4YTIA 3VS2A 3WF9A 4FV5A 3UG1A 5ITAA 3CD3A 2XA4A 3CP9A 5FTOA 3PJ3A 5LCKA 3RZBA 5A3XA 4QTAA 1U5RA 4N4SA 3PA5A 4F1TA 1A48A 2ITQA 3DDPA 3EJ1A 4NIFA 4X2FA 5D1JA 3ROYA 4O0XA 3RM6A 3I7CA 4AN9A 4MQ1A 2GNJA 3BRBA 4R78A 4MQ2A 3GCPA 4L3PA 2OZAB 5AR2A 3SC1A 2AYPA 2XF0A 3Q60A 3VBQA 4IVAA 4ZOGA 4ZSAA 1FOTA 4K6ZA 4GG7A 4HYSA 5DE2A 2WMQA 2R9SA 1OIQA 4UXLA 5E7RA 1QL6A 3FMKA 2GTMA 4ZZOA 1GZ8A 4QMPA 4RA4A 4U79A 5M4CA 5AUUA 5T6KA 4A4LA 4EKLA 2QNJA 4JDHA 5M08A 3MJ1A 2VTIA 1QMZA 4ZMEA 3PIXA 5AUXA 4S32A 4FV1A 3AQVA 2QHNA 2P0CA 2ITUA 2YHVA 3BCEA 3HGKA 3LFDA 3Q2JA 3GVUA 2X8DA 4IE9A 4DC2A 3KFAA 4AW2A 1OMWA 4QPAA 3R7YA 1ERKA 3MPAA 3KREA 4O7ZA 5L8JA 4F6SA 2PVFA 3CKXA 3G5DA 4Q9SA 1OL7A 3DQXA 5DA3A 3TNHA 5GNKA 3U87A 1PY5A 3V5LA 4L9IA 3QYWA 4KS7A 3ZO2A 1BKXA 5HCYA 3EMGA 2VTQA 1U5QA 2JDVA 3C4EA 4PL4A 4XOZA 3ATTA 4TYHB 3C0HA 2KTYA 2WAJA 2WMAA 1TVOA 4XEYA 3R8ZA 4DH8A 3CCNA 3LCKA 4QQTA 3FJQE 2OJ9A 3BE9A 3NNVA 4IAIA 3LVPA 4EOKA 3IGOA 4WG3A 2CKQA 4F65A 4BDEA 3E88A 3ATSA 2XIZA 4J97A 5EM5A 1WAKA 2CN5A 3OOMA 4EK5A 4ZMFA 2UZVA 3MI9A 4Y72A 2F7XE 5AUVA 4KAOA 4BCFA 4PDOA 4OTDA 3WILA 4L01A 4G17A 4P2KA 4G2FA 2W1IA 3FKNA 3EQPA 1NA7A 3N4TA 5DEYA 1YRPA 5I9YA 3HUCA 4FKVA 3V8WA 2YACA 2UZTA 4FTQA 2UZDA 4FSRA 2XYNA 3PXZA 4TPTA 4W4XA 5HLNA 3K2LA 3P0MA 4X2GA 4MD8E 3VRZA 3NX8A 5JGBA 4F9YA 3ZRKA 3MBLA 4F9AA 3ZLSA 4YC3A 1J7UA 4EQUA 4LI5A 4E3CA 1R0PA 2CKOA 3BLQA 3CSVA 2YJRA 4JIAA 4L52A 4TXCA 5EFQA 3AT2A 1XKKA 3KXZA 4QNYA 4FIHA 3R01A 4CVAA 4ZTRA 3EN5A 4AGUA 2PU8A 5C8MA 2QOOA 4MNEA 5HBEA 1ZWSA 2I6LA 4E6QA 1T45A 4JL9A 4TWCA 5KE0A 3TV4A 3JR1A 2YLEA 3A99A 2VWIA 5EHOA 2VZ6A 4NK9A 3GQLA 2QOQA 2WOTA 2R4BA 4KWPA 4OBQA 5HD7A 3C50A 4AW5A 3CD8A 3R8MA 2YA9A 2BAJA 5FBNC 3RVGA 2C5XA 4PP9A 4Z3VA 4M8TA 3ORZA 4YP8A 5FXQA 2P2IA 2ZM1A 4FODA 4RSSA 4ZK5A 2GMXA 3WZEA 3BLRA 4IZ5A 3CTHA 4EOJA 5FXRA 5J9LA 2PVYA 5LWMA 5EYKA 1ZYJA 3QQLA 3OOGA 2FGIA 4C7TA 4FEQA 3VHKA 2EXMA 1V0OA 2ZV2A 4NM0A 4MD7E 4Q9ZA 2XNMA 3OUKA 4RIWA 4YMJA 5E8XA 1WCCA 1SVHA 1NVQA 3V8SA 3A62A 3EKNA 2GHLA 2YWPA 5E1SA 4BVUA 3V51A 2W1EA 1Y8GA 4YC6A 3O23A 1SZMA 4GYIA 5E90A 4HYHA 5G6VA 1L3RE 2YABA 2ZMDA 3FLQA 3WIKA 1RQQA 3S0OA 2YM3A 4MH7A 4IANA 2QD9A 4O38A 3HA8A 4OTIA 1JPAA 3OD6X 3ULZA 4ZJVA 4TNDA 2XVDA 2SRCA 5BUJA 3UZTA 4U80A 1UKHA 1LEWA 4PPAA 1MUOA 2I0EA 3PP1A 5BPYA 4DE4A 4Y73A 3TCPA 3CJFA 3B8QA 4M15A 3HAVA 3DXNA 1Q99A 2J2IB 5ANGA 4CSVA 4BDIA 3MFTA 4XBRA 2WTKB 1ZY5A 1W98A 1Y91A 4PWNA 4BKJA 3PA3A 3UOHA 3L8SA 3PSBA 3NPCA 3H0ZA 4Y5QA 3GU5A 3HV3A 2WQNA 2VTLA 3AOXA 3ORLA 1QPJA 3KU2A 3QHRA 4CKIA 4JDKA 2WMRA 3VS6A 3OXTA 2WQBA 5HKMA 1YVJA 1VYZA 2BZJA 2OH0E 5ICPA 1W8CA 2GFSA 4UEUA 4BBMA 3ULIA 2JKQA 1ND4A 4TKSA 4G3DA 2A19B 4I6HA 2RFNA 1BI7A 4JR7A 4WNOA 5FQDC 3S2PA 4GEOA 1FGKA 1YXXA 2W5HA 3R02A 2G01A 4UN0C 3TEIA 2J6MA 4O7WA 2F7ZE 4QTDA 1B6CB 3PWDA 5DR2A 5DT0A 3Q9YA 5E8ZA 5K5NA 1R1WA 4O22A 4WRSA 3ERKA 1LR4A 2RL5A 4H58A 3VQUA 1Q8YA 2BVAA 5JEBA 5KBQA 2XNOA 1J91A 5AIRA 1B38A 1TQIA 2G2FA 5AR4A 1JSVA 4LGHA 5CVGA 4A4OA 4BTMA 4L53A 4ASXA 1BX6A 4QYGA 4RZWA 4OAUC 3DK6A 1ZMUA 4H3QA 2C6MA 4WSYA 3L9MA 3OT8A 2GQRA 3SW7A 3OW3A 4EQCA 2Y7JA 4X3FC 4MKCA 4TWOA 3GU8A 2WMWA 5D7AA 1CDKA 4FG9A 3JY0A 3RCJA 4BDFA 3FHIA 3FLZA 3QKMA 3RK9A 4HJOA 4O0TA 3DAKA 5CF6A 2WO6A 2WMTA 2ONLC 3E8NA 2GS7A 3TUDA 2ZB0A 2HK5A 3HV4A 3LFBA 3O71A 4FF8A 3SDJA 3RNIA 2C5OA 3BU5A 4NM5A 3PIYA 2J0LA 3AC3A 5CLPA 4EH4A 3QYZA 3OEFX 1AGWA 2JKOA 2YERA 3RK7A 3ZS5A 4DFUA 3BYUA 4BDBA 2VO0A 4BCMA 2OIQA 4YLLA 3ZEPA 4EBVA 4XG9A 2PHKA 3EL7A 5JQ5A 4FV6A 3SVVA 3OWLA 2GNGA 4QQ5A 2BZHB 3ZFXA 5LJJA 3IONA 1JWHA 2G1TA 3BHVA 4DFZE 3TKHA 5AUYA 4DH5A 4NYEA 3E64A 4YTHA 3MY0A 3ZONA 3OC1A 3R8UA 3MB6A 4PPCA 5IUHA 1K9AA 2EVAA 3DKGA 3F3VA 4YLJA 5IQFA 4NT4A 5LWNA 4FYOA 3FZSA 4PF4A 1H00A 4UBAA 1A9UA 4ANQA 4GVAA 5A54A 1ZZLA 1OVEA 3EQBA 2P33A 1ZOHA 2WMSA 3QC4A 5I9XA 2LAVA 3R1YA 3NCZA 5EOLA 4YHJA 3O8UA 2R3KA 4CFWA 5IZFA 4EOLA 5AR7A 1IRKA 3LM5A 4DLIA 3M42A 5JH6A 1APME 4XP0A 4BIBA 4BL1A 4F0GA 3I4BA 5AFVA 2R3PA 1GIIA 3OCBA 5IUGA 2WHBA 4XG6A 3H4JA 1V0BA 4YJRA 4YPSA 3RM7A 3NUSA 3PTGA 4B9DA 4RLLA 4WUAA 3UVRA 4C3RA 4O0WA 4F7SA 4BCQA 4F9BA 1XR1A 4FV8A 3EQIA 2VTPA 4ZP5A 4GT4A 1UKIA 5L2TA 4C8BA 2R2PA 3BPRA 2X0GA 3FY2A 2GNIA 4TT7A 5HVYA 5EHYA 4DF3A 5GIOE 3QX2A 2JGZA 4KKHA 2GNHA 3PXFA 1GIJA 1Q24A 1RDQE 3SQQA 3TJDA 5I3RA 4G5PA 4KIQA 4Z55A 2OF2A 4E73A 4GMYA 4J95A 5J87A 3QALE 4NCTC 3OMVA 3LLTA 4FR4A 3OWKA 2CCIA 5DRBA 4GIHA 3ZSGA 3W33A 5C8NA 1K3AA 3QQJA 1T46A 1ZLTA 3DS6A 4NTSA 3NEWA 2X7GA 3QXOA 3LAUA 2YJSA 3OROA 5CAPA 5JGAA 3OCGA 5HGIA 5M55A 3SRVB 3TNWA 2HZIA 2GNFA 2J51A 5C01A 2XB7A 4DH7A 2VO3A 2X6DA 4L43A 5CF8A 3CR0A 1CKPA 3HVCA 4K8AA 4LL5A 3RWQA 5KMJA 1BL7A 2WQMA 3EKKA 3LCTA 4LFIA 3RPOA 2HENA 4F63A 3UQGA 4CFNA 4D4SA 1GZNA 2B4SB 5C26A 2XIKA 5HLWA 2VTMA 4IX6A 3QKKA 5JFVA 5KUPA 3PJ8A 4YNEA 3R73A 1Z57A 3NCGA 2CN8A 2XBAA 4EK6A 4RZVA 4I5CA 2WTCA 4S34A 4DTKA 1IA8A 3G6GA 2W1DA 5I9UA 1M17A 3KULA 4RVTA 4BWPA 3U6JA 5CVFA 3UNZA 2QO7A 2CKEA 4MVFA 1XH8A 2ZVAA 4QMQA 2OGVA 3VUKA 2GCDA 4C34A 3A8XA 5AAFA 4F4PA 4ZY4A 2CMWA 3DBQA 4ANNA 4AQCA 3RAKA 4LOQA 2C3LA 1Q3DA 1Q8UA 2C1BA 2YDJA 3EFWA 4TYGA 3WF8A 5CEKA 5M07A 5CF4A 2VTTA 3UO4A 3AD6A 3ZRLA 5DMZA 2QR8A 4FNWA 5HTBA 4EOIA 4NIFB 3BBWA 3DFCB 2UW4A 3IS5A 3GFWA 4BKZA 2OZAA 3DLZA 3E8EA 3GCQA 5IA0A 4PTEA 2YM6A 5FRIA 3TZ7A 3VRYA 3A8WA 5AR3A 3SAYA 4EH6A 2IZUA 2J9MA 3PE2A 4UX9A 2W17A 3LQ5A 4C4IA 4O7VA 4XH6A 3L8PA 3ORIA 2GQSA 2I0YA 3EQRA 3WZUA 2RGPA 3ZUTA 4D9TA 3NUAA 2OKRA 3EN4A 3KC3A 4WG5A 4YZBA 4EZ5A 2ACXA 3TIZA 1KWPA 2J90A 1FBNA 2BIYA 4FKJA 1PKGA 5LOHA 4APPA 4QP6A 1XBCA 5EHLA 3TZMA 4FA2A 4AZEA 2XH5A 4I5MA 2XNNA 2XEYA 5ACKA 2PVRA 5DPVA 3QCYA 1ZOEA 5CQUA 1Q61A 2C0IA 5CEIA 5HESA 2PULA 4FMQA 1TQPA 2UZLA 4X21A 5B0XA 4R7HA 4R77A 3FMLA 3MY1A 3O51A 3G15A 3ET7A 4O7YA 3PY3A 4CQEA 3UP7A 4FTCA 2WU7A 2FO0A 3AMYA 3JYAA 2R3RA 5AX3A 3ZHPC 4FKGA 3OT3A 3D4QA 5AP2A 2O8YA 3KRLA 4CG8A 4JAIA 3DAJA 2AC3A 2QO2A 1R39A 5HQ0A 4RT7A 4IZ7A 4TYHA 3R04A 3VQHA 3SG8A 5IISA 3KRXA 3W16A 2DQ7X 5F9EA 2ZYBA 3DBFA 3F5PA 2XZSA 4MXOA 4CKRA 5HNIX 4FKTA 4F70A 4HCVA 5D9HA 4OTRA 2O65A 4ANLA 3NLBA 4J98A 3P86A 4BHZA 4ZTHA 2YISA 3DDQA 3JVSA 3KGAA 3TV7A 3UQCA 5JZJA 4OTQA 2HWPA 2FSLX 2XM8A 5ANKA 3RAWA 5CS6A 4QMUA 3QL8A 4YZMA 4PMMA 3VS5A 2P3GX 2BR1A 3NVKI 4ZSLA 3PY0A 4BI1A 1DM2A 2FA2A 4MX9A 3IW6A 4KS8A 4WNMA 2EWAA 5DNRA 1XWSA 2A2AA 3CJGA 5AAGA 4X2KA 5HBHA 2GHMA 4FC0A 5J1VA 3BHUA 4IDVA 3BGQA 3FSFA 3AT4A 2BKKA 3MB7A 2NO3A 2YIRA 4J1RA 4O91A 2BAQA 2WTIA 3MW1A 3AGMA 1H1WA 1H07A 3GUBA 4EK8A 5JN2A 3ZUUA 1PXMA 4IB5A 1UNGA 2B9HA 4FIEA 4UMUA 3U54A 4D58A 5BVDA 3R6XA 3MY5A 4C02A 2OJJA 3EOCA 4DN5A 2W4JA 3KVWA 3AT3A 4M0ZA 3KRWA 2Z2WA 3Q6UA 4YTCA 3PDTA 4RA5A 2PUPA 2QOLA 1J1CA 1Q5KA 4F6WA 1TQMA 2WD1A 4MCVA 4QMOA 3HP5A 2CGWA 1JSTA 4GS6A 3BU6A 4Y95A 3BWFA 5ANIA 2B54A 4ZSEA 1H8FA 3CGOA 5FLFA 5AADA 5BVOA 3MVJA 4JXFA 4RFMA 2VV9A 5L6WL 2UW8A 2F49A 4TWNA 1S9IA 1LEZA 5AV1A 3U9CA 4PX6A 2YM4A 3F5XA 3ZEWA 1H01A 5LMAA 4H36A 1JVPP 2JAMA 3R1QA 3BGZA 3VJOA 2BTRA 4F64A 1GY3A 2VTOA 4W4WA 3VAPA 3MIAA 4QMVA 4QTBA 3TACA 4FBXA 1M2QA 4EJNA 5IEYA 2WTWA 4UXQA 4QMXA 1PXIA 5BUEA 2X2KA 2XKFA 5LMKC 4AOIA 3KVXA 1OL5A 2RF9A 2C6KA 4NW5A 2RG6A 3KF4A 2WMXA 3PZHA 1STCE 5DGZA 5FBOA 3W10A 4U8ZA 5KMKA 2AC5A 2PPQA 3MDYA 3ZLXA 4Q5EA 5A46A 5IQBA 4HNFA 4G1WA 5BVKA 5IQDA 2GS2A 4DH3A 5HBJA 2P55A 4IWPA 3NUXA 3CQWA 5I3OA 2PMIA 3I0OA 4YZ9A 2C68A 5K4IA 4FV0A 2BRBA 3Q4ZA 5BVEA 5JFXA 3R22A 5GZ9A 1RE8A 4IXPA 1NT2A 2ZB1A 3ZZEA 2PMOX 4IAKA 3QCXA 4UB7A 5AP5A 2PZIA 2ZV7A 2Y0AA 2W4OA 2XK9A 4W4YA 5CAQA 4D2RA 4O7NA 2C30A 3I6UA 4EC9A 1PMVA 4DINA 1OUKA 3HMNA 5EYMA 3RKBA 2BALA 4ZTMA 5KKRC 3RHKA 3AXWA 1OKZA 4A9TA 3TIYA 4S2ZA 4EOMA 5CU6A 1PMNA 2PVHA 3MH3A 5AV3A 3UDBA 1KUTA 3C0GA 2RKUA 1GZKA 4I6BA 4IC7A 4NU1A 4K11A 4K0YA 4CRSA 4O81A 4KUJA 4L44A 4F9CA 4YJNA 3PXRA 4A9RA 1CKJA 5IA5A 2O5KA 3GI3A 3HYHA 3L1SA 3NW6A 5FM2A 4DHFA 2Q0NA 1ZZ2A 2GFCA 3U51A 4L7SA 2IVVA 3D5UA 1KSWA 2HXQA 2XRUA 3DLSA 3FI2A 3FDNA 3LFCA 4V01A 4YLKA 5EG3A 3PLAE 1E1VA 4HGTA 4MBIA 1PYEA 5IH4A 1YWNA 4YBKA 5FEEA 5F4NA 2V7OA 1PXOA 4LQMA 3R9HA 2XIYA 2WXVA 3KK8A 3G9LX 3TZ8A 3UQFA 2PMLX 1SMHA 3O8TA 4BFMA 4FSTA 4R7BA 1KV1A 2JITA 3QD3A 4ZTNA 3V01A 3VUDA 3WE8A 3ZO1A 2YZAA 5HO8A 3QZFA 4YZDA 3RI1A 3SG9A 5I9WA 4J53A 5H3QA 4E5AX 2B0QA 2R7BA 3ALOA 3BZ3A 4RMZA 2JC6A 5FP5A 5BMSA 3I1AA 3VS0A 4E6AA 1UU7A 5KCVA 1IR3A 3RTPA 5L2IA 4ZTSA 3OXZA 4FL3A 4G6OA 5GJGA 4GKIA 3R1NA 2QO9A 3LM0A 3OZ6A 3SRVA 3IDPA 4IACA 3WI6A 2ZOQA 4IAAA 5BYZA 3TUBA 3UVQA 2BFXA 4IIRA 5EKNA 5IMXA 3L8VA 3E87A 3F69A 2Z02A 4I6QA 4ARKA 5EDPA 3VS4A 1K2PA 3ORXA 3D94A 3FI3A 3S3IA 2C3IB 4XG4A 4ACHA 1J1BA 2XIRA 1Q8ZA 4AT4A 3K3JA 3O96A 5AA8A 2VNYA 1BLXA 3QLGA 3BHYA 3PZEA 4MEDA 3W2SA 4D1ZA 1M7QA 2WKMA 3DFAA 4JX7A 5ANEA 2PUNA 1FPUA 4FTIA 3VBWA 3FEGA 3G90X 3HUBA 4I23A 4QQJA 1JKLA 3PVBA 1CMKE 4C4FA 5IA3A 3RP9A 4ALUA 4NH1A 3C4WA 3G6HA 4H1JA 3H9FA 2OZOA 2YAKA 4D0XA 4YR8A 4USDA 2IW9A 4R6VA 4F9WA 4XV1A 2QOHA 3WIGA 5DN3A 4D2VA 3FC1X 1WBWA 3D15A 5ETCA 4F99A 2B53A 4CMUA 5CSPA 2CDZA 2RFSA 3G9NA 2DS1A 5ANJA 3G51A 3EB0A 4BCKA 4UWCA 4RBLA 3L9PA 5FM3A 4L45A 4MWHA 4BGGA 4ANOA 4E4NA 5AWMA 3REPA 4P90A 5KMNA 2WQOA 2YLFA 1OPJA 5DR9A 4E6CA 2Y6MA 5HOAA 3R7EA 1REJA 3HEGA 2YCFA 4FVRA 3WZKA 4RC2A 3LJ0A 2J50A 3FBVA 1KOAA 3WE4A 3ZSIA 1R78A 4JG8A 5M4UA 4IADA 3ZXZA 2J5EA 5I9ZA 3LZBA 3GCSA 3Q3BA 4MF1A 4RJ7A 4EHZA 4N57A 4O1OA 3RJCA 1Q8WA 3FQHA 1JQHA 3KKVA 2YM5A 3FAAA 3ZBXA 4XV3A 4FK6A 3CY3A 5DEWA 4I1ZA 4L3JA 2PY3A 5CEQA 3CQEA 4MTAA 4KSPA 4USFA 2B9IA 4JT3A 2HY81 4B8MA 4BDCA 2PK9A 2PSQA 4D2TA 2BZIB 2RSVA 4U41A 5J8IA 5IQHA 4RQVA 2R3JA 4JRVA 3WOWA 4NUSA 2QKRA 3ZDIA 2WIHA 1H08A 3T8OA 3HRBA 4AX8A 5BX0A 3UO5A 4BTKA 4C3PA 4L42A 2RG5A 3HRCA 4RJ5A 2XS0A 2ITVA 3M2WA 3LFSA 3ACKA 3D5VA 3C4ZA 3MSSA 3I60A 5JRQA 4FSQA 3DQWA 4OBPA 2EXCX 4DA5A 2C6LA 4CYIA 5GIPE 2EUFB 2BDFA 4J7BA 2C5VA 3II5A 3KA0A 2V5QA 3DA6A
chains in the Genus database with same CATH superfamily
3ODYX 1OPLA 3GB2A 5HTCA 3GU4A 1Q4LA 4FNYA 2YAAA 4LG4A 4FG7A 1J7LA 4II5A 5IQGA 4F6UA 4UMRA 2IVTA 5IKWA 4UYAA 4O4FA 3EN6A 3R9RA 1IA9A 2G9XA 5L2WA 3O2MA 2Z60A 4IFGA 3NAXA 2H96A 3LMIA 1I09A 1TFFA 3VBTA 2F57A 3KN5A 5CT0A 2VX3A 4C35A 4NKAA 2YCQA 4S30A 2HZ0A 3I0QA 1S9JA 2O0UA 4U9AA 4G9RA 2B52A 2CGXA 3DGKA 4ZZMA 3RMFA 4JBVA 2A27A 3CE3A 3GC8A 2HYYA 3GOPA 5CTPA 2W99B 4BIEA 1QCFA 2HW7A 4WNPA 3VWAA 5J7HA 4FOBA 1OIRA 4J8NA 4M69B 2ITTA 4QRCA 4R3CA 3NYXA 4J96A 4L7FA 5FEDA 4MXYA 3CTJA 5M4IA 5LVMA 3I81A 3PG3A 4QT1A 3VUIA 4PMTA 4QPSA 3V8TA 2W96B 3ZOSA 5F20A 3RK5A 4CCUA 4I5PA 4JRNA 2CNUA 4DGOA 5HO6A 3CQUA 2IPXA 3LE6A 4GV1A 4IEBA 2FSMX 3CEKA 3O0GA 5ANDA 3EFJA 4U3ZA 5K3YA 1U4DA 5JFSA 1XH5A 2JEDA 1UNHA 2W1ZA 3FXWA 1VEBA 3MIYA 3NDMA 4U43A 4D1XA 4TW9A 5EK7A 4DFXE 3O50A 4M84A 5H8BA 1TZDA 4BHNA 2XP2A 5CNOA 3F3TA 4MF0A 3NW5A 3HV7A 2JDRA 2XIXA 2GPHA 4C2VA 3PRFA 2UUEA 3IOPA 4IAFA 3COKA 4BJJB 3MFRA 4FEVA 4D1SA 3HMMA 2CNVA 2V55A 4KSQA 4FSNA 3RWPA 1JNKA 1H28A 1XH9A 1PMUA 2F2UA 2OG8A 3BELA 3BQCA 5GHVA 4W8DA 3F66A 3LJ1A 3F5UA 2ERZE 4HZRA 3QRJA 3QUDA 3ENHA 3UVPA 1HCKA 4QMZA 1OL2A 3ANRA 3QWKA 4C2WA 3F88A 3QGWA 4C59A 4O7SA 3AD4A 5KMIA 3NIEA 3QTIA 5AMNA 3VF8A 2WTJA 3FWQA 1NXKA 2HXLA 3S00A 2BDWA 3GGFA 2YCRA 5CSXA 4GUBA 5C8KA 3VS7A 3SA0A 4AA4A 3UE4A 1V0PA 4NKSA 4D4RA 4ZY6A 4AOTA 3PVWA 5LVNA 4OAVB 4YSJA 1WVYA 2HW6A 4D4YA 4I22A 2UZEA 3DK7A 4GKHA 3POZA 2JAVA 2VWWA 4JIKA 3UP2A 2UZUE 3LW0A 4FNXA 5HE1A 4ANBA 4XLIA 4FTKA 2PZ5A 3ALNA 4I20A 4GH2A 3TM0A 4DHJA 2PL0A 4JBPA 5A4TA 5HLPA 3QA8A 1PF8A 2R3NA 3K54A 4WNKA 3MPMA 3RPSA 5AP6A 2W1HA 4BWXA 4QO9A 4QP9A 4O6LA 4M7IA 4DCEA 3GC0A 3F2RA 3BEAA 5FTQA 5M09A 2IVSA 3AC1A 2HOGA 3E7OA 4UWBA 5IQCA 2F7EE 3HX4A 2VX0A 4M12A 3RNYA 4BDJA 4EHVA 4CFUA 1M14A 4WSQA 5B2LA 1R3CA 3DNEA 3W32A 2A4LA 4IFCA 1GOLA 4CMTA 5IA4A 2GTNA 2WTKC 4AFEA 2NPQA 2RIOA 3KMWA 4FKQA 4JNWA 5JK3A 4AXDA 3U9NA 3MVLA 2PVKA 3A4PA 1KE8A 4AU8A 3FL4A 4PRJA 4XRLA 4EH5A 5DR6A 3LFQA 3LFAA 3A7HA 3BX5A 3JS2A 3ZDUA 3BKBA 3FYJX 3B2TA 2IO6A 4MAOA 4FRFA 4V0GB 5AUWA 3FMDA 1J3HA 4LUDA 1JBPE 3O8PA 2BILB 4RC3A 3EQDA 4UMQA 3ZYAA 2QLUA 4DBNA 2NNWB 2DYLA 3KMUA 4NTTA 4XV9A 4NM7A 2J0MB 3RPYA 3CBLA 2VTRA 2NRUA 2ZDTA 3G2FA 4FIFA 4ANMA 3QGYA 3WYXA 5HVJA 3FQSA 4AE6A 4EORA 3C9WA 2FSOX 1UA2A 3FLSA 4S33A 5A9UA 4G6LA 3DBEA 3Q5IA 5FP6A 2X6EA 3K5UA 3LKMA 3VF9A 1YXVA 3SD0A 4CZUA 4JX3A 4PDPA 2J5FA 4LUEA 5BV3A 3U55A 5E92A 3TN8A 2E9NA 3OUNB 3ZFMA 2YEXA 1XBAA 5BYYA 4EYMA 2XYUA 5EH0A 3ODZX 2YIYA 5IA1A 4G3FA 1OL1A 2Y8OA 3H3CA 4FKSA 3UGCA 4F0IA 5IDPA 1G3NA 3BYSA 4IAZA 5HI2A 5KBRA 1WVWA 4KABA 3ORKA 4XYFA 5AR8A 2R3GA 5D7VA 4AZWA 3DB8A 4BGQA 4FTTA 1I44A 3AGLA 4GL9A 4XJ0A 5HCZA 4B99A 5HU3A 3WZJA 3ENMA 3UC3A 3NUUA 4NJ3A 3ZO4A 2QCSA 3Q53A 4FSZA 4HVSA 4BRXA 4CT2A 4PNKA 1QPEA 4E6DA 3EWHA 1H26A 3NFFB 3HV6A 3T3UA 4OGRA 3IQ7A 3MA6A 5HIEA 3L9LA 2P2HA 2OFUA 4WO5A 3EHAA 4CNHA 2W1GA 4U81A 3PUFC 3FZPA 4R3RA 5ANOA 4D2WA 4BF2A 4BZNA 4EEVA 1Q8TA 4GJ2A 3W2RA 2OH4A 2JBOA 4EUUA 4K18A 1NVSA 4AXFA 5LARA 3O7LD 2UZBA 3R7UA 1TKIA 2CCHA 3FHRA 5E8SA 3QZGA 5IF1A 5BYLA 2ESMA 2XCHA 3QQHA 4UY9A 3VHEA 4NCTA 4I93A 4IM3A 3RAHA 3VIDA 4ALWA 1YWVA 3CC6A 3U6HA 4QP7A 3LFNA 4RVKA 2YM8A 3F7ZA 3TTJA 4EH8A 1REKA 3PSCA 4AGCA 5M44A 4YJTA 4F7JA 3KQ7A 1WBVA 2ITNA 3A7IA 4A7CA 4YJUA 5CU3A 4BDHA 3MTLA 4V05A 5HTIA 4AGDA 2XBJA 2H8HA 3DPKA 4CEGA 3DJ6A 4R1VA 4H3BA 4PDYA 5KMMA 2I0HA 2VWZA 3FYKX 1GNGA 4FKPA 3HLLA 4FSWA 4KKEA 5ACBC 3N4UA 3VW6A 4Y85A 5E4HA 4FT9A 4XHKB 1ZYSA 2CGUA 4XV2A 1YWRA 3IDCA 2X7OA 3DT1A 3K5VA 1IG1A 3E3PA 3OTUA 3T9TA 4G3CA 3E7VA 5TO8A 4B8LA 3R8VA 1UU3A 3HRFA 5C27A 4MNEB 4QDVA 1Q62A 4OLIA 1P14A 4JQ7A 4ACGA 4B7TA 5FD2A 4EK4A 4B0GA 3EN9A 3MWUA 5LVLA 3QBNA 4AZVA 3FMMA 2WEIA 4DGGA 2R0UA 4ZLZA 3SXRA 4AZSA 1WZYA 4L6QA 4DHIB 2XM9A 1YDTE 2Z7QA 3GBZA 3SOCA 2C5NA 1YDSE 5LMBA 2BAKA 2ITPA 4U45A 1YXTA 5IQAA 4DFBA 1SVGA 3FL5A 3R71A 5KZIA 4B4LA 4C4JA 2R3FA 4DAWA 1WFCA 1SYKA 1G8SA 2YDIA 3V5PA 1CTPE 3AKKA 3WF7A 4CFFA 3H10A 2OIDA 2WGJA 3FPQA 4FGBA 1OBGA 2BTSA 1JAMA 4RX7A 2GQGA 1SNUA 3W2QA 3BLHA 4JAJA 4IJ9A 5AV0A 3IW5A 4U5JA 4F08A 3Q52A 3A7JA 3EQGA 4GIIA 1JKSA 3QQGA 2V62A 3DZQA 4HYUA 5HEZA 2OXDA 5AP1A 3UC4A 3AG9A 3QTQA 4FE2A 4CGAA 2R3HA 4HPUE 1OIYA 4O0SA 4EHEA 5CEOA 2E9OA 3O5AA 5DT4A 3KY2A 3DCVA 5IUIA 1WBNA 2QKWB 3MH2A 3PYYA 4GFOA 5CZHA 4QMSA 2H6DA 4ZY5A 3NVMB 1YHWA 2EXEA 3MJ2A 3BV3A 4GUEA 1P4OA 4FIJA 4KBKA 4QYFA 4LYNA 3VUMA 4AXAA 3GQIA 1WBTA 4JOAA 3C51A 4ZTLA 3E3BX 2W4KA 4FKIA 5T68A 3V3VA 3JXWA 3ZTXA 2QG7A 4ASZA 1P2AA 4UMPA 3PJ2A 3R9DA 3TTIA 4FV3A 5I0BA 2WOUA 2XKDA 4K33A 4D0WA 4KRDA 4IVDA 3SV0A 3SXSA 1XQZA 4MBJA 3W55A 5L4QA 3ZFYA 4BCIA 2UV2A 5LVPA 5K9IA 3PJCA 4LRMA 5EI8A 3RBWA 3LLAA 3DZOA 5HHWA 5A6NA 3QXPA 4U0IA 4K2RA 2OU7A 4I41A 2PWLA 2PUIA 2LGCA 4ANSA 3PXYA 4BZDA 4YZCA 2C1AA 2X1NA 5DVRA 5AUZA 3C0IA 4CRLA 4LM5A 3R8LA 1PXLA 5H2UA 3ZCLA 4RFYA 3F2AA 2A0CX 4AA0A 5HG5A 1SM2A 4WIHA 2J7TA 4FNZA 1PXPA 4ALVA 1OUYA 3UDSA 5HVKA 4AS0A 3MESA 1G8AA 4RJ8A 2WMUA 4PL5A 3D2KA 4FYNA 3LCDA 4ZAUA 4L00A 4KIKB 4AZFA 3VVHA 4ONAA 4EWHA 1EH4A 1H1SA 4DEGA 1XO2B 4CT1A 4YSMA 3ZUVA 5A4LA 5K5XA 3I5ZA 3FY0A 1H25A 4QP3A 2V22A 3D7TA 2FYSA 2WTVA 3QFVA 5L8KA 2A98A 3HDMA 3VBVA 2VAGA 4EBWA 1WBOA 3QC9A 4GYGA 4IZYA 5BVFA 1IASA 4C37A 3M1SA 3ZRMA 3KCFA 5GZAA 2X7FA 4EZ7A 3TDVA 2PMNX 2QU5A 3IECA 5EOBA 5IH6A 3Q6WA 4X3JA 2UZNA 2P4IA 5HZNA 1VYWA 1OL6A 4YC8A 3F61A 5KX8A 4QYEA 2ZDUA 2XUUA 3CLYA 4EKKA 4QPMA 5BQ0A 3QTRA 1XHAA 4E8AA 2UW0A 3F2NA 3DKCA 4HNIA 1ZAOA 2OIBA 5JFWA 4N0SA 5EM8A 5AM6A 4OUCA 5FUTA 5F95A 4D2PA 4FTJA 3EL8A 1WVXA 3PLSA 3QAME 3D5WA 4JBQA 4IWQA 2CKPA 2IG7A 5E1EA 2VRXA 3D2IA 5DG5A 4BR3A 4YZNA 5EQPA 2B9JA 3DAEA 5HIBA 4FSYA 4FT3A 3LOKA 3NW7A 1V1KA 2X8IA 1P4FA 2W0JA 3NNUA 3BEGA 5CU4A 4HZSA 4FZDB 5CX9A 5EM6A 3E8DA 3CIKA 1QPCA 5EQYA 1OZ1A 4Q5HA 5CSHA 3W2PA 2ZAZA 4FVQA 1H1PA 1Y6BA 4YHTA 4GK2A 5TKDA 3TG1A 5IEVA 3U6IA 4QP8A 2X2LA 4AE9A 3MH0A 1VJYA 5HG8A 1OKYA 4X0MA 4BDDA 4FEWA 4BYIA 4M97A 3LMGA 2A1AB 4FT7A 5CXHA 4V04A 3F7WA 2AEGA 4YJPA 5K0XA 2XNEA 3PE1A 1UNLA 3BIZA 3KXNA 4RX9A 5HNBA 5HCXA 4DEDA 4E4XA 1ST0A 3G0EA 3QUPA 1OM1A 2RFDA 4IX4A 3L9NA 4RRVA 4YNOA 1U59A 3KXGA 3GU7A 3VNTA 4HOKA 3UIUA 3TKUA 4EK3A 4UWYA 1YOJA 3EN7A 1VR2A 1KE9A 4M13A 5JZNA 3OCSA 3QTSA 5ETFA 5HX8A 5K4JA 3DJ7A 4R7IA 3BQRA 3UPZA 4O0RA 4AN3A 4EH9A 4UV0A 2H34A 2WU6A 3EQFA 4FICA 3UOKA 3VO3A 5AAEA 2Y4PA 5HICA 5IDNA 1NVRA 4W8EA 2NRYA 4AAAA 3QTWA 4FI1A 2Z7SA 3MVHA 4XG2A 3H30A 2HWOA 2OJGA 1FVTA 2BDJA 2QONA 2JD5A 2X9FA 2G2IA 3TNQB 3C13A 3OS3A 3EQCA 4AZTA 3NWWA 4G3EA 4W9WA 2UW6A 1SVEA 2V7AA 3DOGA 3G33A 4I4EA 3V5QA 5BVWA 4F7LA 1OB3A 4R8QA 3DV3A 2ITWA 4A07A 4ERKA 3A60A 2VX1A 4RX5A 1YI3A 3TI1A 2ITXA 5CF5A 4FX3A 4I4FA 4KBAA 3FZRA 2VWVA 4RIYB 1PRYA 4NJDA 4DEIA 3COHA 4IWOA 3K3IA 2VGOA 2OJFE 2PZPA 3FMHA 4KB8A 3AC5A 5CAVA 4TZRA 1WMKA 3RALA 4AA5A 1W84A 2V0DA 3QX4A 5AUTA 5DH3A 4LV8A 1P5EA 1PMEA 2RFEA 3BV2A 3S95A 4ORKA 3F9NA 3NS9A 1YKRA 4HVGA 3EFLA 3FMNA 4X6RA 4A4XA 3ITZA 4FZ7A 4K9YA 4QP1A 2W05A 4NM3A 5CASA 4NZWB 1FGIA 1XH4A 4IW0A 4P5QA 2ETKA 2X4ZA 1YDRE 2CLXA 3ID6C 3QTZA 4NEUA 4IZAA 2O63A 3QWJA 4FV7A 3I6WA 4KNBA 4YJQA 4I6FA 2OF4A 4FVPA 3D5XA 3EYGA 3UZRA 4GVJA 4FV4A 3KXMA 4ASEA 5CU2A 2R3MA 2XCKA 4XBUA 2YCSA 3W18A 4JS8A 4M0YA 4ZTQA 5BNJA 4RJ3A 5AX9A 3VBXA 3QRUA 1KV2A 4JQEA 2BMCA 4PTGA 3TJCA 3UG2A 1JLUE 3W2OA 3D7ZA 4TN6A 5J9ZA 5HG9A 1YHSA 2PVLA 2C0TA 2Y6OA 2GU8A 2R3OA 3KRJA 4TWPA 4YHFA 1LP4A 5K0KA 2XJ2A 3DNDA 1UWHA 2GSFA 4FEUA 3R1SA 4TY1A 2W9ZB 2X4FA 3FLNC 3N4VA 4E26A 4IVBA 2B9FA 1FQ1B 4GSBA 4W4VA 3P7CA 5FDXA 1DI8A 1RJBA 1O9UA 4PY1A 2OXYA 4O7TA 1JKKA 3OY1A 4TNBA 2C47A 2VU3A 3P79A 2XJ0A 4FG8A 4RWIA 4TYIA 3I7BA 3NSZA 4E93A 4AXEA 1MP8A 2W5BA 3IW7A 5AR5A 3IW4A 4R1YA 3H0YA 1MRVA 2C6IA 3AC2A 4Y83A 4JBOA 2X0PA 5HO7A 2QOFA 5B2KA 3ZC5A 4BB4A 5I5ZA 4WA9A 4XUFA 3T3VA 4XOYA 2QR7A 3QF9A 3F3UA 4F1OA 3PSDA 2IZSA 2UW9A 3IO7A 1ZY4A 3OTVA 3VBYA 4I24A 2XALA 5DLSA 4O2ZA 3PIZA 2AQXA 1Q41A 4M14A 2R3IA 3DBCA 3GCUA 5CEPA 3P7AA 1XBBA 3LCOA 4L3LA 3OBJA 5D11A 4PDSA 5D10A 4ZZNA 3MS9A 2XK4A 5G1XA 2PE2A 3HKOA 3ROCA 3NUPA 2WNTA 3F82A 3KK9A 3LFFA 3P4KA 4OT6A 4X2JA 5C03A 3TNIA 5KNJA 4JLCA 2VWUA 2OXXA 4O4BB 4DITA 5CSVA 2F4JA 5DIAA 4D4VA 1W2FA 4YPDA 3QLFA 3VC4A 3DXQA 4DCAA 1FVRA 4RPVA 4FUYA 4CZYB 3UZPA 3LPBA 3F3ZA 3GCVA 2I0VA 4WRGA 4PMSA 3R00A 5E8UA 3Q9WA 3R0TA 2YFXA 3HMIA 3TKIA 4O86A 3FPMA 1ZRZA 2E9VA 2J0JA 2YN8A 4IH8A 4HVIA 5JT2A 2NYAA 3HZTA 4O4DA 3BYMA 1DS5A 3ZLYA 3QD0A 5J1WA 3PXQA 5J5SA 3VUGA 4FL1A 2IW8A 3M11A 4ZLYA 2VGPA 5TOZA 2QQ7A 5HE3A 2WEVA 3R28A 2EB2A 1U46A 2W7XA 2W5AA 2IW6A 3MFSA 3PG1A 5E8TA 2E9PA 4DFYA 1GJOA 1Q97A 3CS9A 3NZ0A 2FVDA 4AN2A 4BZOA 3L8XA 5AV4A 3P5JC 4P4CA 4H05A 2R5TA 3GC7A 3ZZWA 3FI4A 4C38A 2J0KA 3PJ1A 5H8EA 1ST4A 1PXKA 3RGFA 2IEWA 3WARA 4IM2A 2QU6A 3Q04A 4D55A 5CSWA 4J8MA 3NFGB 5T3QA 2VTSA 4QMNA 2F9GA 4F1MA 4HYIA 4Y46A 5JMSA 4FTNA 2G15A 2B7AA 5KHWA 2JLDA 3SOAA 3U4UA 5J7BA 3UIBA 1E1XA 4EOPA 3BLAA 3UTOA 2JBPA 5CXZA 3G0FA 3Q5ZA 4EHGA 5H9BA 3BGPA 2CJMA 3R7OA 1F0QA 5CEMA 3PXKA 4KA3A 4CZTA 4EOSA 4CD0A 3WYYA 4H3PA 2ZJWA 3FSKA 3V6SA 4D5HA 2PVJA 4BY9E 1Y8YA 4PTCA 4LOOA 4LV5A 1G5SA 5HIDA 4IWDA 1O6KA 3FKOA 3MFUA 2X81A 1JOWB 3LHJA 4UZDA 4I94A 1OGUA 3U8WA 3QCQA 3TL8A 4UALA 3VUTA 5HE0A 1B39A 2BUJA 2ZM3A 5M53A 2KULA 5CAUA 4RFZA 4HGEA 3MVMA 4IM0A 4XP2A 4N6ZA 3E8CA 4RWKA 4OTPA 4ACCA 3HV5A 4GG5A 4QMTA 3W2CA 4FTAA 1PKDA 5TE0A 4B6LA 3AMAA 2R7IA 3BHTA 4FOCA 4ZS0A 3R7IA 2YIWA 3AMBA 1IEPA 2B1PA 1LPUA 3N51A 4S31A 4D5KA 2I7QA 4BGHA 3B2WA 3C5IA 4CG9A 2QOCA 2UVXA 4RGJA 4ENXA 5FTGA 3FV8A 4A9SA 3P08A 3P5KA 3PWYA 3ELJA 3D0EA 3BE2A 3ZMMA 4MXCA 4DEHA 3PPJA 5A4EA 3GOKA 3BYOA 1ZOGA 3LCSA 4YU2A 4FZFB 4CYJA 4YO6A 2QODA 4FZAB 3ORNA 4BCPA 4AACA 3LJ2A 4PUZA 2JIIA 1UU8A 1MQBA 1M2PA 1Q3WA 3COMA 3UOLA 3VONA 4HVHA 3W1FA 2JDSA 5FWKK 4C61A 5AA9A 2ONLA 3PY1A 4XMOA 3QA0A 3HDNA 4R5YA 4GU6A 4O0VA 3ZXTA 4CLIA 3LXKA 4XS2A 3MV5A 4D2SA 3ETAA 4FV2A 4DGMA 4BCGA 4N70A 3P78A 3KN6A 4QQCA 2HAKA 3GP0A 4AW0A 3VJNA 3QTUA 4IJPA 2ERKA 2AUHA 5D41A 4AFJA 3MPTA 4G9CA 4FK3A 4NFMA 3LXNA 3BL9A 2JDTA 4IAYA 1DAYA 4QMMA 4MK0A 1H0VA 3KCKA 4DEBA 3EYHA 1Y6AA 3FKLA 4WOVA 1OPKA 4U3YA 4C0TA 3R63A 4FTMA 4BBEA 2BHHA 4AWIA 1YI6A 4F7NA 4I21A 2JIVA 3KMMA 1XH7A 4EH2A 4FGRA 2UW7A 1VZOA 2XK6A 1Z5MA 4BDKA 4O2PA 4CQGA 3PPKA 3P1AA 3QQKA 4FTUA 1H1QA 3FC2A 3LQ8A 4HGLA 5FEQA 3R30A 2JDOA 4TYEA 4C57A 1U54B 3FZTA 2ETMA 3D7TB 2OWBA 3KB7A 4LGDA 5CY3A 3OW4A 4CXAA 4OW8A 4BIDA 5L2SA 3V5TA 4BTFA 3JVRA 4QOXA 3TWJA 4DLJA 5BVNA 5DT3A 4EH7A 2QURA 1ZYDA 2OW3A 4XG8A 5EYDA 2JFMA 1YOLA 3IKAA 4P7EA 2Q83A 4MHAA 1MQ4A 2XKEA 2NP8A 4FIIA 4O84A 4FKRA 3BWJA 4JJRA 3S1HA 2VTAA 4ITJA 4PQNA 3DKOA 5AP7A 3F3WA 5LVOA 1WBSA 3DY7A 4BICA 4FKOA 2Q0BA 2Y4IC 3P9JA 4M69A 3H9RA 3OBGA 5CQWA 4USEA 1SNXA 4YTFA 2VTHA 2FUMA 2CPKE 1OITA 4G3GA 4U7ZA 4YURA 2XK3A 5JGDA 2W06A 4FTOA 3ZM9A 4MXXA 4TRLA 1ZYLA 3DTWA 3FUPA 3PP0A 4Q2AA 3UPXA 3NYVA 5FXSA 4DBXA 2XKCA 4EH3A 1A06A 5CU0A 5ETIA 5C4KA 4BYJA 5AEPA 4W9XA 4J52A 5C9CA 4CLJA 4APCA 4C4GA 3FMJA 3V5WA 4HGSA 5E8YA 4FT0A 4DG0E 5A4CA 1DI9A 4MNFA 4DT8A 4EC8A 2BHEA 4RQKA 4XG7A 1QPDA 4WUNA 3GENA 4X3FA 4FEXA 4BWKA 4U42A 3R2YA 5BMMA 5HG7A 2IVUA 4YJOA 1VLRA 4J71A 5F94A 3MTFA 4A9YA 1ZMWA 2REIA 3WBLA 2UVYA 3UOJA 2VTNA 2C3KA 4BI2A 3CY2A 4YJSA 4DGLC 1XJDA 1M2RA 2ZV9A 3OFMA 3COIA 3P23A 3E63A 4O4CA 1J7IA 3HAMA 1GZOA 2BCJA 4IX3A 4ACMA 4E4MA 5DRDA 1HOWA 4I0RA 4JR3A 3KRRA 4QD6A 3FXZA 3R7VA 2UZOA 4PPBA 3OVVA 4AGWA 4EYJA 3UYSA 4D28A 2UW5A 3FLYA 1O6YA 1KE5A 4RVLA 5DFPA 3HA6A 2JFLA 2OK1A 4XX9A 2R3LA 3LFEA 4AT3A 2C6OA 3SGCA 3E62A 5KKRB 1MRUA 4IMYA 3EH9A 4AOJA 2CGVA 4ENYA 2C4GA 1L8TA 2IJMA 3Q2MA 4GJ3A 4CFVA 5EW9A 4AP7A 5HX6A 5EYCA 3Q9XA 2X39A 4RWJA 3SW4A 4Z9LA 3HECA 4RX8A 3TNPC 4LOPA 2VO7A 5CWZA 4OTGA 5L6OA 1Y57A 4U6RA 4X6QC 5CYIA 3EZRA 5GJFA 4ZSJA 4NL0A 2PTKA 2C3JA 5FDPA 2GDOA 3ACJA 4EUTA 5FG8A 3FZOA 4G16A 3HL7A 4M68A 4PL3A 1JSUA 3TXOA 2BKZA 4U40A 4EQMA 3MH1A 3RHXA 3TUCA 3N9XA 4G5JA 1PW2A 3UNJA 4U44A 2B55A 2YDKA 2PZRA 3TZ9A 2QOKA 4WBBB 3R83A 4BC6A 3SHEA 1HCLA 4RJ4A 3TDWA 3ZU7A 2W1FA 4KIKA 3DK3A 4YUQA 1U54A 3ORMA 4YGAA 5IPJA 4NWMA 5LQFA 3FXXA 4KIOA 4HCTA 1ZXEA 4TTHB 1FVVA 1M7NA 4E1ZA 4BBFA 4EI4A 1H4LA 5CI7A 4CKJA 3OXIA 3MGYA 5M4FA 3CTQA 2WFYA 3RCDA 4O7LA 1AQ1A 2O64A 5IA2A 3Q4UA 3KEXA 5EQEA 4FSUA 5HU9A 2HZNA 4I5HA 5I9VA 2X0OA 4DDGA 3NNWA 5KZ0A 3NUNA 2X8EA 2VN9A 3PA4A 3QZIA 3RAIA 4ERWA 4RLKA 3MYGA 4FUXA 5HNGA 3GC9A 4BDGA 4IC8A 4I0SA 4V0GA 3ZH8A 4N6YA 2X2MA 3BU3A 3C5UA 4K77A 2WIPA 4YBJA 4C62A 2CNQA 5TR6A 2XK8A 3C4XA 3H9OA 3JY9A 3PUPA 4KINA 4EOQA 2OSCA 4ZS4A 3IDBA 3D9VA 3DJ5A 4H1MA 4LRKA 3IK3A 5JKGA 4XRJA 4DFNA 2FB8A 3TMOA 4QYHA 3A7GA 2XK7A 2XNPA 2GHGA 1YQJA 2WPAA 4K1BA 3QQUA 2BRMA 1URWA 2YITA 4BCHA 2XNGA 3Q96A 4C4HA 4QTEA 5C1QB 2PYWA 4EONA 3NR9A 4F09A 2E9UA 4IVCA 3WF6A 1M52A 2PVNA 4IBMA 4BTJA 5GINE 3QQFA 4LDTA 3GFEA 3DXPA 3ORPA 4QMWA 5A6OA 4IB1A 5IQIA 4BI0A 3MA3A 4LL0A 5CT7A 4Z16A 3HP2A 3BBTB 3CPBA 4HW7A 4QYYA 1CKIA 4G6NA 4E7WA 4O21A 2C0OA 2R3QA 1W83A 2QI8A 3QHWA 4IB3A 4C33A 1PXNA 2OICA 4R3PA 4R5SA 1KE7A 1R0EA 3KF7A 4ZEGA 4C58A 2WMVA 1YHVA 1BI8A 3ZBFA 4DFLA 1XMMA 4GK4A 4HPTE 5KO1A 3ZLWA 3UYTA 3SLSA 2F2CB 3OEZA 3WF5A 4GW8A 3Q4CA 4FKLA 4GRBA 3HMPA 4TYJA 3IG7A 3GT8A 1FMOE 2X9EA 4ZJJA 5GZ8A 4QP4A 5AP3A 2ZV8A 4LMUA 4OTFA 2XEZA 3I5NA 1OIUA 4RIXA 5F1ZA 3TT0A 4BCOA 5JQ8A 3PRIA 3R2BA 2JKKA 2G2HA 2OJIA 3CKWA 3LQ3A 4L46A 3VS1A 4C4EA 4DYMA 4MXAA 2C6EA 3QZHA 2VD5A 2VO6A 1UU9A 4FT5A 3T9IA 4LMNA 4MD9E 2WQEA 1OKVA 4OTHA 3ZM4A 4GFMA 4AF3A 2DWBA 4G31A 4TL0A 3BYVA 4CCBA 5L3AA 5AV2A 5CAOA 3A2CA 4HVDA 4CV9A 2BPMA 3GU6A 3IGGA 2WTDA 5AM7A 3R8PA 2VNWA 3DTCA 3QD4A 4AW1A 4MYGA 5CI6A 4BCNA 3BI6A 4Y8DA 1GIHA 5HORA 1XH6A 4CMOA 4UYNA 5A4QA 4RJ6A 3KULB 2I1MA 3EFKA 3RZFA 2QC6A 3QTXA 4RIWB 3OWPA 5E8WA 1ZARA