3IW4A

Crystal structure of pkc alpha in complex with nvp-aeb071
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
339
structure length
330
Chain Sequence
LDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTREFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVFDKFFTRGQPVLPPDQLVIANIDQSDFEGFYVNPQFVHPILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein kinase C alpha type
publication title Discovery of 3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]pyrrole-2,5-dione (AEB071), a potent and selective inhibitor of protein kinase C isotypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 330
sequence length 339
chains with identical sequence B, C
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iw4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iw4A01
5HZNA 3DB8A 5DHJA 4AA0A 5CAUA 3WE8A 3BHTA 4AGDA 2DS1A 2R3LA 4C3RA 1G5SA 4K9YA 4IAKA 1GZOA 1JBPE 3TL8A 5EW9A 1APME 3H30A 4ALVA 2A19B 3PY1A 3NZ0A 2JIUA 4FNWA 3MFSA 3R7UA 5ICPA 3DLSA 2QR8A 3U8WA 5EKNA 5HG7A 2B55A 4PF4A 3AC5A 5JZJA 3S2PA 4XG3A 5T68A 3RAHA 4USEA 2JDVA 3C0IA 3NWWA 1OPLA 4CZYB 3KB7A 3LXNA 4R3PA 3GCQA 2GNJA 4JDHA 5LMBA 5I9UA 2VO7A 3QQKA 4BCGA 4P7EA 1H4LA 2Z7LA 3DAEA 3R73A 4HYUA 1UU8A 4J95A 4RVTA 5AR2A 5KO1A 3TIYA 4EH2A 3G5DA 5AA8A 2UW4A 1XR1A 1STCE 3DU8A 1H07A 4IJPA 4U3YA 5IEXA 3AT3A 2H9VA 5EI6A 3NPCA 1JSTA 2R3FA 3SX9A 5ITAA 4K1BA 4RBLA 2CNQA 2OXXA 5L4QA 4LMUA 2VUWA 4X2KA 2RG6A 2WD1A 3LCDA 1GIHA 4WBOA 1V0OA 2VWXA 5FEQA 4AUAA 4APPA 4OAUC 4UX9A 2P2HA 4LL5A 2FUMA 3UGCA 3A8WA 1SZMA 2J90A 3SOAA 2O8YA 1RJBA 2PVFA 3IW6A 4L43A 3MH2A 4G9CA 3DNDA 4TWPA 4WNPA 1ZWSA 4H1MA 4EK3A 4EYJA 4JX7A 4RQVA 3UOKA 3O0GA 2I0VA 4IDTA 1PXLA 2ZMDA 4D1ZA 2CN8A 4P2KA 5FDPA 5FTGA 5IQGA 5LCKA 2WOUA 3EWHA 3IGOA 2ZV2A 2W05A 3W2CA 4IWQA 3OZ6A 4I3ZA 4BF2A 4ZZMA 5E8SA 1RW8A 3WZUA 3KMUA 1UWHA 5AFVA 2ITYA 5AJQA 2IJMA 3VS6A 3RK5A 5IU2A 3EJ1A 3MB7A 3QTZA 3C5IA 2B4SB 3HZTA 4JBOA 3HVCA 4JXFA 5HICA 5E92A 4WHZA 4DBXA 4CFNA 3D5UA 3FXWA 4HGSA 5M09A 3S0OA 4XMOA 4FVRA 1F5QA 3MVLA 3UPXA 4PWNA 2QOOA 5AMNA 3LAUA 3I79A 1GZNA 2XP2A 3A99A 3NNUA 2UW9A 4ZAUA 2W7XA 4TPTA 2PUUA 1YI3A 3LXKA 1URWA 2R3QA 3P78A 4ZTLA 2PULA 2W1GA 5ETFA 3CCNA 4RG0A 2QOQA 1NW1A 5GJFA 4U42A 3AC8A 5CEMA 2J0KA 3BIZA 3O8TA 3PA5A 4LG4A 5ACBC 4X2FA 3TEIA 4ANBA 4ZSAA 3JY0A 1ZYSA 4B4LA 3UJGA 4IBMA 3QXOA 5AP3A 5IZFA 2ZV9A 3VBWA 4AW1A 4C2WA 3GP0A 4XP0A 4KUJA 2Z2WA 3BV3A 3D4QA 3L9MA 4AW2A 4GKIA 2HZNA 4IMYA 4D9UA 4L53A 3DAJA 4QPMA 1P2AA 1VYWA 4WBBB 4YZNA 3QQGA 4YO4A 3LOKA 3QD3A 3R9OA 5C26A 1H01A 3DFCB 5DT0A 4EC9A 1OIQA 5BYLA 4GJ3A 3HMPA 3AD6A 3EQRA 3UP7A 3QXPA 4YBJA 4EWQA 3FQEA 3DLZA 4C4JA 1KE8A 4ACHA 4J71A 3UBDA 1OUKA 1XH7A 2HWPA 3PIXA 4BDDA 5A9UA 3MFRA 4EOLA 4CKRA 3HL7A 3OROA 3MVMA 3WILA 5FTOA 3CBLA 1OB3A 4E5AX 4N57A 5DMZA 2VX3A 4IB1A 5GNKA 1PXJA 1YWNA 2XB7A 3EN5A 3ZSGA 3HMMA 3ORXA 2UZVA 3F88A 4FEXA 5KBRA 5IA3A 3PXQA 2FVDA 4HCVA 3COMA 5J1WA 4HGLA 2JFLA 4I6HA 4M67A 3AT2A 5CXZA 2GTMA 3R9DA 2VTIA 4AN9A 1XH4A 4USDA 2X2MA 3VS7A 4C57A 3TZ7A 2FSMX 2YCRA 4BBEA 3LFEA 3PJ2A 1UNGA 2YJSA 4BI2A 5L2SA 2F7ZE 2BROA 3E92A 1XWSA 3FI3A 4BCMA 2R3MA 4FL2A 4GVJA 5EM5A 5IMXA 4ZMFA 3LFNA 3FZ1A 2QLUA 4AT3A 2PZYA 3ORPA 4QYGA 4U45A 3F2RA 1L3RE 3OCTA 5ACKA 4O2PA 4O7VA 2BRGA 5C8KA 4CKIA 5HBJA 3VUIA 3ORNA 4ZLYA 2C6TA 3NUSA 4EH3A 3HUBA 3PG3A 3WZKA 1REJA 4FVQA 4C37A 3U6IA 5CVGA 2CNUA 4LL0A 3SXRA 4KIPA 4ERWA 5BVDA 3Q5ZA 2VTAA 1WVYA 5GINE 2R3OA 1EH4A 3CGOA 5IEYA 3C4EA 5M55A 3A60A 2JKQA 3SOCA 5TO8A 3ZLSA 1PY5A 3UOLA 3SVVA 3UQFA 2GQGA 2JBOA 3OBJA 4QP9A 1GZ8A 1Q5KA 4XX9A 5AV2A 2UZLA 4CXAA 5GZAA 2GQRA 5M4CA 4BKYA 3GQLA 4IDVA 2WQEA 5AADA 2VWUA 3KREA 4DFZE 5HO7A 4EJNA 3UNKA 2UV2A 3HKOA 3IECA 4U44A 4C35A 4F7LA 5D41A 5AP2A 4FSRA 2JDOA 4USFA 4XG9A 4FNXA 3QCSA 1H27A 4H1JA 4XJ0A 4EC8A 4UN0C 2ITNA 5ANGA 5KMMA 4ZIMA 1IG1A 3ULZA 3F9NA 3PY0A 4FG7A 4DG2E 3FZSA 2R7BA 4IJ9A 3W2PA 5E7RA 1UKIA 4QP1A 1JAMA 1U54A 1H1PA 3HP5A 2QG5A 3T9IA 4GVAA 3BBTB 3HV6A 4M3QA 3GFEA 2VWBA 2OBJA 4D5KA 2BIKB 4QQCA 3PXYA 2GU8A 2C5VA 2YIRA 4GK2A 3PLAE 3NNWA 4RPVA 4YHTA 5M53A 2CHLA 3GNIB 1YWVA 5BYYA 2ONLC 1SVHA 2WELA 4GT4A 3VRYA 5I9XA 3MPTA 4UWYA 4ZZOA 2ZM3A 4KBAA 1HOWA 5J9LA 2PVKA 4O96A 1WFCA 2OJ9A 1Q99A 3V8WA 2BRMA 3QLFA 2Y0AA 2CGUA 4O0VA 4Z7HA 4HZRA 4FE2A 4RX8A 3A2CA 1Q3DA 3DKCA 3FY0A 4OR5A 2ERZE 5EOBA 3UVQA 3W33A 3F3VA 3NSZA 1PF8A 2NRYA 3N9XA 4FZ7A 2XIYA 3IO7A 2FA2A 4GFMA 3HRBA 3R7GA 4NJDA 1LUFA 3QAME 3UIXA 5JEBA 1J91A 2F2UA 2XS0A 2RIOA 4F0IA 4AXAA 3PPJA 4PDSA 4LGGA 3VUDA 3RK7A 5AP6A 4AAAA 2NPQA 3KF7A 4LRJA 3WE4A 2C6EA 4BHZA 2OZAA 5JGBA 5HNIX 4B9DA 2WMBA 4UXLA 2VWIA 3SXFA 3LW0A 4E7WA 4YR8A 4I6FA 3GOKA 5LVNA 4QD6A 4RMZA 3UC3A 2GCDA 3UPZA 2QOLA 3FMKA 4RSSA 4EOQA 3MH0A 4FKSA 3V6SA 3L9LA 4CFFA 5L3AA 2BDJA 3V5WA 5EKOA 4ACCA 4TNBA 2OFVA 4GYGA 2X4ZA 3GCPA 2XK8A 3WZJA 4BHNA 5LWNA 3RNIA 4X2NA 4AGCA 4IH8A 4OLIA 2UZOA 3GB2A 3F3UA 4CCBA 4W4XA 3PVWA 5EQYA 3WBLA 5A4EA 4M69A 4FIHA 2J50A 2ZV7A 3QTRA 4FTUA 1AQ1A 2VV9A 3DA6A 3MH1A 4G17A 2X2LA 3RJCA 4LGHA 3UC4A 4FT7A 3PG1A 4ZTSA 5CEIA 5TT7A 4BZNA 5IQEA 3EB0A 1CKPA 4QMNA 3LZBA 3IW5A 3VS2A 4FEQA 3F66A 3DXPA 5E8VA 4E6AA 2KTYA 3QYWA 4JT3A 4FVPA 5AP4A 5L6OA 5IQFA 4Q2AA 3R02A 2FSTX 5IPJA 4EOSA 4BFMA 3NIZA 3EIDA 3KC3A 3V5QA 2OI4X 4N0SA 3VW8A 3O17A 5M07A 4CTCA 3D94A 2J4ZA 2ITVA 3Q4TA 3Q9YA 4OTRA 3QQUA 4ZY4A 4AU8A 5EDQA 3PXZA 1Y6AA 1JSVA 3G6HA 4II5A 4DH3A 4QP3A 2WTJA 5BVNA 3EN6A 1I09A 4A4OA 4PNKA 3TV4A 4L01A 4R7HA 3OW4A 1OM1A 3R7YA 5FXSA 3PE1A 4FTTA 3SDJA 2LAVA 4BRXA 3DCVA 4FSMA 5HVYA 4DGLC 1E1VA 2CLXA 4MBJA 4TW9A 4F09A 3H0YA 4W4WA 2XBJA 4CG8A 4GV1A 4EH9A 2OXDA 2WU7A 5KKRC 3U55A 5M4IA 2G1TA 2BZHB 3T3UA 5J95A 2QI8A 2NP8A 4MNEA 4E3CA 4FKOA 3ZFXA 2VU3A 4Q9SA 4TTHB 1ERKA 2PUIA 1PMEA 1YRPA 3NW7A 4IWDA 1J7IA 3B2TA 1LPUA 3Q60A 1VR2A 4RIOA 4EOIA 3ZO4A 2O3PA 4PPBA 4XEYA 3Q4CA 4QYHA 2QG7A 3V5JA 4E6QA 4JAIA 2HWOA 4ZJVA 4RFMA 2XF0A 2PY3A 4CT1A 1RE8A 2GNGA 4AACA 4KIKB 1NT2A 2W17A 1XBCA 1K2PA 3JS2A 5J5TA 4UV0A 3UOJA 2ITZA 2ITQA 3TM0A 3QC9A 4YZCA 4CV9A 2BAJA 4QTBA 3MTLA 1JKSA 2O63A 4JBQA 2X6EA 4I92A 3UVPA 1R0PA 3LIJA 4NM0A 4F7JA 3EFJA 5IISA 2W4KA 3OHTA 4JDKA 5CI6A 4K2RA 5HU3A 5H8GA 3HV5A 4I41A 4XNEA 4UMPA 3C0HA 5IA5A 2XNGA 3UO5A 5CYIA 1LR4A 3F82A 3PLSA 3E3BX 4DEDA 3MW1A 3FKOA 3R2BA 2PPQA 2C5OA 1U54B 4YTHA 5IG1A 5HVKA 1JVPP 4WUNA 3VC4A 2G2FA 4R6VA 3RVGA 3KMMA 2B0QA 2W1DA 4S30A 1GOLA 4HPTE 3ZH8A 3NYOA 1E1XA 2XEZA 3DQXA 3S95A 3R1SA 1OUYA 2A27A 3ORTA 4O0XA 2XVDA 4GT3A 4TYHB 2W5BA 4PMMA 4DGOA 5FXQA 3BPRA 4CMUA 5CF4A 2XIRA 3NNXA 5A3XA 4ASEA 4FI1A 3QCXA 4ZJJA 4OW8A 1XBBA 4FIFA 4J97A 4YZ9A 4C36A 4K77A 4YBKA 5CNNA 5I3OA 2OJIA 3MA6A 4H3QA 4J7BA 4AQCA 3RHKA 2Z7SA 1MRYA 4TT7A 2B7AA 1RQQA 2PUPA 3EKNA 4QYEA 4XH6A 3TUDA 4BDBA 5DYJA 4DGMA 3O7LD 2OIDA 4PDOA 2F4JA 1FVRA 3ATSA 2WMRA 2IO6A 5KZ0A 4D9TA 2R64A 1O9UA 3P86A 4UY9A 2BAQA 2QOKA 3GCVA 3MWUA 4YNOA 3WF5A 3LQ5A 3OP5A 3OUNB 2OZAB 5IQCA 5E90A 4L3PA 1P4OA 2PMLX 5LMKC 2BTRA 4QMXA 2WQOA 3AT4A 4Y83A 3LFSA 4FTIA 3EQBA 1FQ1B 4PUZA 3SKCA 4H3PA 4L42A 5HBHA 4RJ3A 3WARA 4ANMA 3TNPC 2CCHA 3FL4A 3F69A 4OTPA 3LJ1A 3R2YA 4RQKA 1SVGA 3GENA 3O96A 4XP2A 2C0OA 3NYXA 4FT9A 1TKIA 4IIRA 1H26A 2VX1A 4R77A 1RDQE 4EHEA 2EVAA 2CN5A 3BRBA 2HY0A 3KF4A 5D9HA 4IFCA 3UO6A 5L2TA 1PKDA 5GIOE 1H1SA 5DA3A 4KS7A 5HX8A 3DKGA 4LRMA 4RZWA 4JQ8A 4PTGA 4ZSLA 2R0IA 3OMVA 3BLHA 2ETRA 5H8EA 3BHHA 3Q9XA 4TYEA 4L46A 5IUHA 2ZJWA 2O5KA 5L6WL 3B8RA 2B9IA 4O27B 1JNKA 4I94A 3V5LA 5FDXA 5EW3A 5FM2A 4YTFA 4RX5A 3JYAA 4EK6A 4ZTHA 2JBPA 2OFUA 4XCUA 2IVVA 4G34A 2XK3A 2Y4IB 3RAIA 3BQRA 3CPBA 3NUUA 3PZEA 2EUFB 3R8LA 4A4XA 5FRIA 3FWQA 1R39A 1SNUA 3I81A 4EH6A 5JH6A 4O7SA 1YQJA 4BDEA 3DTWA 3FI2A 4QMOA 3S4QA 5HO8A 4BTMA 1NVSA 4HVHA 1O6LA 3Q9WA 4RJ5A 3ZMMA 4UMRA 4J96A 3KRLA 4RLLA 4PTCA 4YMJA 3ZCLA 1BLXA 2ACXA 4ZTRA 4D2TA 4TL0A 4JS8A 4BYJA 1PXOA 1CSNA 2W4OA 3REPA 4FSWA 4M7IA 3DBFA 3RTPA 5FTQA 3SXSA 4KSQA 3QWKA 4NTTA 4UEUA 4FV5A 4I6BA 5DBXA 4U43A 4L52A 5AX3A 4IC7A 4EI4A 2C6IA 3PJCA 3VS4A 4NEUA 1WBWA 3V5PA 2QVSE 3N4TA 4FSUA 4KA3A 4M68A 4AZFA 5IH6A 3P4KA 4U40A 1UNLA 2W0JA 2YM3A 3F2AA 4IC8A 4NK9A 4BCIA 2OH0E 4BTFA 3KK9A 1MRUA 2JKOA 4DE4A 2P4IA 1Z5MA 3OVVA 1O6KA 3NUXA 5DN3A 3CJGA 2R5TA 4F63A 2OU7A 4I21A 1HCKA 3ORKA 3QUPA 3FZTA 4BCJA 2C1BA 2QURA 2UW6A 3DFAA 3LFAA 4ASDA 2O65A 1R1WA 3RALA 3TJCA 2CNVA 4YUQA 2FH9A 3D15A 3ZO2A 5M44A 4DTBA 4FGBA 4TYJA 2QO7A 2QOBA 3CTJA 4MEDA 4WA9A 1FGIA 4NFNA 1QL6A 2X39A 1YI4A 3EFWA 4AE6A 2X1NA 4EEVA 3V01A 4KKEA 4E6DA 2XJ2A 3GXLA 4FKVA 4EHZA 2I7QA 4DA5A 1TQPA 3H9OA 4OTFA 3QU0A 3R04A 3OY1A 2JGZA 4UWBA 4AGWA 4G5JA 3S00A 4YPSA 3QRUA 4YJQA 1SYKA 1ZMWA 3MB6A 4X7QA 4G31A 3CKXA 1YDTE 2YIYA 3D5WA 4H3BA 1KV1A 2F7EE 3E8DA 1PXMA 4NKAA 5JZNA 1FBNA 1J1CA 2BRNA 4ZSGA 2UVZA 1W8CA 4BCQA 1H0WA 3FY2A 2PE0A 3IW4A 3WF9A 4BGQA 3DGKA 4JLCA 5BUJA 2OF2A 5H9BA 4W8DA 2WFYA 2BKKA 4FKUA 3L8XA 3P5KA 3KULB 2JDTA 3R8ZA 2RG5A 5AR7A 4BCKA 5IQAA 3GU8A 4DTAA 3ACKA 2OF4A 3DAKA 1WBTA 3QRIA 4BWKA 5BUEA 3A8XA 1JOWB 2YLEA 4CKJA 3OC1A 4B99A 4F7NA 3EKKA 2YACA 3RM6A 3DZQA 4ACMA 4IFGA 2JITA 4BZDA 4MF0A 4YHJA 3Q5IA 3UP2A 3ZUTA 2J7TA 4KRCA 4ZEGA 3ZO1A 4C3PA 5AAGA 3WIKA 3TN8A 1IA8A 4M14A 4R1VA 3B8QA 3MPMA 2YDJA 3DK3A 5DNRA 2REIA 4RIYA 3E87A 4F6WA 3UE4A 3WOWA 2CKQA 3LM5A 3KY2A 2WIPA 3PFQA 1AGWA 3R01A 2E9VA 2J5EA 1U46A 5G1XA 3BYVA 4L67A 5HX6A 5IQBA 4RX9A 4FOCA 4QP7A 4O91A 4AW0A 3ZM9A 4ZLZA 1UU3A 3R83A 4U41A 2YZLA 1WMKA 3LJ2A 3DOGA 3BYOA 4A06A 3R71A 5B7VA 3DXNA 3AMAA 4DLJA 5A6OA 4GSBA 2WIHA 3CR0A 2PE1A 5IMEA 5AR4A 4EQUA 1W83A 2WMWA 3V6RA 3KU2A 3SW7A 2YDIA 3PDTA 1BL6A 4G3DA 4GIHA 3L8SA 2R2PA 1PXKA 3C51A 3GFWA 3RCJA 4MXAA 2YISA 5AP7A 4BKZA 4U97A 3U9CA 4NCTA 3QD0A 3AQVA 4L7FA 4MXZA 2PVMA 1ZY4A 4MXCA 4NKSA 4WNMA 4X6RA 2VO0A 4B0GA 2X6DA 2WPAA 3I7BA 4KINA 2O2UA 3Q3BA 5D7VA 3VS1A 2YA9A 3W1FA 1G8SA 5EQPA 5AR8A 4ENYA 4HYIA 4OBOA 3ZC5A 3T3VA 4O0RA 4EKKA 1XO2B 2OW3A 3R8VA 3EL8A 2VTMA 3ODZX 3ORMA 5D1JA 3ZONA 4DT9A 2OKRA 4BBFA 1UKHA 1YXSA 2CGWA 3P08A 4IW0A 2X9EA 2X7OA 4W4YA 3JR1A 1G3NA 5FEDA 1OL6A 2HZ4A 3EQDA 4IWPA 3IW8A 1KOBA 4IANA 1ZMVA 4EUTA 3R22A 2HYYA 2QOHA 3P79A 4AN3A 5CEPA 4Q9ZA 4F0FA 2VWVA 3TZ9A 3HRFA 4BBMA 4DHFA 4C4GA 2I6LA 2P55A 2QKWB 2YIXA 3VF9A 1DS5A 4FL1A 4JOAA 4C4IA 4O82A 4C4HA 4GEOA 4IB0A 5DGZA 4QPAA 4Y85A 2ZM1A 1PMNA 4GH2A 4Z9LA 5EI8A 3FYKX 2R3NA 3CTQA 3TNHA 3ZDUA 5JFSA 4KAOA 2OICA 3PTGA 2R0UA 2UW5A 3GU7A 4OTDA 3ROCA 3COHA 3VVHA 5JQ5A 3C13A 4GCJA 2Q83A 1CKIA 2XK7A 4NCTC 5CSPA 5DI1A 4ACDA 4L3JA 3H10A 2XCKA 4RT7A 4GS6A 3SGCA 4J98A 2XJ0A 4DBNA 5LCJA 4IZ5A 3W2RA 4Z3VA 5HVJA 3IDBA 5AAEA 2P0CA 3FSKA 1OKVA 3FXXA 4AS0A 5B2MA 2HCKA 4G3GA 4X3FC 1QPJA 4L45A 3CE3A 4WOVA 3MH3A 4FUYA 3TNQB 4RJ7A 1PXNA 4FKJA 4P4CA 5KHWA 4J8NA 5EFQA 5M51A 4ZS0A 4BCPA 1XBAA 1Q8ZA 2W1ZA 2XKEA 4IAFA 1ZYLA 4AA5A 4HVIA 1F3MC 3P0MA 3PWYA 3PZHA 4F65A 2DWBA 4BDAA 1ND4A 4JDIA 5EM6A 2YWPA 5LVLA 4BDHA 4E26A 2R7IA 5CAPA 2UW3A 4NSTA 2C30A 2CGVA 3GUBA 3DXQA 3CS9A 3RGFA 4NYEA 4MD7E 4K11A 4MYGA 5HCYA 4BIDA 3OFMA 2OJJA 4AZVA 4DLIA 4W8EA 3G33A 3BQCA 4EH5A 3OWJA 2BZJA 2X0GA 4FK6A 4NZWB 1H00A 4ARKA 4BI0A 1MP8A 4O7ZA 2VTLA 1YHSA 3NEWA 2G2IA 1QPCA 3DS6A 2W1EA 3EQIA 3IK3A 5CT7A 5AUYA 4D4VA 2OLCA 4ALUA 5EQEA 4D58A 5JN2A 2ETMA 3MVJA 2C6LA 4O6EA 3TTJA 5M4UA 1H8FA 1LEWA 2QCSA 3PXKA 3UNJA 4TYGA 4DCEA 3ID6C 2P3GX 3CKWA 3HA6A 4MXXA 4NW6A 3CQEA 4AGUA 3KRWA 5DLSA 3I6UA 3LE6A 5KZIA 5HD4A 3FZPA 1JLUE 3O8UA 4FK3A 3EYHA 4RIYB 5JKGA 1MRVA 2QC6A 2BAKA 3I4BA 3A7GA 4JVGA 4U81A 4BI1A 4E6CA 3C5UA 4C4EA 2BTSA 2W9ZB 3SRVA 4O86A 3OEZA 5K5NA 3QA0A 2C1AA 4MBIA 4EUUA 2I0YA 2YZAA 5HTBA 1R0EA 4FV7A 4IAZA 4IM2A 2I1MA 1J3HA 4U5JA 4GRBA 4RX7A 3I1AA 4JQEA 1REKA 4WKQA 2BZIB 3RPVA 4TWCA 1CMKE 5LMAA 4PQNA 3NCZA 3C4CA 4IM3A 4M12A 3GOPA 4QP8A 3TZ8A 4AZTA 4OTWA 5H3QA 1F0QA 4V01A 2R3JA 3G9NA 4EH7A 5K9IA 3COIA 3IGGA 1OBDA 5CEQA 3BEGA 2HK5A 3QALE 3TKIA 2E9OA 4F9BA 5BMMA 4GMYA 4FT0A 4DEIA 2R3GA 2GDOA 2W5HA 2C47A 4DN5A 3KXZA 4DEBA 5EDRA 1OIUA 4RJ4A 2BKZA 3MY0A 2UZNA 2OJGA 4QMTA 1V1KA 3OXZA 3W32A 4BYIA 4R3RA 1K9AA 3E62A 4FZAB 4EK4A 1SMHA 2YM6A 3NDMA 3W8LA 5CAQA 5CSWA 4NW5A 1VEBA 5BMSA 1GZKA 2JFMA 3HNGA 5HLWA 3PRFA 3QHRA 3TZMA 1BMKA 2BFYA 2RFSA 4F70A 1IEPA 4YLJA 5JFXA 1H28A 3FHIA 3OUKA 4I93A 4E4MA 3FLNC 4JNWA 3NVMB 3RK9A 4PDPA 3VJNA 3RMFA 5LVPA 5CU0A 2YDKA 3I7CA 3M42A 4GU6A 2IW8A 3FUPA 4I23A 1H08A 4F9WA 3LXLA 4FSNA 4XHKB 3M2WA 2R3RA 4G16A 3VAPA 2GTNA 5E8WA 4L00A 5B0XA 4PPAA 2ONLA 2J0IA 4A9SA 4NM7A 3VWAA 4CQEA 2YFXA 3QTSA 4FEWA 1PMVA 3IG7A 3OS3A 3NUYA 5K0XA 2JDSA 5C8NA 2PYWA 2CDZA 2WAJA 3DTCA 2OO8X 4PP9A 1Q62A 2ZAZA 5HLPA 4AFJA 5AUWA 3IOPA 1TVOA 5DIAA 3IPHA 4XBUA 3RPYA 4C59A 3LKMA 3ZBFA 1YOMA 2GHLA 3OTUA 4FV2A 4L3LA 4DEAA 4E5WA 4KABA 2B53A 3OG7A 1ZARA 2YERA 3PVBA 4LRKA 2IN6A 3WF8A 3GU4A 1A48A 5E8TA 3QZGA 2XBAA 1H24A 3ORLA 4FIJA 3L8PA 5CU2A 2V7AA 4FZFB 3R0TA 3CQUA 4CRSA 2B52A 2G2HA 2HZIA 4UMQA 1BX6A 1WBVA 3O50A 5D10A 5HORA 4ZTMA 2WTWA 1FVTA 3IDCA 4C38A 3L8VA 4HJOA 3D5VA 4C61A 5HEZA 2GFCA 3QTQA 5K0KA 2FSLX 1KSWA 2UVXA 3FLSA 2YIWA 2XKCA 3PIZA 3V5TA 2XK4A 3ZUUA 3ET7A 2BFXA 2HELA 3GC7A 3OXTA 2OJFE 2BRHA 4EK8A 4DINA 1UNHA 1ZYCA 4CFXA 4MH7A 1KWPA 2X8EA 3KFAA 4H36A 5E4HA 5BVOA 3VUHA 3AC2A 5HE0A 3DKFA 3BYUA 5AR3A 3QTUA 3DZOA 1GAGA 4IM0A 3MFUA 5HCZA 4OTHA 3F5PA 3G0EA 2YN8A 3PPZA 4M15A 3L9PA 4JRVA 5CU6A 4ZP5A 3QUEA 3KA0A 4DH5A 1JWHA 2C3IB 4O6LA 3LCTA 4RWKA 1ZLTA 3M11A 4I4FA 3FKNA 3KGAA 4HW7A 3PA4A 1KV2A 3K3JA 3RNYA 5KMJA 5C4KA 2VZ6A 5T6KA 2EWAA 4ANLA 5JT2A 5HNBA 4O2ZA 3DT1A 4DFUA 2JIIA 3NS9A 2QKRA 3FKLA 4KBKA 3QKLA 3W10A 3FMEA 3RI1A 3Q2JA 4PL4A 3D9VA 4UYAA 4YNEA 5AP1A 5AWMA 4BDIA 4NT4A 4XV3A 4ZK5A 4ANOA 1J7LA 3FZRA 4MWHA 5AAFA 3QQHA 3CXWA 4F4PA 3G6GA 3CLYA 4D0WA 4FOBA 1YW2A 2XA4A 5JGAA 3GCUA 4J53A 3BLQA 3ULIA 5TE0A 4CVAA 2B54A 2QLQA 3W2SA 5DE2A 3FMJA 2JIVA 3ZUVA 5HGIA 2Y8OA 1OECA 4DFNA 5BX0A 4EK5A 4J99A 4MTAA 4XS2A 5J9ZA 2B1PA 3PRIA 5C03A 3PA3A 4O7WA 2GPHA 4MAOA 5AA9A 4Z55A 1OKYA 5FG8A 4UZHA 4QPSA 5AUZA 2O64A 2YCSA 3Q4ZA 5HTIA 2IW9A 2XH5A 4ANNA 3MI9A 2ITOA 1NVRA 4U3ZA 2JEDA 3IQ7A 4W9WA 2C5NA 4ZTQA 4MQ1A 3HV4A 1FINA 4AG8A 4E5BA 5G6VA 1TQMA 2P2IA 4QOXA 5J7HA 2Y4PA 3QC4A 4BGHA 2WMUA 4U8ZA 2PU8A 5LVOA 4LQMA 4FTNA 3RWQA 4ASXA 2JD5A 2FSOX 2C3JA 3VJOA 4RZVA 4KD1A 1CKJA 4JG7A 3LMIA 3M1SA 4X21A 2BR1A 3VBQA 3AC3A 3KKVA 2ZDTA 4QMLA 3NNVA 3AG9A 2XM8A 3KXHA 3W16A 4D5HA 5LVMA 3WI6A 3FE3A 3EL7A 4IHPA 2YABA 2YJRA 4ZXTA 3CQWA 3L1SA 4A9TA 1UU7A 4MCVA 5DR6A 3NAXA 3O2MA 4IB3A 4LYNA 2PVNA 4E4LA 2C0TA 5EYCA 4J1RA 2NRUA 5AV1A 5AX9A 1ZY5A 2VTNA 5DH3A 1E9HA 4F08A 3I0QA 1M17A 4NM5A 1UV5A 3TNWA 1OIRA 5EYDA 2I0HA 5BYZA 2FYSA 4OTQA 1OPJA 3BYMA 4LMNA 4AW5A 1ATPE 5E8UA 4O83A 5BPYA 4RIWA 4V04A 3R1YA 5DOSA 1W0XC 4G5PA 3DV3A 2RKUA 4OBPA 4ERKA 2C4GA 3Q32A 1NA7A 1UU9A 3F7ZA 3FBVA 1W98A 3Q9ZA 5DWRA 1DAYA 2W1CA 4YJSA 4NWMA 4K6ZA 2YWVA 2F2CB 3PXRA 3R21A 5HBEA 4HVGA 3ZTXA 2EB3A 5C01A 1OL2A 2G15A 3V8TA 2EB2A 5CWZA 3SQQA 5J1VA 2ZYBA 5E9EA 5IA4A 3NMUF 1GIIA 1V0PA 4GFGA 4G6LA 5M06A 4FIGA 1Y8GA 4I4EA 2G9XA 3OTVA 4G9RA 3D0EA 5JRSA 3NUPA 3OWKA 4BVUA 3BGZA 1U5QA 4TNDA 4E8AA 5ETCA 3G90X 5LMKA 4U80A 4DFBA 3RM7A 4O7RA 2RFDA 1Q8WA 1ZAOA 2XNMA 4OT5A 5IQHA 3W8QA 1V0BA 4QQJA 4A9UA 4QMQA 3BHUA 3KXNA 3ITZA 3ZXTA 4QMYA 5DR2A 5A6NA 2DQ7X 4IWOA 5J87A 4BCHA 4BTKA 2YEXA 5CQUA 3DK6A 3E93A 4FX3A 5ANEA 4FV1A 3LM0A 3CD8A 4QP2A 2IVSA 2OIBA 3R7IA 4TXCA 4BDGA 4G3FA 3EN9A 4BDKA 4M0YA 1WAKA 3MIYA 4FTOA 3A61A 2YM8A 3KRXA 4FODA 2XYNA 3Q6UA 1Q8YA 2W06A 3FDNA 3K2LA 4X2JA 4AT5A 4YC3A 4GT5A 4FTRA 3MY1A 4MXOA 3O8PA 4FT3A 2FB8A 2PVYA 4C4FA 1BL7A 5CZHA 4XOYA 2RFNA 1QCFA 2HOGA 4KSPA 1OPKA 3NYVA 4WRGA 5CNOA 5BVWA 4DGGA 4AP7A 4FEVA 2W5AA 2ERKA 2RF9A 4UB7A 1URCA 2X9FA 4WG3A 4WG5A 2WZJA 4L6QA 3ZO3A 2IZTA 3POZA 4ZSEA 4Y73A 3PUPA 5JSMA 2GNIA 5FBOA 1ZRZA 3BWFA 3P1AA 2WEVA 2OXYA 3R8PA 4I20A 4N70A 5KHXA 4HYHA 2UZEA 2XNOA 1OMWA 2PMOX 3KRJA 3D2KA 4QMUA 5CY3A 3W2QA 5I0BA 4C2VA 3BE2A 3NRMA 2WB8A 3R8MA 2ZV8A 2E9NA 4CZUA 3MVHA 5FUTA 4M69B 4YTCA 1P4FA 2DYLA 2NO3A 3Q2MA 4M13A 2QODA 4DCAA 1WVWA 4R1YA 3TNIA 3VW6A 2AC3A 2WMSA 3GEQA 3ODYX 5HG9A 3W55A 3G9LX 2C5XA 4FTLA 3NLBA 4RRVA 2PZPA 2XKDA 3CGFA 4ID7A 2IPXA 1H1RA 4XLVA 5FP6A 4LFIA 3MJ1A 3S3IA 5A4CA 3QL8A 3ZRLA 1XH8A 3NAYA 4JL9A 4FIIA 3RP9A 4FA2A 3HLLA 1B38A 1UWJA 2EU9A 1FPUA 2WMAA 3E7VA 3Q6WA 5IDPA 2B9JA 3KCFA 5TR6A 2QONA 2UZWE 3QFVA 2QQ7A 4PP7A 4FT5A 3CTHA 2XIZA 4FV0A 4QRCA 2CCIA 2WTIA 3RBWA 3KXXA 2WTKB 4DFYA 2Y6MA 3CD3A 3U6HA 2R3HA 4O1OA 4JG6A 4LM5A 5KMLA 2W99B 4F9CA 4JBVA 2KULA 2R3KA 4C62A 3FMDA 3CJFA 3EHAA 4D2VA 3CP9A 4RVMA 1WCCA 2B9FA 3ZHPC 3BU5A 4I6QA 4I5CA 2OG8A 1M52A 3LCOA 3U9NA 5CVHA 5K4IA 2J0MB 4MNEB 3KL8A 4PL3A 5IUGA 2V5QA 1ZZLA 1OVEA 4EBVA 4O7TA 3MFTA 4WRSA 4RIWB 4Z7GA 3QTXA 3ALOA 3UO4A 5HLNA 4LOPA 2ITPA 4YJTA 4LUEA 4RWIA 3FYJX 4EBWA 1Q8UA 4CQGA 5D11A 4DC2A 5E1SA 2PVLA 5F1ZA 3T8OA 3TT0A 4GKHA 4XG6A 2PMIA 2EXEA 4YJOA 2VGOA 4GUEA 4CSVA 1ZMUA 4D28A 2DUVA 5BNJA 5L2WA 3RZBA 3BZ3A 3E63A 3IKAA 2HW7A 3JPVA 4GYIA 4YJUA 3E8NA 4E93A 3PP1A 2EXMA 3DBCA 2BZKB 1Q8TA 1ZOEA 3DBQA 3G0FA 2F9GA 3E5AA 3II5A 2R9SA 4IB5A 4E1ZA 5DT4A 3U4WA 2X2KA 4DEHA 2C6KA 5L2IA 4XLIA 2IVTA 5JK3A 3A7JA 3UYSA 4D4SA 5ETAA 3H4JA 4X2GA 4FKGA 1VYZA 5C1QB 4AT4A 4E73A 4XG4A 5HOAA 4FTCA 4DEGA 4DG0E 4F6UA 5CF8A 4FIEA 1HCLA 2JKMA 4IE9A 4YSJA 2PVRA 3RPRA 2PWLA 3JUHA 4FTJA 4QMZA 5M57A 2IZSA 1LEZA 5KBQA 5LOHA 4O7LA 3QQLA 4GG7A 4FTQA 4GUBA 5CS6A 5IA2A 4Y5HA 3FPQA 3EN7A 4R3CA 4O0SA 4IZAA 2J0JA 3BV2A 2QNJA 4WD5A 1KUTA 5DRBA 4BWXA 3ZDIA 5I4NA 1OL5A 4L44A 4BC6A 5IH5A 2HENA 4FSTA 1YHVA 5F20A 4Z16A 2WMXA 2Y7JA 3VQUA 5LARA 4AX8A 1CTPE 4B8LA 4HNFA 5EHYA 3SLSA 3CY2A 2UZUE 3QTIA 3OXIA 1YWRA 4I24A 2CKPA 4QYFA 2GS2A 2JKKA 5CENA 3TV7A 2RL5A 4WO5A 1Q61A 3AXWA 3D5XA 1MQ4A 3KEXA 2R3IA 1PW2A 2WHBA 3KK8A 1Y57A 4R8QA 2WMVA 5I9YA 5AIKA 4MF1A 3VN9A 4F9YA 4NM3A 3LFFA 5HESA 3P23A 5J5SA 4QO9A 1YDSE 3FQSA 4FYOA 2V7OA 3D14A 3UIMA 4A9YA 2QD9A 3A7IA 3QGYA 3MN3A 3ZRKA 5KMOA 1GIJA 5CZIA 2ZMCA 3PVGA 3HYHA 1Y91A 3QHWA 5CXHA 2WQNA 5I9ZA 1OITA 4JX3A 1MQBA 1OI9A 3LJ0A 2OGVA 4NTSA 5AV0A 2XUUA 4FNYA 5EW8A 4JIKA 1WBSA 3KRRA 1WBOA 2H96A 4NUSA 3CSVA 3QWJA 3MY5A 2JDRA 2GNFA 3QD2B 5CEKA 3AOXA 4QMSA 1KE6A 1NVQA 3R9HA 3F5XA 4TRLA 5C4LA 3TI1A 3AC4A 3K5UA 2PVJA 5L2QA 5GZ9A 4IX5A 1KOAA 3E8CA 1PMUA 4IACA 4TY1A 4CEGA 5EK7A 1LP4A 1YXVA 5LQFA 3QX4A 2X8IA 2XEYA 2E2BA 2VTOA 1ZOHA 2X4FA 4CMTA 4EOPA 2VTHA 4RWLA 2PMNX 4FEUA 4O7NA 4F0GA 3QBNA 3D83A 3EZVA 1M7NA 3K54A 4C7TA 4QP6A 4MHAA 2GHGA 3BYSA 1KE5A 3C9WA 2VO6A 3FLWA 3C1XA 4O21A 4E4XA 4X3FA 4BDFA 1B6CB 5H8BA 4D2PA 1FMKA 5HTCA 5CX9A 2CKOA 3A62A 4TZRA 2W96B 2NNWB 4G2FA 4P5ZA 4AZWA 3POOA 3TUCA 2ZOQA 4RA4A 2GSFA 4PNIA 2SRCA 2C69A 2ZB1A 4Y46A 4ASZA 4HCTA 2PHKA 1Q24A 4BCNA 2PL0A 1M7QA 3Q4UA 3DK7A 4OTIA 3PY3A 2GNHA 4EZ5A 2WTCA 3C4XA 5CAVA 2PVHA 4P5QA 4YURA 3NW6A 3BE9A 2ITXA 2Q0BA 3BU3A 3HGKA 4YHFA 4MVFA 4PY1A 1YDRE 1J7UA 2ITWA 3L9NA 4QTAA 4EOKA 1XH5A 1SM2A 4QTCA 5EYMA 3BELA 3VHEA 5HIDA 4FV4A 2Z7QA 4K0YA 3C4ZA 3OF0A 5CF6A 3AMBA 5EG3A 3HV3A 3ZFMA 4FMQA 4EKLA 2A2AA 4FG8A 4LV8A 4YU2A 4L9IA 1BUHA 3CC6A 4WIHA 4XRLA 5CLPA 1M2RA 3UOHA 3V04A 3QCQA 3PP0A 4OGRA 2VTJA 4IVBA 3ZSHA 3QZIA 2UW7A 5I9WA 4O0YA 3F2NA 4XG2A 3TG1A 4M0ZA 4PRJA 5EYKA 4YP8A 5K3YA 3R28A 4PMTA 4CD0A 4PMSA 5CAOA 3NVKI 4RWJA 1DI9A 2YM4A 3QF9A 2PTKA 1L8TA 4UXQA 4F1TA 1I44A 1U5RA 3DBEA 2I40A 5FM3A 4JRNA 4WNKA 4EH8A 4OUCA 3RAWA 5JFWA 5CI7A 2J0LA 1T45A 4N6YA 4ENXA 4OTGA 3D2IA 5HCXA 3LQ3A 2YITA 4NH1A 2ITUA 3UQGA 3LCKA 5L8KA 4I22A 4YZMA 4R5SA 4FR4A 3MGYA 2YCFA 1YHWA 4YSMA 5GJDA 4AOTA 4ZY5A 3I60A 5CVFA 2H6DA 4CFUA 2YM5A 4R78A 3ALNA 4TYIA 4YC8A 4DEEA 3TV6A 4D55A 5L6PA 3A7HA 4IEBA 3MV5A 3NX8A 2VTTA 3I5ZA 2XRUA 3TTIA 3ZLWA 4YJNA 4RC2A 2WMTA 3RWPA 1X8BA 2XMYA 5BVFA 4L68A 1OZ1A 3NGAA 3TXOA 5CU3A 4FKRA 1JKLA 4FKPA 4I5HA 1FMOE 2CGXA 2IG7A 1M2PA 2V0DA 4V05A 1PXPA 4KB8A 3F3WA 1M14A 3I0OA 1IRKA 3E88A 3SG9A 4BCOA 3OCBA 1IR3A 4Y72A 4BGGA 3G51A 4F6SA 4HPUE 4FG9A 3LXPA 3WIGA 2C3KA 3FSFA 3K5VA 5HO6A 3SD0A 3W2OA 3EQCA 1PHKA 3BCEA 2QOIA 3SW4A 4LOOA 5JFVA 4PX6A 4DITA 5JMSA 2IVUA 4NU1A 3VUGA 2C3LA 5K4JA 4FGRA 3UG2A 4BDCA 4CLJA 2F49A 4FKQA 3GU5A 1MUOA 4J8MA 4QNYA 4A7CA 5CALA 3RINA 2WMQA 5ANKA 3KXGA 3ACJA 3EQHA 4L8MA 4S32A 4NL0A 4ALWA 3MJ2A 3RZFA 3OT8A 4HGTA 5KMNA 1W84A 2BALA 3WF6A 1H25A 3Q53A 5M4FA 1OKZA 2Z60A 3P7BA 4WSQA 5L8LA 2ZDUA 4S31A 4IX6A 4APCA 4CFMA 4FKIA 4EOJA 3KMWA 4IX4A 5K5XA 3KQ7A 3PE2A 2WTDA 3QRKA 3JVSA 4UYNA 2VWWA 5HE2A 3ZSIA 4KRDA 5IH4A 4FBXA 3LFQA 4QTDA 4A07A 3VNTA 3F5GA 4KKGA 4TKSA 4D4RA 5IA1A 3JXWA 4N6ZA 4X3FB 3VUTA 4S2ZA 4FSYA 5HD7A 4JR7A 5DEWA 3UVRA 4QMVA 5HE3A 4M8TA 4XYFA 3ANRA 2JLDA 4BCFA 4BB4A 4IVCA 4A9RA 4KKHA 4AN2A 3KVWA 4D2RA 4DGNA 2WOTA 2UW0A 3E8EA 4ITHA 4CT2A 2QU6A 5J79A 3LVPA 3IDPA 1JQHA 3R6XA 4IQ6A 3U6JA 1IA9A 3IW7A 4S34A 3O71A 2WQMA 4FSZA 3THBA 4ZMEA 3H9FA 3PXFA 2WEIA 4F1MA 5I3RA 2CKEA 4AFEA 3ORZA 2XJ1A 4LUDA 1UA2A 2V55A 2CMWA 4IADA 4HNIA 4M97A 4EOOA 4MXYA 1P5EA 3LHJA 1FOTA 3OWLA 1BI8A 4G6OA 1XKKA 3BU6A 3C50A 3FMHA 2YHVA 3MTFA 4QMMA 3VS5A 5JGDA 1PYXA 5KNJA 3AC1A 2BHEA 4U79A 3ATTA 3MSSA 4M84A 4BN1A 1PKGA 1R3CA 3E64A 1PYEA 3F3TA 3S1HA 3WZEA 2JAMA 3ETAA 3Q04A 4I5MA 5GJGA 3VUMA 3MIAA 1H1QA 4QNAA 3ZZEA 2VNYA 4OAVB 1XH9A 3HDNA 3LFCA 3FMMA 3LMHA 5AUUA 4FKLA 4C58A 2GNLA 3EQGA 4ZOGA 4CYIA 5AM7A 5AM6A 4KIKA 3BHYA 5CU4A 2CPKE 5DT3A 4HZSA 4AZSA 4B7TA 5KCVA 2RGPA 4IVAA 4W9XA 4YO6A 3UYTA 3DKOA 4EOMA 3UQCA 1FVVA 2JC6A 3ERKA 5CT0A 3R7EA 5B2KA 2BVAA 4ANQA 2HXLA 3PSDA 3TJDA 2VRXA 4JI9A 4O0UA 3W18A 3F3ZA 4C02A 4YPDA 5A4QA 2VNWA 3LLAA 3ZEWA 1J1BA 1H1WA 2XKFA 3G15A 1ZOGA 4AWIA 5DVRA 3HMNA 3A7FA 2X7FA 4JR3A 3FV8A 5AP5A 2VTPA 4KBCA 5CQWA 4JAJA 4GW8A 3DB6A 4G6NA 3GC8A 4ZJIA 3AMYA 4LV5A 5IUIA 4CFVA 3UMXA 4IAIA 5CANA 5HU9A 3ENMA 3H3CA 3COKA 4UMTA 4EH4A 4DFLA 5HQ0A 3FI8A 3R1NA 4XV1A 3GC0A 4O7YA 4TYHA 2UZBA 2W4JA 2VAGA 4EZ7A 5E8ZA 4FSQA 3SA0A 4EHVA 3VBYA 2WU6A 3HAMA 4E20A 3QCYA 3OWPA 1DAWA 2W1HA 5IF1A 4C8BA 3N4VA 2PZIA 4FTMA 3F7WA 2IW6A 4P90A 5TOZA 3PJ1A 4EQCA 5HIEA 4ZSJA 3TIZA 4ZTNA 3VS3A 4CYJA 3GVUA 3R63A 3OT3A 5HKMA 3QRJA 1GNGA 3MS9A 4U6RA 4MK0A 4Y95A 4YZDA 4AE9A 3AGMA 4QP4A 3R7OA 5EOLA 2R4BA 3GGFA 3HMIA 4FC0A 4DFXE 4FV3A 5CTPA 4F64A 4HVSA 1OKWA 3BKBA 2ZM4A 3F6XA 3PVUA 5AIRA 2XNEA 2VTSA 3SRVB 4ZLOA 3NUAA 3I5NA 5B2LA 3PPKA 3TDWA 2F57A 4I1ZA 2AC5A 3WYXA 2GS6A 5GIPE 4X6QC 4CGAA 4DH7A 3PSBA 3ENHA 5E8YA 3BX5A 3VRZA 4Q5HA 3OCGA 5TKDA 4RGJA 2CSNA 3VBVA 4RFYA 2HY81 5KE0A 4Y8DA 1OBGA 3UODA 2BPMA 4C3FA 3TKHA 5H2UA 2XZSA 4IAYA 4EL9A 2CJMA 4MD8E 3UG1A 3HP2A 4GK4A 4IXPA 3R9RA 5ANOA 4D2SA 3FAAA 1YKRA 2BUJA 4YLKA 4DT8A 3IOKA 3KN5A 3N51A 4RC3A 4MNFA 4NIFA 3ZM4A 1XH6A 4EQMA 5C8MA 3ZFYA 3QTWA 2QU5A 3D7TA 1DM2A 5AP0A 5FEEA 4YJRA 3O23A 3HX4A 5TF9A 5AEPA 3QD4A 3ZOSA 3EQFA 3F5UA 3UTOA 3VO3A 4FV6A 2I0EA 4JG8A 1IAJA 4Y5QA 4AA4A 2PZRA 4CTBA 3HV7A 4XRJA 3QKMA 5JRQA 3NCGA 1R78A 3LPBA 4MX9A 5IQDA 1T46A 5ANJA 4FKWA 3LFBA 1A9UA 1U4DA 5FBNC 5FQDC 5F9EA 4H39A 2C6OA 3R00A 3VUKA 5GZ8A 4ITJA 4GFOA 5J7BA 4EYMA 4CV8A 4UZDA 4AOJA 5EI2A 3ROYA 2WO6A 2C68A 2HW6A 3PYYA 4HGEA 3T9TA 4EZ3A 5CASA 2XYUA 4FNZA 2BHHA 2G01A 2GHMA 5HNGA 2W9FB 3FLZA 4C33A 5CSVA 4C34A 3GI3A 1W82A 5DFPA 4DG3E 2VTRA 3OOGA 4YTIA 4E4NA 3VIDA 3GBZA 4FYNA 1CDKA 2XK9A 3EZRA 3QQJA 3K3IA 2W1IA 4CFWA 4BTJA 4XUFA 3AD5A 3D7ZA 3SC1A 3ANQA 4YZBA 4DF3A 4FZ6A 2AUHA 3KVXA 1A06A 4CG9A 5DEYA 1Q97A 3ORIA 4LI5A 3MESA 2YM7A 3ZYAA 5BVEA 3ZS5A 2IZRA 1WBPA 2VWZA 3EFLA 1KE9A 4IZYA 2VO3A 3NW5A 2XNBA 1JSUA 3HA8A 3PJ8A 4OBQA 2UVYA 5L8JA 5IA0A 1BKXA 2V22A 4WT6A 5GHVA 3RPOA 4BKJA 3TUBA 2GQSA 1SNXA 4JQ7A 4I0TA 3BGQA 3R8UA 4RJ6A 3RPSA 2Y4IC 3WF7A 3ZRMA 4HYSA 4PL5A 2WTKC 3R1QA 5CSXA 3R9NA 1NXKA 4TN6A 1U59A 2RFEA 4RIXA 2VWYA 5ETIA 2QHMA 2LGCA 4CCUA 3RHXA 5AV3A 4DH1A 1Z57A 2IWIA 3FEGA 4RVKA 4MBLA 3QUDA 4XBRA 3FPMA 3IONA 2WXVA 1XHAA 2YAAA 3EFKA 1ZZ2A 4LOQA 5E91A 3ZC6A 3I6WA 4AF3A 3BI6A 3QX2A 2BDWA 3V8SA 3KXMA 3FC2A 5E8XA 2XM9A 4KNBA 3IS5A 4PV0A 5F4NA 3VS0A 4EWHA 4CMOA 3Q52A 2B9HA 4RVLA 1JKKA 1XJDA 3FLYA 2HXQA 2FO0A 3FL5A 4G3CA 4M66A 2PUNA 2ETKA 2H34A 4FL3A 2WQBA 4D1XA 3KN6A 3LCSA 2BCJA 2QOFA 3QKKA 3DBDA 3QZFA 3LFDA 4HCUA 4D0XA 5EH0A 3LMGA 1OL1A 4BDJA 4I5PA 3GC9A 1G8AA 1Q4LA 5D12A 3C7QA 2V62A 4GIIA 4ORKA 3KULA 2BIYA 3HDMA 3OOMA 3QZHA 2OIQA 3MBLA 4D2WA 3VULA 4EJ7A 2GFSA 3FQHA 4R7BA 3H0ZA 4BY9E 5KKRB 3ZXZA 5AUVA 2R3PA 5AV4A 1YXTA 5FD2A 4B8MA 2Z02A 1K3AA 1O6YA 4MWIA 4QMPA 3EN4A 4XOZA 2GMXA 3GQIA 4MD9E 3UMWA 4FTKA 5EHOA 2FGIA 2XRWA 2VD5A 4L7SA 5D7AA 3TKUA 2WNTA 2JAVA 3BGPA 5IDNA 4BR3A 2OZOA 2XCHA 3E7OA 4YGAA 5I5ZA 2X81A 4V0GA 3UDBA 5IKWA 5AUXA 4DH8A 4JBPA 3NUNA 3QA8A 3F61A 4QTEA 3CIKA 2C5YA 1H0VA 1AD5A 3OW3A 4GL9A 1IASA 3HMOA 4PDYA 2A1AB 5KMIA 2Q0NA 5CEOA 3TCPA 3MYGA 5A54A 3R7VA 5FP5A 2E9UA 3OEFX 3MA3A 4K18A 1PRYA 2P33A 3EQPA 4NIFB 3UZTA 3FZOA 3DDPA 4F7SA 3U54A 3D7TB 3UZRA 3HRCA 3A4PA 3QQFA 3UNZA 4CZTA 5BVKA 3DPKA 5F95A 2VTQA 5A14A 4KS8A 2VN9A 4XP3A 2WKMA 1DI8A 1YXUA 1ZYJA 3DJ6A 4QYYA 5EDPA 5E1EA 2J51A 2J6MA 4F1OA 2YAKA 3SG8A 3BWJA 4O81A 5FLFA 3FLQA 3FXZA 2XNNA 5KUPA 1NY3A 4XG7A 4BZOA 4ZZNA 3AGLA 3E3PA 3JVRA 3ZLXA 4KIOA 2UZTA 4FICA 2PK9A 2X8DA 1JPAA 3DNEA 3V3VA 3HUCA 4FF8A 3ZLYA 3RAKA 2OWBA 4UWCA 4PPCA 4K33A 1YVJA 3HAVA 2WTVA 3DQWA 4S33A 5DPVA 3UZPA 4D4YA 4EONA 4QMWA 3ELJA 2ZB0A 2Y6OA 4G1WA 3EH9A 3VQHA 2UW8A 4HOKA 4CNHA 1VJYA 2GS7A 3CPCA 2BDFA 2BMCA 1ZXEA 4YJPA 3OCSA 2PSQA 4FZDB 3GT8A 3KCKA 5EM8A 4O1PA 3U51A 3WZDA 2J9MA 4CRLA 3UIBA 5M08A 4KWPA 5JQ8A 1UVRA 1Y8YA 3JY9A 4TWNA 3ZU7A 4ONAA 2CLQA 4JDJA 4YC6A 2W1FA 2QO2A 3EOCA 3FI4A 4U7ZA 3H9RA 3VBTA 5J9YA 4ZS4A 2A0CX 3HECA 3VBXA 3DY7A 4NFMA 5IQIA 4PMPA 4O84A 4IZ7A 5EHLA 2PZ5A 4RJ8A 3MDYA 1JKTA 3U87A 4X3JA 2J5FA 1KE7A 2WGJA 3P7AA 3PSCA 4IX3A 4H05A 4U9AA 3C4WA 4XV2A 2Z8CA 4EORA 2VGPA 2C6MA 4G3EA 4ZY6A 1W7HA 2VX0A 4O22A 2ESMA 4WG4A 3SV0A 2AYPA 1SVEA 3Q96A 1WVXA 3NIEA 1GY3A 1ZYDA 4RIXB 4OT6A 3N4UA 4AZEA 4I0SA 2ZVAA 1QMZA 1S9IA 4JIAA 2OK1A 3BHVA 4R7IA 5FGKA 5FWKK 2HAKA 5DR9A 4QT1A 1YOJA 4IAAA 5I9VA 1WZYA 2Y9QA 4F99A 1IAHA 5KX8A 5A4LA 2QHNA 3BLRA 2OH4A 3VHKA 4N4SA 5EM7A 4BIBA 3OBGA 3DDQA 3GCSA 5T3QA 1BYGA 1TQIA 3OY3A 1XQZA 4O38A 4DAWA 3ZEPA 2A4LA 4WSYA 1CM8A 1WBNA 1YI6A 3FHRA 3V51A 3WYYA 4R5YA 2YLFA 4KIQA 1S9JA 1PJKA 4LGDA 3SHEA 3FC1X 4X0MA 4K8AA 1BI7A 3EYGA 1OGUA 3EMGA 5DRDA 4B6LA 2BILB 3TDVA 3SAYA 4GK3A 3O51A 3MPAA 3B2WA 4YLLA 4CLIA 2HZ0A 3DJ7A 3G2FA 2E9PA 1B39A 3QYZA 3P7CA 1YOLA 3BBWA 3QLGA 3RCDA 3ZBXA 4GG5A 2UZDA 4XG8A 2J2IB 1QPDA 5F94A 1Q41A 3AD4A 3CEKA 3P9JA 3A4OX 3DJ5A 3LLTA 4RLKA 3NR9A 5CSHA 1P14A 4UALA 3OD6X 4FKTA 4GU9A 3VF8A 4O0TA 3UIUA 2H8HA 5LJJA 5DG5A 5HHWA 4BWPA 5BQ0A 3QGWA 2PE2A 3FMNA 4GJ2A 4I0RA 2IZUA 4ITIA 4JJRA 5HE1A 3FJQE 5CF5A 4Q5EA 1Q3WA 5C27A 2BRBA 4NJ3A 3O7LB 3PJ3A 4ACGA 4AOIA 3C0GA 1FGKA 2QO9A 4UBAA 5C9CA 3PIYA 4ANSA 4TWOA 1PXIA 1GJOA 1Z9XA 2HIWA 3NYNA 4PTEA 3HEGA 4RA5A 4U0IA 3TWJA 3U4UA 2RSVA 5AR5A 4C0TA 4HVDA 5M56A 2F7XE 4H58A 5AUTA 5J8IA 4V0GB 4WUAA 4FV9A 5HI2A 2YCQA 4IVDA 2X7GA 5ANDA 2C0IA 2YIQA 4D1SA 5HG5A 2QOCA 4XV9A 1VZOA 2XIXA 1OIYA 3CY3A 4MKCA 4MQ2A 4A4LA 4FTAA 4J52A 3QRTA 4QQTA 4QQ5A 4BICA 1YXXA 4UMUA 4EHGA 2Z7RA 5LWMA 3GU6A 3BEAA 5ANIA 2XK6A 3FMLA 2O0UA 5BUIA 3RKBA 5IEVA 5KMKA 3PWDA 3ZZWA 4DTKA 4YJVA 2XIKA 3C4FA 4BIEA 4BL1A 4FV8A 4RFZA 3R30A 2ITTA 2XNPA 4WNOA 2UUEA 4FUXA 4RC4A 1QPEA 4DYMA 5A46A 2OSCA 3TACA 4W4VA 5HIBA 4O0WA 1OL7A 2C6DA 2EXCX 4F9AA 5LXMA 3LQ8A 5HG8A 5A4TA 1Y6BA 1M2QA 2QR7A 5FXRA
chains in the Genus database with same CATH superfamily
5HZNA 3DB8A 5DHJA 4AA0A 5CAUA 3WE8A 3BHTA 4AGDA 2DS1A 2R3LA 4C3RA 1G5SA 4K9YA 4IAKA 1GZOA 1JBPE 3TL8A 5EW9A 1APME 3H30A 4ALVA 2A19B 3PY1A 3NZ0A 2JIUA 4FNWA 3MFSA 3R7UA 5ICPA 3DLSA 2QR8A 3U8WA 5EKNA 5HG7A 2B55A 4PF4A 3AC5A 5JZJA 3S2PA 4XG3A 5T68A 3RAHA 4USEA 2JDVA 3C0IA 3NWWA 1OPLA 4CZYB 3KB7A 3LXNA 4R3PA 3GCQA 2GNJA 4JDHA 5LMBA 5I9UA 2VO7A 3QQKA 4BCGA 4P7EA 1H4LA 2Z7LA 3DAEA 3R73A 4HYUA 1UU8A 4J95A 4RVTA 5AR2A 5KO1A 3TIYA 4EH2A 3G5DA 5AA8A 2UW4A 1XR1A 1STCE 3DU8A 1H07A 4IJPA 4U3YA 5IEXA 3AT3A 2H9VA 5EI6A 3NPCA 1JSTA 2R3FA 3SX9A 5ITAA 4K1BA 4RBLA 2CNQA 2OXXA 5L4QA 4LMUA 2VUWA 4X2KA 2RG6A 2WD1A 3LCDA 1GIHA 4WBOA 1V0OA 2VWXA 5FEQA 4AUAA 4APPA 4OAUC 4UX9A 3P5JC 2P2HA 4LL5A 2FUMA 3UGCA 3A8WA 1SZMA 2J90A 3SOAA 2O8YA 1RJBA 2PVFA 3IW6A 4L43A 3MH2A 4G9CA 3DNDA 4TWPA 4WNPA 1ZWSA 4H1MA 4EK3A 4EYJA 4JX7A 4RQVA 3UOKA 3O0GA 2I0VA 4IDTA 1PXLA 2ZMDA 4D1ZA 2CN8A 4P2KA 5FDPA 3AKKA 5FTGA 5LCKA 2WOUA 3EWHA 3IGOA 2ZV2A 2W05A 4O4DA 4IWQA 3OZ6A 4I3ZA 3W2CA 4ZZMA 5E8SA 1RW8A 3WZUA 3KMUA 1UWHA 5AFVA 2ITYA 5AJQA 2IJMA 3VS6A 3RK5A 5IU2A 3EJ1A 3MB7A 3QTZA 3C5IA 2B4SB 3HZTA 4JBOA 3HVCA 4JXFA 5HICA 5E92A 4WHZA 4DBXA 4CFNA 3D5UA 3FXWA 4HGSA 5M09A 3S0OA 4XMOA 4FVRA 1F5QA 3MVLA 3UPXA 4PWNA 2QOOA 5AMNA 3LAUA 3I79A 1GZNA 2XP2A 3A99A 3NNUA 2UW9A 4ZAUA 2W7XA 4TPTA 2PUUA 1YI3A 3LXKA 1URWA 2R3QA 3P78A 4ZTLA 2PULA 2W1GA 5ETFA 3CCNA 4RG0A 2NYAA 2QOQA 1NW1A 4QEBA 5GJFA 4U42A 3AC8A 5CEMA 2J0KA 3BIZA 3O8TA 3PA5A 4LG4A 5ACBC 4X2FA 3TEIA 4ANBA 4ZSAA 3JY0A 1ZYSA 4B4LA 3UJGA 4IBMA 1W2CA 3QXOA 5AP3A 5IZFA 2ZV9A 3VBWA 4AW1A 4C2WA 3GP0A 4XP0A 4KUJA 2Z2WA 3BV3A 3D4QA 3L9MA 4AW2A 4GKIA 2HZNA 4IMYA 4D9UA 4L53A 3DAJA 4QPMA 1P2AA 1VYWA 4WBBB 4YZNA 3QQGA 4YO4A 4O4BB 3LOKA 3QD3A 3R9OA 5C26A 1H01A 3DFCB 5DT0A 4EC9A 1OIQA 5BYLA 4GJ3A 3HMPA 3AD6A 3EQRA 3UP7A 4AXFA 3QXPA 4YBJA 4EWQA 3FQEA 3DLZA 4C4JA 1KE8A 4ACHA 4J71A 3UBDA 1OUKA 1XH7A 2HWPA 3PIXA 4BDDA 5A9UA 3PUFC 3MFRA 4EOLA 4CKRA 3HL7A 3OROA 3MVMA 3WILA 5FTOA 3CBLA 1OB3A 4E5AX 4N57A 5DMZA 2VX3A 4IB1A 5GNKA 1PXJA 1YWNA 2XB7A 3EN5A 4AXEA 3ZSGA 3HMMA 3ORXA 2UZVA 3F88A 4FEXA 5KBRA 5IA3A 3PXQA 2FVDA 4HCVA 3COMA 5J1WA 4HGLA 2JFLA 4I6HA 4M67A 3AT2A 5CXZA 2GTMA 3R9DA 2VTIA 4AN9A 1XH4A 4USDA 2X2MA 3VS7A 4C57A 3TZ7A 2FSMX 2YCRA 4BBEA 3LFEA 3PJ2A 1UNGA 2YJSA 4BI2A 5L2SA 2F7ZE 2BROA 3E92A 1XWSA 3FI3A 4BCMA 2R3MA 4FL2A 4GVJA 5EM5A 5IMXA 4ZMFA 3LFNA 3FZ1A 2QLUA 4AT3A 3KIOC 2PZYA 3ORPA 4QYGA 4U45A 3F2RA 1L3RE 3OCTA 5ACKA 4O2PA 4O7VA 2BRGA 5C8KA 4CKIA 5HBJA 3VUIA 3ORNA 4ZLYA 2C6TA 3NUSA 1ST0A 4EH3A 3HUBA 3PG3A 3WZKA 1REJA 4FVQA 4C37A 3U6IA 5CVGA 2CNUA 4LL0A 3SXRA 4KIPA 4ERWA 5BVDA 3Q5ZA 2VTAA 1WVYA 5GINE 2R3OA 1EH4A 3CGOA 5IEYA 3C4EA 5M55A 3A60A 2JKQA 3SOCA 5TO8A 4FJVA 3ZLSA 1PY5A 3UOLA 1OGYA 3SVVA 3UQFA 2GQGA 2JBOA 3OBJA 4QP9A 1GZ8A 1Q5KA 4XX9A 5AV2A 2UZLA 4CXAA 5GZAA 2GQRA 5M4CA 4BKYA 3GQLA 4IDVA 2WQEA 5AADA 2VWUA 3KREA 4DFZE 5HO7A 4EJNA 3UNKA 2UV2A 3HKOA 3IECA 4U44A 4C35A 4F7LA 5D41A 5AP2A 4FSRA 2JDOA 4USFA 4XG9A 4FNXA 3QCSA 1H27A 4H1JA 4XJ0A 4EC8A 4UN0C 2ITNA 5ANGA 5KMMA 4ZIMA 1IG1A 3ULZA 3F9NA 3PY0A 4FG7A 4DG2E 3FZSA 2R7BA 4IJ9A 3W2PA 5E7RA 1UKIA 4QP1A 1JAMA 1U54A 1H1PA 3HP5A 2QG5A 3T9IA 4GVAA 3BBTB 3HV6A 4M3QA 3GFEA 2VWBA 2OBJA 4D5KA 2BIKB 4QQCA 3PXYA 2GU8A 2C5VA 2YIRA 4GK2A 3PLAE 3NNWA 4RPVA 4YHTA 5M53A 2CHLA 3GNIB 1YWVA 5BYYA 2ONLC 1SVHA 2WELA 4GT4A 3VRYA 5I9XA 3MPTA 4UWYA 4ZZOA 2ZM3A 4KBAA 1HOWA 5J9LA 2PVKA 4O96A 1WFCA 2OJ9A 1Q99A 3V8WA 2BRMA 3QLFA 2Y0AA 2CGUA 4O0VA 4Z7HA 4HZRA 4FE2A 4RX8A 3A2CA 1Q3DA 3DKCA 3FY0A 4OR5A 2ERZE 5EOBA 3UVQA 3W33A 3F3VA 3NSZA 1PF8A 2NRYA 3N9XA 4FZ7A 2XIYA 3IO7A 2FA2A 4GFMA 3HRBA 3R7GA 4NJDA 1LUFA 3QAME 3UIXA 4BJJA 5JEBA 1J91A 2F2UA 2XS0A 2RIOA 4F0IA 4AXAA 3PPJA 4PDSA 4LGGA 3VUDA 3RK7A 5AP6A 4AAAA 2NPQA 3KF7A 4LRJA 3WE4A 2C6EA 4BHZA 2OZAA 5JGBA 5HNIX 4B9DA 2WMBA 4UXLA 2VWIA 3SXFA 3LW0A 4E7WA 4YR8A 4I6FA 3GOKA 5LVNA 4QD6A 4O4FA 4RMZA 3UC3A 2GCDA 3UPZA 2QOLA 3FMKA 4RSSA 4EOQA 3MH0A 4FKSA 3V6SA 3L9LA 4CFFA 5L3AA 2BDJA 3V5WA 5EKOA 4ACCA 4TNBA 2OFVA 4GYGA 2X4ZA 3GCPA 2XK8A 3WZJA 4BHNA 5LWNA 3RNIA 4X2NA 4AGCA 4IH8A 4OLIA 2UZOA 3GB2A 3F3UA 4CCBA 4W4XA 3PVWA 5EQYA 3WBLA 5A4EA 4M69A 4FIHA 2J50A 2ZV7A 3QTRA 4FTUA 1AQ1A 2VV9A 3DA6A 3MH1A 4G17A 2X2LA 3RJCA 4LGHA 3UC4A 4FT7A 3PG1A 4ZTSA 5CEIA 5TT7A 4BZNA 5IQEA 3EB0A 1CKPA 4QMNA 3LZBA 3IW5A 3VS2A 4FEQA 3W0MA 3F66A 3DXPA 5E8VA 4E6AA 2KTYA 3QYWA 4JT3A 4FVPA 5AP4A 5L6OA 5IQFA 4Q2AA 3R02A 2FSTX 5IPJA 4EOSA 4BFMA 3NIZA 3EIDA 3KC3A 3V5QA 2OI4X 4N0SA 3VW8A 3O17A 5M07A 4CTCA 3D94A 2J4ZA 2ITVA 3Q4TA 3Q9YA 4OTRA 3QQUA 4ZY4A 4AU8A 5EDQA 3PXZA 1Y6AA 1JSVA 3G6HA 4II5A 4DH3A 4QP3A 2WTJA 5BVNA 3EN6A 1I09A 4A4OA 4PNKA 3TV4A 4L01A 4R7HA 3OW4A 1OM1A 3R7YA 5FXSA 3PE1A 4FTTA 3SDJA 2LAVA 4BRXA 3DCVA 4FSMA 5HVYA 4DGLC 1E1VA 2CLXA 4MBJA 4TW9A 4F09A 3H0YA 4W4WA 2XBJA 4CG8A 4GV1A 4EH9A 2OXDA 2WU7A 5KKRC 3U55A 5M4IA 2G1TA 2BZHB 3T3UA 5J95A 2QI8A 2NP8A 4MNEA 4E3CA 4FKOA 3ZFXA 2VU3A 4Q9SA 4TTHB 1ERKA 2PUIA 1PMEA 1YRPA 3NW7A 4IWDA 1J7IA 3B2TA 1LPUA 3Q60A 1VR2A 4RIOA 4EOIA 3ZO4A 2O3PA 4PPBA 4XEYA 3Q4CA 4QYHA 2QG7A 3V5JA 4E6QA 4JAIA 2HWOA 4ZJVA 4RFMA 2XF0A 2PY3A 4CT1A 1RE8A 2GNGA 4AACA 4KIKB 1NT2A 2W17A 1XBCA 1K2PA 3JS2A 5J5TA 4UV0A 3UOJA 2ITZA 2ITQA 3TM0A 3QC9A 4YZCA 4CV9A 2BAJA 4QTBA 3MTLA 1JKSA 2O63A 4JBQA 2X6EA 4I92A 3UVPA 1R0PA 3LIJA 4NM0A 4F7JA 3EFJA 5IISA 2W4KA 3OHTA 4JDKA 5CI6A 4K2RA 5HU3A 5H8GA 3HV5A 4I41A 4XNEA 4UMPA 3C0HA 5IA5A 2XNGA 3UO5A 5CYIA 1LR4A 3F82A 3PLSA 3E3BX 4DEDA 3MW1A 3FKOA 3R2BA 2PPQA 2C5OA 1U54B 4YTHA 3ML1A 5IG1A 5HVKA 1JVPP 4WUNA 3VC4A 2G2FA 4R6VA 3RVGA 3KMMA 2B0QA 2W1DA 4S30A 1GOLA 4HPTE 3ZH8A 3NYOA 1E1XA 2XEZA 3DQXA 2AQXA 3S95A 3R1SA 1OUYA 2A27A 3ORTA 4O0XA 2XVDA 4GT3A 4TYHB 2W5BA 4PMMA 4DGOA 5FXQA 3BPRA 4CMUA 5CF4A 2XIRA 3NNXA 5A3XA 4ASEA 4FI1A 3QCXA 4ZJJA 4OW8A 1XBBA 4FIFA 4J97A 4YZ9A 4C36A 4K77A 4YBKA 5CNNA 5I3OA 2OJIA 3MA6A 4H3QA 4J7BA 4AQCA 3RHKA 2Z7SA 1MRYA 4TT7A 2B7AA 1RQQA 2PUPA 3EKNA 4QYEA 4XH6A 3TUDA 4BDBA 5DYJA 4DGMA 3O7LD 4BJJB 2OIDA 4PDOA 2F4JA 1FVRA 3ATSA 2WMRA 2IO6A 5KZ0A 4D9TA 2R64A 1O9UA 3P86A 4UY9A 2BAQA 2QOKA 3GCVA 3MWUA 4YNOA 3WF5A 3LQ5A 3OP5A 3OUNB 2OZAB 5IQCA 5E90A 4L3PA 1P4OA 2PMLX 5LMKC 3BLAA 2BTRA 4QMXA 2WQOA 3AT4A 4Y83A 3LFSA 4FTIA 3EQBA 1FQ1B 4PUZA 3SKCA 4H3PA 4L42A 5HBHA 4RJ3A 3WARA 4ANMA 3TNPC 2CCHA 3FL4A 3F69A 4OTPA 3LJ1A 3R2YA 4RQKA 1SVGA 3GENA 3O96A 4XP2A 2C0OA 3NYXA 4FT9A 1TKIA 4IIRA 1H26A 2VX1A 4QDEA 1RDQE 4R77A 4EHEA 2EVAA 2CN5A 3BRBA 2HY0A 3KF4A 5D9HA 4IFCA 3UO6A 5L2TA 1PKDA 5GIOE 1H1SA 5DA3A 4KS7A 5HX8A 3O5AA 3DKGA 4LRMA 4RZWA 4JQ8A 4PTGA 4ZSLA 2R0IA 3OMVA 3BLHA 2ETRA 5H8EA 3BHHA 3Q9XA 4TYEA 4L46A 5IUHA 2ZJWA 2O5KA 5L6WL 3B8RA 2B9IA 4O27B 1JNKA 4I94A 3V5LA 5FDXA 5EW3A 5FM2A 4YTFA 4RX5A 3JYAA 4EK6A 4ZTHA 2JBPA 2OFUA 4XCUA 2IVVA 4G34A 2XK3A 2Y4IB 3RAIA 3BQRA 3CPBA 3NUUA 3PZEA 2EUFB 3R8LA 4A4XA 5FRIA 3FWQA 1R39A 1SNUA 3I81A 4EH6A 5JH6A 4O7SA 1YQJA 4BDEA 3DTWA 3FI2A 4QMOA 3S4QA 5HO8A 2X0QA 1NVSA 4BTMA 4HVHA 1O6LA 3Q9WA 4RJ5A 3ZMMA 4UMRA 4J96A 3KRLA 4RLLA 4PTCA 4YMJA 3ZCLA 1BLXA 2ACXA 4ZTRA 4D2TA 4TL0A 4JS8A 4BYJA 1PXOA 1CSNA 2W4OA 3REPA 2XALA 4FSWA 4M7IA 3DBFA 3RTPA 5FTQA 3SXSA 4KSQA 3QWKA 4NTTA 4UEUA 4FV5A 4I6BA 5DBXA 4U43A 4L52A 5AX3A 4IC7A 4EI4A 3NFFB 2C6IA 3PJCA 3VS4A 4NEUA 1WBWA 3V5PA 2QVSE 3N4TA 4FSUA 4KA3A 4M68A 4AZFA 5IH6A 3P4KA 4U40A 1UNLA 2W0JA 2YM3A 3F2AA 4IC8A 4NK9A 4BCIA 2OH0E 4BTFA 3PFYA 3KK9A 1MRUA 2JKOA 4DE4A 2P4IA 1Z5MA 3OVVA 1O6KA 3NUXA 5DN3A 3CJGA 2R5TA 4F63A 2OU7A 4I21A 1HCKA 3ORKA 3QUPA 3FZTA 4BCJA 2C1BA 2QURA 2UW6A 3DFAA 3LFAA 4ASDA 2O65A 1R1WA 4FRFA 3RALA 3TJCA 2CNVA 4YUQA 2FH9A 3D15A 3ZO2A 5M44A 4DTBA 4FGBA 4TYJA 2QO7A 2QOBA 3CTJA 4MEDA 4WA9A 1FGIA 4NFNA 1QL6A 2X39A 1YI4A 3EFWA 4AE6A 2X1NA 4EEVA 3V01A 4KKEA 4E6DA 2XJ2A 3GXLA 4FKVA 4EHZA 2I7QA 4DA5A 1TQPA 3H9OA 4OTFA 3QU0A 3R04A 3OY1A 2JGZA 4UWBA 4AGWA 4G5JA 3S00A 4YPSA 3QRUA 4YJQA 1SYKA 1ZMWA 3MB6A 4X7QA 4G31A 3CKXA 1YDTE 2YIYA 3D5WA 4H3BA 1KV1A 2F7EE 3E8DA 1PXMA 4NKAA 5JZNA 1FBNA 1J1CA 2BRNA 4ZSGA 2UVZA 1W8CA 4BCQA 1H0WA 3FY2A 2PE0A 3IW4A 3WF9A 4BGQA 3DGKA 4JLCA 5BUJA 2OF2A 5H9BA 4W8DA 2WFYA 2BKKA 4FKUA 3L8XA 3P5KA 3KULB 2JDTA 3R8ZA 2RG5A 5AR7A 4BCKA 5IQAA 3GU8A 4DTAA 3ACKA 2OF4A 3DAKA 1WBTA 3QRIA 4BWKA 5BUEA 3A8XA 1JOWB 2YLEA 4CKJA 3OC1A 4B99A 4F7NA 3EKKA 2YACA 3RM6A 3DZQA 4ACMA 4IFGA 2JITA 4BZDA 4MF0A 4YHJA 3Q5IA 3UP2A 3ZUTA 2J7TA 4KRCA 4ZEGA 3ZO1A 4C3PA 5AAGA 3WIKA 3TN8A 1IA8A 4M14A 4R1VA 3B8QA 3MPMA 2YDJA 3DK3A 5DNRA 2REIA 4RIYA 3E87A 4F6WA 3UE4A 3WOWA 2CKQA 3LM5A 3KY2A 2WIPA 3PFQA 1AGWA 3R01A 2E9VA 2J5EA 1U46A 5G1XA 3BYVA 4L67A 5HX6A 5IQBA 4RX9A 4DDGA 4FOCA 3W0QA 4QP7A 4O91A 4AW0A 3ZM9A 4ZLZA 1UU3A 3R83A 4U41A 2YZLA 1WMKA 3LJ2A 3DOGA 3BYOA 4A06A 3R71A 5B7VA 3DXNA 3AMAA 4DLJA 5A6OA 4GSBA 2WIHA 3CR0A 2PE1A 5IMEA 5AR4A 4EQUA 1W83A 2WMWA 3V6RA 3KU2A 3SW7A 2YDIA 3PDTA 1BL6A 4G3DA 4GIHA 3L8SA 2R2PA 1PXKA 3C51A 3GFWA 3RCJA 4MXAA 2YISA 5AP7A 4BKZA 4U97A 3U9CA 4NCTA 3QD0A 3AQVA 4L7FA 4MXZA 2PVMA 1ZY4A 4MXCA 4NKSA 4WNMA 4X6RA 2VO0A 4B0GA 2X6DA 2WPAA 3I7BA 4KINA 2O2UA 3Q3BA 5D7VA 3VS1A 2YA9A 3W1FA 1G8SA 5EQPA 5AR8A 4ENYA 4HYIA 4OBOA 3ZC5A 3T3VA 4O0RA 4EKKA 1XO2B 2OW3A 3R8VA 3EL8A 2VTMA 3ODZX 3ORMA 5D1JA 3ZONA 4DT9A 2OKRA 4BBFA 1UKHA 1YXSA 2CGWA 3P08A 4IW0A 2X9EA 2X7OA 4W4YA 3JR1A 1G3NA 5FEDA 1OL6A 2HZ4A 3EQDA 4IWPA 3IW8A 1KOBA 4IANA 1ZMVA 4EUTA 3R22A 2HYYA 2QOHA 3P79A 4AN3A 5CEPA 4Q9ZA 4F0FA 2VWVA 3TZ9A 3HRFA 4BBMA 4DHFA 4C4GA 2I6LA 2P55A 2QKWB 2YIXA 3VF9A 1DS5A 4FL1A 4JOAA 4C4IA 3BL9A 4O82A 4C4HA 4LDTA 4GEOA 4IB0A 5DGZA 4QPAA 4Y85A 2ZM1A 1PMNA 4GH2A 4Z9LA 5EI8A 3FYKX 2R3NA 3CTQA 3TNHA 3ZDUA 5JFSA 4KAOA 2OICA 3PTGA 2R0UA 2UW5A 3GU7A 4OTDA 3ROCA 3COHA 3VVHA 5JQ5A 3C13A 4GCJA 2Q83A 1CKIA 2XK7A 4NCTC 5CSPA 5DI1A 4ACDA 4L3JA 3H10A 2XCKA 4RT7A 4GS6A 3SGCA 4J98A 2XJ0A 4DBNA 5LCJA 4IZ5A 3W2RA 4Z3VA 5HVJA 3IDBA 5AAEA 2P0CA 3FSKA 1OKVA 3FXXA 4AS0A 5B2MA 2HCKA 4G3GA 4X3FC 1QPJA 4L45A 3CE3A 4WOVA 3MH3A 4FUYA 3TNQB 4RJ7A 1PXNA 4FKJA 4P4CA 5KHWA 4J8NA 5EFQA 5BV3A 5M51A 4ZS0A 4BCPA 1XBAA 1Q8ZA 2W1ZA 2XKEA 4IAFA 1ZYLA 4AA5A 4HVIA 1F3MC 3P0MA 3PWYA 3PZHA 4F65A 2DWBA 4BDAA 1ND4A 4JDIA 5EM6A 2YWPA 5LVLA 4BDHA 4E26A 2R7IA 5CAPA 3W0RA 2UW3A 4NSTA 2C30A 2CGVA 3GUBA 3DXQA 3CS9A 3RGFA 4NYEA 4MD7E 4K11A 4MYGA 5HCYA 4BIDA 3OFMA 2OJJA 4AZVA 4DLIA 4W8EA 3G33A 3BQCA 4EH5A 3OWJA 2BZJA 2X0GA 4FK6A 4NZWB 1H00A 4ARKA 4BI0A 1MP8A 4O7ZA 2VTLA 1YHSA 3NEWA 2G2IA 1QPCA 3DS6A 2W1EA 3EQIA 3IK3A 5CT7A 5AUYA 4D4VA 2OLCA 4ALUA 5EQEA 4D58A 5JN2A 2ETMA 3MVJA 2C6LA 4O6EA 3TTJA 5M4UA 1H8FA 1LEWA 2QCSA 3PXKA 3UNJA 4TYGA 4DCEA 3ID6C 2P3GX 3CKWA 3HA6A 4MXXA 4NW6A 3CQEA 4AGUA 3KRWA 5DLSA 3I6UA 3LE6A 5KZIA 5HD4A 3FZPA 1JLUE 3O8UA 4FK3A 3EYHA 4RIYB 5JKGA 1MRVA 2QC6A 2BAKA 3I4BA 3A7GA 4JVGA 4U81A 4BI1A 4E6CA 3C5UA 4C4EA 2BTSA 2W9ZB 3SRVA 4O86A 3OEZA 5K5NA 3QA0A 2C1AA 4MBIA 4EUUA 2I0YA 2YZAA 5HTBA 1R0EA 4FV7A 4IAZA 4IM2A 2I1MA 1J3HA 4U5JA 4GRBA 4RX7A 3I1AA 4JQEA 1REKA 4WKQA 2BZIB 3RPVA 4TWCA 1CMKE 5LMAA 4PQNA 3NCZA 3C4CA 4IM3A 4M12A 3GOPA 4QP8A 3TZ8A 4AZTA 3TMOA 4OTWA 5H3QA 1F0QA 4V01A 2R3JA 3G9NA 4EH7A 5K9IA 3COIA 3IGGA 1OBDA 5CEQA 3BEGA 2HK5A 3QALE 3TKIA 2E9OA 4F9BA 5BMMA 4GMYA 4FT0A 4DEIA 2R3GA 2GDOA 2W5HA 2C47A 4DN5A 3KXZA 4DEBA 5EDRA 1OIUA 4RJ4A 2BKZA 3MY0A 2UZNA 2OJGA 4QMTA 1V1KA 3OXZA 3W32A 4BYIA 4R3RA 1K9AA 3E62A 4FZAB 4EK4A 1SMHA 2YM6A 3NDMA 3W8LA 5CAQA 5CSWA 4NW5A 1VEBA 5BMSA 1GZKA 2JFMA 3HNGA 5HLWA 3PRFA 3QHRA 3TZMA 1BMKA 2BFYA 2RFSA 4F70A 1IEPA 4YLJA 5JFXA 1H28A 3FHIA 3OUKA 4I93A 4E4MA 3FLNC 4JNWA 3NVMB 3RK9A 4PDPA 3VJNA 3RMFA 5LVPA 5CU0A 2YDKA 3I7CA 3M42A 4GU6A 2IW8A 3FUPA 4I23A 1H08A 4F9WA 3LXLA 4FSNA 4XHKB 3M2WA 2R3RA 4G16A 3VAPA 4DHZA 2GTNA 5E8WA 4L00A 5B0XA 4PPAA 2ONLA 2J0IA 4A9SA 4NM7A 3VWAA 4CQEA 2YFXA 3QTSA 4FEWA 1PMVA 3IG7A 3OS3A 2XAOA 3NUYA 5K0XA 2JDSA 5C8NA 2PYWA 2CDZA 2WAJA 3DTCA 2OO8X 4PP9A 1Q62A 2ZAZA 5HLPA 4AFJA 5AUWA 3IOPA 1TVOA 5DIAA 3IPHA 4XBUA 3RPYA 4C59A 3LKMA 3ZBFA 1YOMA 2GHLA 3OTUA 4FV2A 4L3LA 4DEAA 4E5WA 4KABA 2B53A 3OG7A 1ZARA 2YERA 3PVBA 4LRKA 2IN6A 3WF8A 3GU4A 1A48A 5E8TA 3QZGA 2XBAA 4AXCA 1H24A 3ORLA 4FIJA 3L8PA 5CU2A 2V7AA 4FZFB 3R0TA 3CQUA 4CRSA 2B52A 2G2HA 2HZIA 4UMQA 1BX6A 1WBVA 3O50A 5D10A 5HORA 4ZTMA 2WTWA 1FVTA 3IDCA 4C38A 3L8VA 4HJOA 3D5VA 4C61A 5HEZA 2GFCA 3QTQA 5K0KA 2FSLX 1KSWA 2UVXA 3FLSA 2YIWA 2XKCA 3PIZA 3V5TA 2XK4A 3ZUUA 3ET7A 2BFXA 2HELA 3GC7A 3OXTA 2OJFE 2BRHA 4EK8A 4DINA 1UNHA 1ZYCA 4CFXA 4AQKA 4MH7A 1KWPA 2X8EA 3KFAA 4H36A 5E4HA 5BVOA 3VUHA 3AC2A 5HE0A 3DKFA 3BYUA 5AR3A 3QTUA 3DZOA 1GAGA 4IM0A 3MFUA 5HCZA 4OTHA 3F5PA 3G0EA 2YN8A 3PPZA 4M15A 3L9PA 4JRVA 5CU6A 4ZP5A 3QUEA 3KA0A 4DH5A 1JWHA 2C3IB 4O6LA 3LCTA 4RWKA 1ZLTA 3M11A 4I4FA 3FKNA 3KGAA 4HW7A 3PA4A 1KV2A 3K3JA 3RNYA 5KMJA 5C4KA 2VZ6A 5T6KA 2EWAA 4ANLA 5JT2A 5HNBA 4O2ZA 3DT1A 4DFUA 2JIIA 3NS9A 2QKRA 3FKLA 4KBKA 3QKLA 3W10A 3FMEA 3RI1A 3Q2JA 4PL4A 3D9VA 4UYAA 4YNEA 5AP1A 5AWMA 4BDIA 4NT4A 4XV3A 4ZK5A 4ANOA 1J7LA 3FZRA 4MWHA 5AAFA 3QQHA 3CXWA 4F4PA 3G6GA 3CLYA 4D0WA 4FOBA 1YW2A 2XA4A 5JGAA 3GCUA 4J53A 3BLQA 3ULIA 5TE0A 4CVAA 2B54A 2QLQA 3W2SA 5DE2A 3FMJA 2JIVA 3ZUVA 5HGIA 2Y8OA 1OECA 4DFNA 5BX0A 4EK5A 4J99A 4MTAA 4XS2A 5J9ZA 2B1PA 3PRIA 5C03A 3PA3A 4O7WA 2GPHA 4MAOA 5AA9A 4Z55A 1OKYA 5FG8A 4UZHA 4QPSA 5AUZA 2O64A 2YCSA 3Q4ZA 5HTIA 2IW9A 2XH5A 4ANNA 3MI9A 2ITOA 1NVRA 4U3ZA 2JEDA 3IQ7A 4W9WA 2C5NA 4ZTQA 4MQ1A 3HV4A 1FINA 4AG8A 4E5BA 5G6VA 1TQMA 2P2IA 4QOXA 5J7HA 2Y4PA 3QC4A 4BGHA 2WMUA 4U8ZA 2PU8A 5LVOA 4LQMA 4FTNA 2XAMA 3RWQA 4ASXA 2JD5A 2FSOX 2C3JA 3VJOA 4RZVA 4KD1A 1CKJA 4JG7A 3LMIA 3M1SA 4X21A 2BR1A 3VBQA 3AC3A 3KKVA 2ZDTA 4QMLA 3NNVA 3AG9A 2XM8A 3KXHA 3W16A 4D5HA 5LVMA 3WI6A 3FE3A 3EL7A 4IHPA 2YABA 2YJRA 4ZXTA 3CQWA 3L1SA 4A9TA 1UU7A 4MCVA 1ST4A