3IW4A

Crystal structure of pkc alpha in complex with nvp-aeb071
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
339
structure length
330
Chain Sequence
LDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTREFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVFDKFFTRGQPVLPPDQLVIANIDQSDFEGFYVNPQFVHPILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of 3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]pyrrole-2,5-dione (AEB071), a potent and selective inhibitor of protein kinase C isotypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C alpha type
total genus 86
structure length 330
sequence length 339
chains with identical sequence B, C
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iw4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iw4A01
4QMVA 5BVDA 4XBUA 3BZ3A 4G6OA 4P5ZA 4XOZA 2B0QA 4J98A 1ND4A 3AGMA 5BUEA 1ZOHA 1OITA 2C3KA 4FTTA 5TT7A 3G2FA 3F6XA 4FTJA 1G5SA 4FEUA 4YZNA 2J0LA 5H3QA 2OZAA 5CSVA 3TV6A 1MUOA 4R7BA 1OPLA 4V01A 4AW0A 4FZAB 4JS8A 3NW6A 4M97A 3QLGA 4RFYA 3HVCA 3EQIA 4RRVA 4DEDA 2QHMA 3TEIA 2W1CA 4TWCA 5HU3A 5CVFA 5IDNA 4AZTA 2GCDA 2JDTA 1YXXA 2JLDA 2NP8A 4EUUA 4PP7A 3DKFA 5HICA 4EOPA 3V51A 1APME 2WO6A 2X81A 3R04A 4TNDA 5D1JA 5A3XA 1PYXA 5AA9A 4U6RA 4EHVA 4OR5A 5AUXA 4AW5A 5FEEA 1OGUA 1S9JA 4PDOA 5KMJA 4LV5A 5CAVA 3LFNA 4L6QA 3DZQA 2XNOA 2OF4A 4WOVA 2XRUA 5CENA 3FZ1A 1J7IA 2GPHA 4EOQA 2VTLA 4J8MA 5AA8A 5AR4A 2IN6A 2E9VA 5GIPE 3G33A 3FY2A 4MWIA 3BU5A 4R3PA 4DGGA 3CY2A 3KRWA 5LVNA 2Z2WA 4I1ZA 5AV2A 1R39A 3FMEA 3TTIA 1GNGA 2VWUA 5DVRA 2BDWA 4OUCA 3FLYA 1BUHA 4HYHA 4AOTA 4FTMA 4WRSA 1ZRZA 2FUMA 1R1WA 2Z7QA 3DY7A 3FI2A 3EQPA 3PSCA 4IE9A 5E90A 3HV5A 3A7JA 4Q5HA 4PPAA 3SRVA 4ZLYA 4RZWA 4YBKA 4H39A 3LPBA 4K9YA 3QKMA 5HVYA 3ZHPC 3WZEA 3OS3A 3P4KA 3E8DA 3DKOA 4O22A 3Q4CA 3D7TA 1I44A 4IH8A 3V5PA 3L9MA 3DA6A 5CAPA 5B2MA 5BYYA 5HG7A 3NVKI 2F49A 2OXDA 5J1VA 3EH9A 4E5AX 2FSOX 4TWPA 1Q3DA 2GS7A 3VC4A 2ITVA 3NYVA 5JQ8A 5LVPA 3POOA 4WHZA 2W7XA 4GH2A 3HUCA 5DPVA 4EH3A 2NNWB 3V5JA 4PMPA 1AGWA 4HVHA 4O1PA 5JFWA 2ZOQA 4O6EA 3PXYA 3UNZA 3NUXA 3OXTA 1H1WA 3ZO3A 4BYJA 3G6HA 5EI6A 2GNFA 4XP2A 2WGJA 4JDKA 4S31A 3NIEA 4ZSEA 3ZTXA 5IDPA 2DS1A 1CKIA 1YXSA 4P7EA 4XP3A 3DTWA 5ANGA 3CGFA 1WAKA 3P08A 4IX6A 1FVVA 1OL5A 4OAUC 3HAMA 4UX9A 3BU6A 2IWIA 3D83A 1BMKA 5IA3A 4OBOA 3NIZA 2WAJA 4PV0A 4UXQA 3IS5A 3W8LA 3CD3A 5HX6A 1H1QA 5HO8A 5HD4A 4RWLA 3D15A 4E4NA 5FRIA 5CT0A 1QPJA 3MH3A 4XG3A 2Q0NA 1H0VA 2IVVA 3QHWA 3FMHA 2WOUA 3HV6A 1PXLA 3OBJA 4ZIMA 4DFXE 1Q61A 4JQ7A 1XWSA 5AR7A 3VHKA 4EORA 3VBYA 5BVEA 4OTPA 3V5TA 2WKMA 2PUPA 3NNWA 5L8KA 1PXMA 4QPMA 2QC6A 4BDEA 2YERA 4O84A 4XV2A 5K0XA 3LFBA 5E8SA 3U55A 4V0GB 4D4RA 3FC2A 3WF9A 1P4FA 2PUUA 3OY3A 5KBRA 3R0TA 2GFCA 4FIGA 4FODA 4EH7A 4YZDA 3R9RA 1STCE 2BKZA 3I6WA 4X2NA 3KFAA 2CGVA 4ZMFA 2Z60A 4A9SA 1YI4A 4I5MA 3EFWA 2YLEA 3FZRA 2Y8OA 2X2KA 5CNOA 4ZP5A 5AM7A 2CKPA 4CFVA 2CGWA 3TG1A 2QHNA 5DIAA 3NX8A 4RQVA 3U6IA 3HMMA 3P23A 5E8UA 1WBNA 5L3AA 2AUHA 2XBJA 1M17A 3A7HA 4A4OA 3CR0A 4EHEA 3GCQA 3BEGA 3OWLA 4E8AA 3LMGA 1YI3A 1Q62A 2VTTA 3NNXA 3TKUA 3JPVA 4F6SA 2V5QA 1RJBA 4IX4A 4RA4A 4Y85A 3ROCA 5CY3A 4M12A 4L00A 4LRKA 2BAQA 2XKFA 2X7OA 4W9WA 5IUIA 2I0EA 3OWJA 4XS2A 2VWYA 2WTCA 2CNVA 4U3YA 4ZJIA 4S30A 3R2BA 4UMQA 4ARKA 4GYGA 3UOJA 2FSLX 4BI1A 3JR1A 4AGUA 2BRNA 2V22A 3NGAA 1V0PA 4FT5A 2JKKA 3F5XA 5DNRA 4C35A 4KNBA 3DJ7A 5GZAA 4Y72A 3KRRA 4JL9A 2LGCA 5AMNA 2ITTA 4QNYA 4WNOA 3TWJA 4XG6A 3UZRA 4ZLOA 5LXMA 3PJ1A 3CTHA 4OT5A 3RHXA 3PUPA 3EQDA 2C0TA 1PW2A 4GFOA 2YIYA 1KUTA 3NUUA 5EQEA 4C4EA 4X2JA 2HWPA 3C9WA 4DH5A 3FEGA 3PDTA 3QQHA 3A7IA 4MYGA 3ZDUA 2PMIA 2QKWB 1IAJA 3OBGA 1WBOA 1WFCA 2HK5A 3VS0A 3MY1A 2EUFB 4R8QA 5DOSA 5GJDA 4BGGA 2Q83A 4CG8A 1QPEA 4QP2A 5CSHA 4AG8A 5FEDA 2ITUA 3ZSIA 3RHKA 3WYYA 4EH9A 5DEWA 1DM2A 4NYEA 3HUBA 4RIWA 4NW5A 1ZYCA 5I9ZA 2C0OA 2VWZA 3V6RA 3BQCA 4NU1A 2B54A 5EI2A 3MB7A 4O7NA 2UZLA 4DLJA 2V55A 4PTEA 3VJOA 3CEKA 3PA3A 2ITNA 2YDJA 3AMBA 3HMIA 3LE6A 4J1RA 4C0TA 5IA0A 2REIA 1FMKA 3DAKA 1FVRA 4FK3A 4OBQA 5LMKC 4TY1A 4Y46A 2V62A 4D1XA 2Y4IB 3IPHA 4XX9A 2ERZE 1BYGA 5A9UA 2OXXA 2ETRA 3BYSA 2J5FA 2WELA 4LUDA 2CKEA 4O6LA 5CLPA 4JIKA 3BYUA 4RLLA 3MVLA 2ZJWA 4CRSA 3FYJX 4QYYA 3VS5A 2FB8A 3FWQA 5ANIA 4Y5QA 4CQGA 3R8VA 5TF9A 3GP0A 3MTLA 3BCEA 4K8AA 3BLHA 2QLQA 2OZOA 3RPSA 5M53A 3QQKA 2OICA 2UW6A 3LXPA 3P78A 4K11A 2QKRA 4B0GA 2WMQA 5M06A 4CNHA 5AUVA 4YJQA 3UOLA 4WA9A 2ZM4A 2C6MA 1LP4A 1NXKA 4F7NA 1YHWA 4RX8A 5F95A 4ZLZA 3HMOA 3BWJA 4KA3A 3ZSHA 3WOWA 4G1WA 3R8PA 5HX8A 4IADA 5AM6A 4BDCA 5FBNC 4DFUA 3RBWA 3SVVA 2I40A 2WU6A 3RPOA 4APCA 3O2MA 2R64A 3KA0A 3GENA 4FNWA 2UVZA 2PMOX 1YHVA 3BEAA 4EOKA 4PDYA 3NNUA 3REPA 3D5XA 2B9IA 3EL8A 3IG7A 3NNVA 2EXMA 4PTGA 4R3RA 5E1EA 2J5EA 1NW1A 3COKA 2ESMA 4YC6A 3E7VA 3BELA 3MJ1A 3AT4A 4L45A 5K0KA 5EKOA 1HCKA 3WF6A 4BTKA 3RK7A 5HBEA 2PZIA 1ZY5A 1GJOA 4RZVA 3QD4A 1IR3A 3LM5A 4FSUA 3I79A 2BDFA 3CLYA 4YJUA 5FM3A 3R02A 3F88A 5KMLA 3C1XA 2IVUA 2XK4A 2PU8A 4DH8A 5CWZA 2NRUA 1PXOA 1R0PA 2WB8A 3ZXZA 4QNAA 3MVJA 3C4WA 3QQFA 3V5LA 4BRXA 5D9HA 4CV8A 3QTSA 4MD7E 4HPTE 3AT3A 3PXZA 2F57A 2OXYA 4BDDA 3ULZA 3QUPA 2X9FA 3R1NA 3SW7A 3KRJA 4EC8A 3IW7A 1NVQA 3ORMA 5CQWA 2OZAB 5CEIA 2YITA 5EW9A 2XF0A 4QPSA 5E91A 5LOHA 3F2NA 3F5GA 4FIEA 4Y8DA 1LUFA 2UZUE 4R1VA 3ZUUA 4QYFA 3ORPA 4DH3A 1H28A 4L3LA 3T3VA 2YCFA 1CMKE 2VTRA 1P14A 2RFSA 2UW3A 3F2AA 1KE7A 3AC8A 3AXWA 2BRHA 1H27A 3KMMA 3MW1A 3VS4A 4FE2A 4G6LA 4KKHA 4QD6A 4ZZOA 1W0XC 2QO9A 1A9UA 3GCSA 2JIUA 3LW0A 4QMXA 4EOIA 1Q8WA 5AV1A 3PP0A 4H36A 4LQMA 2OI4X 5AR5A 3ZU7A 3QX4A 2BKKA 2VTQA 1O6LA 4GCJA 3HDNA 3KN5A 2ZV7A 3MH1A 3DB6A 3QUDA 2UVYA 5J79A 2WMBA 3FDNA 1CM8A 4BCHA 4JBPA 4I23A 1KE6A 3LHJA 5AAEA 4Q5EA 3AG9A 5L6OA 3KULB 2BIKB 4NFNA 4U3ZA 4CT1A 3WZKA 1U5QA 5DRDA 5CXZA 1M2RA 5AV0A 5ACKA 3VUDA 3C4EA 5JH6A 4KD1A 2BHEA 1PXKA 2HOGA 4FT7A 3EFLA 5HNBA 5L8JA 3H9FA 4DEEA 4OLIA 3QC9A 5DFPA 4B8MA 4DFZE 1K3AA 3V01A 5HQ0A 4YJTA 3ERKA 2JBPA 4Z9LA 3THBA 4APPA 3QD0A 1YOMA 1PKGA 2BZIB 2YM6A 3U87A 3PVBA 5T6KA 3R7YA 3UMWA 5IQCA 4YLKA 4AE9A 4XG9A 5I5ZA 5CVHA 3IOKA 4J53A 4ZY5A 5E8VA 5DT4A 3D0EA 4CKRA 5JK3A 4OTFA 3A62A 2XNNA 5AUWA 2BZKB 3DBQA 4OTRA 4YO4A 3NEWA 4W9XA 3CE3A 3HA8A 4ZY6A 1G8SA 5GIOE 1ZYJA 4G3DA 4QMZA 2BFYA 5L2TA 2YIXA 2VNWA 5AP2A 3F7WA 1ZWSA 4FTUA 2WIPA 2GNHA 3DBDA 4UV0A 3VRYA 2PVMA 4IC8A 4R3CA 4RVTA 5HVJA 1XBCA 3EQFA 2WPAA 3FL5A 3DBEA 4FOCA 4KB8A 4GW8A 4UYNA 4H3BA 2YDIA 4FYOA 1GIHA 4IVDA 1FGIA 3UO6A 3OOMA 4HGTA 3HL7A 4IANA 4XG8A 5CU6A 5ETFA 3VQUA 4NM5A 1Q8ZA 2R3GA 3P0MA 4R7IA 1J3HA 2KULA 2CJMA 5HCYA 3ZLWA 2B9HA 3ORTA 4N6YA 4UMRA 4XEYA 1OB3A 2I0VA 3BHUA 1DS5A 4G34A 5HE3A 4BCPA 4IVCA 4BZDA 1NVSA 4L52A 1IG1A 3PIZA 3OUKA 4DTBA 4NL0A 4EYJA 3N9XA 4I6BA 3W2QA 3ZH8A 5H9BA 4AZEA 4UB7A 3W2SA 3BX5A 5I9UA 3VS6A 2VTNA 5LMAA 1SMHA 5AUZA 1Y8GA 4CVAA 3KXGA 4FV3A 3C50A 3OCBA 1OPJA 4E73A 3MFSA 1L3RE 4RJ6A 3LLAA 4BF2A 2ZMDA 2QOOA 2VTPA 2J9MA 3FAAA 3QD3A 5BYLA 3WIGA 5E8ZA 4JXFA 4R78A 3ORKA 2G2FA 3LFFA 4EL9A 4L7SA 5FXSA 2BCJA 4F09A 1VYWA 3R7OA 1LPUA 5DG5A 1XH4A 3OY1A 4EOLA 4GU6A 1PMVA 4FA2A 3HZTA 5J5TA 3RNIA 3HMNA 3FQEA 3NW7A 4HYSA 4QMOA 5DR6A 3F7ZA 4IB0A 4ASDA 5AEPA 3MN3A 3QZFA 4AE6A 4FVRA 3TI1A 1XBBA 4LV8A 4GJ2A 1UKIA 2WMRA 5GJFA 5L2SA 4TYIA 4I0SA 4X2FA 4N0SA 4CV9A 3UE4A 4GT4A 3R1YA 4QOXA 5AR2A 3F3UA 4C02A 5AP3A 2YZAA 2Z7SA 4PF4A 2CN5A 3ELJA 1V0BA 4U0IA 3D5WA 4S34A 3LCKA 5AR8A 1BLXA 3PTGA 4BKYA 2YFXA 4J97A 4DTKA 3T9IA 4WG5A 4XUFA 3RM7A 4PL3A 4C38A 4II5A 3EN9A 2W4OA 4GFMA 2OJGA 3OT8A 4TNBA 5CSWA 4XNEA 3NUYA 5E7RA 1OBGA 3OC1A 5L8LA 2UW9A 3W2OA 2R3KA 4FKJA 5E4HA 4A9TA 3M1SA 4D1ZA 1Y6BA 1VEBA 4TZRA 1MRVA 3QCXA 3F69A 4CFXA 3LFDA 3PJ3A 3CJGA 2ITOA 4HCTA 3SHEA 4OTIA 2PY3A 4JDJA 2IVTA 2J50A 2X7GA 4O0XA 1XH5A 2X39A 3BBWA 4RVLA 2BAJA 1YWRA 3Q9YA 3KRXA 2J0IA 4JLCA 4CLJA 1H01A 4FKLA 4WSQA 1J7LA 5EQYA 2BVAA 3AC5A 5AP5A 1WMKA 1OMWA 3R6XA 1TKIA 1WZYA 3QC4A 3C4CA 2W1IA 3F3WA 1YKRA 3NSZA 2PL0A 4PMMA 5AV3A 5HTBA 4IAIA 4D4YA 4EH5A 3KVXA 2Y4IC 3F82A 2YJRA 4QMLA 3IK3A 4O82A 5EW3A 2UZEA 3ZYAA 5EYCA 1GAGA 4BTFA 3O96A 4FV4A 1UNHA 2QOBA 3I60A 1UKHA 3W10A 3F3VA 5EM7A 2C6OA 3DB8A 1JSVA 5C8NA 4GV1A 4F9CA 2BILB 3EB0A 3Q6WA 5D10A 3T8OA 5T68A 2PZ5A 3EHAA 2YM5A 4BWXA 1PMUA 2VTHA 3H9OA 4AAAA 4FNXA 3GCUA 1UU8A 2FSTX 2ITQA 4BTMA 4ZMEA 2PMNX 5HGIA 3Q4TA 4FT9A 3RAHA 4BCJA 3H30A 3QZGA 3HDMA 3QWJA 4QYGA 2VV9A 3LFQA 4XOYA 1R3CA 2UZOA 2KTYA 2XEZA 4E4MA 4E6AA 3AMYA 4DGOA 4YNEA 3MA3A 3RPVA 3WZJA 3VS1A 3TV7A 2C5YA 2JD5A 3OG7A 4L9IA 2OH0E 4ZSLA 4DEHA 1KV1A 2XP2A 3TACA 4C3PA 4DC2A 4R77A 4FZ6A 4TWNA 5J8IA 1S9IA 5F1ZA 2BFXA 4F7LA 3ANQA 3QYZA 1ZARA 5DN3A 4IQ6A 4FEXA 1R0EA 2YAAA 4QMUA 5DR9A 4EWQA 3ZONA 4YTFA 3RWPA 3R8ZA 2YCRA 5F9EA 4F9AA 4WG3A 3RI1A 4BCFA 1HCLA 4EQMA 4JBQA 3TUDA 2ZYBA 1LEWA 4O0YA 5J5SA 2Y9QA 3G15A 3UGCA 4IWQA 3R7UA 5IUGA 2XYNA 1OVEA 2G2IA 4M0ZA 4YO6A 4DGNA 2J0KA 4D4VA 2VRXA 2X6DA 4Q9ZA 3TKIA 4D28A 3LFAA 4U43A 4IB3A 1ZZ2A 3SXSA 4F70A 4ZJVA 2XNMA 3CSVA 4QYEA 5HNIX 3FBVA 1IA9A 1URCA 3GCPA 4BDAA 2QVSE 4I21A 4CCBA 1ZY4A 2BZJA 2C30A 4GK4A 2RSVA 3R7GA 3ZLSA 4DITA 3PY3A 3I6UA 2XNPA 2F7ZE 5HESA 4D55A 4GKHA 4A4LA 2B9JA 4YJNA 2WNTA 3V8TA 3LIJA 4IEBA 2RGPA 3QTIA 3VW8A 4O91A 2OO8X 1Q8UA 4DLIA 2B52A 2R3MA 3QZIA 4FSWA 5KX8A 4X6RA 2X2LA 3HV3A 4WBOA 4U5JA 4IW0A 1E9HA 2O8YA 3PPKA 3W32A 5EYDA 5IQFA 3TL8A 1XHAA 2CDZA 4YHJA 4FKTA 4FSZA 5M51A 2WTIA 3DLSA 4J96A 2BDJA 2BZHB 3MVMA 2ONLA 3O51A 3ZFYA 4M69B 2IZUA 4WUAA 4CFFA 4H05A 2JKQA 2WQMA 4E26A 2C6TA 3FLWA 4J8NA 2R3HA 1ZYDA 2XIZA 3G0EA 5IEXA 3A8WA 3M42A 4QTCA 3RCJA 3ZXTA 3ANRA 3CQWA 3PSBA 1NT2A 5BVFA 5AP7A 4E6CA 5J87A 5CT7A 4IAKA 3HRFA 4S2ZA 4D9TA 2OJIA 3NWWA 2AYPA 2R3RA 3CTQA 4G3EA 4F65A 5J1WA 3FLQA 3OCTA 5FEQA 1O6KA 2QLUA 4XHKB 4I0RA 4FZ7A 2VTSA 2GSFA 5I3RA 4XV3A 2F7XE 3OUNB 2F2UA 3P7BA 2EXCX 5ETIA 4BB4A 4C37A 2C1AA 2Y6OA 5AP1A 3RK9A 4NCTA 4EQUA 4A06A 2OWBA 4BZNA 3QKKA 4B7TA 5T3QA 3R7IA 1T45A 3C4FA 2WQNA 3LCDA 3PWDA 4L3JA 4FG7A 4GU9A 3E63A 2FA2A 3MPTA 5G1XA 5I9WA 2PVHA 3C4XA 3PVGA 1SNXA 1SZMA 4ORKA 3G6GA 3VBVA 2I6LA 3C0IA 4IZ7A 2W9FB 3MTFA 4IMYA 2VO0A 4KIKB 3QWKA 2OFUA 1RQQA 5KCVA 4XV9A 2JEDA 1GIJA 2JDVA 4O0WA 4EUTA 4N57A 4BBMA 2R9SA 4W4YA 2QNJA 4MX9A 3UG2A 5CQUA 3FPMA 4CMTA 2GHGA 2C5OA 2O65A 2UVXA 4QMSA 4J7BA 5HG5A 3F61A 4AZVA 5IQGA 1JLUE 3OXIA 5AP0A 2JKOA 4BGQA 2YA9A 3ORLA 2PYWA 2BHHA 5F20A 4E5WA 2C6DA 2IZTA 3BGZA 4D2VA 4KUJA 4MNFA 4O2PA 5CF8A 3QD2B 2CNQA 4LRMA 4KKGA 1MRYA 5A4TA 3BQRA 3NAXA 4YPSA 4EH2A 2JGZA 3EOCA 5TO8A 4BWKA 3GQIA 5FQDC 4ENXA 3DKGA 3DXNA 1Q5KA 3MV5A 3HMPA 3ORZA 3TJDA 3MJ2A 2Z7LA 2CLQA 4C4HA 1YWNA 4TTHB 1OL2A 4UN0C 2H8HA 3ROYA 4YJVA 1OECA 3FSFA 3QUEA 3K2LA 4F6UA 1ZMVA 3QL8A 4K1BA 1PRYA 4O7YA 2ITXA 5FTGA 1JOWB 4FIHA 2YZLA 3MFTA 1H1PA 3A7GA 3A2CA 4RC2A 4YLJA 3PE2A 5KKRB 3GNIB 4OTGA 4QT1A 3TUCA 4EHZA 4EKLA 1BI8A 2VWXA 3EJ1A 5EDQA 3ZC6A 2HZNA 3O7LB 4IVBA 4G5PA 5C01A 1CDKA 2R7IA 3PIYA 5ANKA 3VW6A 3GU5A 4FC0A 3TNIA 2GNIA 4NJDA 3SKCA 1KWPA 4C4JA 5DE2A 4IIRA 2WQBA 3Q60A 4EBWA 3DFCB 3QALE 1JBPE 3PXQA 3Q04A 2XJ0A 3LAUA 3R1QA 4H58A 4ITHA 4OTHA 3MS9A 4U7ZA 4YMJA 1U46A 2GNGA 4U40A 4CCUA 2Z8CA 1X8BA 4EK3A 1PY5A 3IO7A 2GNLA 2JC6A 2XH5A 2XK8A 4PUZA 5CI6A 4ANLA 4EHGA 3RGFA 4JAIA 5C4LA 1Q99A 4FNZA 1YXUA 5M57A 4BBEA 2PE1A 5EYMA 4USDA 4ZOGA 4CFUA 5CF5A 4IM3A 2ZAZA 2WTDA 3NYOA 4FVPA 4JG8A 5JKGA 3GU4A 5KMOA 1VR2A 3LQ5A 3IGOA 4NWMA 4IZ5A 2CCIA 3HV4A 4O7ZA 1BKXA 3UIXA 2IW9A 3OZ6A 3W2CA 5JMSA 1P4OA 4FEVA 4GK2A 4PNIA 3ZFXA 4WNPA 2CKQA 4D5KA 1FOTA 5EH0A 4HOKA 3K54A 3WF7A 3W16A 3CKXA 5CF6A 3C0HA 3SLSA 4F0IA 5IEYA 5E9EA 4RSSA 2GTNA 3IDBA 2ERKA 1T46A 4GUBA 5CU0A 1FGKA 4RWJA 4YGAA 4YJOA 4LMNA 4FICA 2WZJA 4ALWA 4JAJA 5TKDA 4KSQA 5CYIA 4F99A 5IQAA 4RIYA 3R00A 4ZEGA 3FI3A 2J90A 4BCGA 1JVPP 3CY3A 3DT1A 4U42A 3ORXA 4QQ5A 3V3VA 1YDRE 2PVFA 3RMFA 4GRBA 3Q4ZA 5M4IA 3WE4A 4XCUA 1REKA 1OPKA 2EU9A 5TOZA 4F9WA 5JSMA 1XH7A 5FXRA 5IKWA 2GU8A 2F9GA 4IWOA 4RJ5A 4MVFA 4LL0A 3TJCA 5CX9A 4IWPA 3MPMA 5CU2A 4JDHA 3PY0A 4DEBA 1WBVA 4F1TA 2A2AA 5FGKA 4Z55A 5AADA 3R71A 1TQMA 3BI6A 3MPAA 2PULA 4IX3A 3AC4A 2WQEA 4EOSA 4DEIA 4QMTA 1DI8A 4NZWB 4YJPA 2WD1A 3KRLA 4NTTA 5E8TA 4ASEA 5I9VA 3LLTA 3BYVA 5BYZA 3ZRMA 3DS6A 5AX3A 5KUPA 4MXOA 4TKSA 4WSYA 5AAFA 1OUYA 5AUUA 1ZMWA 3IW6A 4IJPA 2QOHA 2EVAA 3EQRA 3BWFA 2CGUA 4KKEA 4I92A 1ZXEA 3GC0A 3GFWA 4DEGA 2XYUA 3FY0A 3DCVA 1F0QA 2C4GA 1SNUA 1FPUA 2XIKA 3FMNA 4QP8A 4XV1A 2RFEA 1CTPE 4ANOA 4MBJA 4FSRA 5HLWA 4F0GA 3RKBA 3U4UA 3LXNA 4FUXA 2RFNA 2JFMA 4YNOA 4RWKA 5L4QA 3O71A 5FDPA 3TDWA 3KXZA 4G6NA 1G3NA 3BE9A 3ZZEA 3BKBA 2UZBA 4ZY4A 3UDBA 2DWBA 3Q9ZA 3UTOA 1W83A 3FMLA 4MBLA 3S0OA 2HZ0A 4BI0A 2C1BA 4LI5A 2XKEA 5IEVA 4MNEB 3ZRKA 3TCPA 1QCFA 4CZYB 4D5HA 3JY9A 4DE4A 4FZFB 2E9PA 5KMIA 4EK5A 1YWVA 3FQSA 1P2AA 4L7FA 4EH4A 3O8UA 4I0TA 4X3JA 3GC7A 4FTQA 3LM0A 4MHAA 4QP7A 4KABA 3FUPA 2ZDTA 3TTJA 3C13A 3PPJA 5H8EA 4GMYA 5EG3A 3MFRA 4WIHA 5EI8A 4YU2A 4X2GA 4JBOA 3W18A 2GHMA 1FBNA 5DT3A 3LFSA 4FKRA 3PZHA 3U9CA 3RPRA 5A6OA 5I0BA 2VX1A 3TUBA 4QTAA 5E8WA 1CKPA 4PMTA 2X1NA 3VF9A 4P5QA 1WVWA 3W33A 1Q4LA 3UBDA 2G15A 3UMXA 4EH6A 3UG1A 4DCAA 1YRPA 2ZB0A 4GIHA 5K9IA 3UO5A 3R28A 5ITAA 2VU3A 3OOGA 3EKKA 4FIIA 3JVSA 3PWYA 1PXJA 4RJ8A 4KBKA 3Q2JA 4MAOA 4AWIA 1OIUA 1XKKA 2OSCA 3SXFA 2IW6A 3KF4A 3PIXA 1MP8A 4AGCA 4BDFA 4D58A 2IZRA 2R4BA 2PSQA 2BIYA 2X4FA 2YACA 1XH8A 2YWPA 3B2WA 4JG6A 4LM5A 3EFKA 3UJGA 3UVRA 3FHRA 2Y7JA 2YISA 3VS3A 4CZTA 4EK4A 2XVDA 1MRUA 3HGKA 4JR3A 4NW6A 2YAKA 4S32A 5I9XA 4JJRA 2WTKB 3DFAA 5ETAA 5CAOA 2CPKE 4EK8A 4DG2E 3DJ5A 4O0RA 4O81A 4CG9A 4CMOA 1OZ1A 3QTXA 5IPJA 3O17A 5BPYA 4FIJA 3ZCLA 4MF0A 3BYOA 4TYEA 3W55A 4GFGA 5D7AA 5HO7A 1XR1A 2C6IA 3BGQA 2QOIA 3VN9A 4FSMA 2FGIA 3D5VA 4RMZA 4XRLA 2PE0A 1M14A 4L3PA 1JKTA 2HY0A 5IMXA 2QOCA 5ETCA 5IA2A 2VWVA 3QTUA 3VUGA 3D7ZA 4E93A 3UNJA 3JXWA 3VO3A 3PP1A 3E88A 4FVQA 2BAKA 4BY9E 3JS2A 3QXOA 5DHJA 3EN7A 5HBJA 2R3OA 1SM2A 1XH9A 2YM4A 4LL5A 4D1SA 3MY5A 2C47A 4TYGA 1PXIA 5HVKA 2BRMA 4XG7A 3EL7A 1WBTA 3QZHA 1B38A 4LMUA 5LCJA 4GEOA 3OWPA 5EW8A 5FWKK 4CKJA 4BDBA 2JITA 3A61A 3P86A 2ZV9A 4YLLA 3AT2A 1ZZLA 2ETMA 1L8TA 4YUQA 4I5HA 3HP5A 4HYIA 3BYMA 1UNGA 4W8DA 3PVWA 2VO6A 2DUVA 2VTIA 4KINA 5FTQA 3QAME 3UNKA 4I22A 4F7SA 4L68A 2YCQA 3PSDA 4GK3A 5CASA 4XLIA 5KHWA 4FKQA 3W8QA 3EZRA 1ZAOA 2HZ4A 2QU6A 3L9LA 4FTRA 4ALUA 4KIKA 4E4XA 1IA8A 3ZZWA 2BMCA 3BIZA 3FHIA 5LVOA 3ZM9A 2XIXA 4RVMA 4HVIA 4OTQA 4BKZA 3GCVA 4I3ZA 4MD9E 4NUSA 5FM2A 4DEAA 1J7UA 5IH4A 4AXAA 4QMMA 5HTIA 2E9NA 2P2HA 1IEPA 1Q8TA 3SQQA 4IX5A 3ORIA 4ERWA 4WO5A 3CQEA 4JX3A 3RP9A 1QPCA 2YIWA 2O3PA 3ZS5A 1UU3A 5CEQA 4ZSAA 2OBJA 3KVWA 1KE8A 4MF1A 5K4JA 4RC3A 5M44A 3ZO1A 4BCMA 4NM7A 1OL1A 1W82A 4TXCA 1J91A 4EQCA 4NT4A 4NJ3A 2I1MA 3DQXA 2A19B 4HW7A 5IH6A 3KXHA 1UA2A 3AGLA 2W5HA 4FKOA 5CZIA 4M67A 3L8PA 4PPBA 5K3YA 2UW5A 3P9JA 4I93A 2RF9A 4MXZA 4HCVA 2IW8A 4Y73A 1OIRA 4FTAA 3R9NA 2YDKA 1H0WA 1KOBA 2WQOA 3II5A 3QQJA 4HGEA 2GS6A 3GU6A 3DNEA 5AUYA 3RJCA 1QMZA 2W1FA 3FLNC 4CYJA 4Z7GA 4YJRA 2W4JA 5M4FA 4FV8A 5GZ9A 4EONA 4Z7HA 1OIQA 2QD9A 3COMA 3EKNA 5EYKA 3RM6A 4B9DA 3UQFA 3G0FA 5CF4A 2AC3A 4I6QA 1OKZA 2QR8A 4WKQA 5EM6A 5H8GA 5HLNA 2H34A 3EYGA 4QO9A 2IG7A 4PL4A 4UWCA 3PJCA 2C6EA 5C03A 1QL6A 3AD4A 3ZLYA 2R0UA 5LMKA 4JNWA 4ACDA 5JRSA 4EOOA 5I9YA 4WT6A 3NUSA 3S00A 2A0CX 5CAQA 4C2WA 2I7QA 3OHTA 3QCYA 4RFMA 3VUMA 2HW7A 4AFJA 3HEGA 4AU8A 4BKJA 5CXHA 1OL6A 5EKNA 3VVHA 4RBLA 3V5QA 2O2UA 2ZM1A 2EWAA 2HAKA 4GG7A 4DYMA 3HRBA 5CI7A 3D4QA 1K2PA 2BR1A 2ZDUA 3U8WA 2HXQA 1W98A 2OH4A 2CGXA 4FV5A 3NPCA 4RX7A 2XJ1A 4BCQA 4NFMA 5HORA 1H00A 3ZLXA 4HVDA 4KWPA 5CS6A 5LJJA 2OJJA 3QRTA 3NMUF 2ZMCA 3PA5A 4ANNA 4B6LA 3DBCA 4G31A 1SVEA 4D2WA 2OFVA 4PY1A 5A4CA 4EWHA 4O7SA 3IONA 3Q96A 4RIYB 5HBHA 3UIBA 2VO3A 5IA4A 1Z9XA 4I4EA 3FJQE 4PP9A 3TN8A 2WEIA 3G9LX 2VX0A 2X2MA 3FLZA 4IFGA 2OJFE 2XUUA 5BNJA 3ODYX 2VD5A 1YOJA 4AX8A 2OK1A 5E8YA 1FINA 4L53A 1OIYA 4U80A 5EM5A 5K4IA 4I4FA 4I6HA 4CKIA 2QR7A 1CSNA 4LRJA 4MWHA 4NTSA 1ZYLA 4FK6A 2W17A 2VWBA 4WUNA 4X3FC 5AIRA 3RPYA 2CKOA 1YXTA 2ITZA 4M84A 3AMAA 4L46A 4E7WA 4BGHA 4CGAA 3VHEA 5CVGA 2FH9A 1ZOGA 2CN8A 4CQEA 5C1QB 4ASXA 4E20A 3KCFA 1B6CB 3PG1A 2FSMX 3QTZA 4IBMA 4ZTNA 4ASZA 5IF1A 3UVPA 2OLCA 4G16A 2X8EA 3Q53A 2VTMA 1H4LA 2OIDA 2JKMA 4AZFA 4DFNA 4PMSA 3DQWA 3LJ2A 2B1PA 4I20A 3CPCA 4MXAA 3PXKA 2ZB1A 5CANA 2W96B 3F2RA 2PVRA 2ZVAA 5EHOA 5LQFA 2F4JA 3DXPA 4YBJA 3RAIA 4BWPA 5JGAA 1F3MC 3OEFX 3CTJA 5DMZA 4JRNA 2UZDA 5AP6A 3GFEA 1JKLA 5AJQA 3DZOA 2PTKA 4QMYA 4M0YA 2P2IA 3FMJA 3ZUVA 4BVUA 3K3IA 3H3CA 3CXWA 2NRYA 2XM8A 1TQPA 2YHVA 4XLVA 5IH5A 4O0VA 3D2IA 4FT3A 3VJNA 2GNJA 4LYNA 4UALA 4DA5A 3TNPC 4MNEA 2B9FA 1OL7A 4QMWA 1Y6AA 5DH3A 3H0YA 4V05A 3AD5A 3ATSA 2XKDA 1ATPE 3OMVA 5FP6A 3IW8A 4YC8A 4K77A 4UWYA 5DGZA 4BC6A 2R3FA 4IVAA 4PPCA 3VQHA 3CKWA 3CIKA 3WZUA 5BVOA 3KEXA 2Q0BA 4EZ3A 5JFSA 4NEUA 2QOQA 2VN9A 2WMUA 5DA3A 3OFMA 5D12A 4OW8A 4BDGA 3FMMA 2ITWA 4XRJA 1FVTA 2R7BA 2YJSA 1M7NA 5EDPA 3WIKA 3WF8A 1Q41A 2GMXA 3G51A 1XJDA 3LOKA 4GS6A 3NDMA 4ACCA 5CEOA 5L2WA 3NLBA 3Q9XA 3CS9A 5AUTA 1TQIA 4JOAA 5HE2A 5HCXA 2ZV8A 3F3ZA 4HJOA 4TW9A 5B0XA 4D0WA 3RINA 3PVUA 3BLRA 3NZ0A 5GNKA 3ZFMA 5FLFA 3VUKA 4F64A 4FF8A 4FL2A 4L67A 4C3RA 3Q52A 3QTRA 3KCKA 1BI7A 3MFUA 4DBNA 2J0MB 3O23A 3U51A 1YDSE 3ACJA 3O0GA 2XK6A 1I09A 4CFNA 3NUNA 5KMKA 3K5VA 1PJKA 2YIQA 4PX6A 3ZSGA 4BL1A 1G8AA 3B8RA 5JRQA 4YTIA 2C6LA 4G17A 3N51A 3OXZA 4GT3A 2E2BA 3TNQB 3WYXA 4E5BA 3KK9A 5EHLA 3VS7A 4FT0A 2XA4A 4C2VA 4GIIA 5KO1A 2HCKA 4YHTA 1ZOEA 2HIWA 5IZFA 4DTAA 4BFMA 4LOQA 3E64A 4QYHA 3QRKA 4I94A 4BHZA 5A4LA 2PVJA 3BGPA 5D41A 3QLFA 2W1EA 3JUHA 4TPTA 3FI8A 2BALA 3BRBA 4CYIA 3FMDA 1UNLA 2XCHA 4I24A 1IRKA 1J1CA 3IOPA 4R6VA 4EK6A 4ZTLA 2OIBA 3OT3A 5JGDA 4FL1A 5M07A 3SRVB 1NY3A 1UU7A 1JSUA 2GS2A 3HLLA 5GINE 4LGDA 1VJYA 4DT8A 5C9CA 3FE3A 2YM7A 3OW4A 3D7TB 3QCQA 4YPDA 3KK8A 3IGGA 3H0ZA 2R0IA 4AGWA 2B55A 4FMQA 4IAAA 3NYXA 4KIPA 5D11A 4L8MA 4MQ1A 2PK9A 4M68A 4AZWA 4DGMA 1LR4A 3FYKX 2IO6A 1XH6A 1IASA 1Q3WA 4O7WA 3P7CA 4U81A 4UXLA 2X0GA 1PMEA 3NRMA 5EHYA 2W1ZA 2DQ7X 2RIOA 4FV2A 4I41A 4FKPA 4R7HA 4WNKA 4QQTA 5B7VA 3SOCA 1ERKA 2VTOA 5FXQA 1SYKA 3KU2A 3HP2A 2UZWE 2A27A 1GZ8A 3GUBA 5HI2A 2XIRA 3PJ8A 2W5BA 5BVNA 3EN5A 3Q9WA 4FSQA 5J7HA 2NPQA 4MQ2A 2WTKC 4B99A 1VYZA 1Y8YA 3O8TA 4OTWA 1JWHA 5C26A 3UC3A 2C5VA 2GDOA 3KREA 2VNYA 1H26A 3A4PA 4FV7A 5ANDA 3WARA 3R9HA 3C4ZA 3KF7A 4BCKA 4FBXA 1Z5MA 2RG6A 1YQJA 4J95A 4WBBB 3ZEPA 3QA0A 3MB6A 3R2YA 3SAYA 3W1FA 4AA0A 2Y4PA 3MGYA 3MIAA 4KRDA 4YZ9A 5ACBC 3WE8A 3P79A 2CCHA 3FZSA 4RJ3A 5L2QA 1H08A 4C33A 3UIMA 1JNKA 3U4WA 4ANQA 2H9VA 2H6DA 2HENA 3F3TA 3IW5A 4JQ8A 4PWNA 4JDIA 4RVKA 1TVOA 1Q24A 3EMGA 4CD0A 2QQ7A 3QQUA 2FYSA 2WMSA 1UU9A 3QGYA 2XEYA 3ZDIA 4A7CA 4G3CA 4BIBA 2VAGA 4X3FA 3BHYA 3KXNA 3GQLA 4F1OA 1H25A 4K18A 4AF3A 4PTCA 4RWIA 4TN6A 2JAVA 2H96A 5D7VA 2CMWA 3Q5ZA 2UZTA 4JRVA 2CSNA 2VUWA 4ITJA 4A4XA 4WD5A 3I0OA 2XBAA 4IZAA 4Y5HA 4TL0A 3FXZA 4QMNA 4CRLA 3UQCA 1PKDA 3WILA 4EOMA 1P5EA 4IDVA 1URWA 3BHTA 3Q4UA 2R3PA 2XMYA 2OF2A 3ITZA 2BTRA 2RG5A 5G6VA 3UOKA 3KC3A 2J51A 3HNGA 1REJA 3EZVA 3E8CA 2O63A 3DOGA 2PZRA 3ODZX 3QTQA 3UP7A 4A07A 4AGDA 2VO7A 2HYYA 4JR7A 2VGPA 4HZRA 3LKMA 4K6ZA 3V04A 4EJ7A 4AN9A 4C3FA 2WMWA 3UQGA 3BV2A 2PE2A 3VRZA 3R9OA 3PG3A 4ZS4A 4Q2AA 4HCUA 5LVLA 3R8UA 3ALOA 4UMUA 5BVKA 4AA5A 3P5KA 5ANJA 3BU3A 4TYJA 4UMPA 3ENMA 3NR9A 4RQKA 5J95A 1SVGA 4IXPA 5DI1A 3LQ8A 4QQJA 4Y83A 1KE9A 3ZUTA 3ULIA 2G01A 4UZHA 2G9XA 4L42A 2Y6MA 2OG8A 2YLFA 1V1KA 4GVAA 3PXRA 3L8SA 4RLKA 2UZNA 2YN8A 2V0DA 4FYNA 5CU3A 2JBOA 5HKMA 4AS0A 5JFVA 2QG7A 1DAYA 4EH8A 4AN3A 2QG5A 4DCEA 4ACHA 4IAZA 5DR2A 5CEKA 3TZ8A 4NKAA 5CEMA 2XCKA 5ANEA 3OP5A 1AD5A 2VX3A 3CD8A 4GG5A 3S1HA 1YHSA 3QYWA 4AW2A 5M09A 3BPRA 1B39A 1ZMUA 1SVHA 2C0IA 3QXPA 3C5UA 4MXYA 4M69A 2OIQA 1OKWA 3OF0A 3S2PA 2VWIA 4OTDA 4FL3A 3ZM4A 3A7FA 3ZMMA 4DINA 3FLSA 3EQHA 2ITPA 1PXNA 2JDOA 2GHLA 1YVJA 5BX0A 2X6EA 3DDQA 3KMUA 4RIOA 2O0UA 4CXAA 4BN1A 2I0HA 2PUNA 4ALVA 1LEZA 2BTSA 1JPAA 1UWJA 4LFIA 4M3QA 3OCGA 4NK9A 4BCIA 3TT0A 3KMWA 1YOLA 4YURA 4RIWB 4C36A 2QONA 3G9NA 3NUPA 4YHFA 3FC1X 4KBCA 5AP4A 4H1MA 4HYUA 2E9UA 3IQ7A 4DT9A 5IQBA 1UVRA 3VBXA 3QRJA 1JAMA 4FTOA 4P4CA 5JN2A 5EOBA 3PPZA 3DK7A 4PDPA 4DF3A 4V04A 4D4SA 4DG3E 5GHVA 2YM3A 3R30A 1OBDA 4KIOA 3GVUA 2VGOA 4D0XA 4XJ0A 2FO0A 2OW3A 3FXWA 3IECA 4U44A 3OTUA 5A4EA 2PVKA 4U45A 4EZ5A 3E93A 1UWHA 5CTPA 3PZEA 3LXKA 4KRCA 3PA4A 5JZJA 4KS8A 1U54A 3RWQA 4GJ3A 2X7FA 4E4LA 4FEWA 4QRCA 3FV8A 2UZVA 4QTEA 4C4IA 5GZ8A 3OTVA 2P0CA 4QP4A 4QTDA 3T9TA 4JI9A 5LWMA 2RKUA 4IFCA 3EFJA 4ANBA 2R5TA 2NO3A 2W99B 4GUEA 4UZDA 2X8IA 4YZBA 3AC1A 4W4XA 3GT8A 2XRWA 4C34A 4M14A 4FTLA 4LG4A 4AQCA 3DV3A 3SD0A 2HWOA 4G3FA 1Q97A 5ANOA 4BZOA 3I81A 3QRUA 4D2RA 3QQLA 4MBIA 4UYAA 4CFWA 2PVYA 3UC4A 4FKUA 4YC3A 3C51A 5CSPA 4TYHB 4L44A 3R63A 5IQHA 4W4VA 4FV0A 2UV2A 5FTOA 4C62A 5LARA 3R9DA 3MH2A 3QF9A 4FKIA 4P2KA 3E3PA 4NIFA 5C8MA 3K3JA 4R1YA 2R3QA 2V7AA 1NA7A 4Z16A 4IM0A 3UVQA 2G1TA 4GT5A 3GB2A 5LCKA 1Y57A 4A9YA 3RCDA 5JEBA 2HZIA 3MWUA 2WOTA 3CPBA 2YABA 3FPQA 3H10A 4QTBA 4FV6A 4GL9A 3RZFA 5HIEA 5I4NA 3L1SA 4I5CA 4AA4A 3OCSA 1ZYSA 3QGWA 5KKRC 3UPZA 3GXLA 3I0QA 4FSYA 2XK9A 2HW6A 5IA1A 5AAGA 3HRCA 5DT0A 1BX6A 4EYMA 3R8LA 3LJ1A 5KHXA 5M08A 1H24A 5EDRA 3KY2A 3QA8A 3MYGA 3R7VA 3VULA 4DN5A 4J99A 4S33A 1UV5A 1W8CA 4FGBA 3U6HA 4C57A 3NW5A 3POZA 1M7QA 1PXPA 3DU8A 3TDVA 4UMTA 3GOKA 3E5AA 4PDSA 2P55A 4IDTA 3QHRA 4OT6A 5HCZA 3E87A 3ZBXA 4EJNA 2ITYA 3I4BA 4N70A 4C4GA 1M2PA 4MXCA 4AACA 5CEPA 5IUHA 2WU7A 4BDKA 4K2RA 4O0SA 3VBWA 3TV4A 4YSJA 4D2PA 1WCCA 3E62A 3UODA 1Y91A 3E7OA 4PRJA 4RC4A 1FMOE 4RIXB 3I1AA 4F1MA 3O50A 3ZC5A 2Z7RA 4AT4A 5JFXA 4O2ZA 4E3CA 4ZAUA 2EXEA 4X6QC 3COHA 3E3BX 5IQIA 4RIXA 2YIRA 4D2TA 2YCSA 4IAFA 4YJSA 5FP5A 5IQDA 3F5UA 2W0JA 3PE1A 3V8WA 4XYFA 4C7TA 1OUKA 3A4OX 1W84A 3Q32A 4FIFA 2PZPA 4PL5A 3MESA 2XNBA 3SOAA 5HE0A 1XO2B 2JIVA 3OVVA 2XM9A 3FZTA 3IKAA 4L43A 5EK7A 4F9BA 1PHKA 3LVPA 3QU0A 4DFYA 4HZSA 3ZEWA 4TRLA 4O7LA 5J9YA 4HGLA 5HIDA 2G2HA 2VZ6A 4MH7A 4CFMA 3VNTA 2XK7A 5IISA 2OU7A 4LOOA 4LGGA 2QO7A 4GKIA 1JKSA 3KN6A 5DWRA 3SW4A 2GQGA 3DJ6A 1WBSA 1K9AA 2CLXA 3GC9A 3RK5A 2QCSA 3HAVA 4H1JA 4CTBA 5KBQA 4O7RA 3TNHA 3WF5A 3EN4A 5J9ZA 2PMLX 2J0JA 2XKCA 5L6WL 4EEVA 2E9OA 3M2WA 5DBXA 4FTKA 5JQ5A 4MD8E 3R22A 4U8ZA 2B4SB 2XB7A 4O96A 5CALA 4FV1A 2JIIA 4AN2A 2GTMA 3UYTA 3QFVA 4O7VA 1GZOA 5E92A 1RDQE 3GBZA 3FMKA 5KE0A 4XG4A 3VUTA 3SDJA 2RL5A 3HECA 5FD2A 5EOLA 1U5RA 3PFQA 3PYYA 1Q8YA 3SV0A 1JSTA 4F0FA 4E1ZA 2SRCA 5AFVA 2BPMA 3F66A 3MIYA 1DI9A 4FSTA 4BICA 3U54A 3G5DA 4X21A 3ZBFA 2C5NA 4O38A 3F9NA 5M55A 2VTAA 3FKNA 3GC8A 4E6DA 1A48A 4FNYA 2GQRA 2W5AA 3R73A 2C69A 5BUJA 2C3JA 2C68A 2PVNA 4G9RA 5HTCA 3UZTA 4FUYA 3LXLA 4XH6A 5DEYA 4FTCA 4AOIA 5C4KA 5AX9A 4R5YA 5FDXA 3O8PA 3PY1A 3MDYA 3UIUA 4CT2A 2P3GX 2XIYA 2QURA 4U9AA 3W2PA 4U97A 5JT2A 4BDIA 3I7CA 4X2KA 2Y0AA 2WMXA 1MQBA 4M66A 4F7JA 4EZ7A 3C7QA 2C6KA 2WXVA 4G2FA 4L01A 3VBTA 1H1SA 3LFCA 5DLSA 5FBOA 4HNIA 4PQNA 3N4VA 3SG8A 3I5NA 3QQGA 5DYJA 3COIA 3OD6X 3DXQA 3HV7A 2WEVA 4KS7A 3VWAA 2JDSA 3Q2MA 3HYHA 1R78A 1U59A 4MXXA 4IAYA 4X3FB 3L9NA 3UZPA 4ANMA 3LCSA 3TIZA 4G3GA 3EYHA 3V6SA 2WHBA 1OKVA 3RZBA 4BTJA 3NYNA 4IACA 3R21A 2WIHA 4CEGA 2I0YA 4AP7A 4N6ZA 4A9RA 4ZTQA 4DAWA 1PF8A 4AZSA 4F6WA 1JKKA 5HLPA 3AC2A 5DRBA 3TXOA 3KQ7A 2P33A 4NH1A 4G5JA 2QU5A 2UW8A 2PWLA 4N4SA 4AT5A 3AOXA 3E8EA 3TM0A 5KZIA 4AW1A 4YZMA 4RT7A 3VS2A 2ACXA 4RX5A 1KE5A 5HEZA 3WZDA 4ENYA 4YTCA 5HNGA 1H8FA 1YXVA 3IDCA 3G90X 4JBVA 3DAEA 4DH7A 4JX7A 4O27B 3KXXA 3FI4A 4IB5A 2W05A 2CNUA 4I5PA 4RGJA 5HOAA 3V8SA 4H3QA 5GJGA 1J1BA 3D94A 2QOKA 3NAYA 4IWDA 4EKKA 5BMMA 3VBQA 5L6PA 5F94A 4HNFA 2F2CB 2X9EA 3RALA 2XS0A 5ICPA 1HOWA 1JQHA 4TWOA 3PRFA 5HHWA 4R5SA 3T3UA 3ID6C 4YSMA 2DYLA 5HIBA 3L8XA 4JG7A 4Y95A 4ITIA 2O64A 3FQHA 2B7AA 5KMNA 4HGSA 4MKCA 3R7EA 4EOJA 3LCTA 4DHFA 4PNKA 5BQ0A 4BIDA 1WVXA 5A54A 1OI9A 4M7IA 3OROA 4CTCA 4BIEA 1O6YA 2QOFA 2X8DA 3WI6A 3ZO2A 4QP9A 4YR8A 4GVJA 2XZSA 3NCGA 2IPXA 2YWVA 4RPVA 4C59A 5IU2A 1NVRA 1BL7A 4JQEA 3N4TA 4U79A 4FOBA 4GSBA 2WMTA 4BHNA 2C5XA 3FXXA 5AIKA 1BL6A 3EQCA 5AR3A 4Z3VA 4FKSA 3RNYA 3C5IA 4UEUA 3OW3A 2R3IA 5KZ0A 2HXLA 3DBFA 3UP2A 4B4LA 1W7HA 3M11A 3ZRLA 1FQ1B 3GU8A 2UW4A 4O0TA 2R2PA 5AWMA 5HG8A 3GGFA 4NM0A 3UPXA 3ZOSA 4J71A 4EC9A 4C61A 5J9LA 4DFBA 3MVHA 2FVDA 2J2IB 3LFEA 1RW8A 3U6JA 2BROA 2BUJA 2W9ZB 3FKOA 2YEXA 4ZTMA 1U4DA 2QODA 4FSNA 2AC5A 4UWBA 4ZJJA 4DGLC 3JVRA 3L8VA 5K5NA 2QI8A 2X4ZA 5H8BA 5IA5A 4FKVA 2YM8A 5HE1A 3BHVA 3R8MA 3SX9A 1IAHA 3AQVA 2BRGA 4IZYA 3DKCA 4ZK5A 3LZBA 3VIDA 4LGHA 4NSTA 2LAVA 4KSPA 3D9VA 3CC6A 3GU7A 4U41A 4XMOA 4BDJA 2R3LA 4WNMA 2IZSA 4BR3A 3E92A 4F9YA 3N4UA 3GEQA 4OBPA 4OGRA 3VF8A 4DH1A 4K0YA 4AFEA 3P1AA 1F5QA 1GZKA 3DLZA 3FL4A 4O0UA 2EB2A 3MSSA 5HG9A 3TZMA 5M56A 4I6FA 3LCOA 3P7AA 2R3JA 4YZCA 5AV4A 4ZTRA 4NM3A 4RX9A 1YDTE 4ANSA 4IB1A 3EQBA 1VZOA 5EM8A 4EBVA 4F4PA 4ID7A 5C27A 4HVSA 4ZZNA 4BCNA 3Q6UA 3TKHA 3BLQA 4W8EA 1KSWA 5FUTA 2J4ZA 2F7EE 3CQUA 1H07A 3KKVA 3KL8A 2WTWA 3PXFA 1E1XA 1V0OA 3FZOA 1ZLTA 4QP1A 3CBLA 2IJMA 3AC3A 4H3PA 4V0GA 4A9UA 4D2SA 3QBNA 3CCNA 2HELA 3D2KA 3D5UA 3DK6A 3JYAA 4QQCA 3HKOA 4WG4A 2IVSA 3VUHA 3U9NA 2ONLC 4K33A 4CZUA 3TNWA 3L9PA 3SXRA 3CGOA 4D9UA 5IQEA 4FR4A 2J7TA 5B2KA 3O7LD 1QPDA 3EIDA 4TT7A 5A4QA 3R83A 2ZM3A 4JIAA 1GOLA 4FEQA 4KBAA 5HZNA 3EN6A 2OJ9A 3MH0A 4FGRA 3SG9A 5CU4A 4CMUA 3AD6A 3MI9A 5CAUA 4XBRA 3S3IA 3UYSA 4FTNA 5M4UA 3KXMA 3MY0A 4NKSA 5EFQA 2W06A 2W1HA 4AT3A 5IMEA 1GZNA 4LUEA 2Z02A 3ACKA 2A4LA 3MBLA 5A46A 5E8XA 4M8TA 3LJ0A 5K5XA 2OGVA 4CLIA 3SA0A 3NS9A 4FX3A 2UUEA 2PVLA 2PHKA 4MEDA 1YI6A 5HO6A 1KV2A 2V7OA 3TZ7A 3K5UA 2PPQA 4MTAA 4IC7A 3A99A 3NUAA 2JDRA 4ZSJA 4ZXTA 3CP9A 4B8LA 2C3IB 3Q3BA 3B8QA 1CKJA 4G9CA 3KGAA 4HVGA 5LVMA 4FKWA 4OAVB 1XBAA 4FG8A 5CNNA 4E6QA 4GYIA 4RA5A 3I5ZA 4ERKA 4RJ7A 4C4FA 3BHHA 4O86A 5KNJA 4XG2A 2J6MA 3JY0A 3VAPA 4FV9A 2P4IA 3W2RA 1AQ1A 3C0GA 3BV3A 3SC1A 2XNEA 4ZTHA 5KMMA 4FI1A 5A14A 1E1VA 2A1AB 3Q5IA 3HX4A 4RG0A 4ZS0A 4O21A 3UO4A 2XK3A 4FG9A 4YP8A 3H4JA 4QPAA 2R3NA 3R01A 4BYIA 2ETKA 3EWHA 3QCSA 4XP0A 4ZTSA 3S4QA 4DBXA 3PRIA 1GIIA 2JFLA 3DPKA 1O9UA 3EQGA 3ET7A 4LOPA 4EI4A 4P90A 4YTHA 4FZDB 4MK0A 3ZO4A 4RFZA 2WTJA 2CHLA 2XNGA 4UBAA 4CSVA 3S95A 1PMNA 2W1DA 3RAKA 3UOHA 2PUIA 4DFLA 3A60A 3E8NA 5B2LA 3LMHA 1GY3A 2UW0A 3BBTB 5F4NA 4AOJA 3LMIA 4BBFA 4ZSGA 5C8KA 3QTWA 4USEA 3B2TA 1RE8A 3KULA 4HPUE 2C3LA 2WMVA 2PZYA 4USFA 4M13A 1OM1A 4BCOA 5HU9A 1WVYA 5A6NA 3QRIA 2O5KA 2VTJA 3RAWA 2JAMA 3FKLA 3H9RA 5BVWA 4ACGA 4ACMA 3TIYA 1EH4A 2UW7A 5TE0A 5L2IA 3PLSA 4BI2A 3ALNA 5LWNA 3IW4A 3SGCA 5FG8A 3RTPA 3WBLA 4JVGA 2B53A 4UY9A 5JGBA 4O1OA 1U54B 2HY81 5BMSA 5M4CA 3CJFA 4IM2A 2WFYA 4MCVA 5BUIA 1M52A 4O83A 4X0MA 1MQ4A 1WBPA 1Z57A 3GOPA 5H2UA 4QP3A 5CSXA 2QOLA 1PYEA 1XQZA 4JT3A 1DAWA 3DTCA 4C8BA 3PLAE 3KB7A 4J52A 4X7QA 3OWKA 3DGKA 3DNDA 3OEZA 4NCTC 2BRBA 3I7BA 4KAOA 3DK3A 5HD7A 2VWWA 1OKYA 4M15A 4QP6A 1A06A 5I3OA 4C58A 1H1RA 4F63A 4IHPA 3LQ3A 4ONAA 4BDHA 4FKGA 3QX2A 3V5WA 3VUIA 3ATTA 2GFSA 5TR6A 3DAJA 3ETAA 4TYHA 4QMPA 5J7BA 3FZPA 3IDPA 5IG1A 2ZV2A 2XJ2A 2WTVA 5JZNA 2OKRA 4NIFB 3ENHA 4KIQA 1WBWA 4W4WA 3FSKA 1YW2A 5E1SA 3HA6A 3MA6A 4Q9SA 4WRGA 2W4KA 3GI3A 4DG0E 2GQSA 4F08A 3RVGA 4ZZMA 2W1GA 1KOAA 5LMBA 2RFDA 3PJ2A 4O7TA 3A8XA 1M2QA 3QKLA 3R1SA 4IJ9A 4AUAA 4FTIA 2EB3A 2QO2A 3DDPA 4RJ4A 3TZ9A 3NVMB 3ORNA 3BE2A 3F5PA 5CZHA 2WMAA 3D14A 3NCZA 5EQPA 4QMQA
chains in the Genus database with same CATH superfamily
4QMVA 5BVDA 4XBUA 3BZ3A 4G6OA 4P5ZA 4XOZA 2XARA 2B0QA 4J98A 1ND4A 3AGMA 5BUEA 1ZOHA 1OITA 2C3KA 4FTTA 5TT7A 3G2FA 3F6XA 4FTJA 1G5SA 4FEUA 4YZNA 2J0LA 5H3QA 2OZAA 5CSVA 3TV6A 1MUOA 4R7BA 1OPLA 4V01A 4AW0A 4FZAB 4JS8A 3NW6A 4M97A 3QLGA 4RFYA 3HVCA 3EQIA 4RRVA 4DEDA 2QHMA 3TEIA 2W1CA 4TWCA 5HU3A 5CVFA 5IDNA 4AZTA 2GCDA 2JDTA 1YXXA 2JLDA 2NP8A 4EUUA 4PP7A 3DKFA 5HICA 4EOPA 3V51A 1APME 2WO6A 2X81A 3R04A 4TNDA 5D1JA 5A3XA 1PYXA 5AA9A 4U6RA 4EHVA 4OR5A 5AUXA 4AW5A 5FEEA 1OGUA 1S9JA 4PDOA 5KMJA 4LV5A 5CAVA 3LFNA 4L6QA 3DZQA 2XNOA 2OF4A 4WOVA 2XRUA 5CENA 3FZ1A 1J7IA 2GPHA 4EOQA 2VTLA 4J8MA 5AA8A 5AR4A 2IN6A 2E9VA 5GIPE 3G33A 3FY2A 4MWIA 3BU5A 4R3PA 4DGGA 3CY2A 3KRWA 5LVNA 2Z2WA 4I1ZA 5AV2A 1R39A 3FMEA 3TTIA 1GNGA 1W2FA 2VWUA 5DVRA 2BDWA 4OUCA 3FLYA 1BUHA 4HYHA 4AOTA 4FTMA 4WRSA 1ZRZA 2FUMA 1R1WA 2Z7QA 3DY7A 3FI2A 3EQPA 3PSCA 4IE9A 5E90A 3HV5A 3A7JA 4Q5HA 4PPAA 3SRVA 4ZLYA 4RZWA 4YBKA 4H39A 3LPBA 4K9YA 3QKMA 5HVYA 3ZHPC 3WZEA 3OS3A 3P4KA 3E8DA 3DKOA 4O22A 3Q4CA 3D7TA 1I44A 4IH8A 3V5PA 3L9MA 3DA6A 5CAPA 5B2MA 5BYYA 5HG7A 3NVKI 2F49A 2OXDA 5J1VA 3EH9A 4E5AX 2FSOX 4TWPA 1Q3DA 2GS7A 3VC4A 2ITVA 3NYVA 5JQ8A 5LVPA 3POOA 4WHZA 2W7XA 4GH2A 3HUCA 5DPVA 4EH3A 2NNWB 3V5JA 4PMPA 1AGWA 4HVHA 4O1PA 5JFWA 2ZOQA 4O6EA 3PXYA 3UNZA 3NUXA 3OXTA 1H1WA 3ZO3A 4BYJA 3G6HA 5EI6A 2GNFA 4XP2A 2WGJA 4JDKA 4S31A 3NIEA 4ZSEA 3ZTXA 5IDPA 2DS1A 1CKIA 1YXSA 4P7EA 4XP3A 3DTWA 5ANGA 3CGFA 1WAKA 3P08A 4IX6A 1FVVA 1OL5A 4OAUC 3HAMA 4UX9A 3BU6A 2IWIA 3D83A 1BMKA 5IA3A 4OBOA 3NIZA 2WAJA 4PV0A 4UXQA 3IS5A 3W8LA 3CD3A 5HX6A 1H1QA 5HO8A 5HD4A 4RWLA 3D15A 4E4NA 5FRIA 5CT0A 1QPJA 3MH3A 4XG3A 2Q0NA 3AKKA 1H0VA 2IVVA 3QHWA 3FMHA 2WOUA 3HV6A 1PXLA 3OBJA 4ZIMA 4DFXE 1Q61A 4JQ7A 1XWSA 5AR7A 3VHKA 4EORA 3VBYA 5BVEA 4OTPA 3V5TA 2WKMA 2PUPA 3NNWA 5L8KA 1PXMA 4QPMA 2QC6A 4BDEA 1W2DA 2YERA 4O84A 4XV2A 5K0XA 3LFBA 5E8SA 3U55A 4V0GB 4D4RA 3FC2A 3WF9A 1P4FA 2PUUA 3OY3A 5KBRA 3R0TA 2GFCA 4FIGA 4FODA 4EH7A 4YZDA 3R9RA 1STCE 2BKZA 3I6WA 4X2NA 3KFAA 2CGVA 4ZMFA 2Z60A 4A9SA 1YI4A 4I5MA 3EFWA 2XALA 2IEWA 2YLEA 3FZRA 2Y8OA 2X2KA 5CNOA 4ZP5A 5AM7A 2CKPA 4CFVA 2CGWA 3TG1A 2QHNA 5DIAA 3NX8A 4RQVA 3U6IA 3HMMA 3P23A 5E8UA 1WBNA 5L3AA 2AUHA 2XBJA 1M17A 3A7HA 4A4OA 3CR0A 4EHEA 3GCQA 3BEGA 3OWLA 4E8AA 3LMGA 1YI3A 1Q62A 2VTTA 3NNXA 3TKUA 3JPVA 4F6SA 2V5QA 1RJBA 4IX4A 4RA4A 4Y85A 3ROCA 5CY3A 4M12A 4L00A 4LRKA 2BAQA 2XKFA 2X7OA 4W9WA 5IUIA 2I0EA 3OWJA 4XS2A 2VWYA 2WTCA 2CNVA 4U3YA 4ZJIA 4S30A 3R2BA 4UMQA 4ARKA 4GYGA 3UOJA 2FSLX 4BI1A 3JR1A 4AGUA 2BRNA 2V22A 3NGAA 1V0PA 4FT5A 2JKKA 3F5XA 5DNRA 4C35A 4KNBA 3DJ7A 5GZAA 4Y72A 3KRRA 4JL9A 2LGCA 5AMNA 2ITTA 4QNYA 4WNOA 3TWJA 4XG6A 3UZRA 4ZLOA 5LXMA 3PJ1A 3CTHA 4OT5A 3RHXA 3PUPA 3EQDA 2C0TA 1PW2A 4GFOA 2YIYA 1KUTA 3NUUA 5EQEA 4C4EA 4X2JA 2HWPA 3C9WA 4DH5A 3FEGA 3PDTA 3QQHA 3A7IA 4MYGA 3ZDUA 2PMIA 2QKWB 1IAJA 3OBGA 1WBOA 1WFCA 2HK5A 3VS0A 3MY1A 2EUFB 4R8QA 5DOSA 5GJDA 4BGGA 2Q83A 4CG8A 1QPEA 4QP2A 5CSHA 4AG8A 5FEDA 2ITUA 3ZSIA 3RHKA 3WYYA 4EH9A 5DEWA 1DM2A 4NYEA 3HUBA 4RIWA 4NW5A 1ZYCA 5I9ZA 2C0OA 2VWZA 3V6RA 3BQCA 4NU1A 2B54A 5EI2A 3MB7A 4O7NA 2UZLA 4DLJA 2V55A 4PTEA 3VJOA 3CEKA 3PA3A 2ITNA 2YDJA 3AMBA 3HMIA 3LE6A 4J1RA 4C0TA 5IA0A 2REIA 1FMKA 3DAKA 1FVRA 4FK3A 4OBQA 5LMKC 4TY1A 4Y46A 2V62A 4D1XA 2Y4IB 3IPHA 4XX9A 2ERZE 1BYGA 5A9UA 2OXXA 2ETRA 3BYSA 2J5FA 2WELA 4LUDA 2CKEA 4O6LA 5CLPA 4JIKA 4O4DA 3BYUA 4RLLA 3MVLA 2ZJWA 4CRSA 3FYJX 4QYYA 3VS5A 2FB8A 3FWQA 5ANIA 4Y5QA 4CQGA 3R8VA 5TF9A 3GP0A 3MTLA 3BCEA 4K8AA 3BLHA 2QLQA 2OZOA 3RPSA 5M53A 3QQKA 2OICA 2UW6A 3LXPA 3P78A 4K11A 2QKRA 4B0GA 2WMQA 5M06A 4CNHA 5AUVA 4YJQA 3UOLA 4WA9A 2ZM4A 2C6MA 1LP4A 1NXKA 4F7NA 1YHWA 4RX8A 5F95A 4ZLZA 3HMOA 3BWJA 4KA3A 3ZSHA 3WOWA 4G1WA 3R8PA 5HX8A 4IADA 5AM6A 4BDCA 5FBNC 4DFUA 3RBWA 3SVVA 2I40A 2WU6A 3RPOA 4APCA 3O2MA 2R64A 3KA0A 3GENA 4FNWA 2UVZA 2PMOX 1YHVA 3BEAA 4EOKA 4PDYA 3NNUA 3REPA 3D5XA 2B9IA 3EL8A 3IG7A 3NNVA 2EXMA 4PTGA 4R3RA 5E1EA 2J5EA 1NW1A 3COKA 2ESMA 4YC6A 3E7VA 3BELA 3MJ1A 3AT4A 4L45A 5K0KA 5EKOA 1HCKA 3WF6A 4BTKA 3RK7A 5HBEA 2PZIA 1ZY5A 1GJOA 4RZVA 3QD4A 1IR3A 3LM5A 4FSUA 3I79A 2BDFA 3CLYA 4YJUA 5FM3A 3R02A 3F88A 5KMLA 3C1XA 2IVUA 2XK4A 2PU8A 4DH8A 5CWZA 2NRUA 1PXOA 1R0PA 2WB8A 3ZXZA 4QNAA 3MVJA 3C4WA 3QQFA 3V5LA 4BRXA 5D9HA 4CV8A 3QTSA 4MD7E 4HPTE 3AT3A 3PXZA 2F57A 2OXYA 4BDDA 3ULZA 3QUPA 2X9FA 3R1NA 3SW7A 4AXCA 3KRJA 4EC8A 3IW7A 1NVQA 3ORMA 5CQWA 2OZAB 5CEIA 2YITA 5EW9A 2XF0A 4QPSA 5E91A 5LOHA 3F2NA 3F5GA 4FIEA 4Y8DA 1LUFA 2UZUE 4R1VA 3ZUUA 4QYFA 3ORPA 4DH3A 1H28A 4L3LA 3T3VA 2YCFA 1CMKE 2VTRA 3W0OA 1P14A 2RFSA 2UW3A 3F2AA 1KE7A 3AC8A 3AXWA 2BRHA 1H27A 3KMMA 3MW1A 3VS4A 4FE2A 4G6LA 4KKHA 4QD6A 4ZZOA 1W0XC 2QO9A 1A9UA 3GCSA 2JIUA 3LW0A 4QMXA 4EOIA 1Q8WA 5AV1A 3PP0A 4H36A 4LQMA 2OI4X 5AR5A 3ZU7A 3QX4A 2BKKA 2VTQA 1O6LA 4GCJA 3HDNA 3KN5A 2ZV7A 3MH1A 3DB6A 3QUDA 2UVYA 5J79A 2WMBA 3FDNA 1CM8A 4BCHA 4JBPA 4I23A 1KE6A 3LHJA 5AAEA 4Q5EA 3AG9A 5L6OA 3KULB 2BIKB 4NFNA 4U3ZA 4CT1A 3WZKA 1U5QA 5DRDA 5CXZA 1M2RA 5AV0A 5ACKA 3VUDA 3C4EA 5JH6A 4KD1A 2BHEA 1PXKA 2HOGA 4FT7A 3EFLA 5HNBA 5L8JA 3H9FA 4DEEA 4OLIA 3QC9A 5DFPA 4B8MA 4DFZE 1K3AA 3BL9A 3V01A 5HQ0A 4YJTA 3ERKA 2JBPA 4Z9LA 3THBA 4APPA 3QD0A 1YOMA 1PKGA 2BZIB 2YM6A 3U87A 3PVBA 5T6KA 3R7YA 3UMWA 3UDSA 4YLKA 5IQCA 4AE9A 4XG9A 5I5ZA 5CVHA 3IOKA 4J53A 4ZY5A 5E8VA 5DT4A 3D0EA 4CKRA 5JK3A 4OTFA 3A62A 2XNNA 5AUWA 2BZKB 3DBQA 4OTRA 4YO4A 3NEWA 4W9XA 3CE3A 3HA8A 4ZY6A 1G8SA 5GIOE 1ZYJA 4G3DA 4QMZA 2BFYA 5L2TA 2YIXA 2VNWA 5AP2A 3F7WA 1ZWSA 4AXEA 4FTUA 2WIPA 2GNHA 3DBDA 4UV0A 3VRYA 2PVMA 4IC8A 4R3CA 4RVTA 5HVJA 4AQKA 1XBCA 3EQFA 2WPAA 3FL5A 3DBEA 4FOCA 4KB8A 4GW8A 4UYNA 4H3BA 2YDIA 4FYOA 1GIHA 4IVDA 1FGIA 3UO6A 3OOMA 4HGTA 3HL7A 4IANA 4XG8A 5CU6A 5ETFA 3VQUA 4NM5A 1Q8ZA 2R3GA 3P0MA 4R7IA 1J3HA 2KULA 2CJMA 5HCYA 3ZLWA 2B9HA 3ORTA 4N6YA 4UMRA 4XEYA 1OB3A 2I0VA 3BHUA 1DS5A 4G34A 5HE3A 4BCPA 4IVCA 4BZDA 1NVSA 4L52A 1IG1A 3PIZA 3OUKA 4BJJA 4DTBA 4NL0A 4EYJA 3N9XA 4I6BA 3W2QA 3ZH8A 5H9BA 4AZEA 4UB7A 3W2SA 3BX5A 5I9UA 3VS6A 2VTNA 5LMAA 1SMHA 5AUZA 1Y8GA 4CVAA 3KXGA 4FV3A 3C50A 3OCBA 1OPJA 4E73A 3MFSA 1L3RE 4RJ6A 3LLAA 4BF2A 2ZMDA 2QOOA 2VTPA 2J9MA 3FAAA 3QD3A 5BYLA 3WIGA 5E8ZA 4JXFA 4R78A 3ORKA 3AKLA 2G2FA 3LFFA 4EL9A 4L7SA 5FXSA 2BCJA 4F09A 1VYWA 3R7OA 1LPUA 5DG5A 1XH4A 3OY1A 4EOLA 4GU6A 1PMVA 4FA2A 3HZTA 5J5TA 3RNIA 3HMNA 3FQEA 3NW7A 4HYSA 4QMOA 5DR6A 3F7ZA 4IB0A 4ASDA 5AEPA 3MN3A 3QZFA 4AE6A 4FVRA 3TI1A 1XBBA 4LV8A 4GJ2A 1UKIA 2WMRA 5GJFA 5L2SA 4TYIA 4I0SA 4X2FA 4N0SA 4CV9A 3UE4A 4GT4A 3R1YA 4QOXA 5AR2A 3F3UA 4C02A 5AP3A 3KIOC 2YZAA 2Z7SA 4PF4A 2CN5A 3ELJA 1V0BA 4U0IA 3D5WA 4S34A 3LCKA 5AR8A 1BLXA 3PTGA 4BKYA 2YFXA 4J97A 4DTKA 3T9IA 4WG5A 4XUFA 3RM7A 4PL3A 4C38A 4II5A 3EN9A 2W4OA 4GFMA 2OJGA 3OT8A 4TNBA 5CSWA 4XNEA 3NUYA 5E7RA 1OBGA 3OC1A 5L8LA 2UW9A 3W2OA 2R3KA 4FKJA 5E4HA 4A9TA 3M1SA 4D1ZA 1Y6BA 1VEBA 4TZRA 1MRVA 3QCXA 3F69A 4CFXA 3LFDA 3PJ3A 3CJGA 2ITOA 4HCTA 3SHEA 4OTIA 3TYKA 2PY3A 4JDJA 2IVTA 2J50A 2X7GA 4O0XA 1XH5A 2X39A 3BBWA 4RVLA 2BAJA 1YWRA 3Q9YA 3KRXA 2J0IA 4JLCA 4CLJA 1H01A 4FKLA 4WSQA 1J7LA 5EQYA 2BVAA 3AC5A 5AP5A 1WMKA 1OMWA 3R6XA 1TKIA 1WZYA 3QC4A 3C4CA 2W1IA 3F3WA 1YKRA 3NSZA 2PL0A 4PMMA 5AV3A 5HTBA 4IAIA 4D4YA 4EH5A 3KVXA 2Y4IC 3F82A 2YJRA 4QMLA 3IK3A 4O82A 5EW3A 2UZEA 3ZYAA 5EYCA 1GAGA 4BTFA 3O96A 4FV4A 1XMMA 1UNHA 2QOBA 3I60A 1UKHA 3W10A 3F3VA 5EM7A 2C6OA 3DB8A 1JSVA 5C8NA 4GV1A 4F9CA 2BILB 3EB0A 3Q6WA 5D10A 3T8OA 5T68A 2PZ5A 3EHAA 2YM5A 4BWXA 1PMUA 2VTHA 3H9OA 4AAAA 4F78A 4FNXA 2X0PA 3GCUA 1UU8A 2FSTX 2ITQA 4BTMA 4ZMEA 2PMNX 5HGIA 3Q4TA 4FT9A 3RAHA 4BCJA 3H30A 3QZGA 3HDMA 3QWJA 4QYGA 2VV9A 3LFQA 4XOYA 1R3CA 2UZOA 2KTYA 2XEZA 4E4MA 4E6AA 3AMYA 4DGOA 4YNEA 3MA3A 3RPVA 3WZJA 3VS1A 3TV7A 2C5YA 2JD5A 3OG7A 4L9IA 2OH0E 4ZSLA 4DEHA 1KV1A 2XP2A 2X0OA 3TACA 4C3PA 4DC2A 4R77A 4DDGA 4FZ6A 4TWNA 5J8IA 1S9IA 5F1ZA 2BFXA 4F7LA 3ANQA 3QYZA 1ZARA 5DN3A 4IQ6A 4FEXA 1R0EA 4BJJB 2YAAA 4QMUA 5DR9A 4EWQA 3ZONA 4YTFA 3RWPA 3R8ZA 2YCRA 5F9EA 4F9AA 4WG3A 3RI1A 4BCFA 1HCLA 4EQMA 3UDTA 3W0QA 4JBQA 3TUDA 2ZYBA 1LEWA 4O0YA 5J5SA 2Y9QA 3G15A 3UGCA 4IWQA 3R7UA 5IUGA 2XYNA 1OVEA 2G2IA 4M0ZA 4YO6A 4DGNA 2J0KA 4D4VA 2VRXA 2X6DA 4Q9ZA 3TKIA 4D28A 3LFAA 4U43A 4IB3A 1ZZ2A 3SXSA 4O4CA 4F70A 2XNMA 4ZJVA 4QYEA 3CSVA 5HNIX 3FBVA 1IA9A 1URCA 3GCPA 4BDAA 2QVSE 4I21A 4CCBA 1ZY4A 2BZJA 2C30A 4GK4A 2RSVA 3R7GA 3ZLSA 4DITA 3PY3A 3I6UA 2XNPA 2F7ZE 5HESA 4D55A 4GKHA 4A4LA 2B9JA 4YJNA 2WNTA 3V8TA 3LIJA 4IEBA 2RGPA 3QTIA 3VW8A 4O91A 2OO8X 4FRFA 1Q8UA 4DLIA 2B52A 2XAOA 2R3MA 3QZIA 4FSWA 5KX8A 4X6RA 2X2LA 3HV3A 4WBOA 4U5JA 4IW0A 1E9HA 2O8YA 3PPKA 3W32A 5EYDA 5IQFA 3TL8A 1XHAA 2CDZA 4YHJA 4FKTA 4FSZA 5M51A 2WTIA 3DLSA 4J96A 2BDJA 2BZHB 3MVMA 2ONLA 3O51A 3ZFYA 4M69B 2IZUA 4WUAA 4CFFA 4H05A 2JKQA 2WQMA 4E26A 2C6TA 3FLWA 4J8NA 2R3HA 1ZYDA 2XIZA 3G0EA 5IEXA 3A8WA 3M42A 4QTCA 3RCJA 3ZXTA 3ANRA 3CQWA 3PSBA 1NT2A 5BVFA 5AP7A 4E6CA 5J87A 5CT7A 4IAKA 3HRFA 4S2ZA 4D9TA 2OJIA 3NWWA 2AYPA 2R3RA 3CTQA 4G3EA 4F65A 5J1WA 3FLQA 3OCTA 5FEQA 1O6KA 2QLUA 4XHKB 4I0RA 4FZ7A 2VTSA 2GSFA 5I3RA 4XV3A 2F7XE 3OUNB 2F2UA 3P7BA 2EXCX 5ETIA 4BB4A 4C37A 2C1AA 2Y6OA 5AP1A 3RK9A 4NCTA 4EQUA 4A06A 2OWBA 4BZNA 3QKKA 4B7TA 5T3QA 3R7IA 1T45A 3C4FA 2WQNA 3LCDA 3PWDA 4L3JA 4FG7A 4GU9A 3E63A 2FA2A 3MPTA 5G1XA 5I9WA 2PVHA 3C4XA 3PVGA 1SNXA 1SZMA 4ORKA 3G6GA 3VBVA 2I6LA 3C0IA 4IZ7A 2W9FB 3MTFA 4IMYA 2VO0A 4KIKB 3QWKA 2OFUA 1RQQA 5KCVA 4XV9A 2JEDA 1GIJA 2JDVA 4O0WA 4EUTA 4N57A 4BBMA 2R9SA 4W4YA 2QNJA 4MX9A 3UG2A 5CQUA 3FPMA 4CMTA 2GHGA 2C5OA 2O65A 2UVXA 4QMSA 4J7BA 5HG5A 3F61A 4AZVA 5IQGA 1JLUE 3OXIA 5AP0A 2JKOA 4BGQA 2YA9A 3ORLA 2PYWA 2BHHA 5F20A 4E5WA 2C6DA 2IZTA 3BGZA 4D2VA 4KUJA 4MNFA 4O2PA 5CF8A 3QD2B 2CNQA 4LRMA 4KKGA 1MRYA 5A4TA 3BQRA 3NAXA 4YPSA 4EH2A 2JGZA 3EOCA 5TO8A 4BWKA 3GQIA 5FQDC 4ENXA 3DKGA 3DXNA 1Q5KA 3MV5A 3HMPA 3ORZA 3TJDA 3MJ2A 2Z7LA 2CLQA 4C4HA 1YWNA 4TTHB 1OL2A 4UN0C 2H8HA 3ROYA 4YJVA 1OECA 3FSFA 3QUEA 3K2LA 4F6UA 1ZMVA 3QL8A 4K1BA 1PRYA 4O7YA 2ITXA 5FTGA 1JOWB 4FIHA 2YZLA 3MFTA 1H1PA 3A7GA 3A2CA 4RC2A 4YLJA 3PE2A 5KKRB 3GNIB 4OTGA 4QT1A 3TUCA 4EHZA 4EKLA 1BI8A 2VWXA 3EJ1A 5EDQA 3ZC6A 2HZNA 3O7LB 4IVBA 4G5PA 5C01A 1CDKA 2R7IA 3PIYA 5ANKA 3VW6A 3GU5A 4FC0A 3TNIA 2GNIA 4NJDA 3SKCA 1KWPA 4C4JA 5DE2A 4IIRA 2WQBA 3Q60A 4EBWA 3DFCB 3QALE 1JBPE 3PXQA 3Q04A 2XJ0A 3LAUA 3R1QA 4H58A 4ITHA 4OTHA 3MS9A 4U7ZA 4YMJA 1U46A 2GNGA 4U40A 4CCUA 2Z8CA 1X8BA 4EK3A 1PY5A 3IO7A 2GNLA 2JC6A 2XH5A 2XK8A 4PUZA 5CI6A 4ANLA 4EHGA 3RGFA 4JAIA 5C4LA 1Q99A 4FNZA 1YXUA 5M57A 4BBEA 2PE1A 5EYMA 4USDA 4ZOGA 4CFUA 5CF5A 4IM3A 2ZAZA 2WTDA 3NYOA 4FVPA 4JG8A 5JKGA 3GU4A 5KMOA 1VR2A 3LQ5A 3IGOA 4NWMA 4IZ5A 2CCIA 3HV4A 4O7ZA 1BKXA 3UIXA 2IW9A 3OZ6A 3W2CA 5JMSA 1P4OA 4FEVA 4GK2A 4PNIA 3ZFXA 4WNPA 2CKQA 4D5KA 1FOTA 5EH0A 4HOKA 3K54A 3WF7A 3W16A 3CKXA 5CF6A 3C0HA 3SLSA 4F0IA 5IEYA 5E9EA 4RSSA 2GTNA 3IDBA 2ERKA 1T46A 4GUBA 5CU0A 1FGKA 4RWJA 4YGAA 4YJOA 4LMNA 4FICA 2WZJA 4ALWA 4JAJA 5TKDA 4I6LA 1ST0A 4KSQA 5CYIA 4F99A 5IQAA 4RIYA 3R00A 4ZEGA 3FI3A 2J90A 4BCGA 1JVPP 3CY3A 3DT1A 4U42A 3ORXA 4QQ5A 3V3VA 1YDRE 2PVFA 3RMFA 4GRBA 3Q4ZA 5M4IA 3WE4A 4XCUA 1REKA 1OPKA 2EU9A 5TOZA 4F9WA 5JSMA 1XH7A 5FXRA 5IKWA 2GU8A 2F9GA 4IWOA 4RJ5A 4MVFA 4LL0A 3TJCA 5CX9A 4IWPA 3MPMA 5CU2A 4JDHA 3PY0A 4DEBA 1WBVA 4F1TA 2A2AA 5FGKA 4Z55A 3ML1A 5AADA 3R71A 1TQMA 3BI6A 3MPAA 2PULA 4IX3A 3AC4A 2WQEA 4EOSA 4DEIA 4QMTA 1DI8A 4NZWB 4YJPA 2WD1A 3KRLA 4NTTA 5E8TA 4ASEA 5I9VA 3LLTA 3BYVA 5BYZA 3ZRMA 3DS6A 5AX3A 5KUPA 3BL7A 4MXOA 4TKSA 4WSYA 5AAFA 1OUYA 5AUUA 1ZMWA 3IW6A 4IJPA 2QOHA 2EVAA 3W0SA 3EQRA 3BWFA 2CGUA 4KKEA 4I92A 1ZXEA 3GC0A 3GFWA 4DEGA 2XYUA 3FY0A 3DCVA 1F0QA 2C4GA 1SNUA 1FPUA 2XIKA 3FMNA 4QP8A 4XV1A 2RFEA 1CTPE 4ANOA 4MBJA 4FSRA 5HLWA 4F0GA 3RKBA 3U4UA 3LXNA 4FUXA 2RFNA 2JFMA 4YNOA 4RWKA 5L4QA 3O71A 5FDPA 3TDWA 3KXZA 4G6NA 1G3NA 3BE9A 3ZZEA 5BV3A 3BKBA 2UZBA 4ZY4A 3UDBA 2DWBA 3Q9ZA 3UTOA 1W83A 3FMLA 4MBLA 3S0OA 2HZ0A 4BI0A 2C1BA 4LI5A 2XKEA 5IEVA 4MNEB 3ZRKA 3TCPA 1QCFA 4CZYB 4D5HA 3JY9A 4DE4A 4FZFB 2E9PA 5KMIA 4EK5A 1YWVA 3FQSA 1P2AA 4L7FA 4EH4A 3O8UA 4I0TA 4X3JA 3GC7A 4FTQA 3LM0A 4MHAA 4QP7A 4KABA 3FUPA 2ZDTA 3TTJA 3C13A 3PPJA 5H8EA 4GMYA 5EG3A 3MFRA 4WIHA 5EI8A 4YU2A 4X2GA 4JBOA 3W18A 2GHMA 1FBNA 5DT3A 3LFSA 4FKRA 3PZHA 3U9CA 3RPRA 5A6OA 5I0BA 2VX1A 3TUBA 4QTAA 5E8WA 1CKPA 4PMTA 2X1NA 3VF9A 4P5QA 1WVWA 3W33A 1Q4LA 3UBDA 2G15A 3UMXA 4EH6A 3UG1A 4DCAA 1YRPA 2ZB0A 4GIHA 5K9IA 3UO5A 3R28A 5ITAA 2VU3A 3OOGA 3EKKA 4FIIA 3JVSA 3PWYA 1PXJA 4RJ8A 4KBKA 3Q2JA 4MAOA 4AWIA 1OIUA 1XKKA 2OSCA 3SXFA 2IW6A 3KF4A 3PIXA 1MP8A 4AGCA 4BDFA 4D58A 2IZRA 2R4BA 2PSQA 2BIYA 2X4FA 2YACA 1XH8A 2YWPA 3B2WA 4JG6A 4LM5A 3EFKA 3UJGA 3UVRA 3FHRA 2Y7JA 2YISA 3VS3A 4CZTA 4EK4A 2XVDA 1MRUA 3HGKA 4JR3A 4NW6A 2YAKA 4S32A 5I9XA 4JJRA 2WTKB 3DFAA 5ETAA 5CAOA 2CPKE 4EK8A 4DG2E 3DJ5A 4O0RA 4O81A 4CG9A 4CMOA 1OZ1A 3QTXA 5IPJA 3O17A 5BPYA 4FIJA 3ZCLA 4MF0A 3BYOA 4TYEA 3W55A 4GFGA 5D7AA 3PUFC 5HO7A 1XR1A 2C6IA 3BGQA 2QOIA 3VN9A 4FSMA 2FGIA 3D5VA 4RMZA 4XRLA 2PE0A 1M14A 4L3PA 1JKTA 2HY0A 5IMXA 2QOCA 5ETCA 5IA2A 2VWVA 3QTUA 3VUGA 3D7ZA 4E93A 3UNJA 3JXWA 3VO3A 3PP1A 3E88A 4FVQA 2BAKA 4BY9E 3JS2A 3QXOA 5DHJA 3EN7A 5HBJA 2R3OA 1SM2A 1XH9A 2YM4A 4LL5A 4D1SA 3MY5A 2C47A 4TYGA 1PXIA 5HVKA 3AKJA 2BRMA 4XG7A 3EL7A 1WBTA 3QZHA 1B38A 4LMUA 5LCJA 4GEOA 3OWPA 5EW8A 5FWKK 4CKJA 4BDBA 2JITA 3A61A 3P86A 2ZV9A 4YLLA 3AT2A 1ZZLA 2ETMA 1L8TA 4YUQA 4I5HA 3HP5A 4HYIA 3BYMA 1UNGA 4W8DA 3PVWA 2VO6A 2DUVA 2VTIA 4KINA 5FTQA 3QAME 3UNKA 4I22A 4F7SA 4L68A 2YCQA 3PSDA 4GK3A 5CASA 4XLIA 5KHWA 4FKQA 2AQXA 3W8QA 3EZRA 1ZAOA 2HZ4A 2QU6A 3L9LA 4FTRA 4ALUA 4KIKA 4E4XA 1IA8A 3ZZWA 2BMCA 3BIZA 3FHIA 5LVOA 3ZM9A 2XIXA 4RVMA 4HVIA 4OTQA 4BKZA 3GCVA 4I3ZA 4MD9E 4NUSA 5FM2A