3IW4A

Crystal structure of pkc alpha in complex with nvp-aeb071
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
339
structure length
330
Chain Sequence
LDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTREFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVFDKFFTRGQPVLPPDQLVIANIDQSDFEGFYVNPQFVHPILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein kinase C alpha type
publication title Discovery of 3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]pyrrole-2,5-dione (AEB071), a potent and selective inhibitor of protein kinase C isotypes
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 330
sequence length 339
chains with identical sequence B, C
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iw4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iw4A01
3FQSA 2R5TA 3QLFA 5DYJA 2C6LA 2R3IA 2BRBA 2UVZA 5AR3A 5A4EA 3NX8A 3MPTA 1Y6BA 5CF8A 3UVQA 3ZLXA 4C8BA 4ZLYA 5A46A 1Y91A 5AIRA 4NIFB 4LOQA 3WZDA 4JT3A 3RAKA 3LFNA 3ZXZA 4YURA 4FYOA 4J8NA 3WILA 4D5KA 3Q2MA 3SRVB 4L3JA 4QYGA 3I1AA 1JAMA 4DTBA 4W4YA 2CKPA 4DTKA 3TKIA 2RFDA 3PY0A 3KRWA 1CM8A 5CI7A 4JI9A 3KK9A 4YLLA 5AUUA 5CU4A 2GCDA 2X7OA 2WMWA 4F9BA 5C4LA 3H0ZA 4LUDA 4YZBA 5KHXA 2WMXA 3OMVA 4B0GA 3SXSA 4YHFA 1Q4LA 4G17A 5EH0A 4JDJA 4O83A 4ARKA 3UO5A 3COHA 3E8NA 4FKWA 5D11A 5CEPA 5GINE 2BDWA 3KXXA 4HZSA 4NK9A 5ANDA 5IH5A 5F1ZA 5JGBA 3ZSIA 4APCA 4M66A 1NVRA 4WRSA 3GOKA 1UU8A 4YJUA 5AA8A 1CTPE 2UV2A 4HVDA 3DKOA 2J2IB 1L3RE 2W1EA 3HYHA 3NW7A 3PVGA 4MBJA 4QTAA 3TNHA 4BDKA 4DGGA 3U6JA 4QPSA 3UQFA 3TUDA 2JITA 5EKOA 5HGIA 4DFUA 2GTMA 1H8FA 3HV7A 3QZIA 2EB3A 2P4IA 4FTIA 1WVXA 4I94A 4O27B 4Q2AA 3QTWA 3AG9A 4U41A 3RBWA 2BHHA 2ZB1A 3UZRA 4I23A 2XM9A 3IGGA 2JKOA 2BKZA 4J99A 4OBOA 3NW6A 4CFUA 4Z7GA 2X6DA 1IASA 3JS2A 2YM5A 2X1NA 4FICA 5T68A 3TIYA 2C47A 1FVTA 1BUHA 3AT2A 5L6WL 3TZ7A 3A7JA 3ZRMA 3QRKA 2Y4IB 2XEYA 5LARA 3BBTB 2B55A 2J9MA 2PZPA 5CAVA 3H30A 3FI2A 3ORPA 3FSKA 1KV1A 1J91A 3FL4A 3G5DA 5J1WA 2QODA 2UW7A 3ZU7A 3TV4A 2ZM1A 3U9NA 3QQKA 4NH1A 1QPDA 4TN6A 4TYEA 3QXOA 4IDVA 5AR2A 3OTUA 2OO8X 1KUTA 4JRVA 3F3VA 5AP5A 4KS8A 3OP5A 2OF4A 3GQIA 4X2NA 4IBMA 3KGAA 3MN3A 1Q8WA 5L3AA 2PZRA 5AV0A 2YLFA 2B9HA 5D41A 2CN5A 2XKDA 5E8ZA 4ZJVA 3I79A 4IX4A 5HU9A 5BNJA 5AJQA 3E63A 5ACKA 2W1DA 4D2SA 4BDDA 3DQXA 1PXNA 2HZ4A 1B38A 2VRXA 3MIAA 4HVIA 3MY5A 4GU9A 2WOTA 4RZVA 5HLNA 5IMXA 4IZ5A 3R7VA 4DA5A 5AM7A 2GHMA 3BGQA 3MH0A 3ZFMA 3QF9A 4Y83A 5EHLA 3RCDA 3OOGA 3OXZA 1K9AA 1OB3A 3QFVA 4ACGA 4KSQA 2VX1A 2VWVA 3TG1A 3R7OA 5C9CA 5DBXA 3LCKA 3LE6A 2GHLA 4ZZOA 5AUYA 1REKA 3OCSA 2GQGA 2C3KA 1P14A 1ZMUA 4YSMA 1ZOHA 2YWPA 3Q5IA 3UOLA 1WBPA 4YSJA 5M56A 2OKRA 5JH6A 1Q5KA 4MH7A 5L8LA 4Z7HA 5L2SA 3QYWA 3DAJA 5CS6A 4W8DA 4R1VA 3VULA 3Q53A 4FG9A 4AP7A 2UW6A 4NTSA 4IW0A 4ZY6A 4FSTA 2QOKA 3OOMA 1I44A 3D2KA 4X2JA 4BVUA 5H9BA 2C68A 4E6QA 3U4UA 4K0YA 4ZS4A 3E64A 5K3YA 5J9LA 4PNKA 1UU7A 2YIQA 1M14A 4H3PA 5L2QA 2C5NA 3PPJA 1DS5A 1JKTA 2Y6MA 4N0SA 2R3NA 3ALNA 3C4WA 3IW6A 2VWYA 4KINA 4I6BA 3U8WA 2ITPA 2VTQA 2X8DA 5FDXA 2PMIA 4RA4A 1R78A 2JDSA 3PLAE 2XK6A 1CMKE 1ERKA 3OXTA 1SVHA 4QMMA 3DXPA 3AD6A 3BRBA 2GS6A 1YI6A 4HNFA 3WIKA 4C58A 3LQ5A 4FA2A 4ANBA 4FZ6A 5HOAA 5HIEA 4U8ZA 4XV3A 1PMEA 4D4YA 3KXNA 2C1AA 4GG5A 2VTRA 1ZOGA 4AT4A 2CHLA 3PXZA 1BI7A 3C4EA 4LQMA 3NUAA 3N4TA 5KE0A 1VJYA 2ITZA 2QO2A 3DB6A 4AGCA 5HTBA 5GIPE 1G3NA 3O8TA 3MIYA 2QG7A 5E8TA 4M68A 3C0GA 3LM0A 4QP8A 2ITTA 4XG9A 4D1ZA 4P2KA 4XG8A 3E7VA 5JQ5A 3LXKA 4O91A 3E62A 3BQCA 3UODA 5FBNC 4DH8A 3ORXA 2C5YA 1FPUA 4XG3A 4WG5A 3V3VA 4CZYB 2QVSE 3F5PA 1Z5MA 5A4TA 1QPEA 3VWAA 2R3KA 4CKRA 4A7CA 5IH4A 4NWMA 5I9UA 2OH4A 5EW9A 4C38A 2YIYA 2F57A 2AC3A 2IWIA 3MS9A 3OCTA 4FTKA 1FOTA 4ZEGA 3FQHA 5JRSA 5BYLA 1JNKA 4EOKA 2C3LA 1U46A 3A60A 3TZ9A 3P79A 3LVPA 3EQDA 5HVJA 5FTQA 4FC0A 2UZUE 4X0MA 3DB8A 4RIXB 4C59A 3VS6A 4QMQA 3BX5A 5KO1A 2R3QA 1O6YA 4J97A 4QTDA 2OGVA 4YNEA 3COKA 3QTZA 5IU2A 1PXLA 3PIYA 4O0VA 3E87A 2WO6A 4PQNA 5A14A 3MVJA 2XKEA 4O0RA 4PPAA 2JIIA 1GIIA 5CSWA 4R6VA 2BROA 3P0MA 2WMUA 2VU3A 2JDVA 3I5ZA 1ZZ2A 4AN9A 4E1ZA 4FVRA 1P2AA 4H39A 4V01A 3ANQA 3OF0A 3GCPA 3K3IA 4FKUA 5D1JA 4ZMFA 3OY3A 4KBCA 3TZ8A 3HX4A 3P1AA 5EW3A 3PIXA 3D5VA 5E8WA 5LWMA 4MX9A 4XUFA 5B2MA 4DCAA 5DPVA 3R00A 5E1SA 3W55A 4AA0A 3ZSHA 3ZM4A 3KCFA 2ZMDA 4FTAA 3MVLA 4RIWB 3FEGA 4FI1A 5E92A 5JMSA 3GCQA 2YZAA 4CYJA 1PRYA 3IDBA 3R9HA 2OJ9A 4RVKA 3VW8A 3SVVA 2W1HA 4FT7A 3W2OA 1WBVA 5ETFA 1STCE 3CY3A 2IJMA 2JDRA 2EVAA 5DI1A 3FLQA 2BZKB 4HGSA 4EORA 2RIOA 4FIGA 3PZEA 5HE3A 3EFKA 2CKEA 4M84A 2UVYA 4R7HA 3LIJA 3MESA 3OFMA 1PHKA 3DFCB 5AR4A 3AMAA 3EQGA 3HECA 3O8UA 4RRVA 3IQ7A 4OBPA 4USFA 4RWLA 5KBRA 2VTNA 4JG7A 4H3QA 5BVDA 3NNUA 3HP5A 3ANRA 3A4OX 4C2WA 4BHZA 3HUCA 5AV2A 4ZSEA 4CTBA 4D2PA 1SM2A 4QYFA 4EKKA 1OZ1A 2XIKA 4FV1A 3ZRLA 1OIUA 2ZM4A 2P55A 5AEPA 1H27A 4BFMA 5KMIA 1WAKA 4BDCA 3EQRA 1GZ8A 4KNBA 1Z9XA 4JX3A 2R3MA 4FT3A 1XH4A 5I9XA 4JVGA 3BU6A 2PVMA 4IZ7A 4D9TA 4E6AA 2ACXA 3C0HA 2CDZA 4JXFA 4ZTLA 3BWFA 1BL6A 4C3RA 4W4WA 4FTNA 4F99A 4F1MA 4KIOA 2HZNA 4KIQA 4OTRA 2BILB 3ORLA 4B8MA 5FEEA 3MY0A 2ITNA 4WD5A 4FTOA 5H2UA 2QR7A 2YACA 4YTIA 4DEIA 3TTIA 3Q5ZA 3MTFA 4WOVA 3I60A 3FYKX 4JBVA 2XNGA 3WZUA 5CEOA 4ZTRA 4PL3A 5EOBA 3DA6A 4RX8A 4X7QA 3DBDA 2XZSA 4MQ1A 4AGDA 1ZRZA 4XS2A 4H05A 5EI8A 2FSOX 2R7BA 4XG2A 2VNWA 3NMUF 4UMRA 3DJ6A 3FDNA 2X0GA 3EN6A 3I81A 4XBRA 4DFLA 3FMMA 4GS6A 2IPXA 1KE9A 3LJ2A 2HZ0A 4I6FA 3JVSA 4FTUA 4AA4A 5C26A 3VQUA 2CPKE 3EHAA 3F7ZA 4CG8A 4PTCA 4BCIA 1V0BA 3W33A 2QOQA 3UIMA 4CV8A 1H1WA 5H3QA 3I7CA 1BKXA 4IX6A 4IHPA 5TO8A 3TTJA 3UOHA 4QP4A 3NYXA 3SW7A 4U44A 4EK3A 5DRBA 5JFWA 3VBWA 3P86A 2YM7A 3E92A 2Y8OA 2XYUA 1YDTE 4OAVB 2WFYA 2XK9A 1W82A 3IG7A 2BCJA 5JGDA 3FMNA 4R3PA 3TV7A 1JSVA 3VBTA 4MYGA 3A4PA 2ZV8A 4XP3A 4FIHA 2P33A 3PVUA 4FIJA 2OFVA 2Z60A 2PZIA 4UB7A 1OMWA 5L8JA 4QMNA 4MF1A 5HCXA 4C2VA 3V01A 2A27A 3D5WA 2XS0A 3MTLA 2AYPA 4QPMA 3W2PA 4CMOA 2GQRA 4L00A 2QOOA 4G16A 4JQ8A 4FX3A 4YNOA 3QD3A 2Z7LA 4FV2A 5JK3A 4NCTC 4MD8E 2RFEA 5DR6A 1UKHA 3G2FA 5EM5A 4ZY5A 4FV4A 4RSSA 3HAVA 3OUKA 4RJ3A 2R9SA 4BIEA 2ONLA 4JAIA 1G8AA 2HXQA 3R02A 3EQPA 5AADA 2UZBA 3HEGA 3ATTA 4QMOA 4CLIA 1OIQA 4C4EA 4AACA 4YHTA 2ZVAA 2DYLA 2CNVA 4AOIA 1WBTA 4DEBA 4JDIA 5I0BA 2O63A 1T46A 5BUIA 1RDQE 4F09A 2UZWE 1QMZA 3AMYA 5HVYA 2HXLA 4HVHA 1JSUA 2WU7A 3F5GA 3HP2A 1Q24A 2PMNX 3ID6C 5I9ZA 2QOCA 4QMZA 1H28A 1GY3A 2CLXA 2W5HA 2LAVA 3EJ1A 2R0UA 5FBOA 3TKHA 1U54B 4YZMA 3R8UA 4A07A 2DQ7X 3BE2A 4IZAA 3DK3A 4EHZA 1ZLTA 4BCKA 1XKKA 3OW3A 3HV3A 4RVMA 4L7FA 3G6GA 3QRUA 4A9TA 3S0OA 4I20A 2OLCA 4GKIA 1ZOEA 5CSPA 4L43A 4V0GA 3C51A 3FAAA 4MNEA 2OZAA 3MV5A 5J9YA 2WU6A 2ZAZA 4C34A 3ALOA 3R8MA 3GC0A 3RPYA 2IO6A 1ZZLA 3ZH8A 2Z7QA 5FP5A 2QOHA 4OTWA 3WOWA 4UX9A 3MFUA 3DLZA 3Q4CA 3W2SA 4FSZA 3PXFA 4QP9A 4QP6A 4EL9A 1Q3DA 3R30A 3F66A 3LFAA 5J9ZA 3PPKA 4JG8A 4EQCA 2IVSA 5BYZA 3PZHA 1BMKA 1E1VA 3JVRA 4EH5A 4FK6A 5CNOA 3V5PA 2WMSA 4PMSA 4CT2A 1L8TA 2ERZE 2OXXA 2RF9A 3HMPA 1ZYLA 1WCCA 2C6IA 4D0XA 4ZLOA 4YTCA 3PP1A 1WFCA 2O8YA 4DCEA 2VO0A 3R7YA 1A06A 4EHEA 3EYGA 4EH9A 2V5QA 4U3YA 5M4UA 4NL0A 1MUOA 4IQ6A 2X4FA 1M7NA 2PVNA 3WF5A 3D7TB 2GDOA 3FC1X 4KB8A 4W4VA 5ANKA 3H9RA 2OIBA 4TWCA 5GHVA 3LMIA 2E9PA 5D9HA 4ZY4A 4OTIA 4I6HA 5AUZA 4CKIA 2W17A 3TJCA 4N6ZA 2XEZA 3HMIA 3GNIB 4OGRA 4EOIA 4FVPA 5FDPA 3R7GA 4OUCA 4BYJA 4MXYA 4EH3A 3OROA 4H3BA 3CQWA 2IZTA 2AC5A 2JD5A 3ZUTA 2JEDA 3CIKA 3DAKA 1T45A 2JIVA 4YZNA 4HW7A 4DF3A 2J5EA 1RQQA 3M11A 3MFTA 4QMSA 4WNKA 3FL5A 3WI6A 1Q62A 4FZAB 2QG5A 2X7FA 4PMTA 4KBKA 4BTJA 3F6XA 3GC8A 4ZTNA 3BU5A 3R2BA 4FV9A 5DH3A 2B9JA 2FVDA 3I0OA 3DK6A 3IK3A 4L3PA 3RALA 4DGNA 2PYWA 3IW5A 2PU8A 1FVVA 4MWHA 5TF9A 4G5JA 4R5YA 3FLSA 5ANGA 3HMNA 4TYJA 5F94A 1IAHA 2O2UA 3GUBA 4OTDA 2CCIA 2YFXA 3HGKA 4FV6A 5AP6A 3MFSA 2XM8A 4RX5A 5ITAA 3OD6X 2NO3A 3ELJA 3GU5A 2VTAA 1H01A 3MJ2A 4FKRA 4J1RA 1YHVA 5BMMA 4QTEA 5CAPA 2FH9A 3BHTA 4K11A 4J95A 4RIOA 2BZJA 3EN4A 5HCZA 4DGLC 3PA5A 4WBOA 5ETIA 1K2PA 4CVAA 5BVKA 1H08A 3GCUA 3VUKA 4C02A 3S2PA 3ORKA 4KS7A 3FPQA 3UNJA 3EQBA 4FIFA 5IA1A 2PMLX 2WNTA 5LVNA 2FA2A 2BZHB 3LMGA 4HNIA 4O7VA 1BLXA 2BAQA 4AGWA 1XHAA 3PA3A 4NEUA 4DEHA 4J53A 5IQFA 1BI8A 2WTKC 1M52A 1AD5A 3SOCA 2X6EA 4Z55A 2Z02A 1ND4A 3F5UA 4ANSA 4CQEA 1J7IA 5EW8A 3RAIA 1H1QA 5JT2A 2WTJA 3TL8A 4PTGA 1URCA 2G2HA 5C01A 3EZVA 4K33A 4R78A 3QCSA 5HKMA 3VF9A 4DN5A 2WOUA 3NGAA 4UWCA 4ENYA 4BTMA 4O7WA 4GFMA 4HGEA 4LOOA 4BDHA 4M69A 4TWNA 4K9YA 3HDMA 3KMUA 3KF4A 5EHOA 4I0RA 4BGGA 3ZCLA 4IWQA 5E7RA 4ANMA 5LXMA 4U0IA 3PVWA 3OWKA 2XB7A 3D5XA 4BWPA 3D0EA 4EH2A 5B0XA 4OBQA 3UMWA 3DQWA 3MGYA 3FBVA 4APPA 4JBPA 1PF8A 3QTQA 5CU2A 3O8PA 3R73A 1PXMA 5LVPA 3A7FA 4IAFA 3QTUA 4J98A 4NFMA 2QD9A 4I21A 2XRUA 4EONA 4R77A 2FO0A 4Y85A 4IWDA 2OJFE 2XNPA 5GJFA 2IVUA 1TVOA 3FY0A 5EYMA 3DFAA 5LMAA 4D0WA 3VS4A 3KRJA 5KZIA 4E20A 4IIRA 3WBLA 3RM7A 2E9OA 1ZXEA 3UC3A 3PXYA 3OY1A 5FRIA 4RC3A 3FHRA 4B8LA 5M4IA 3KVWA 4GT5A 2PVYA 3D2IA 5E8YA 4IB1A 4EKLA 3OT8A 3ETAA 1Q41A 2VTMA 1DM2A 4DFXE 1EH4A 3COIA 4MXCA 1XBCA 4LGHA 3K2LA 2WQNA 3WZKA 3TNIA 3GBZA 4HCUA 3ZYAA 2NRYA 2VN9A 2W9ZB 3BGZA 3G90X 4EYMA 2YM6A 3FC2A 4HOKA 2J6MA 3KK8A 5AUWA 5KMKA 4P5ZA 2OU7A 5AUTA 2WZJA 3FE3A 5IG1A 1BX6A 4DGMA 5JSMA 4EH7A 3KB7A 1WVYA 3U55A 4IVDA 4JIKA 4QT1A 3EN9A 4C4JA 1XBBA 3LOKA 3WYYA 3HDNA 2GQSA 3B2WA 3AGMA 2PULA 1PXKA 2YHVA 2BRGA 5GZAA 3FV8A 2YM8A 2WAJA 2XK3A 4L3LA 2XNBA 5CI6A 4NM5A 4FEUA 4XRLA 1XR1A 3MH1A 3QGWA 4ASDA 4XP2A 3MA6A 4XG6A 3C1XA 4FEQA 3FXZA 4U6RA 2QOIA 1IA8A 2B9FA 3CGFA 3RVGA 2WMAA 4MNFA 4YTFA 3QTXA 4MEDA 3MPMA 4MWIA 3U51A 4A4XA 4ZJJA 1H1SA 4BHNA 4F7JA 3CPBA 3M42A 4GH2A 4K6ZA 4OR5A 4Y73A 1GNGA 5AP7A 2WTDA 3UG2A 5IISA 3HA8A 4FKVA 4F7SA 3VS5A 5LVMA 3GB2A 4AGUA 4EEVA 3TNWA 3GU8A 4E4MA 4MBIA 5AP3A 1OIYA 4O7TA 4IWOA 1MQBA 5HG7A 4F1OA 4BTFA 1Y57A 1IG1A 4USDA 1JVPP 2GU8A 2W0JA 2Z7SA 4TPTA 5DEYA 2OZOA 2PZYA 5BVFA 1OUYA 4GIHA 4BCQA 1GIHA 4TWPA 5KUPA 1YHSA 4CLJA 4AW0A 2OFUA 3K5VA 3T9TA 3ZO4A 1VR2A 4Q5HA 3RK7A 4CGAA 5IQEA 4GUEA 1OL6A 3WYXA 4A06A 4MXXA 5L2WA 5C03A 2XP2A 4E4LA 5JFXA 3BV2A 3Q9ZA 4M67A 4UEUA 4OTGA 4ZTQA 1U5QA 1WBOA 1MRUA 4IAYA 4BY9E 1Y8GA 2HK5A 4IM3A 5CT0A 2W4JA 4BI1A 3G0EA 4AZFA 1YOJA 4QOXA 4N70A 5L8KA 4D2VA 2BTRA 2HELA 3FZPA 2XKCA 3W2QA 4F64A 4Q9ZA 2R3FA 2EXEA 3VAPA 1PKGA 2EXMA 3DZOA 3SDJA 4G9RA 4AFEA 3BHUA 2CGXA 2PVLA 4GEOA 3NWWA 1Z57A 5B7VA 3W2CA 4IACA 3MPAA 4A4LA 3NYNA 3RPRA 4G3GA 4ONAA 4JDHA 1RJBA 3NAXA 1XH6A 4QP3A 1P4OA 4IC7A 2VWIA 3QCQA 5IDNA 4N57A 5E8XA 4BZNA 5AR7A 3F5XA 4ITJA 5IMEA 3DNEA 3EQCA 3ENHA 3ZSGA 3FXWA 1DAYA 5CSXA 1TQIA 4DLJA 3R71A 4OT6A 1SMHA 4PNIA 4BKYA 4D1XA 3UQGA 4ID7A 3DNDA 3AT4A 4O86A 5IEXA 3JUHA 4FV7A 4NM7A 4EZ5A 1PKDA 4UXLA 3QKMA 2JDTA 4KIPA 3R9NA 5I3RA 5H8EA 2R3HA 5CEIA 4B99A 2PE2A 4PF4A 4CMUA 1REJA 5LCJA 4YJTA 4C36A 1UKIA 4O2PA 3MH2A 3BQRA 3O0GA 3OWJA 4IVAA 2JLDA 4RWIA 3VBYA 3JXWA 3WIGA 4S32A 4B4LA 4Y5QA 3R7EA 3TN8A 3VQHA 1OPJA 5DG5A 5DRDA 4AAAA 3CTJA 3E8EA 2PTKA 4RGJA 5H8GA 3KL8A 4IX3A 2GFSA 5CVGA 1O6LA 3GFWA 3ENMA 2XNEA 3PTGA 3FI3A 3R04A 4J7BA 4LG4A 4QTBA 4QYEA 5JN2A 1J7LA 1FMKA 3BLHA 3PLSA 3KN5A 4HCVA 4EOPA 3BHVA 4IMYA 4QTCA 3TT0A 1W98A 3FSFA 4MQ2A 3UPXA 1FQ1B 2HZIA 4FV8A 3D94A 4AW2A 4LYNA 4EK8A 3D4QA 5IH6A 3C50A 3GEQA 4Z3VA 4FTTA 4XOZA 4F1TA 5HLPA 2JIUA 2Y4PA 1PMVA 1XH9A 4ZOGA 5I9YA 5K5NA 2GS2A 4G3DA 3T3VA 2WTCA 3IDCA 3P9JA 3UYTA 5CF4A 5M53A 3CKWA 5HBEA 3FLZA 3BHYA 3CJGA 3KULA 5HICA 3DBCA 1DAWA 3DGKA 4UWBA 3G9NA 3F61A 3NS9A 1OKZA 3W16A 4BKZA 2BKKA 4PDSA 4AF3A 5HVKA 4OTQA 4QMLA 4FBXA 3MJ1A 5K5XA 3JYAA 4FIEA 3FI8A 3VS7A 4NIFA 1H4LA 4UY9A 4ACCA 5CASA 1JWHA 3ORTA 2QNJA 4XBUA 5C27A 3SRVA 4FYNA 4L68A 2CCHA 1R39A 4BI0A 3TEIA 2O5KA 5CQWA 3MYGA 2YITA 3UBDA 5ETAA 3VUTA 4F6WA 1JKLA 2WEVA 3FLWA 2W1FA 4MVFA 4XRJA 4BICA 3PE1A 4XP0A 2JKQA 4A9YA 2PE1A 2UVXA 5AAFA 4ORKA 4ZP5A 3ZONA 5AP0A 2EB2A 2XBAA 3F3UA 3OCGA 1URWA 4PRJA 4U79A 4G6OA 4JBOA 1Q99A 1JBPE 2VAGA 2VWXA 2PK9A 3P08A 4TW9A 3UIBA 3WE8A 4F9WA 5DT0A 3OG7A 3Q9XA 2VWBA 3O23A 4DT9A 4RJ5A 2G1TA 3NNWA 3POOA 3Q60A 2QURA 4Q9SA 3OHTA 4QYHA 5KNJA 1NXKA 2C3JA 1TQMA 1YOLA 2FYSA 4BDGA 1YWRA 2XCKA 1YDSE 5I4NA 1M2QA 3LJ0A 4FZFB 4YHJA 5IQBA 2UZNA 4EBVA 4TL0A 2IVTA 1B39A 1KWPA 3IDPA 2RFNA 3L9NA 3KREA 5DMZA 4NKAA 3NZ0A 2UZDA 2YM3A 3QHWA 3DXQA 3B8RA 5BUJA 1R3CA 3MVHA 5J8IA 3A61A 3FYJX 4RWJA 4EK5A 4BYIA 4V04A 3HL7A 4J71A 4NUSA 2ZV7A 4YZCA 5E8VA 5M07A 1JQHA 1R0PA 2ETRA 3EYHA 3E5AA 4G34A 3RKBA 5CEKA 4PMPA 4DYMA 4JR3A 3FZTA 4UV0A 4S33A 5CQUA 1RE8A 2X2LA 3FLYA 3TZMA 1V1KA 2O65A 4FZDB 4BCMA 4MAOA 4QMYA 1XO2B 4GL9A 5TR6A 3DDPA 3R1YA 4BL1A 5AP2A 1OITA 3IPHA 3PP0A 4IB3A 2R2PA 4LI5A 2GNGA 2UW0A 4H36A 5CLPA 4BCPA 3GVUA 2C6MA 3H10A 2GNLA 5B2KA 5IQAA 4F6UA 4CXAA 1UWJA 4RC2A 1RW8A 3HZTA 4AW5A 4R3RA 2QKWB 4BCGA 4QRCA 4CFWA 2A1AB 2F7XE 2HCKA 4KIKA 1V0PA 4CMTA 4TNDA 4A9RA 2YDJA 4BKJA 3LCSA 4DEDA 4GYIA 4AT5A 3RZFA 2ZDTA 3ZRKA 4YR8A 5C8NA 2PVFA 1AQ1A 4O21A 3UZTA 2WTKB 2J0KA 4QP7A 3OZ6A 3Q9YA 5DNRA 4ASXA 3V5WA 3PDTA 3A99A 2JKKA 4BCNA 2Y0AA 4G1WA 3C13A 5E9EA 3ZEWA 4QQCA 3AC5A 4EJ7A 2H34A 1M17A 2OW3A 2UUEA 4PMMA 3V04A 4YJOA 4LGDA 1JOWB 5AX3A 4E5BA 4DTAA 4IAIA 4MXZA 1ZAOA 5FTGA 1KE6A 3Q4UA 3R8VA 4FOBA 2XIZA 2C6DA 4AUAA 2XNNA 1QPJA 2B52A 4FEWA 4FIIA 5AMNA 2VTPA 4EH4A 3U4WA 4PDOA 4C4HA 3R9OA 3SG9A 5A9UA 2VTJA 3PXQA 2C5VA 2J51A 3QBNA 4GG7A 2PUIA 3LQ8A 1UNGA 5A6NA 2P3GX 2VTLA 3BEGA 3PE2A 2CGWA 5CZIA 3AQVA 4O7SA 3MBLA 4JJRA 4AE6A 2OIQA 5AUXA 4WG4A 5FG8A 4D5HA 5IQCA 5F9EA 3NR9A 4MK0A 3A7GA 5BMSA 1OBDA 3CY2A 2Y6OA 4ERKA 1PW2A 4LMUA 4PPBA 4OTHA 5TE0A 3R6XA 4M8TA 5AR8A 5CSVA 4ZIMA 4AU8A 4PV0A 4QP2A 5HG5A 5CU3A 3V51A 1OECA 4FGRA 3BELA 2R3RA 2W1IA 3AGLA 5GZ8A 1HOWA 3RPSA 3ZHPC 1LP4A 4QNAA 4CZUA 1YXSA 3BHHA 4NW6A 3F9NA 1HCKA 3LHJA 3KQ7A 3E7OA 4FNZA 4KWPA 3COMA 4ASZA 3HAMA 5G1XA 1ZY5A 3QRJA 2B0QA 1WBWA 4XYFA 2JBOA 2OWBA 4YU2A 1W0XC 4FKGA 4MD7E 2VTIA 3Q3BA 4IVCA 4TYIA 4MBLA 4WT6A 4BCFA 3ORIA 1O6KA 3I0QA 5IA4A 3QRTA 4C0TA 4GK4A 2GTNA 3V8SA 2BHEA 5L2IA 4QQ5A 3LKMA 2PVHA 2J0JA 4V0GB 3B2TA 5TT7A 5F20A 4MNEB 5EG3A 3U87A 4AW1A 3CE3A 3NEWA 4FSWA 4BCOA 4YMJA 4RBLA 2W1ZA 4OAUC 5K0XA 3WF7A 1F3MC 3E3PA 2YAAA 5K4JA 2UW8A 5IQIA 3POZA 4FTQA 5KKRC 4D4SA 3K54A 1Q8ZA 3CCNA 2R4BA 2J90A 2WQOA 3DU8A 3LFDA 4IM0A 4W8EA 3ZO3A 2UW3A 4UZHA 4ACMA 3E93A 4O6EA 4QMWA 4HYHA 3ODZX 2BPMA 3RP9A 3HVCA 5T6KA 2GMXA 1KE8A 3AC4A 4RZWA 3P7AA 4C57A 4CG9A 3UP2A 3FKLA 1JKKA 3BZ3A 3C4CA 3PSDA 4RIXA 2J0LA 1TQPA 4YJSA 3R0TA 4A9SA 3QC4A 4A9UA 4FL1A 3CD8A 4FV5A 4YJPA 4EWQA 3OEZA 5HBHA 4BR3A 1Q97A 5J87A 3DDQA 5EQYA 4FTLA 4FG8A 3CQUA 4WA9A 4XG4A 3KFAA 4HYSA 3LQ3A 2XK8A 4I5PA 4GFGA 3QWJA 4WNOA 2OI4X 4DG0E 4ENXA 3IW4A 2R64A 4WSYA 3ZLWA 3LFBA 2EXCX 3F3ZA 3PRIA 5L6PA 1OUKA 2EU9A 3QWKA 4DFBA 5LWNA 4DEEA 2B54A 4XV9A 2BDFA 1H1PA 5CEQA 3RCJA 5M09A 1ZWSA 3H4JA 2B4SB 4DEAA 5M55A 2QC6A 3LW0A 4JAJA 1IA9A 1OGUA 3NUSA 1YQJA 4QO9A 5IQGA 2G01A 4F0GA 1J1BA 4D28A 3QUEA 2GPHA 3D5UA 3Q6WA 4XEYA 3V5LA 4AE9A 5HIDA 3QLGA 3DTCA 3IKAA 4E7WA 4ZZMA 1KOAA 4OTFA 3CPCA 4YLJA 4LGGA 4PWNA 2ETKA 2OSCA 2WIPA 4Y72A 3D15A 3UGCA 3ATSA 2JKMA 5CXZA 5CX9A 4IWPA 2I0EA 2ZV2A 4L53A 2VTOA 5EYDA 5A6OA 3U6HA 3F82A 5C1QB 4BN1A 3DBQA 4WHZA 3OS3A 1NY3A 2SRCA 4C37A 2DS1A 4BIDA 3DKGA 3UVPA 2I0VA 2YJRA 5CSHA 2CMWA 4AZWA 5EKNA 1LUFA 4U5JA 5DOSA 5KHWA 1M2RA 1HCLA 2VUWA 4C3PA 3A7IA 4CKJA 4CSVA 4OTPA 3LCOA 4I24A 5IQHA 5KMNA 3MA3A 4B6LA 5FEDA 5KMOA 3EMGA 4O7RA 3L9MA 2PVRA 3TI1A 1SVGA 2OJGA 3QD4A 4G9CA 4IFGA 1NVQA 2X4ZA 4X21A 3EWHA 4UMQA 2JGZA 4DH3A 4ACDA 4X3FA 3C5IA 4YJQA 4O0SA 4LM5A 2A19B 3QQJA 1H24A 4FZ7A 3LXLA 4C7TA 4DH7A 3UOJA 4G31A 1FMOE 3S00A 2CNQA 5AX9A 2IW8A 1DI9A 3CQEA 4HGTA 4AZTA 4I1ZA 4X3JA 1UNHA 3JY9A 2WMVA 4RJ8A 3GT8A 5IUHA 2Q83A 5LOHA 3O17A 3RGFA 2VTSA 2XYNA 4ZTHA 4E3CA 4Z16A 4JL9A 3S4QA 3C4XA 4Y8DA 2V7AA 4CRLA 3REPA 2WQEA 3UJGA 1CDKA 3HKOA 2ITUA 3OVVA 4MXOA 3FY2A 4O2ZA 5BX0A 3AT3A 4CYIA 4K18A 4JR7A 3R8ZA 3S1HA 4FOCA 5LMKA 1YI4A 2E9VA 4GT3A 3HUBA 5GZ9A 1Y8YA 2P0CA 4YUQA 2NRUA 5D7AA 1VYZA 2BAKA 2W1CA 3F69A 5D7VA 3ZZEA 4EQMA 4O7LA 3AD5A 1H0WA 4MHAA 4ITIA 5FEQA 3FMJA 4G3EA 3QTSA 3CD3A 3PJ8A 3QL8A 4BDEA 3AC3A 5AAGA 3NUXA 5A3XA 3WF6A 4ZSGA 3EKKA 4FMQA 4RJ6A 5HE0A 2YWVA 2RKUA 5KZ0A 4D2TA 4M12A 4ANOA 1QL6A 1LPUA 3KRXA 5HHWA 3ZEPA 5IPJA 3K5UA 5HO8A 3UTOA 2WXVA 4HYIA 2R3GA 1APME 2UW4A 3D14A 3L8XA 4I0TA 4JS8A 5HE2A 4CFNA 3QC9A 2XIYA 5AP4A 2OXDA 4PUZA 5E8UA 4EUTA 4W9WA 3PFQA 3R8LA 4YJNA 5KCVA 4I93A 4ERWA 4YBKA 2ITWA 4TYGA 1FVRA 2QO9A 2VX3A 3FMHA 3FMDA 2ETMA 2UZEA 4U40A 3H9FA 3LXPA 4ANNA 2Q0BA 2XVDA 4MKCA 4BF2A 4F0FA 4X6RA 1PMNA 2BZIB 2FB8A 2YERA 3F2AA 2YA9A 3ERKA 3VF8A 3NVKI 4LV5A 2W99B 1CKPA 5IA0A 3QHRA 1SYKA 4UWYA 1X8BA 1LR4A 2GHGA 5M51A 3L8SA 4CFXA 4YTHA 3ZM9A 5HIBA 2JDOA 2P2IA 3V5JA 3WF9A 3MW1A 3ZC6A 3SKCA 4E26A 2WMQA 2XIXA 3R1NA 3HRBA 4L42A 1WBNA 2HW7A 4FTMA 5TOZA 4YC8A 5K0KA 1H1RA 5IUIA 3IS5A 4II5A 2HWOA 4BDJA 2IW6A 4R3CA 3I4BA 4IVBA 5HESA 1OKYA 4BBEA 4IXPA 1A48A 4NSTA 2WIHA 3OBJA 3R7IA 3OWPA 3P7BA 4KAOA 2X2KA 5C8KA 2X81A 2V7OA 3EZRA 4EOOA 3FMEA 4O0XA 4FSNA 2XIRA 4CFMA 2WGJA 2A2AA 2QKRA 5M57A 3GC9A 4JQ7A 4RX7A 3SAYA 3UOKA 3KC3A 4FKSA 3QX4A 4FF8A 4F70A 5HZNA 4YC3A 1BYGA 3GU4A 4F63A 2PWLA 4FSRA 1YKRA 2XRWA 4XV2A 2KTYA 3IW8A 1I09A 2F4JA 5CNNA 2WQMA 2QONA 4NJDA 2F2CB 4G3FA 4GK2A 4RPVA 3UPZA 4PDYA 1PYXA 4OW8A 4QPAA 3ZUVA 5DA3A 3R9DA 5AM6A 1NA7A 2C5OA 3MB6A 3W32A 5HX8A 4S31A 4RWKA 4H1JA 2J4ZA 2H8HA 4UBAA 2ERKA 1W83A 5F95A 3T3UA 1KE7A 4ITHA 2XH5A 3A7HA 5ETCA 5M08A 4FKLA 5CZHA 3NUYA 3OW4A 5FP6A 5HNGA 5BVWA 4HGLA 1OKVA 3KXGA 3T8OA 4I5MA 1QPCA 3QCXA 3V5TA 4IE9A 2WTWA 4TRLA 3W1FA 2X9EA 2ONLC 2BDJA 4RVLA 2YM4A 3EL8A 3QA0A 4FE2A 4EHVA 2CKOA 1MRYA 2JC6A 3HNGA 4BZOA 1XWSA 4UXQA 4DINA 4YPSA 5K9IA 4FTCA 4IB0A 4EQUA 4GJ2A 3CBLA 5EM6A 4QQJA 1LEZA 2V22A 3LJ1A 2YIXA 4ALUA 4L45A 5B2LA 3FUPA 4TXCA 3HV4A 4BI2A 3D9VA 2PUNA 2QLQA 2W96B 2HYYA 3VRZA 4X6QC 4DG3E 2WQBA 3MY1A 3F88A 4C4IA 1B6CB 2G15A 3CXWA 1WZYA 4EOJA 1FGKA 2B53A 4GJ3A 4O7NA 2ZM3A 4IZYA 5J1VA 4FEVA 4KABA 1UNLA 3CP9A 4JDKA 3SXFA 3VC4A 4CQGA 4AG8A 3QTRA 2C3IB 3P7CA 4FKIA 4JQEA 3F3TA 3OC1A 3ZS5A 3PPZA 4FUYA 2UZLA 4CT1A 3Q32A 3HMOA 3L9PA 5M4CA 3S95A 4TWOA 4AZEA 3SA0A 3OUNB 3R2YA 4C3FA 4H58A 2FSMX 4UYAA 5IF1A 4GIIA 1PXIA 3A8XA 3AC1A 3C4FA 3KU2A 3NUNA 3QALE 4RJ4A 4NW5A 4NKSA 5LVLA 4IM2A 1XJDA 3OXIA 3WF8A 2VO7A 3FHIA 3PXKA 2XCHA 1OM1A 2QOBA 3G51A 4F9YA 4RJ7A 3V8TA 4GVJA 3H0YA 2UW5A 4EJNA 5HG9A 2VZ6A 3EN5A 3OEFX 5J7HA 3C7QA 1F0QA 1CKIA 1YXTA 5GJDA 4L6QA 4YPDA 2YISA 3EOCA 3LFSA 4I22A 1YXUA 4C4GA 3Q4ZA 2QCSA 3ODYX 4S30A 4DLIA 4I92A 2V55A 3GXLA 4JLCA 5E1EA 4A4OA 4IJPA 3P5KA 2FSTX 3C0IA 1PJKA 2X7GA 4RFZA 3VUHA 2BIKB 2XK7A 3QQFA 3N4UA 3PJ2A 2HW6A 3D83A 2GFCA 1ZYJA 3ZFXA 4ALVA 2I40A 3R21A 2GNIA 4M0YA 3G33A 3M2WA 4QNYA 1NW1A 3JR1A 3VUMA 5KMMA 2FSLX 4TYHA 3VUDA 3TUBA 1IAJA 4ZLZA 3UO6A 2E2BA 3VRYA 2C6OA 3GOPA 5CXHA 3TNQB 4G6LA 4GFOA 4RIYA 4BC6A 1XH5A 4QMXA 2VTTA 3MI9A 4FNXA 3IW7A 1CSNA 4DHFA 4Y5HA 2UZVA 1ZMWA 2BRMA 4D55A 4G2FA 4M14A 3ZC5A 2XNMA 3Q52A 4FODA 3VUGA 3O96A 4RLLA 5JFSA 2VNYA 5C4KA 2JAMA 3E8DA 3GU6A 3ROCA 5A4QA 4O0TA 4QMUA 3KVXA 5HTCA 3U54A 1R0EA 4ZJIA 4HJOA 4ACHA 1Q8UA 3RAWA 5CYIA 1XH7A 3TIZA 5KKRB 2ZJWA 3A62A 3RJCA 3W10A 3NCGA 4NFNA 1KE5A 4Y46A 2I7QA 4FV3A 5BUEA 2X39A 3PRFA 4WO5A 3PG3A 3NNXA 4G3CA 4CFVA 1YOMA 2BRNA 1XH8A 2GS7A 2XJ0A 3V8WA 4K1BA 3Q4TA 4XX9A 5DGZA 3NAYA 2H96A 1O9UA 4EHGA 2WTVA 4UN0C 5FLFA 3FWQA 4ANQA 2KULA 3IOPA 3DXNA 4OT5A 2ZB0A 4P5QA 3QYZA 5BPYA 3E8CA 5DN3A 3VHEA 4XNEA 3MWUA 5AA9A 4WNMA 1W84A 4FT9A 5HO7A 4J96A 1ZYCA 5EM8A 2ITVA 1Q8TA 3AOXA 3BPRA 2C0IA 4FSQA 5DFPA 3BYOA 3KA0A 2JBPA 4EC8A 4IAZA 3QX2A 2ZV9A 5DEWA 5L4QA 3BIZA 5IUGA 3RWQA 3OTVA 2QU5A 2G2FA 3DKCA 3GC7A 2CSNA 3P23A 4L44A 5CEMA 5FD2A 3O71A 4EWHA 1PYEA 4ZZNA 2X9FA 2CLQA 1U5RA 3AC2A 5CU6A 3SQQA 1P4FA 2NPQA 4FTJA 3DAEA 3RK5A 4GUBA 5BVNA 2VO6A 1OL2A 4R1YA 2J0IA 4D4VA 3CC6A 4DFNA 2R3OA 2W7XA 2QI8A 4ZSLA 4AWIA 3FQEA 3KXHA 3R7UA 3QKKA 4W4XA 3SG8A 2W4KA 5ANJA 5GNKA 1ATPE 2CJMA 4MD9E 2PHKA 3BYMA 3R83A 2WELA 3E3BX 2PE0A 3RHXA 4PDPA 1GOLA 2OXYA 4QQTA 2F7EE 3NIEA 4FNWA 3UDBA 3FKNA 2GSFA 4Y95A 5K4IA 3TNPC 4RQVA 2IZUA 3NSZA 2W5AA 3BI6A 5DR9A 5IZFA 1CKJA 4HYUA 4FVQA 4KIKB 1K3AA 1PXJA 2R3LA 2I0YA 3SW4A 4JG6A 1M2PA 3BV3A 4M13A 5DT3A 4XJ0A 4KKGA 5HU3A 3KCKA 5AFVA 3PSBA 1YXVA 2ITXA 5ANEA 3C5UA 5EQPA 3DBFA 1W7HA 5HG8A 3QD2B 3PG1A 2BRHA 3SX9A 5CF6A 2W06A 2YIRA 3DBEA 4DFZE 1MP8A 4TNBA 1H00A 3GCVA 4GK3A 5DIAA 2XBJA 4E5WA 4LL0A 4RG0A 3ZDUA 3KY2A 3BWJA 4D2WA 2QR8A 2PUUA 5FM2A 1M7QA 3BEAA 1FGIA 4LFIA 4PTEA 4L52A 3DT1A 4RFMA 4E4NA 4JX7A 3QXPA 3IECA 3RWPA 4CNHA 3CSVA 2R0IA 4GU6A 2W9FB 4QMVA 4U45A 3RAHA 5A4LA 4J8MA 3RM6A 4WNPA 4MXAA 5DT4A 5FWKK 5J95A 3HA6A 3EFLA 4QP1A 2DWBA 3V6RA 2PY3A 3CR0A 5IA3A 5HI2A 2WHBA 3C4ZA 3F7WA 4DG2E 4EBWA 3VBVA 3ZDIA 4I5CA 4MCVA 2X2MA 4TKSA 4BGQA 4WKQA 4ZSAA 3DTWA 4YBJA 4BGHA 3O50A 4F65A 2W1GA 2H9VA 4PPCA 3W8QA 2R3PA 3ZLYA 4O1PA 4BDBA 2YLEA 2C6TA 2BFXA 2XNOA 4E73A 2X8IA 5IEVA 2VWZA 3VW6A 4BTKA 4EOQA 1W8CA 1PXOA 2RSVA 4F7NA 5G6VA 4X2KA 4S2ZA 2BVAA 3NYOA 3OBGA 3VN9A 4BWXA 3BKBA 5CTPA 5CALA 3JY0A 5ANIA 3QQUA 4R5SA 3VNTA 2GNHA 4F9CA 3NNVA 4P4CA 5CT7A 4XLIA 3R01A 3CS9A 3VBXA 2BIYA 2VO3A 5FUTA 3ZUUA 4BB4A 4W9XA 2PVJA 4IH8A 4TTHB 4KKEA 2QLUA 3DCVA 3ACJA 1A9UA 3TUCA 4YO6A 5HCYA 4EC9A 4HVSA 5L6OA 4YJRA 3ZO2A 1OKWA 3T9IA 4NCTA 3KKVA 1MRVA 2P2HA 4M3QA 2HIWA 3DPKA 4O82A 4CTCA 5JEBA 2VX0A 1XBAA 1VYWA 1OL7A 3PJ1A 5IA2A 2Z7RA 5CU0A 3PVBA 3BYVA 3ACKA 3RHKA 4K8AA 3R8PA 4I5HA 2YABA 2CN8A 2NP8A 3QA8A 4M15A 5AR5A 4BBMA 4EZ3A 5HNBA 2IZRA 2YDIA 2YCQA 5CENA 4GCJA 4F9AA 3AC8A 1ZYDA 4XMOA 2AUHA 3RPOA 3UNKA 4AFJA 3M1SA 2HENA 3OT3A 2BALA 3QCYA 3A8WA 4KSPA 2ZDUA 2REIA 3TJDA 4F08A 5EHYA 3AD4A 4Q5EA 3KF7A 2WMRA 3KMWA 3VBQA 5BQ0A 3NIZA 3G0FA 3I5NA 3BCEA 2WB8A 4K2RA 4P90A 2C0TA 4FKJA 2ITQA 3BGPA 2VTHA 2HOGA 5E8SA 5EDPA 3F2RA 4NZWB 3O51A 5FXSA 4O1OA 4D4RA 3CKXA 5TKDA 5JQ8A 2C30A 3VS3A 2PVKA 4JOAA 3JPVA 1YWNA 4KRDA 5EDQA 4AOTA 5LVOA 4NYEA 3W8LA 5I5ZA 4GMYA 4XCUA 4XLVA 3LLTA 3LLAA 4C4FA 4AA5A 4F6SA 1YVJA 1XQZA 3IOKA 5FQDC 1PY5A 3ULIA 2R7IA 2XJ1A 3UZPA 3VJOA 4CCUA 3G15A 1ZY4A 3PJ3A 3R9RA 4F4PA 5HQ0A 2A4LA 4FL2A 3VIDA 5DE2A 2RL5A 2PMOX 4BIBA 3EQFA 3UQCA 5CAOA 4BZDA 4AN3A 2OJJA 3PA4A 5AAEA 1IRKA 3FMKA 3N51A 5DLSA 5HD7A 5ACBC 5HORA 1UA2A 4L8MA 4FSYA 4XHKB 2XA4A 3UYSA 5I9VA 3UO4A 4KRCA 4NU1A 5A54A 1Q3WA 2XF0A 2UW9A 3TDWA 2VWWA 5H8BA 4O81A 4IEBA 2W5BA 2YDKA 3TWJA 3O7LB 3SXRA 4V05A 2Y7JA 3RPVA 2BUJA 4RC4A 4BWKA 2W4OA 4N6YA 4TT7A 3THBA 4ANLA 3QU0A 3CEKA 3KN6A 5CVFA 4L9IA 1LEWA 4YO4A 2HAKA 3IO7A 4IJ9A 4PY1A 4AN2A 1GZOA 1UVRA 4DH1A 3HMMA 2QOLA 3KMMA 3PJCA 5CY3A 3W2RA 4QMPA 3FKOA 3QZGA 3QAME 5JFVA 1V0OA 3TCPA 3PUPA 3UIXA 4BDIA 5F4NA 2OICA 3GGFA 3K3JA 2OZAB 4EOSA 5LMBA 4X3FB 2Q0NA 3ZBFA 4CZTA 4PP7A 3NUPA 4RX9A 4FKTA 1OPKA 4JRNA 4XOYA 4IAAA 5J7BA 5CF5A 2LGCA 2YAKA 1JLUE 2A0CX 2QHNA 5EYCA 4GV1A 4WUNA 1S9JA 1UU3A 3PSCA 4U81A 4EH8A 5JGAA 2RFSA 2BTSA 4GVAA 4D2RA 4EUUA 4QYYA 3GI3A 2C0OA 5IDPA 2YN8A 4EYJA 4C62A 3UP7A 5JZJA 5L2TA 4O22A 3F2NA 3R63A 3ET7A 4FV0A 5CVHA 2I1MA 1PMUA 3QQLA 4O0WA 4DEGA 2QO7A 3L1SA 2CNUA 1Q8YA 4P7EA 3HRCA 5E4HA 2C69A 2GNFA 4PL5A 2J50A 4IC8A 4BDAA 1U4DA 1DI8A 3B8QA 3ITZA 5HD4A 1NT2A 2CGUA 3MB7A 3RINA 3UIUA 4O0UA 2GNJA 2H6DA 2J0MB 3EL7A 3DS6A 4FTRA 4KUJA 3LAUA 3NCZA 2PSQA 3FMLA 3FXXA 3ROYA 4RMZA 1H0VA 5IEYA 2HWPA 4HZRA 5IQDA 3P78A 3L9LA 5HE1A 3NUUA 4K77A 2WPAA 4U80A 3QUPA 5JKGA 3MSSA 4FR4A 4WSQA 2OIDA 2BMCA 5JZNA 4FKQA 4IANA 3QGYA 4RIWA 4L01A 3V5QA 4QMTA 1UV5A 2XMYA 3LM5A 3QKLA 1FBNA 4LV8A 2FGIA 1QCFA 3ORMA 5KBQA 3OCBA 4RQKA 2Y4IC 5KMLA 1SNXA 3VS0A 4B9DA 4DITA 3P4KA 4IAKA 2BFYA 3RNYA 3IGOA 3KXMA 1JSTA 5AV1A 3F3WA 4FL3A 3RTPA 4DBNA 4EOMA 2G2IA 4LRKA 4EK6A 4HVGA 1BL7A 3ORNA 3NRMA 3PXRA 4FNYA 4U3ZA 4AZSA 2CKQA 3Q04A 3N4VA 4CV9A 2O3PA 4NT4A 4EI4A 3NPCA 5D12A 3EFWA 1IEPA 4E6DA 3LPBA 1OL1A 3GCSA 4AXAA 3DY7A 3BBWA 5BVEA 4RFYA 4ZTSA 3EIDA 5KMJA 2ESMA 5CAUA 2DUVA 4HPTE 1FINA 2O0UA 4KKHA 2Z2WA 3GENA 1OIRA 2F2UA 2F7ZE 5M44A 3IONA 4PL4A 4FGBA 4S34A 3MFRA 5ANOA 1WVWA 2G9XA 2YCSA 1E9HA 1UU9A 3NW5A 3R1QA 2IN6A 2WEIA 5LQFA 3R28A 3U9CA 3QD0A 5GJGA 3LMHA 2JFLA 4YP8A 3QQGA 5T3QA 3TDVA 1YI3A 1J7UA 2JAVA 3KRLA 5M4FA 3EH9A 1GJOA 3GQLA 1YRPA 3SD0A 4IB5A 3SC1A 4FKPA 4DBXA 4C35A 3C9WA 5FM3A 5GIOE 2QU6A 4CEGA 1SZMA 4D1SA 2B9IA 1PXPA 2VD5A 4AOJA 5KX8A 4R7BA 4M7IA 2XK4A 4M69B 5HX6A 4XV1A 3AMBA 5FTOA 4GT4A 3LFFA 3SGCA 1Y6AA 4ZK5A 5M06A 4EOLA 4TZRA 4N4SA 4DT8A 5HNIX 2PZ5A 3DOGA 3QRIA 3W18A 3Q2JA 4AZVA 3EFJA 3EB0A 1R1WA 4UMTA 4FEXA 3LFQA 4UYNA 4G6NA 4LMNA 3VS1A 3EQHA 2UZTA 2O64A 4YC6A 4B7TA 3PY3A 3BYUA 2F9GA 1YW2A 3BLRA 4ZSJA 2B7AA 3FZSA 3FZOA 2YJSA 3G6HA 5J5TA 1G8SA 2IZSA 4FT0A 2QHMA 3RZBA 5BVOA 2XUUA 2NNWB 2YCRA 3MDYA 2CGVA 4TY1A 3KXZA 2HY81 2Z8CA 5HO6A 3ZTXA 2QOFA 3LXNA 1IR3A 4OLIA 1ZARA 1OPLA 4YLKA 4Z9LA 3HV6A 3PYYA 2VGOA 4LUEA 3D7ZA 1KV2A 1VZOA 2WTIA 4RVTA 4DFYA 4JIAA 5HEZA 4CFFA 4CD0A 4D9UA 4E6CA 3RMFA 3FZRA 2RG6A 3TV6A 4XG7A 1Q61A 3WE4A 5ICPA 3U6IA 5A4CA 1KOBA 3DV3A 3LCDA 3EN7A 3LFCA 4FSMA 4I4EA 4CRSA 3ULZA 4AX8A 4QD6A 5AP1A 1E1XA 3A2CA 2W05A 3ORZA 5CAQA 5DVRA 4USEA 4O7YA 3PY1A 5LCKA 4ZMEA 2X8EA 2IVVA 4IADA 2ZYBA 3ZBXA 5J5SA 3UVRA 4G5PA 4J52A 5D10A 3G9LX 4GKHA 2ITYA 3TXOA 4U97A 4O84A 1UWHA 1YHWA 3KEXA 2OF2A 2XKFA 4WUAA 4CCBA 2WMTA 4ZS0A 4AQCA 1YDRE 4EZ7A 4X2GA 3FPMA 5LJJA 3N9XA 5CWZA 1SVEA 1J1CA 4UALA 4I6QA 4U9AA 5DHJA 4GSBA 4JBQA 1NVSA 4DE4A 5AWMA 3S3IA 5FGKA 2WKMA 3TACA 1H26A 2C1BA 4C61A 4MTAA 4O0YA 3BYSA 4I3ZA 4BRXA 4AT3A 4MF0A 3NYVA 3I6WA 5DWRA 1U54A 4YJVA 3WZJA 2VWUA 4WBBB 2QQ7A 2ZMCA 3MH3A 1S9IA 3E88A 3HLLA 2E9NA 3I6UA 4L67A 4L7SA 5EOLA 3Q96A 1MQ4A 3AXWA 4PP9A 4NM3A 4NTTA 3UG1A 4X2FA 3FZ1A 3V6SA 2HY0A 3NLBA 4DGOA 4ZXTA 4HCTA 3L8PA 1KSWA 4O6LA 4PX6A 4YZDA 4DAWA 4TYHB 4M97A 1G5SA 5FXRA 2PPQA 1JPAA 4U43A 5DR2A 3PWDA 3UMXA 1WBSA 3WZEA 4IFCA 5HBJA 4RIYB 3OWLA 3QUDA 1F5QA 4I41A 3CLYA 3DJ7A 5HLWA 1YXXA 3GP0A 3LCTA 3R22A 4NJ3A 3ZZWA 2JFMA 5HTIA 2OH0E 4GW8A 4ZAUA 3BLQA 3PIZA 3CTHA 4UZDA 3DZQA 3GFEA 1AGWA 4FG7A 2YIWA 4HPUE 4XH6A 1J3HA 4F7LA 5AV3A 2I6LA 3O7LD 3ZLSA 4BDFA 3EQIA 4YGAA 4ZTMA 5IA5A 3LFEA 4R8QA 5C8MA 3ZMMA 2IG7A 4AS0A 5AV4A 1GAGA 5AUVA 3TKUA 4C33A 4DC2A 4UMPA 2BAJA 1H07A 1GZNA 4FKOA 5EM7A 2J5FA 4D58A 2C4GA 3D7TA 4FSUA 4JNWA 5EDRA 2EUFB 3ZFYA 4F0IA 2VV9A 1VEBA 2OK1A 3QTIA 2EWAA 2PUPA 3BE9A 4KD1A 2R3JA 1H25A 5IKWA 4ASEA 2YCFA 3Q9WA 5EFQA 2WD1A 1OVEA 4R7IA 3DKFA 3R1SA 4RLKA 5BYYA 3KRRA 3HRFA 2RG5A 3DLSA 4WG3A 4E93A 1SNUA 3ZO1A 3DJ5A 5I9WA 4X3FC 3CGOA 3MVMA 4FK3A 5EI6A 4ALWA 3ZXTA 4FUXA 3SLSA 2ZOQA 3VS2A 5EK7A 4WRGA 2VGPA 3SHEA 4O38A 3RI1A 1P5EA 3RNIA 5E90A 5I3OA 1ZMVA 4KA3A 2BR1A 4EH6A 3SV0A 4BCJA 3CJFA 2J7TA 2V0DA 3FLNC 3II5A 3H9OA 3L8VA 4LRMA 4E5AX 4IX5A 2RGPA 4FT5A 3SOAA 2B1PA 4RT7A 5EQEA 3QQHA 4I0SA 3QZHA 4GYGA 5AIKA 4EK4A 5J79A 3HV5A 4LL5A 3EKNA 3VO3A 4IDTA 1GIJA 4U42A 3UNZA 4BCHA 3UC4A 2YZLA 4M0ZA 4E4XA 3NDMA 5FXQA 2C5XA 2C6EA 2Y9QA 2OG8A 3DK7A 3FI4A 2PL0A 4L46A 4LRJA 3RK9A 2XJ2A 5LMKC 2IW9A 5EI2A 2V62A 1ZYSA 3Q6UA 4RA5A 4BBFA 3TM0A 1OL5A 2UZOA 3I7BA 2FUMA 3VVHA 5CANA 5JRQA 2E9UA 3BU3A 4I4FA 3LZBA 1OI9A 4DH5A 4KBAA 3UE4A 4WIHA 5E91A 3H3CA 2ITOA 1JKSA 1U59A 4E8AA 4NM0A 2OBJA 4U7ZA 1WMKA 3VUIA 3ZOSA 3PWYA 1OBGA 4H1MA 1GZKA 2F49A 4LOPA 3NVMB 1YWVA 4GRBA 2I0HA 3VHKA 4UMUA 3CTQA 4O7ZA 2C6KA 1TKIA 2YEXA 2OJIA 3O2MA 3VJNA 3KULB 3QZFA 2WMBA 3GU7A 4YZ9A 5EYKA 3FJQE 4O96A 3WARA
chains in the Genus database with same CATH superfamily
3FQSA 2R5TA 3QLFA 5DYJA 2C6LA 2R3IA 2BRBA 2UVZA 5AR3A 5A4EA 3NX8A 3MPTA 1Y6BA 5CF8A 3UVQA 3ZLXA 4C8BA 4ZLYA 5A46A 1Y91A 5AIRA 4NIFB 4LOQA 3WZDA 4JT3A 3RAKA 3LFNA 3ZXZA 4YURA 4FYOA 4J8NA 3WILA 4D5KA 3Q2MA 3SRVB 4L3JA 4QYGA 3I1AA 1JAMA 4DTBA 4W4YA 2CKPA 4DTKA 3TKIA 2RFDA 3PY0A 3KRWA 1CM8A 5CI7A 4JI9A 3KK9A 4YLLA 5AUUA 5CU4A 2GCDA 2X7OA 2WMWA 4F9BA 5C4LA 3H0ZA 4LUDA 4YZBA 5KHXA 2WMXA 3OMVA 4B0GA 3SXSA 4YHFA 1Q4LA 4G17A 5EH0A 4JDJA 4O83A 4ARKA 3UO5A 3COHA 3E8NA 4FKWA 5D11A 5CEPA 3VONA 2BDWA 5GINE 2XAOA 3KXXA 4HZSA 4NK9A 5ANDA 5IH5A 5F1ZA 5JGBA 3ZSIA 4APCA 4M66A 1NVRA 4WRSA 3GOKA 1UU8A 4YJUA 5AA8A 1CTPE 2UV2A 4HVDA 3DKOA 2J2IB 1L3RE 2W1EA 3HYHA 3NW7A 3PVGA 4MBJA 4QTAA 3TNHA 4BDKA 4DGGA 3U6JA 4QPSA 3UQFA 3TUDA 2JITA 5EKOA 5HGIA 4DFUA 2GTMA 1H8FA 3HV7A 3QZIA 2EB3A 2P4IA 4FTIA 1WVXA 4I94A 4O27B 4Q2AA 3QTWA 3AG9A 2IF8A 4U41A 3RBWA 2BHHA 2ZB1A 3UZRA 4I23A 2XM9A 3IGGA 2JKOA 2BKZA 4J99A 4OBOA 3NW6A 4CFUA 4Z7GA 2X6DA 1IASA 3JS2A 2YM5A 2X1NA 4FICA 5T68A 3TIYA 2C47A 1FVTA 1BUHA 3AT2A 5L6WL 3TZ7A 3A7JA 3ZRMA 3QRKA 2Y4IB 2XEYA 5LARA 3BBTB 2B55A 2J9MA 2PZPA 5CAVA 3H30A 3FI2A 3ORPA 3FSKA 1KV1A 1J91A 3FL4A 3G5DA 5J1WA 2QODA 2UW7A 3ZU7A 3TV4A 2ZM1A 3U9NA 3QQKA 4NH1A 1QPDA 4TN6A 4TYEA 3QXOA 4IDVA 5AR2A 3OTUA 2OO8X 1KUTA 4JRVA 3F3VA 5AP5A 4KS8A 3OP5A 2OF4A 3GQIA 4X2NA 4IBMA 3KGAA 3MN3A 1Q8WA 5L3AA 2PZRA 5AV0A 2YLFA 2B9HA 5D41A 2CN5A 2XKDA 5E8ZA 4ZJVA 3I79A 4IX4A 5HU9A 5BNJA 5AJQA 3E63A 5ACKA 2W1DA 4D2SA 4BDDA 3DQXA 1PXNA 2HZ4A 1B38A 2VRXA 3MIAA 4HVIA 3MY5A 4GU9A 2WOTA 4RZVA 5HLNA 5IMXA 4IZ5A 3R7VA 4DA5A 5AM7A 2GHMA 3BGQA 3MH0A 3ZFMA 3QF9A 4Y83A 5EHLA 3RCDA 3OOGA 3OXZA 1K9AA 1OB3A 3QFVA 4ACGA 4KSQA 2VX1A 2VWVA 3TG1A 3R7OA 5C9CA 5DBXA 3LCKA 3LE6A 2GHLA 4ZZOA 5AUYA 1REKA 3OCSA 2GQGA 2C3KA 1P14A 1ZMUA 4YSMA 1ZOHA 2YWPA 3Q5IA 3UOLA 1WBPA 4YSJA 5M56A 2OKRA 5JH6A 1Q5KA 4MH7A 5L8LA 4Z7HA 5L2SA 3QYWA 3DAJA 5CS6A 4W8DA 4R1VA 3VULA 3Q53A 4FG9A 4AP7A 2UW6A 4NTSA 4IW0A 3TYKA 4ZY6A 4FSTA 2QOKA 3OOMA 1I44A 3D2KA 4X2JA 4BVUA 5H9BA 2C68A 4E6QA 3U4UA 4K0YA 4ZS4A 3E64A 5K3YA 5J9LA 4PNKA 1UU7A 2YIQA 1M14A 4H3PA 4QDVA 5L2QA 2C5NA 3PPJA 1DS5A 1JKTA 2Y6MA 4N0SA 2R3NA 3ALNA 3C4WA 3IW6A 2VWYA 4KINA 4I6BA 3U8WA 2ITPA 2VTQA 2X8DA 5FDXA 2PMIA 4RA4A 1R78A 2JDSA 3PLAE 2XK6A 1CMKE 4QEBA 1ERKA 3OXTA 1SVHA 4QMMA 3DXPA 3AD6A 3BRBA 2GS6A 1YI6A 4HNFA 3WIKA 4C58A 3LQ5A 4FA2A 4ANBA 4FZ6A 5HOAA 5HIEA 4U8ZA 4XV3A 1PMEA 4D4YA 3KXNA 2C1AA 4GG5A 2VTRA 1ZOGA 4AT4A 2CHLA 3PXZA 1BI7A 3C4EA 4LQMA 3NUAA 3N4TA 5KE0A 1VJYA 2ITZA 2QO2A 3DB6A 4AGCA 5HTBA 5GIPE 1G3NA 3O8TA 3MIYA 2QG7A 5E8TA 4M68A 3C0GA 3LM0A 4QP8A 2ITTA 4XG9A 4D1ZA 4P2KA 4XG8A 3E7VA 5JQ5A 3LXKA 4O91A 3E62A 3BQCA 3UODA 5FBNC 4DH8A 4DHIB 2XALA 3ORXA 2C5YA 1FPUA 4XG3A 4WG5A 3V3VA 4CZYB 2QVSE 3F5PA 1Z5MA 5A4TA 1QPEA 3VWAA 2R3KA 4CKRA 4A7CA 5IH4A 4NWMA 5I9UA 2OH4A 5EW9A 4C38A 2AEGA 2YIYA 2F57A 2AC3A 2IWIA 3MS9A 3OCTA 4FTKA 1FOTA 4ZEGA 3FQHA 5JRSA 5BYLA 1JNKA 4EOKA 3NFFB 2C3LA 1U46A 3A60A 3TZ9A 3P79A 3LVPA 3EQDA 5HVJA 5FTQA 4FC0A 2UZUE 4X0MA 3DB8A 4RIXB 4C59A 3VS6A 4QMQA 3BX5A 5KO1A 2R3QA 1O6YA 4J97A 4QTDA 2OGVA 4YNEA 3COKA 3QTZA 5IU2A 1PXLA 3PIYA 4O0VA 3E87A 2WO6A 4PQNA 5A14A 3MVJA 2XKEA 4O0RA 4PPAA 2JIIA 1GIIA 5CSWA 4R6VA 2BROA 3P0MA 2WMUA 2VU3A 2JDVA 3I5ZA 1ZZ2A 4AN9A 4E1ZA 4FVRA 1P2AA 4H39A 4V01A 3ANQA 3OF0A 3GCPA 3K3IA 4FKUA 5D1JA 4ZMFA 3OY3A 4KBCA 3TZ8A 3HX4A 3P1AA 5EW3A 4O4DA 3PIXA 3D5VA 5E8WA 5LWMA 4MX9A 4XUFA 5B2MA 4DCAA 5DPVA 3R00A 5E1SA 3W55A 4AA0A 3ZSHA 3ZM4A 3KCFA 2ZMDA 4FTAA 3MVLA 4RIWB 3FEGA 4FI1A 5E92A 5JMSA 3GCQA 2YZAA 4BJJA 4CYJA 1PRYA 3IDBA 3R9HA 2OJ9A 4RVKA 3VW8A 3SVVA 2W1HA 4FT7A 3W2OA 1WBVA 5ETFA 1STCE 3CY3A 2IJMA 2JDRA 2EVAA 5DI1A 3FLQA 2BZKB 4HGSA 4EORA 2RIOA 4FIGA 3PZEA 5HE3A 3AKJA 3EFKA 2CKEA 4M84A 2UVYA 4R7HA 3LIJA 3MESA 3OFMA 1PHKA 3DFCB 5AR4A 3AMAA 3EQGA 3HECA 3O8UA 4RRVA 3IQ7A 4OBPA 4USFA 1XMLA 4RWLA 5KBRA 2VTNA 4JG7A 4H3QA 5BVDA 3NNUA 3HP5A 3ANRA 3A4OX 4C2WA 4BHZA 3HUCA 5AV2A 4ZSEA 4CTBA 4D2PA 1SM2A 4QYFA 4EKKA 1OZ1A 2XIKA 4FV1A 3ZRLA 1OIUA 2ZM4A 2P55A 5AEPA 1H27A 4BFMA 5KMIA 1WAKA 4BDCA 3EQRA 1GZ8A 4KNBA 1Z9XA 4JX3A 2R3MA 4FT3A 1XH4A 5I9XA 4JVGA 3BU6A 2PVMA 4IZ7A 4D9TA 4E6AA 2ACXA 3C0HA 2CDZA 4JXFA 4ZTLA 3BWFA 1BL6A 4C3RA 4W4WA 4FTNA 4F99A 4F1MA 4KIOA 2HZNA 4KIQA 4OTRA 2BILB 3ORLA 4B8MA 5FEEA 3MY0A 2ITNA 4WD5A 4FTOA 5H2UA 2QR7A 2YACA 4YTIA 4DEIA 3TTIA 3Q5ZA 3MTFA 4WOVA 3I60A 3FYKX 4JBVA 2XNGA 3WZUA 5CEOA 4ZTRA 4PL3A 5EOBA 3DA6A 4RX8A 4X7QA 3DBDA 2XZSA 4MQ1A 4AGDA 1ZRZA 4XS2A 4H05A 5EI8A 2FSOX 2R7BA 4XG2A 2VNWA 3NMUF 4UMRA 3DJ6A 3FDNA 2X0GA 3EN6A 3I81A 4XBRA 4DFLA 4DDGA 3FMMA 4GS6A 2IPXA 1KE9A 3LJ2A 2HZ0A 4I6FA 3JVSA 4FTUA 4AA4A 5C26A 3VQUA 2CPKE 3EHAA 3F7ZA 4CG8A 4DHZA 4PTCA 4BCIA 1V0BA 3W33A 2QOQA 3UIMA 4CV8A 1H1WA 5H3QA 3I7CA 1BKXA 4IX6A 4IHPA 5TO8A 3TTJA 3UOHA 4QP4A 3NYXA 3SW7A 4U44A 4EK3A 5DRBA 5JFWA 3VBWA 3P86A 2YM7A 3E92A 2Y8OA 2XYUA 1YDTE 4O4CA 4OAVB 2WFYA 2XK9A 1W82A 3IG7A 2BCJA 5JGDA 3FMNA 4R3PA 3TV7A 1JSVA 3VBTA 4MYGA 3A4PA 2ZV8A 4XP3A 4FIHA 2P33A 3PVUA 4FIJA 2OFVA 2Z60A 2PZIA 4UB7A 1OMWA 5L8JA 4QMNA 4MF1A 5HCXA 3UDZA 4C2VA 3V01A 2A27A 3D5WA 2XS0A 3MTLA 2AYPA 4QPMA 3W2PA 4CMOA 2GQRA 4L00A 2QOOA 4G16A 4JQ8A 4FX3A 4YNOA 3QD3A 2Z7LA 4FV2A 5JK3A 4NCTC 4MD8E 2RFEA 5DR6A 1UKHA 3G2FA 5EM5A 4ZY5A 4FV4A 4RSSA 3HAVA 3OUKA 4RJ3A 2R9SA 4BIEA 2ONLA 4JAIA 1G8AA 2HXQA 3R02A 3EQPA 5AADA 2UZBA 3HEGA 3ATTA 4QMOA 4CLIA 1OIQA 4C4EA 4AACA 4YHTA 2ZVAA 2DYLA 2CNVA 4AOIA 1WBTA 4DEBA 4JDIA 5I0BA 2O63A 1T46A 5BUIA 1RDQE 4F09A 2UZWE 1QMZA 3AMYA 5HVYA 2HXLA 4HVHA 1JSUA 2WU7A 3F5GA 3HP2A 1Q24A 2PMNX 3ID6C 5I9ZA 2QOCA 4QMZA 1H28A 1GY3A 2CLXA 2W5HA 2LAVA 3EJ1A 2R0UA 5FBOA 3TKHA 1U54B 4YZMA 3R8UA 4A07A 2DQ7X 3BE2A 4IZAA 3DK3A 4EHZA 1ZLTA 4BCKA 1XKKA 3OW3A 3HV3A 4RVMA 4L7FA 3G6GA 3QRUA 4A9TA 3S0OA 4I20A 2OLCA 4GKIA 1ZOEA 5CSPA 4L43A 4V0GA 3C51A 3FAAA 4MNEA 2OZAA 3MV5A 5J9YA 2WU6A 2ZAZA 4C34A 3ALOA 3R8MA 3GC0A 3RPYA 2IO6A 1ZZLA 3ZH8A 2Z7QA 5FP5A 2QOHA 4OTWA 3WOWA 4UX9A 3MFUA 3DLZA 3Q4CA 3W2SA 4FSZA 3PXFA 4QP9A 4QP6A 4EL9A 1Q3DA 3R30A 3F66A 3LFAA 5J9ZA 3PPKA 4JG8A 4EQCA 2IVSA 5BYZA 3PZHA 1BMKA 1E1VA 3JVRA 4EH5A 4FK6A 5CNOA 3V5PA 2WMSA 4PMSA 4CT2A 1L8TA 2ERZE 2OXXA 2RF9A 3HMPA 1ZYLA 1WCCA 2C6IA 4D0XA 4ZLOA 4YTCA 3PP1A 1WFCA 2O8YA 4DCEA 2VO0A 3R7YA 1A06A 4EHEA 3EYGA 4EH9A 2V5QA 4U3YA 5M4UA 4NL0A 1MUOA 4IQ6A 2X4FA 1M7NA 2PVNA 3WF5A 3D7TB 2GDOA 3FC1X 4KB8A 4W4VA 5ANKA 3H9RA 4O4FA 2OIBA 4TWCA 5GHVA 3LMIA 2E9PA 5D9HA 4ZY4A 4OTIA 4I6HA 3BLAA 5AUZA 4CKIA 2W17A 3TJCA 4N6ZA 2XEZA 3HMIA 3GNIB 4OGRA 4EOIA 4FVPA 5FDPA 3R7GA 4OUCA 4BYJA 4MXYA 4EH3A 3OROA 4H3BA 3CQWA 2IZTA 2AC5A 2JD5A 3ZUTA 2JEDA 3CIKA 3DAKA 3W0QA 1T45A 2JIVA 4YZNA 4HW7A 4DF3A 2J5EA 1RQQA 3M11A 3MFTA 4QMSA 4WNKA 3FL5A 3WI6A 1Q62A 4FZAB 2QG5A 2X7FA 4PMTA 4KBKA 4BTJA 3F6XA 3GC8A 4ZTNA 3BU5A 3R2BA 4FV9A 5DH3A 2B9JA 2FVDA 3I0OA 3DK6A 3IK3A 4L3PA 3RALA 4DGNA 2PYWA 3IW5A 2PU8A 1FVVA 4MWHA 5TF9A 4G5JA 4R5YA 3FLSA 5ANGA 3HMNA 4TYJA 5F94A 1IAHA 2O2UA 3GUBA 4OTDA 2CCIA 2YFXA 3HGKA 4FV6A 5AP6A 3MFSA 2XM8A 4RX5A 5ITAA 3OD6X 2NO3A 3ELJA 3GU5A 2VTAA 1H01A 3MJ2A 4FKRA 4J1RA 1YHVA 5BMMA 4QTEA 5CAPA 2FH9A 3BHTA 4K11A 4J95A 4RIOA 2BZJA 3EN4A 5HCZA 4DGLC 3PA5A 4WBOA 5ETIA 1K2PA 4CVAA 3NFGB 5BVKA 1H08A 3GCUA 3VUKA 4C02A 3S2PA 3ORKA 4KS7A 3FPQA 3UNJA 3EQBA 4FIFA 5IA1A 2PMLX 2WNTA 5LVNA 2FA2A 2BZHB 3LMGA 4HNIA 4O7VA 1BLXA 2BAQA 4AGWA 1XHAA 3PA3A 4NEUA 4DEHA 4J53A 5IQFA 1BI8A 2WTKC 1M52A 1AD5A 1W2DA 3SOCA 2X6EA 4Z55A 2Z02A 1ND4A 3F5UA 4ANSA 4CQEA 1J7IA 5EW8A 3RAIA 1H1QA 5JT2A 2WTJA 3TL8A 4PTGA 1URCA 2G2HA 5C01A 3EZVA 4K33A 4R78A 3QCSA 5HKMA 3VF9A 4DN5A 2WOUA 3NGAA 4UWCA 4ENYA 4BTMA 4O7WA 4GFMA 4HGEA 4LOOA 3AKKA 4BDHA 4M69A 4TWNA 4K9YA 3HDMA 3KMUA 3KF4A 5EHOA 4I0RA 4BGGA 3ZCLA 4IWQA 5E7RA 4ANMA 5LXMA 4U0IA 3PVWA 3OWKA 2XB7A 3D5XA 4BWPA 3W0PA 3D0EA 4EH2A 5B0XA 4OBQA 3UMWA 3DQWA 3MGYA 3FBVA 4APPA 4JBPA 1W2FA 1PF8A 3QTQA 5CU2A 3O8PA 3R73A 1PXMA 5LVPA 3A7FA 4IAFA 3QTUA 4J98A 4NFMA 2QD9A 2X0QA 4I21A 2XRUA 4EONA 4R77A 2FO0A 4Y85A 4IWDA 2OJFE 2XNPA 5GJFA 2IVUA 1TVOA 3FY0A 5EYMA 3DFAA 5LMAA 4D0WA 3VS4A 3KRJA 5KZIA 4E20A 4IIRA 3WBLA 3RM7A 2E9OA 1ZXEA 3UC3A 3PXYA 3OY1A 5FRIA 4RC3A 3FHRA 4B8LA 5M4IA 3KVWA 4GT5A 2PVYA 3D2IA 5E8YA 4IB1A 4EKLA 3OT8A 3ETAA 1Q41A 2VTMA 1DM2A 4DFXE 1EH4A 3COIA 4MXCA 1XBCA 4LGHA 3K2LA 2WQNA 3WZKA 3TNIA 3GBZA 4HCUA 3ZYAA 2NRYA 2VN9A 2W9ZB 3BGZA 3G90X 4EYMA 2YM6A 3FC2A 4HOKA 2J6MA 3KK8A 5AUWA 5KMKA 4P5ZA 2OU7A 5AUTA 2WZJA 3FE3A 5IG1A 1BX6A 4DGMA 5JSMA 4EH7A 3KB7A 1WVYA 3U55A 1TZDA 4IVDA 4JIKA 4QT1A 3EN9A 4C4JA 1XBBA 3LOKA 3WYYA 4LV7A 3HDNA 2GQSA 3B2WA 3AGMA 2PULA 1PXKA 2YHVA 2BRGA 5GZAA 3FV8A 2YM8A 2WAJA 2XK3A 4L3LA 2XNBA 5CI6A 4NM5A 4FEUA 4XRLA 1XR1A 3MH1A 3QGWA 4ASDA 4XP2A 3MA6A 4XG6A 3C1XA 4FEQA 3FXZA 4U6RA 2QOIA 1IA8A 2B9FA 3CGFA 3RVGA 3TMOA 2WMAA 4MNFA 4YTFA 3QTXA 4MEDA 3MPMA 4MWIA 3U51A 4A4XA 4ZJJA 1H1SA 4BHNA 4F7JA 3CPBA 3M42A 4GH2A 4K6ZA 4OR5A 4Y73A 1GNGA 5AP7A 2WTDA 3UG2A 5IISA 3HA8A 4FKVA 4F7SA 3VS5A 5LVMA 3GB2A 4AGUA 4EEVA 3TNWA 3GU8A 4E4MA 4MBIA 5AP3A 1OIYA 3PUFC 4O7TA 4IWOA 1MQBA 5HG7A 4F1OA 4BTFA 1Y57A 1IG1A 4USDA 1JVPP 2GU8A 2W0JA 2Z7SA 4TPTA 5DEYA 2OZOA 2PZYA 5BVFA 1OUYA 4GIHA 4BCQA 1GIHA 4TWPA 5KUPA 1YHSA 4CLJA 4AW0A 2OFUA 3K5VA 3T9TA 3ZO4A 1VR2A 4Q5HA 3RK7A 4CGAA 5IQEA 4GUEA 1OL6A 3WYXA 4A06A 4MXXA 5L2WA 5C03A 2XP2A 4E4LA 5JFXA 3BV2A 3Q9ZA 4M67A 4UEUA 4OTGA 4ZTQA 1U5QA 1WBOA 1MRUA 4IAYA 4BY9E 1Y8GA 2HK5A 4IM3A 5CT0A 2W4JA 4BI1A 3G0EA 4AZFA 1YOJA 4QOXA 4N70A 5L8KA 4D2VA 2BTRA 2HELA 3FZPA 2XKCA 3W2QA 4F64A 4Q9ZA 2R3FA 2EXEA 3VAPA 1PKGA 2EXMA 3DZOA 3SDJA 4G9RA 4AFEA 3BHUA 2CGXA 2PVLA 4GEOA 3NWWA 1Z57A 5B7VA 3W2CA 4IACA 3MPAA 4A4LA 3NYNA 3RPRA 4G3GA 4ONAA 4JDHA 1RJBA 3NAXA 1XH6A 4QP3A 1P4OA 4IC7A 2VWIA 3QCQA 5IDNA 4N57A 5E8XA 4BZNA 5AR7A 3F5XA 4ITJA 5IMEA 3DNEA 3EQCA 3ENHA 3ZSGA 3FXWA 1DAYA 5CSXA 1TQIA 4DLJA 3R71A 4OT6A 1SMHA 4PNIA 4BKYA 4D1XA 3UQGA 4ID7A 3DNDA 3AT4A 4O86A 5IEXA 3JUHA 4FV7A 4NM7A 4EZ5A 1PKDA 4UXLA 3QKMA 2JDTA 4KIPA 3R9NA 5I3RA 5H8EA 2R3HA 5CEIA 4B99A 2PE2A 4PF4A 4CMUA 1REJA 5LCJA 4YJTA 4C36A 1UKIA 4O2PA 3MH2A 3BQRA 3O0GA 3OWJA 4IVAA 2JLDA 4RWIA 3VBYA 3JXWA 3WIGA 4S32A 4B4LA 4Y5QA 3R7EA 3TN8A 3VQHA 1OPJA 5DG5A 5DRDA 4AAAA 3CTJA 3E8EA 2PTKA 4RGJA 5H8GA 3KL8A 4IX3A 2GFSA 5CVGA 1O6LA 3GFWA 3ENMA 2XNEA 3PTGA 3FI3A 3R04A 4J7BA 4LG4A 4QTBA 4QYEA 5JN2A 1J7LA 1FMKA 3BLHA 3PLSA 3KN5A 4HCVA 4EOPA 3BHVA 4IMYA 4QTCA 3TT0A 1W98A 3FSFA 4MQ2A 3UPXA 1FQ1B 2HZIA 4FV8A 3D94A 4AW2A 4LYNA 4EK8A 3D4QA 5IH6A 3C50A 3GEQA 4Z3VA 4FTTA 4XOZA 4F1TA 5HLPA 2JIUA 2Y4PA 1PMVA 1XH9A 4ZOGA 5I9YA 5K5NA 2GS2A 4G3DA 3T3VA 2WTCA 3IDCA 3P9JA 3UYTA 5CF4A 5M53A 3CKWA 5HBEA 3FLZA 3BHYA 3CJGA 3KULA 5HICA 3DBCA 1DAWA 3DGKA 4UWBA 3G9NA 3F61A 3NS9A 1OKZA 3W16A 4BKZA 2BKKA 4PDSA 4AF3A 5HVKA 4OTQA 4QMLA 4FBXA 3MJ1A 5K5XA 3JYAA 4FIEA 3FI8A 3VS7A 4NIFA 1H4LA 4UY9A 4ACCA 5CASA 1JWHA 3ORTA 2QNJA 4XBUA 5C27A 3SRVA 4FYNA 4L68A 2CCHA 1R39A 4BI0A 3TEIA 2O5KA 2XANA 5CQWA 3MYGA 2YITA 3UBDA 5ETAA 3VUTA 4F6WA 1JKLA 2WEVA 3FLWA 2W1FA 4MVFA 4XRJA 4BICA 3PE1A 4XP0A 2JKQA 4A9YA 2PE1A 2UVXA 5AAFA 4ORKA 4ZP5A 3ZONA 5AP0A 2EB2A 2XBAA 3F3UA 3OCGA 1URWA 4PRJA 4U79A 4G6OA 4JBOA 1Q99A 1JBPE 2VAGA 2VWXA 2PK9A 3P08A 4TW9A 3UIBA 3WE8A 4F9WA 5DT0A 3P5JC 3OG7A 3Q9XA 2VWBA 3O23A 4DT9A 4RJ5A 2G1TA 3NNWA 3POOA 3Q60A 2QURA 4Q9SA 3OHTA 4QYHA 5KNJA 1NXKA 2C3JA 1TQMA 1YOLA 2FYSA 4BDGA 1YWRA 2XCKA 1YDSE 5I4NA 1M2QA 3LJ0A 4FZFB 4YHJA 5IQBA 2UZNA 4EBVA 4TL0A 2IVTA 1B39A 1KWPA 3IDPA 2RFNA 3L9NA 3KREA 5DMZA 4NKAA 3NZ0A 2UZDA 2YM3A 3QHWA 3DXQA 3B8RA 5BUJA 1R3CA 3MVHA 5J8IA 3A61A 3FYJX 4RWJA 4EK5A 4BYIA 4V04A 3HL7A 4J71A 4NUSA 2ZV7A 4YZCA 5E8VA 5M07A 1JQHA 1R0PA 2ETRA 3EYHA 3E5AA 4G34A 3RKBA 5CEKA 4PMPA 4DYMA 4JR3A 3FZTA 4UV0A 4S33A 5CQUA 1RE8A 2X2LA 3FLYA 3TZMA 1V1KA 2O65A 4FZDB 4BCMA 4MAOA 4QMYA 1XO2B 4GL9A 5TR6A 3DDPA 3R1YA 4BL1A 5AP2A 1OITA 3IPHA 3PP0A 4IB3A 2R2PA 4LI5A 2GNGA 2UW0A 4H36A 4AXDA 5CLPA 4BCPA 3GVUA 2C6MA 3H10A 2GNLA 5B2KA 5IQAA 4F6UA 4CXAA 1UWJA 4RC2A 1RW8A 3HZTA 4AW5A 4R3RA 2NYAA 2QKWB 4BCGA 4QRCA 4CFWA 2A1AB 2F7XE 2HCKA 4KIKA 1V0PA 2AQXA 4CMTA 4TNDA 4A9RA 2YDJA 4BKJA 3LCSA 4DEDA 4GYIA 4AT5A 3RZFA 2ZDTA 3ZRKA 4YR8A 5C8NA 2PVFA 1AQ1A 4O21A 3UZTA 2WTKB 2J0KA 4QP7A 3OZ6A 3Q9YA 5DNRA 4ASXA 3V5WA 3PDTA 3A99A 2JKKA 4BCNA 2Y0AA 4G1WA 3C13A 5E9EA 3ZEWA 4QQCA 3AC5A 4EJ7A 2H34A 1M17A 2OW3A 2UUEA 4PMMA 3V04A 4YJOA 4LGDA 1JOWB 5AX3A 4E5BA 4DTAA 4IAIA 4MXZA 1ZAOA 5FTGA 1KE6A 3Q4UA 3R8VA 3W0SA 4FOBA 2XIZA 2C6DA 4AUAA 2XNNA 1QPJA 2B52A 4FEWA 4FIIA 5AMNA 2VTPA 4EH4A 3U4WA 4PDOA 4C4HA 3R9OA 3SG9A 5A9UA 2VTJA 3PXQA 2C5VA 2J51A 3QBNA 4GG7A 2PUIA 3LQ8A 1UNGA 5A6NA 2P3GX 2VTLA 3BEGA 3PE2A 2CGWA 5CZIA 3AQVA 4O7SA 3MBLA 4JJRA 4AE6A 2OIQA 5AUXA 4WG4A 5FG8A 4D5HA 5IQCA 5F9EA 3NR9A 4MK0A 3A7GA 5BMSA 1OBDA 3CY2A 2Y6OA 4ERKA 1PW2A 4LMUA 4PPBA 4OTHA 5TE0A 3R6XA 4M8TA 5AR8A 5CSVA 4ZIMA 4AU8A 4PV0A 4QP2A 5HG5A 5CU3A 3V51A 1OECA 4FGRA 3BELA 2R3RA 2W1IA 3AGLA 5GZ8A 1HOWA 3RPSA 3ZHPC 1LP4A 4QNAA 4CZUA 1YXSA 3BHHA 4NW6A 3F9NA 1HCKA 3LHJA 3KQ7A 3E7OA 4FNZA 4KWPA 3COMA 4ASZA 3HAMA 5G1XA 1ZY5A 3QRJA 2B0QA 1WBWA 4XYFA 2JBOA 2OWBA 4YU2A 1W0XC 4FKGA 4MD7E 2VTIA 3Q3BA 4IVCA 4O4EA 4MBLA 4TYIA 4WT6A 3ORIA 4BCFA 1O6KA 3I0QA 5IA4A 3QRTA 4C0TA 4GK4A 2GTNA 3V8SA 2BHEA 5L2IA 3AKLA 4QQ5A 3LKMA 2PVHA 4F78A 2J0JA 4V0GB 3B2TA 5TT7A 5F20A 4MNEB 5EG3A 3U87A 4AW1A 3CE3A 3NEWA 4FSWA 4BCOA 4YMJA 4RBLA 2W1ZA 4OAUC 5K0XA 3WF7A 1F3MC 3E3PA 2YAAA 5K4JA 2UW8A 5IQIA 3POZA 4FTQA 4LDTA 5KKRC 4D4SA 3K54A 1Q8ZA 3CCNA 2R4BA 2J90A 2WQOA 3DU8A 3LFDA 4IM0A 4W8EA 3ZO3A 2UW3A 4UZHA 4ACMA 3E93A 4O6EA 4QMWA 3O5AA 4HYHA 3ODZX 2BPMA 3RP9A 3HVCA 5T6KA 2GMXA 1KE8A 3AC4A 4RZWA 3P7AA 4C57A 4CG9A 3UP2A 3FKLA 1JKKA 3BZ3A 3C4CA 3PSDA 4RIXA