1S9JA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a complex with ligand and mgatp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structures of human MAP kinase kinase 1 (MEK1) and MEK2 describe novel noncompetitive kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1s9jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1s9jA01
2HIWA 3DS6A 3GB2A 5D9HA 4RJ4A 4LOOA 3WZEA 5J5TA 1WFCA 2VTQA 3LCOA 3FZTA 3FYJX 4RJ8A 4JS8A 1OKZA 2FVDA 3OWPA 2IG7A 3DBQA 3DAKA 3QX2A 4PDSA 2BRHA 3EWHA 3VUTA 3OOMA 4D5KA 4FIGA 2R5TA 4FG9A 5TKDA 4FV9A 5L2QA 2QOLA 3UC4A 2OZAA 3AD5A 2I0HA 2Z7SA 3QTWA 4IVBA 4FA2A 1G8AA 4IB1A 3H10A 4MK0A 4QTCA 4C02A 3LKMA 4MWIA 3N4TA 4FTKA 4FEUA 2V7OA 4YSMA 3K2LA 3O7LD 3LCSA 3ZONA 4BTKA 4MBLA 3E92A 4GMYA 4QYYA 5IUHA 4R7BA 1DM2A 5HORA 3JVRA 3DAJA 3IONA 4EOMA 4UX9A 4N70A 2WOUA 5CVGA 4ZTNA 3VBTA 5HU3A 3CQWA 3A99A 3PIZA 4IB0A 4ZTQA 4XG6A 3D94A 2RG6A 4H3QA 5CF4A 3TL8A 4QMLA 2W5AA 4ITIA 5IKWA 4WG4A 2C5NA 1IEPA 5AV1A 4DEHA 4LV8A 4W4YA 5AP1A 1RJBA 5DRBA 1JLUE 1PJKA 1QMZA 2WD1A 3NIZA 5CAOA 5EKOA 3R1NA 4GCJA 3BE9A 3QLFA 4RX8A 3Q9XA 3FQHA 1Y8GA 1W98A 4IZAA 4AG8A 4B7TA 2RG5A 5AUTA 3Q2JA 5CY3A 4HYHA 4FTLA 1GZ8A 3C7QA 4IZ7A 2OXXA 4LM5A 5CSXA 3OXZA 4NTTA 4U79A 2PTKA 5LARA 2C6OA 3GFWA 4E4NA 3MDYA 4TT7A 5IA4A 4FKWA 4EOSA 4QTBA 3P7AA 5EDQA 4C36A 4BCQA 5D41A 4BCFA 4XRJA 2ITYA 5FD2A 2WTKB 4GS6A 4JLCA 4CRLA 1NA7A 2W1FA 3AC1A 3WZDA 4EC9A 5J1WA 4MXZA 5JKGA 4EQCA 5IH6A 1JVPP 3ORTA 5AUZA 2OK1A 4TYIA 4GG5A 3DLZA 4MBJA 4F64A 5CU4A 5GINE 5J79A 4K9YA 2F4JA 4HVGA 2A19B 3VVHA 4YZDA 3V5LA 5HLNA 3D4QA 5I9YA 2OIDA 2RKUA 4NWMA 3QUPA 4PV0A 4U97A 5JEBA 4NZWB 3OD6X 4RX7A 3QWJA 3ERKA 2VTOA 4IMYA 4WRGA 3BBTB 2UZNA 2V55A 5F1ZA 2YFXA 4FC0A 5ICPA 3A62A 4BBEA 4E6AA 5CI7A 2FSOX 3C13A 3I79A 4XLIA 1YXSA 5M53A 4CZTA 4TZRA 3FI4A 3HX4A 3DKFA 3FI8A 2W06A 5JH6A 1MUOA 2HZ4A 2FSTX 2QLUA 3LFFA 1AD5A 4C4IA 2R0IA 5AA8A 3NYVA 5HLPA 4D2SA 4MTAA 1WVXA 3N4UA 2FSLX 2O2UA 2QHNA 1GNGA 1U5QA 3W33A 3ZXTA 5EQYA 1J7LA 2XNPA 3BU6A 4KIQA 3RHKA 5CEPA 5EYKA 2ZM1A 4BN1A 2WQOA 3G0FA 3LZBA 3ZO1A 2H96A 4PTEA 1BYGA 3DGKA 2PUIA 5IQCA 4E3CA 3PPKA 4BYIA 4TWPA 3MN3A 4NSTA 4YZNA 2PL0A 3QKKA 5FM3A 4TYHA 3ZBXA 3QALE 1PYEA 2C3LA 4O2ZA 4RIXA 2JDTA 3HAMA 2UZWE 4TKSA 2BMCA 3OCTA 4O0VA 2W1HA 3GVUA 4YC6A 3DXPA 2V7AA 5I4NA 5F4NA 3UIUA 2OBJA 2CLXA 5HO7A 4PMMA 3FI3A 2BDFA 4QMMA 2WTDA 5CT0A 5E8YA 5LXMA 5LJJA 1MQ4A 2BDWA 2OFUA 3N51A 2PMNX 4CZYB 4PX6A 3EIDA 3EQPA 1Q8ZA 1ZWSA 3QQGA 2IZRA 2OU7A 2B9IA 1H27A 4FTOA 3WIKA 4AE9A 5M55A 4BWPA 4ERKA 2W9FB 4D4RA 4C2WA 4GFOA 3RK7A 2IZSA 1ZOHA 4CMOA 2BZIB 5AMNA 4NJ3A 4U8ZA 5DYJA 1DI8A 2GHLA 2XNGA 5M06A 5DRDA 2C6DA 4PTGA 1YI3A 3VUMA 4ANSA 4LV5A 4UMUA 3QQFA 5IDPA 2BILB 4FL3A 5E1EA 3ZO3A 2PHKA 2RL5A 4RVLA 3V3VA 3PPZA 3ZEPA 4D1SA 5KMOA 3QQUA 4IX5A 4CMUA 4BYJA 5AAEA 5HG5A 2JBPA 2XKEA 4FKGA 3K5UA 2OF2A 1OIYA 2HZ0A 4F6SA 4MNFA 2JGZA 1UU8A 4M84A 4E5AX 4ZLZA 1J7UA 3FXXA 4GT5A 1V0PA 3KULA 3QZGA 4EH3A 1IG1A 4ALVA 1GJOA 4FSZA 1H07A 3EQDA 5LOHA 3O50A 4FOBA 4ZJJA 3HP2A 2KULA 5CEIA 4DH7A 3DK3A 5KO1A 1V0BA 4FKIA 2HY0A 2V0DA 3IPHA 3U9NA 5HBEA 3R1QA 4JAIA 3EMGA 4QP2A 4RJ5A 4CT1A 2I0YA 4FTAA 4B8MA 1Z5MA 4WNKA 2IW8A 5IEVA 1FVVA 1UVRA 1M7NA 4DBXA 3BLHA 1KE6A 5A4CA 1XHAA 1VR2A 2FA2A 4M7IA 4HCUA 2OKRA 4RQVA 3ZDIA 3MVHA 2PSQA 5ETFA 3NCZA 5BUEA 4N57A 2OIQA 2QQ7A 3AC8A 3LPBA 4RIXB 4FV1A 5D7AA 5L3AA 4IHPA 4OT5A 3VBVA 5LQFA 4O7WA 1V0OA 3PXRA 4OBPA 4F63A 1JQHA 2VRXA 3C4WA 3AG9A 3DZOA 3SLSA 4EOKA 5LCJA 4PF4A 3KXHA 4FF8A 3MH0A 3RGFA 5L2WA 4OR5A 2XKCA 2W1IA 2CN5A 3A7HA 4G1WA 5T6KA 3A4OX 3OTUA 5GHVA 5EHOA 4X2KA 3UQGA 3E64A 5JZNA 4E93A 5I9XA 1H01A 4AZEA 4KIKB 4X6RA 1H0WA 1M2QA 4S32A 3ZUTA 4BDAA 5BYLA 2XK8A 4LMNA 3I4BA 2QOFA 3QUEA 2CGWA 3CJFA 2VAGA 3O23A 4FGBA 3VJOA 4QTDA 4G2FA 3QUDA 2RFNA 1B38A 4II5A 4L8MA 4ZLYA 5EFQA 4HZSA 3TEIA 4B6LA 5JFWA 3F82A 3QKLA 5EM5A 4AZSA 1UKIA 4F7LA 2P0CA 2VTSA 3IDPA 3ZZEA 2O65A 3LCDA 3SXFA 3ZBFA 2ZOQA 3NZ0A 3COMA 4I5HA 4RWKA 4JRVA 1OL7A 2W1DA 5AJQA 5L4QA 4KAOA 3UMWA 1UKHA 4CRSA 5EYCA 2G15A 2ITNA 4DFNA 4ZJIA 4BL1A 4NCTA 2HW7A 3BEAA 5DR6A 3KEXA 1H26A 4OTFA 1DS5A 2BZHB 4BCKA 3QXPA 4FV0A 4MD9E 4DH8A 4DLJA 3OY3A 5K4IA 3KULB 4QOXA 3BYOA 3VBYA 4XG7A 3A7FA 2ETKA 4AW2A 3BEGA 2UW4A 1QPDA 3KA0A 4QMYA 1OUYA 3KFAA 4MYGA 4BRXA 4G34A 3FBVA 3VQHA 1BLXA 3JXWA 3Q5ZA 4MCVA 3CTJA 2ZAZA 3CEKA 2QO7A 5IQFA 4FIJA 2X8EA 2W4KA 5CAUA 4IWOA 2JFMA 4RC2A 3D7TA 1JWHA 4MQ2A 4X2FA 4HPTE 4O0TA 4EOQA 1ZYCA 4DLIA 3ZSIA 5HI2A 2GFSA 3PVWA 1V1KA 1PW2A 3WYXA 3A8WA 4ENXA 5LWNA 1XR1A 4E1ZA 2PU8A 5K0KA 4NKSA 3QTQA 4O91A 4BGGA 3E8EA 4DFZE 3Q4ZA 3W32A 2CKOA 4ZZNA 5BVEA 2WNTA 1YOJA 4PY1A 1Q8YA 1OM1A 4WO5A 4XYFA 5IA2A 5J7BA 4R8QA 4OW8A 2WGJA 3HDNA 4I5CA 1TQIA 3ELJA 3B8QA 4XG3A 4ZSJA 4F6WA 3E93A 4LQMA 4FSNA 3TM0A 5CI6A 2XIKA 4FT0A 4AE6A 1U54B 2HXLA 1M2PA 1OPJA 4XEYA 5HO6A 2YJRA 2BTRA 5AP6A 2ITVA 2FSMX 2FGIA 2YIXA 3MFSA 3F3VA 4GFGA 3GC7A 4Q5EA 4QRCA 4KRCA 4YTFA 2R7IA 5HZNA 4EH2A 4FT5A 2QOHA 4GT4A 4JNWA 1KOBA 3ZUVA 5CLPA 1O9UA 4Y8DA 3PVGA 3QFVA 4FEXA 1SNXA 3AC3A 3F3UA 3BV2A 4CV9A 2R3MA 3GC0A 4O1OA 4OLIA 4RPVA 2GS6A 4AW1A 3UVRA 3TDWA 4ANOA 1OKWA 5E7RA 3LXPA 4D58A 4TY1A 3ZLXA 4GUEA 3ZFXA 1U5RA 2SRCA 4JBOA 4HPUE 2PE0A 3HV5A 4CV8A 2WMVA 3GFEA 3WF8A 3FPQA 5AR2A 3O71A 2P3GX 3Q4TA 2PVKA 4AAAA 2QG5A 2XM8A 4MNEB 5E91A 1O6KA 3RHXA 4KINA 2C4GA 3QQLA 4ONAA 4OTWA 4RZVA 4ZAUA 4V0GA 4OT6A 4BDEA 4S34A 2WTWA 2UW0A 2XJ1A 3H0ZA 5E8SA 5JZJA 3FC1X 4L52A 4EK8A 3D7TB 4A9UA 2QO9A 4BKYA 1OGUA 4CTCA 1HCLA 2HY81 4EWHA 2PUNA 4F7JA 2Z2WA 3IQ7A 3LM0A 3P86A 2QHMA 1LEZA 3KREA 3MV5A 4A9YA 4K0YA 5AUYA 4JBVA 5JRSA 4D1XA 3VHKA 3JUHA 4KS7A 4WOVA 4FV6A 4GL9A 3GOKA 4ZTRA 5J95A 4A4OA 3R9DA 3DBFA 2Q0NA 3D5WA 4C4GA 2QOCA 1REJA 2B54A 5HCZA 1B39A 2YM7A 5CU6A 3W8LA 4YJOA 3S2PA 3I60A 4E26A 5CALA 4EEVA 3DB6A 3EB0A 4YPDA 3DK6A 4OUCA 3TXOA 5ITAA 4OTRA 5TT7A 3FC2A 5L8KA 1WBNA 5IUIA 1JAMA 4C0TA 5ANDA 2R3RA 4FV5A 2J51A 2WMXA 5A46A 2Y4IC 2BTSA 3R8VA 3HRBA 5L8LA 4I6BA 4AGCA 3QCYA 4YNEA 3WILA 4B99A 5A6OA 2QOKA 4RG0A 1M7QA 3HKOA 3MBLA 3IDBA 4DG0E 4JQ8A 4GYGA 5FUTA 3IECA 3FXZA 1QPEA 4DBNA 4U3ZA 4EL9A 3SD0A 4UN0C 3PYYA 4FICA 2BHEA 4J8NA 4C4HA 1PRYA 2FB8A 4ZXTA 4BTJA 5HIEA 2PMLX 4FSUA 3R30A 3NMUF 2ZM4A 5LCKA 4Y95A 2E9UA 4RJ3A 4E73A 1URCA 1R78A 4F4PA 3BYVA 3V6SA 4J97A 4JT3A 2HCKA 3EJ1A 4AXAA 2X81A 2Z7LA 5EW8A 5G6VA 2C1AA 2BZKB 4A7CA 4F9WA 1Q8UA 4N0SA 3P0MA 3UTOA 1J1CA 4MD7E 1JSVA 2UW3A 3HUCA 1UNLA 5AM6A 2CKQA 2WQNA 4FUXA 2IJMA 3PG1A 3BQCA 4I1ZA 2G2FA 3IDCA 4G5PA 3FLWA 4FZ7A 1BX6A 3FUPA 3HUBA 4GW8A 4BTMA 3OTVA 4BICA 3P08A 4FT9A 1YWVA 1XH4A 3PXYA 5CNNA 1OI9A 4F7NA 4FT7A 4F9BA 2BFXA 4IDVA 3EFKA 4RBLA 3LJ1A 3E63A 4GU9A 1OBDA 3R83A 2ITPA 5B7VA 1NY3A 4EJ7A 2OH4A 1FOTA 3FLSA 3ALNA 4G6NA 4JX3A 4KD1A 2X2LA 1PKGA 1OL5A 4BI0A 4KSPA 2GNLA 1UNHA 4USDA 4BHNA 2IO6A 3F66A 3Q2MA 3CD8A 4N6ZA 1H4LA 3ENMA 4FSTA 2IPXA 1R3CA 3FKNA 3SGCA 3W8QA 2Y6OA 4HGLA 4EOLA 5A54A 5E8TA 5CAQA 4R5YA 3WIGA 2I40A 2OIBA 3RALA 3RJCA 3VUIA 2XK7A 5DFPA 4BDKA 1I44A 2F7EE 3DNEA 5CEQA 1ZRZA 3W16A 3JY0A 4QP8A 2XIYA 5TE0A 3CC6A 2BROA 3G9NA 3FMKA 1NW1A 3JR1A 4JQEA 3QTXA 2NP8A 4XV2A 3IS5A 2QONA 1VEBA 4NW6A 3VBXA 3TTIA 4CFNA 1SVGA 2PZIA 1TVOA 5ANGA 4LRKA 3SXSA 4BI2A 3DNDA 2YLEA 1P5EA 2WTIA 5CVHA 5KHXA 5E9EA 2R3LA 5HE1A 4QP9A 2YCSA 3RPYA 1IAHA 4UXQA 4C4EA 2XNBA 4YJVA 5HICA 2HXQA 3RMFA 3F2NA 4FZDB 5IA0A 4ZLOA 2PE1A 3QQHA 3UNZA 5A4EA 3KCKA 1GAGA 4ZY6A 3RP9A 4WG3A 2YM3A 3NR9A 3MH3A 3FL5A 4P4CA 4EOOA 2XZSA 1YWNA 3DU8A 3FZSA 4IAFA 5J7HA 3B8RA 3OW4A 5E8XA 5JMSA 3G0EA 3QWKA 4IJ9A 3HRFA 4JXFA 2ITWA 3A60A 1YWRA 1L8TA 3OCBA 3PSBA 4MXOA 3U6JA 4YTIA 3GUBA 4TN6A 4EYJA 3EN4A 5HG7A 5M07A 5FEEA 2YZLA 4NCTC 5BMSA 2W96B 3UDBA 4CCUA 2X6EA 2ZDTA 4C2VA 4FG8A 3GNIB 3U8WA 3OEFX 3OT3A 4WSYA 3U54A 4QTEA 4JAJA 4FK6A 5EG3A 3C5IA 2JDVA 4EH6A 2YAKA 1CKJA 2J0JA 3BX5A 3FJQE 4UXLA 4FEWA 4F1MA 2PVJA 2YLFA 1H28A 3FAAA 1WBTA 4WKQA 5IA1A 2C0OA 1GIIA 2PVMA 5AM7A 3L8SA 4M69B 2BUJA 1XH8A 1GIHA 5AV2A 5BUIA 3UO5A 4RVKA 4ZK5A 2BKKA 3A7JA 3QKMA 4RFZA 4S2ZA 4C59A 3V5PA 5IQIA 1JBPE 1F3MC 2ONLA 2W1CA 3UVPA 3EFWA 4BBFA 4A9RA 2J50A 3JVSA 3WARA 2BRMA 1E1XA 4EK5A 2YIWA 3I1AA 1FGIA 2GPHA 3PRIA 4IDTA 5AUWA 4CG9A 1WBWA 4EHZA 3T8OA 3DKCA 4JIKA 2OSCA 4RIYB 1XH6A 3RK5A 3RKBA 3NVKI 1JKSA 3QC4A 3E8NA 3ORZA 1FMOE 2XKFA 3POZA 5LVLA 1TQMA 2CGUA 3K3IA 4GT3A 3ZC6A 2X8IA 3OXIA 3MVMA 3IGOA 3DQXA 3QRKA 4U81A 2QODA 2O8YA 2VX0A 1IR3A 3KF7A 2E9VA 3O8PA 4EBVA 4GK4A 1PXIA 3KMWA 5J8IA 5HTIA 4JDKA 2ITQA 4RLLA 4EKKA 3KVWA 2WTCA 3E87A 4ZTMA 3QLGA 3TUBA 1NVRA 3ULZA 4GIIA 4IM0A 4AGUA 4WBBB 3V5JA 3VO3A 2H34A 2OW3A 2YWPA 3O17A 3O96A 4IC7A 3QHWA 5AR8A 4I4FA 3AMYA 2C30A 4UZHA 3BIZA 4CMTA 4MF1A 4ANQA 4CLJA 3S4QA 1OPKA 3BPRA 5K9IA 5GZAA 2O63A 5KZ0A 2VWUA 3DPKA 3PG3A 1T45A 3AGMA 3D0EA 3TG1A 3QYZA 2EUFB 4TNBA 4D55A 4E6CA 2X7OA 3FHIA 4ACCA 3IW6A 3LFQA 4NL0A 1Q3DA 2VV9A 2W1ZA 1DAWA 4QNAA 4XV1A 4YO6A 4D0WA 3EFJA 5CX9A 4O22A 4M14A 4QP3A 1ZMVA 2UVZA 3GP0A 4WRSA 4IVDA 5CXZA 4EHEA 2BR1A 4RJ6A 4CKRA 4MF0A 5M09A 4X3FA 2VTHA 3C9WA 2WQMA 5EM6A 3GQIA 4AT3A 4R6VA 4C35A 4QNYA 4V04A 2H6DA 4W4VA 3NNUA 2UUEA 4UYAA 3ZM4A 3E62A 4CG8A 4UV0A 1UV5A 4IX4A 2YCQA 3KC3A 3BGPA 2QR8A 3HNGA 2B1PA 3W55A 3G5DA 3FMHA 3KXGA 3RCDA 5LMAA 1DAYA 4BGHA 1HCKA 1XH9A 5JGAA 2UZUE 3V6RA 5JFSA 3ZFMA 1YKRA 1ZMWA 4I21A 4OTDA 1YI4A 4R3CA 4MAOA 1KE7A 4GVJA 5FEDA 4RT7A 4E6QA 4NJDA 2X4ZA 2EB3A 5FDXA 3PY3A 4ID7A 3U87A 4J53A 5HIBA 4XOYA 1PXLA 2HZNA 2GNIA 2XNEA 3F5XA 4PMTA 4O27B 4C38A 2C3KA 4L9IA 1X8BA 4CTBA 2LGCA 3KQ7A 3O8TA 5DEWA 4O7RA 5JQ8A 2KTYA 4LMUA 4X3JA 4G5JA 5IQDA 2UVYA 4DTKA 2ESMA 3IKAA 3DFAA 3BBWA 1SVEA 4N6YA 4O2PA 3RWPA 2VWVA 1FVRA 4EOJA 3AT4A 3L9PA 3UE4A 2X7GA 3TTJA 1H1RA 3EQCA 1M52A 4RMZA 1BI7A 4UMPA 3F2RA 4PDYA 3G51A 4FUYA 3EH9A 4YTHA 2IW6A 1NVQA 3TI1A 2R3OA 5C03A 4AGWA 4GK3A 3KXNA 4WNOA 3D7ZA 4EORA 1G3NA 2BFYA 2IWIA 5GIOE 3R8MA 2ETMA 2G2IA 5IQGA 3O51A 2BIYA 3EL7A 1Q61A 2XM9A 2VTAA 5HD7A 5BVOA 4U3YA 3R7YA 3TACA 3R63A 3C4EA 4XV9A 4OAUC 4UY9A 5AP0A 3RM7A 5JN2A 1H1WA 4FMQA 4BDFA 5IA5A 4AP7A 2C47A 4RIWB 4KBKA 3DFCB 5DBXA 5E4HA 1ND4A 4IX3A 2XH5A 2YDKA 2R3PA 2J0MB 4HYIA 3TZ7A 2XMYA 5JFVA 2BAJA 4FSMA 5C9CA 4E4XA 5EOLA 5DGZA 2WKMA 3C4CA 4X2JA 4AOJA 3PXQA 4AX8A 1OIUA 5AR5A 3MIYA 3PA4A 4PPAA 3VF9A 3LAUA 4YU2A 4FV3A 3U9CA 2GHMA 4DG3E 2LAVA 4ALWA 3LMIA 1ZY5A 4D2TA 5CANA 3F7WA 1J1BA 4UWYA 3R9NA 4QMPA 1WBSA 3BYSA 3GU4A 4PPCA 3GBZA 5DI1A 1WVWA 4QMQA 5CQWA 3OWJA 3G6HA 1IA9A 5D10A 5E90A 3PA5A 3RPSA 2OZAB 4GUBA 2O3PA 3ZLSA 2OI4X 1W82A 2W1GA 3P7BA 3ZYAA 3AOXA 4G3EA 5IMEA 3P78A 1B6CB 2CGXA 4AOIA 3BGZA 3M11A 2ITTA 1Q4LA 5EW3A 1MQBA 1ZOGA 3HV7A 4RSSA 4ZMFA 4ZTLA 1OITA 1GOLA 2QG7A 4KA3A 4LRMA 2JKQA 2VD5A 2JBOA 2XIXA 4QO9A 3ZO4A 4CXAA 2XYNA 4FYNA 5F9EA 5M56A 5C8MA 4B0GA 3V5QA 5L2IA 1Q3WA 1P4OA 4CLIA 4RQKA 4IVCA 3MGYA 2VX1A 3ROYA 3QGWA 4O96A 3ZS5A 5EDRA 2UZOA 4YC8A 3VBQA 4G16A 4NM3A 5HE3A 4HOKA 1SM2A 4G3DA 5CSWA 1VYZA 2IW9A 1JSUA 3GGFA 5F95A 3UO4A 3P4KA 5KBQA 3I0QA 5FEQA 4BHZA 3U6IA 5K4JA 2HWOA 4XS2A 5CU2A 1YDSE 5EW9A 4P7EA 4P5ZA 3W1FA 2JFLA 2OJFE 5EI6A 4R7HA 4ANMA 3BHHA 3MPAA 5CWZA 3F7ZA 4H1MA 4JBQA 4TWOA 4CYIA 5HLWA 2QC6A 3D14A 3IW7A 4MXYA 4I0RA 3W18A 4AWIA 4BF2A 3NUNA 4D2WA 3FYKX 4IB3A 3FPMA 4D4VA 3QA0A 3UG1A 3EN9A 1A48A 5KUPA 4EK4A 4HW7A 2HW6A 2F7XE 2OJ9A 3Q9WA 4IFGA 4XH6A 4CSVA 4EH5A 4FIEA 4FTUA 5L2TA 5HKMA 4CFFA 4K8AA 4PUZA 5E8VA 5I3RA 2GNHA 3DAEA 5I9UA 4E5BA 3EFLA 2UZBA 3DCVA 1K2PA 3NUXA 4YLKA 2YJSA 4YJTA 5D11A 5ANIA 2NO3A 2I6LA 3RPRA 5M51A 3EKKA 3PVBA 3QCSA 4L53A 4AF3A 5C4LA 3GU7A 4ZZMA 5LVOA 3LXNA 4FKPA 1PXJA 2B53A 4C8BA 5DE2A 2UZTA 2CDZA 5KMIA 2CNUA 3EQGA 4CZUA 2WU7A 3BYMA 3P7CA 4U43A 1VJYA 4O7NA 3HVCA 3LFNA 4FKRA 3FQEA 3PFQA 1BUHA 3V04A 3V8WA 2W4OA 2Y6MA 4LGGA 4TYJA 4RX5A 5EI2A 3DBEA 3R8UA 4ITJA 3UP2A 5JT2A 3BU5A 4APPA 2ONLC 2OFVA 3I5ZA 1J91A 4O1PA 1Q5KA 1K3AA 4FKTA 4D5HA 1YXTA 4W8DA 3G2FA 2J0IA 3PZEA 2WQEA 4F99A 2JD5A 3W2RA 4YO4A 5M08A 3NSZA 5CT7A 2QU6A 4BIBA 3GENA 4ZSEA 2WQBA 4LUDA 3C4FA 3I7BA 4WIHA 4QQCA 5EH0A 3E5AA 3TV6A 5BX0A 4MHAA 4RA4A 5IUGA 2IZUA 2YACA 2J4ZA 3MS9A 3KRRA 1W83A 4G6LA 1UWJA 3TIYA 4BCJA 4LI5A 4OTIA 5HCXA 1OBGA 4XP3A 2CCIA 3QA8A 4TYHB 5KMLA 4U40A 2AC3A 2B9HA 4NH1A 1MP8A 4GRBA 4PMSA 2JKKA 2NPQA 3DTWA 3E7OA 3EKNA 3RZBA 2OJGA 4RGJA 1KV1A 3ULIA 3C51A 3ET7A 3G9LX 4BCPA 2RGPA 4F1TA 3ETAA 2Y4IB 2P2HA 4H36A 4QP1A 3ORXA 4O7ZA 3PLSA 3LLTA 1R39A 4FSRA 1W84A 2XUUA 4KBCA 1UWHA 4UALA 3VUHA 3M1SA 2ERZE 4BZOA 5C01A 3LW0A 4M68A 5CNOA 5DT3A 4F08A 2UW8A 3MTLA 4MD8E 1YDRE 4J52A 3KL8A 5FXRA 3OXTA 3TNWA 4EOPA 4XX9A 2B4SB 4PL5A 1WVYA 2C5YA 5CU3A 4EYMA 4FSQA 4JQ7A 4EUUA 3OBJA 3QTUA 3UZPA 4TL0A 3WBLA 2DQ7X 2XEYA 4HYUA 4AOTA 1H1QA 3HMPA 3QXOA 4I6QA 4I22A 3Q9YA 3KMMA 4JG6A 3FY2A 4X3FC 4ASZA 5HBHA 4YJUA 5ETAA 4XP2A 2X4FA 1PXOA 2HELA 2W4JA 3F5UA 4TYEA 5DH3A 3ZMMA 4NYEA 4Y5QA 2YIYA 4L42A 4QYEA 4RFMA 4Y83A 3L9MA 3HMIA 2PVLA 2YCFA 3HV3A 4IEBA 3T3VA 4RJ7A 3QU0A 3S1HA 2YERA 3NYNA 3ORIA 4I6HA 3DJ5A 4MVFA 4AN9A 4C4FA 4ZS0A 1OECA 4Z16A 2XIRA 3VRYA 3GXLA 2DS1A 4DC2A 3F2AA 2IVUA 4EZ7A 4OTGA 2YM4A 1PHKA 3VUDA 3SAYA 2F2CB 1W7HA 2GSFA 2PVRA 4G3GA 4WNMA 4PMPA 3P79A 4M3QA 2ITXA 4A9SA 1F5QA 2C5XA 2Y9QA 2JKOA 3NW7A 4PPBA 3FV8A 5M57A 1U59A 3C0IA 1I09A 4K1BA 2UZLA 4HVDA 3MJ1A 2XJ2A 3A2CA 3UOHA 1CMKE 3KGAA 3FSFA 4NEUA 1Q8WA 4YZBA 4ZY5A 2HOGA 1P4FA 4EZ3A 3GCSA 5GJFA 3VS7A 3TN8A 5LMKA 4KIOA 1UU3A 2JAVA 5F94A 3WF6A 3ITZA 3NYOA 5BVWA 3RVGA 3KRLA 3COHA 3E3BX 4FIFA 4G3CA 4CCBA 3VS0A 4FEVA 4K77A 3UZTA 2VTLA 2E9PA 1YXUA 3KCFA 4JR7A 2GFCA 3R21A 4Y46A 4W4XA 5E92A 2W9ZB 2XA4A 4O7VA 4U6RA 3S3IA 4QYHA 2C6MA 2QI8A 3QRIA 2R3GA 3CP9A 2YDJA 4LYNA 3V01A 4GJ3A 2W05A 5TF9A 4AA5A 4F65A 4ZSAA 4JRNA 5L6OA 2GNGA 2B0QA 1WCCA 4KNBA 3QL8A 3VNTA 4JJRA 4LGDA 1ZYJA 4K2RA 3UOLA 4DHFA 4XHKB 4BR3A 2QNJA 5CEKA 3PXFA 1IASA 2PZPA 3ZDUA 2VO6A 4J1RA 1IAJA 4L43A 3LFCA 4GV1A 3AQVA 3P5KA 3A4PA 5L6PA 3HAVA 4TYGA 4NFMA 5HOAA 2PUPA 3OT8A 1E9HA 3R6XA 4XJ0A 4YJPA 1BL6A 4R3RA 4NW5A 4FGRA 4L68A 2QOOA 3L9LA 5CASA 5EOBA 5ACKA 4EJNA 3IK3A 1Y57A 2XNOA 3PPJA 5HVYA 3F5GA 3V8TA 2C3JA 1GZOA 3Q4UA 4DH5A 5BPYA 3FHRA 2C6EA 3R7UA 4F0IA 5I9WA 3TT0A 2C6IA 2QURA 2BRNA 3OP5A 3CPBA 4RA5A 5CXHA 1AQ1A 4IXPA 5AX9A 3QD4A 4QMXA 2F9GA 2J7TA 2CHLA 4HVSA 3MFRA 2EVAA 4NM7A 3VS2A 4DGNA 4A9TA 4FVQA 4DITA 4NTSA 3SG8A 5FXQA 3DB8A 3QZFA 3CKWA 4U42A 2XCKA 4QMZA 4GJ2A 1Q24A 1R1WA 4Z55A 3PTGA 1FBNA 3IW5A 3R1YA 2Q0BA 4AW0A 4BBMA 4DG2E 5FDPA 1LPUA 4E6DA 4IAAA 4KABA 4YC3A 4LL5A 4RX9A 3F5PA 2OLCA 3WF7A 4ITHA 2Z02A 4FSWA 2OJIA 1A06A 3VN9A 1URWA 3PXZA 2JIUA 3WI6A 1P2AA 3I5NA 3PE2A 5I3OA 2AC5A 5BUJA 2IVSA 3VIDA 1CTPE 3C50A 5EKNA 1CKPA 2GNJA 3TJCA 1UU7A 3FLNC 2CGVA 2VWYA 3BU3A 3WZKA 4YTCA 4PWNA 5EYDA 4TWNA 3PE1A 4KS8A 5AWMA 4C3RA 3NUYA 3QAME 4AUAA 4E4LA 5CF8A 4IZYA 4AZWA 3PSCA 1L3RE 3DQWA 5C27A 2F2UA 1BKXA 4EZ5A 5IA3A 3UGCA 3N9XA 4D9UA 3II5A 3LFDA 3VUKA 3HGKA 3QTRA 4YR8A 4I4EA 4L3PA 4RIOA 4Z3VA 4JIAA 1CDKA 3H3CA 4WSQA 3SRVA 3DDQA 5JQ5A 5ACBC 2BRBA 2C0TA 3SV0A 4QP7A 4TNDA 2VO7A 4FV7A 3UYSA 3ZHPC 5CENA 2XBJA 4KUJA 3D15A 5CEMA 3MIAA 4X0MA 5HVJA 3S0OA 3NPCA 3F9NA 3OWKA 2PVYA 4M67A 2R3NA 1XBBA 3NRMA 2PZ5A 4YJRA 1H8FA 4QTAA 2JKMA 3ZXZA 1NXKA 5IG1A 2WPAA 2QU5A 3DJ6A 4J99A 4GFMA 5AV0A 2J6MA 5ANEA 3T9TA 4HJOA 3EZVA 3W2CA 4D4SA 2RSVA 3DT1A 4Y5HA 4M8TA 2B52A 5DVRA 3W2OA 5HX8A 3VS5A 2BDJA 5EHYA 3PWDA 1XKKA 3F3WA 3VS6A 3OCGA 5ETIA 2C6LA 2E2BA 4XG8A 3CCNA 3ORKA 4V0GB 3WZUA 3SG9A 3D83A 4RLKA 4JR3A 3PY0A 5LVPA 2E9OA 4O83A 2Z7RA 4O0XA 5KHWA 4BCHA 1HOWA 4AT5A 4NM0A 5EM8A 2H8HA 4IQ6A 3TWJA 4ASXA 3MVLA 3R73A 4QP4A 4FZ6A 2REIA 3KB7A 2VWWA 3AMAA 5AUUA 4ANNA 3BHVA 3COKA 2WZJA 1XO2B 4M97A 5IH5A 4FTMA 4I41A 2WB8A 3U6HA 4QPMA 4JX7A 5HQ0A 3ID6C 3WE8A 5HVKA 1H08A 4UBAA 4FV4A 1MRVA 4OBQA 1PMNA 3H9FA 3PJCA 5H2UA 4J71A 3VW6A 4GH2A 3LXLA 5B2KA 1KOAA 4WG5A 1JKKA 3C5UA 1TKIA 2PVHA 4QP6A 3BHTA 3MB7A 5TR6A 5M4CA 4KKHA 4LG4A 3AMBA 4QPSA 3E7VA 2Y4PA 3BYUA 4KB8A 5FBNC 1ZYLA 3Q6WA 4HZRA 3PIYA 2DYLA 3Q3BA 1Q41A 1YHVA 3MY1A 5A9UA 3BV3A 3DY7A 3MY5A 1J7IA 4O38A 4PP7A 4UZDA 1M14A 2PMOX 4YZMA 3U4UA 4L3JA 5JK3A 3ZH8A 3W10A 1XWSA 3I6UA 3MTFA 2X2KA 5GNKA 3DJ7A 3P9JA 4L00A 4DYMA 4M0YA 4F6UA 2BAKA 5KMJA 1WAKA 4AGDA 4OAVB 2YEXA 3JPVA 4H05A 4W4WA 4PL3A 3VULA 4YLLA 2VTJA 2XEZA 1OKVA 1U4DA 2XKDA 3FMDA 3R2BA 4FYOA 4IFCA 4WBOA 5AR7A 2C3IB 2WEVA 4L6QA 4BFMA 3ACKA 3C4ZA 5D12A 4ACGA 1Q8TA 3DXQA 2XJ0A 2O64A 3BLRA 5C1QB 4BCOA 3H4JA 3QHRA 3MSSA 4I6FA 4K18A 4UB7A 5FM2A 4QMVA 4QMNA 3NLBA 2W5HA 2ZV9A 4J95A 2VN9A 3HEGA 4ZSLA 4QMUA 3TKHA 3WYYA 3R2YA 2JEDA 3W2PA 4BKJA 2C6KA 3VUGA 4Y73A 2ZB1A 2BAQA 3H30A 3MA6A 5FP6A 3PDTA 5B2LA 4R77A 3R9RA 4QQTA 3OF0A 1K9AA 5KE0A 5DG5A 3VHEA 2VGPA 2W99B 2WMSA 3NUAA 3AC2A 4O0SA 5FQDC 3VS4A 1LUFA 4JDIA 4G6OA 1NT2A 2F57A 3U4WA 3N4VA 5IEXA 1DI9A 5DA3A 4X21A 5JGDA 2BIKB 2QVSE 5IQAA 4XBUA 4C57A 3AC4A 2RFDA 5AUXA 4AS0A 1XH7A 4YJSA 4F09A 4S30A 2JIIA 4HVHA 3ORLA 4U80A 3ZCLA 3FZPA 1PYXA 2B9FA 3PP1A 4AA0A 1LR4A 1TQPA 1STCE 1QL6A 2BKZA 3DV3A 3SW7A 3NGAA 2ZV2A 1OB3A 1YXXA 3Q5IA 5GJGA 2IVTA 3OEZA 3ORNA 4CFUA 1M17A 3PZHA 3EQFA 2BRGA 5LMKC 4L44A 5C8NA 3LFSA 4WUAA 2EU9A 5A14A 3ZC5A 5HCYA 2QOBA 1ZZLA 4Q9ZA 2GHGA 4E7WA 4C7TA 1KV2A 4OTPA 5HGIA 3SVVA 4C37A 1GIJA 4R7IA 1APME 3D2IA 4AT4A 3QRJA 4ZJVA 4I94A 4L7SA 4Y72A 3UG2A 3UIBA 4FI1A 1SMHA 4JDHA 2X1NA 4CFVA 3ZFYA 4V01A 5AX3A 3AT3A 2W5BA 1ZYDA 4FNYA 3DTCA 4EK6A 4O7YA 4H1JA 5HG8A 4O84A 5DPVA 3SA0A 3R7OA 2PZYA 2YAAA 2ZM3A 3TNIA 4U41A 2NRUA 1H1PA 3KRWA 3MA3A 3R22A 4I92A 4D1ZA 2C6TA 2OZOA 2ZB0A 2FO0A 2AYPA 2C5OA 3KN5A 2OXYA 3RNYA 3G6GA 4AZFA 3U55A 2OGVA 4XBRA 3LQ5A 5AR3A 3D2KA 4FNWA 4FVPA 5DT0A 2R3JA 4YGAA 3THBA 4IB5A 2ITZA 4ZY4A 5KZIA 5CSVA 3ZEWA 2XYUA 3HL7A 3T9IA 4ASDA 3UBDA 4DN5A 5KCVA 2X39A 3OW3A 4QMWA 4B8LA 2Y0AA 3R28A 5JSMA 4AZTA 4YZCA 4FV2A 2X2MA 3GCPA 3L8PA 3ORMA 2BCJA 5FLFA 3LJ2A 2X9FA 1O6LA 4Q9SA 2IZTA 5HU9A 3HP5A 3ZM9A 2P4IA 2FYSA 5FGKA 5IZFA 5AP4A 3NNXA 3WF5A 1F0QA 1Z9XA 2XRWA 2GNFA 1XJDA 2HK5A 2IN6A 3LJ0A 3IW8A 3QC9A 4AN2A 3FXWA 3ZRMA 1OKYA 5HE0A 3COIA 4BCIA 5A4QA 5CSHA 5ETCA 5BVNA 5H9BA 3OFMA 4FKJA 2DUVA 3ZZWA 1YI6A 4H3PA 3FZRA 5J9LA 4EHVA 3L9NA 2WFYA 3GCQA 4XP0A 4C61A 4USEA 2F49A 3RAWA 4ACHA 4CVAA 3IW4A 1MRUA 3CTQA 4X2GA 3TZMA 2OF4A 3FKLA 5AAFA 3CLYA 4G31A 4IZ5A 3TKUA 4F0GA 1H1SA 3D9VA 3KN6A 5HESA 2VUWA 2UZEA 4GSBA 5ANKA 4W8EA 3OG7A 3UIXA 4DGGA 3DXNA 3PIXA 5TOZA 5EQPA 3TV4A 1PKDA 3AC5A 1OL6A 1YHSA 3EQHA 5BQ0A 3PLAE 4CGAA 4C34A 3RAKA 3SQQA 2A0CX 2WMQA 3RI1A 4CQEA 3B2TA 3UNJA 5CAVA 3PXKA 3QGYA 4G9RA 4EI4A 3UZRA 3PP0A 4LL0A 5AEPA 5CSPA 3NAXA 3CY2A 3OY1A 4AZVA 1W0XC 3SX9A 5LMBA 1FVTA 3SOAA 3F61A 3TZ9A 4BZDA 2CN8A 5M4UA 2R64A 3FMNA 2WMWA 5IF1A 5HNBA 2UW6A 4EWQA 3OC1A 2GU8A 1S9JA 1WZYA 3V51A 2YA9A 3UYTA 3ZTXA 4G17A 3JYAA 2VNYA 3C0HA 3MFUA 3FDNA 3R1SA 4BDBA 4V05A 3DBDA 4D2RA 5CU0A 4YHFA 2B9JA 4BTFA 4FTIA 5BMMA 4EBWA 2YM5A 1YRPA 1R0PA 2XP2A 3CKXA 3GEQA 3K5VA 5A4LA 2R9SA 3GCUA 4JG7A 4GKIA 2DWBA 2A4LA 3BCEA 2BPMA 4G9CA 4DCAA 2GQRA 2WXVA 2VGOA 2UW9A 1UA2A 2CMWA 2XK4A 3HMOA 5C8KA 3UNKA 4X3FB 3CIKA 5DEYA 3LFBA 1JPAA 1BI8A 4RVTA 4MX9A 4PQNA 3K54A 4HCTA 3VBWA 1ATPE 4WHZA 1WMKA 4PP9A 4JVGA 1YW2A 3LLAA 2HENA 1UU9A 3I81A 3RTPA 3R7VA 4EOIA 1H00A 1JSTA 5FRIA 3UIMA 3F6XA 3OROA 5LWMA 2GS2A 3ACJA 4H39A 1OMWA 1KE8A 3Q9ZA 3HA8A 4YNOA 3AD4A 3QCXA 2NNWB 3BI6A 4ANLA 5IISA 4FK3A 5HO8A 3TCPA 5KMKA 1KWPA 2A27A 3UO6A 4EHGA 4RVMA 3QD2B 4MKCA 4E20A 4XUFA 4R78A 1LP4A 4EH7A 4C3FA 4B4LA 5IDNA 1FPUA 5K0XA 4BDGA 2JDSA 5CF5A 3KRJA 1KUTA 4CD0A 2YM6A 3FLYA 2VTPA 3V5WA 4NIFA 2R4BA 2JDOA 2P33A 4RWIA 2VTNA 2UVXA 5IH4A 4Q5HA 2YHVA 5I9ZA 4FKQA 4YBKA 3UJGA 5FTGA 1YOLA 2OH0E 4MWHA 4FZFB 4UWBA 3KXXA 4K6ZA 4RC3A 3V5TA 3M42A 4PTCA 4ZSGA 4DTBA 1RQQA 2UW7A 3LMGA 5GJDA 2R3HA 5HTCA 3NWWA 5JGBA 4FT3A 1JOWB 4IE9A 5EHLA 4A07A 3ORPA 3Q6UA 2UZVA 1PXNA 3EN5A 3CPCA 2QD9A 3NIEA 1E1VA 1MRYA 2VWIA 3O8UA 2FUMA 4LOPA 1JKTA 5CQUA 3MH2A 4AU8A 2J9MA 5EI8A 4CFMA 1Q62A 4GVAA 4BZNA 3NNWA 3OUNB 4YUQA 5IQHA 4I0SA 3PA3A 3R04A 4K33A 2EXEA 3RPOA 4HYSA 3MFTA 3NS9A 3UC3A 4M0ZA 3ODZX 4AA4A 5FTQA 1ERKA 3MJ2A 3OVVA 3LM5A 3OS3A 5IPJA 4IJPA 3PSDA 2VWZA 4IIRA 4QMTA 2CNVA 4BGQA 2GTNA 4XOZA 2ZMCA 4HCVA 3BLQA 4YHTA 3ATSA 4O81A 2VNWA 1JKLA 5AR4A 3OUKA 4W9WA 5KKRB 5E8WA 3ROCA 4U9AA 2VZ6A 3H9OA 4M12A 5J1VA 3BKBA 3BWJA 4YPSA 3FSKA 4KBAA 4O0UA 1H0VA 3UODA 2XIZA 5T3QA 3Q60A 4APCA 3AT2A 5F20A 3PUPA 3R8LA 4M13A 3HV4A 3PJ8A 3E8CA 3NNVA 4BDCA 3WE4A 4A4LA 3HDMA 3TIZA 3UP7A 3A7GA 4NFNA 4KIKA 3TKIA 2YDIA 4DAWA 3CQUA 5CS6A 3LXKA 5AP3A 5DR2A 4DF3A 4L3LA 1ZXEA 3BZ3A 4FKUA 4FV8A 3HECA 4FKVA 3RAIA 2C1BA 4IAIA 4DEEA 5B2MA 4D0XA 4NIFB 5KX8A 3R8ZA 3GC9A 4M15A 4DFXE 2YWVA 1EH4A 3FMMA 4UWCA 3FKOA 2I0EA 2WAJA 2XBAA 4YZ9A 4TW9A 4CFWA 3LHJA 4I0TA 2I7QA 2G2HA 4DFBA 3ZUUA 3K3JA 2CJMA 2VX3A 4J98A 3UPXA 4YP8A 4NKAA 2QOIA 1OPLA 3FL4A 4ZZOA 3LFEA 3SHEA 3RWQA 3TJDA 3HMMA 4P2KA 2WMRA 4HNIA 3DBCA 4HNFA 4Z7GA 4EKLA 4IADA 3RK9A 4GU6A 4WUNA 2XRUA 3SC1A 2PULA 2R7BA 3OCSA 4GYIA 4QQJA 5CF6A 4EUTA 2Q83A 3IOKA 5IEYA 3NUPA 4EH9A 2R3QA 2ETRA 1ZAOA 5DN3A 2UZDA 1YXVA 2XK3A 1YVJA 3ZLWA 4ASEA 3FY0A 4EQUA 3KKVA 2RFEA 1WBPA 3KU2A 4DFLA 4Z9LA 1Q97A 3EOCA 4L01A 3ZLYA 2R3IA 2QKWB 3EHAA 1RDQE 5AADA 2A1AB 2NRYA 3D5VA 2CNQA 1BL7A 3LE6A 4DTAA 1NVSA 2VTMA 2WOTA 4RZWA 2PVFA 1Y91A 4PNIA 2GQSA 3F88A 4GK2A 3NW6A 1GZKA 5C26A 2J5EA 1IRKA 3E88A 4J96A 3FMLA 1ZYSA 4U5JA 5EYMA 4FODA 3AXWA 4N4SA 3GC8A 2PE2A 3DZQA 3G90X 3FQSA 3CBLA 2WHBA 2PYWA 4FNXA 4CKJA 4X2NA 2JC6A 2V22A 3QD3A 4H3BA 4CKIA 4OGRA 5HD4A 1PMVA 1RE8A 4XCUA 3I0OA 1CM8A 1FGKA 3FLZA 3EN6A 5EDPA 5DMZA 2ZV8A 4IWPA 3FI2A 1Y6AA 3IOPA 5I5ZA 1OIRA 4KSQA 4YJNA 1R0EA 5HX6A 4QPAA 4BDDA 2B55A 1U54A 3FLQA 3C0GA 4DEGA 3HV6A 2FH9A 3NVMB 3VQUA 5L2SA 2QOQA 3EQIA 4DEDA 3SW4A 2R0UA 2VTIA 5TO8A 2B7AA 3DLSA 5K3YA 3EN7A 3KRXA 3Q04A 4FTNA 3POOA 5C4KA 3CY3A 3Q96A 5EQEA 3LQ3A 2RIOA 1RW8A 3C1XA 2WTKC 5D7VA 1M2RA 4Q2AA 1ZMUA 4IACA 3M2WA 3VW8A 4BB4A 5AFVA 3BWFA 4MEDA 5G1XA 3A8XA 3T3UA 3CGFA 2WIHA 4KKEA 4TXCA 4R1VA 4E8AA 5J5SA 2BZJA 4DFYA 4MXAA 3Q53A 3W2SA 3R01A 4O7LA 3B2WA 3QRUA 4RC4A 3WF9A 3EYGA 3DKOA 3OOGA 3H9RA 3QTZA 1XBAA 4XLVA 3PWYA 4P5QA 1SYKA 5DR9A 3L1SA 4IANA 3ZRKA 4FZAB 3VWAA 2R3FA 3RPVA 2HZIA 1Z57A 3MY0A 4ZIMA 1A9UA 2HWPA 4MNEA 3G15A 2YISA 3PRFA 1WBOA 2P55A 3PJ3A 3EQBA 4QYGA 1O6YA 4W9XA 3U51A 3SOCA 3HRCA 3BHYA 1PXMA 3VJNA 3CE3A 3UMXA 3KXMA 3QZHA 4HGEA 4IBMA 5ANOA 4XMOA 1OL1A 3R71A 4TTHB 3MPMA 1YDTE 5HE2A 2RFSA 3QCQA 4AQCA 2J90A 2WEIA 4EC8A 4R3PA 2XS0A 4LOQA 3UOJA 2GCDA 2ZVAA 2OXDA 4BWXA 4R1YA 3VAPA 4CFXA 4FKLA 3Q4CA 4FNZA 4IW0A 2GQGA 4IAKA 2OG8A 1U46A 5HHWA 5DIAA 4D2VA 3GI3A 2ZV7A 5IQEA 2IVVA 4JI9A 2PPQA 2EB2A 4C4JA 4WNPA 4BDIA 1G8SA 3AD6A 3ZSHA 1PXKA 2WTJA 4JL9A 5KKRC 5M4IA 4UMTA 4CYJA 2C0IA 5L8JA 3GU5A 2OICA 1Y6BA 4FL1A 4FBXA 5KMNA 2V5QA 4BCGA 2YABA 1GY3A 4JBPA 3O0GA 3UVQA 4L7FA 4ARKA 4GKHA 2Y8OA 4QD6A 3KF4A 3CTHA 5E1SA 5T68A 1WBVA 5FXSA 5DLSA 3WZJA 4DGMA 4GG7A 5IMXA 5A4TA 2WELA 3HA6A 3QF9A 5HNGA 4F9YA 3PJ2A 4FTJA 3ANRA 4GIHA 2OWBA 3OBGA 4A06A 4KWPA 4FKSA 1KE9A 3R02A 2WMTA 5ANJA 4I23A 2JAMA 5FP5A 3EL8A 4G3FA 1XBCA 4D28A 2X6DA 3L8VA 4X6QC 4FTRA 3VS1A 1LEWA 3NEWA 2HAKA 2ITOA 4QYFA 5DWRA 4I5MA 4YLJA 3P23A 1YQJA 4ZMEA 2WMUA 4DT8A 5GIPE 2R2PA 3QTSA 2PUUA 2YCRA 3CD3A 4FKOA 4S31A 3TV7A 4WA9A 4RFYA 2BALA 2XNMA 5BVKA 4A4XA 4BWKA 4CNHA 4DFUA 3TZ8A 1ZZ2A 5CYIA 4DH1A 5IU2A 3A7IA 1AGWA 3QRTA 4AN3A 4DEIA 1YOMA 4S33A 3L8XA 4DH3A 3R9OA 2UW5A 3IO7A 4H58A 3MH1A 2H9VA 3WOWA 4DA5A 4B9DA 4QMSA 5CZIA 5AP2A 4WT6A 3ZO2A 4FOCA 4D2PA 3MWUA 3GT8A 4DGOA 3BRBA 3OWLA 4IC8A 5AUVA 4DE4A 4O0YA 3UQFA 1FINA 5CZHA 3R00A 1PY5A 3AGLA 4O6LA 3FEGA 3ENHA 1CKIA 1IA8A 1ZARA 4BVUA 1QPJA 4JOAA 5JRQA 4RWLA 4HGSA 5AP5A 3R7IA 3BHUA 3E3PA 1SVHA 2PY3A 2VO3A 3G33A 3MVJA 2XVDA 3RZFA 3NW5A 4KIPA 3LCTA 4U7ZA 4TWCA 4RRVA 2XB7A 2YIQA 3PVUA 4R5SA 2EWAA 3DA6A 4L46A 3FZOA 4NUSA 5FTOA 2W7XA 5H8GA 3RBWA 4BDJA 4DEAA 3P1AA 3GOPA 4D9TA 2O0UA 2VTRA 3UOKA 4FE2A 1REKA 2XNNA 5DHJA 4D4YA 3TUDA 2PWLA 4ZP5A 3C4XA 4C58A 1J3HA 5E8UA 5BNJA 4IX6A 4HVIA 4XNEA 4QMOA 4O6EA 3RINA 4BIEA 4EH4A 4DEBA 3QBNA 2Z8CA 3ZOSA 1ZLTA 2ZJWA 4I20A 4AW5A 3KK9A 3MI9A 3O2MA 3A61A 4AFJA 1PMEA 3FMEA 2XK9A 3VF8A 3ZRLA 1H24A 3FMJA 3GQLA 4PDOA 1P14A 2PZRA 3SKCA 4E5WA 4EK3A 4I3ZA 4F9AA 4MH7A 3KY2A 3TNHA 3KK8A 4ZTHA 2I1MA 2R3KA 2QO2A 4BKZA 5J87A 4QQ5A 5A3XA 4ENYA 2C5VA 5KNJA 2CSNA 3TNPC 3ALOA 5M44A 4DT9A 5HBJA 4PNKA 4ACDA 2O5KA 1XH5A 2WMAA 3F3ZA 3LIJA 2BHHA 3BELA 1QCFA 2X8DA 3PY1A 5B0XA 5HIDA 2J2IB 4J8MA 1KSWA 1YHWA 4M66A 4CT2A 3QYWA 4FSYA 4YBJA 4USFA 5LVMA 2XF0A 4I5PA 5CAPA 1Y8YA 2YM8A 4AFEA 5GZ8A 3TUCA 2EXCX 2G1TA 4FG7A 3HZTA 3NDMA 5KMMA 2Z7QA 2G01A 3GCVA 5EK7A 4M69A 5H8BA 4XRLA 5IQBA 4JDJA 5DT4A 3FE3A 3VC4A 4U45A 3V8SA 4EONA 3MYGA 4LRJA 3S00A 2CKEA 4U44A 5AIRA 5BYYA 4O0WA 1PXPA 2WO6A 3SRVB 4PRJA 4BCNA 4IAYA 4FX3A 3KXZA 3QQJA 4O0RA 2PVNA 2G9XA 3CJGA 4KRDA 2PMIA 4EH8A 2AUHA 2V62A 5EM7A 4MXXA 1ZOEA 4ZTSA 3D5XA 3D5UA 3CGOA 3OMVA 3ATTA 3KVXA 4TPTA 3NX8A 3LFAA 3MW1A 1Q99A 2YZAA 4RIYA 5J9ZA 4UMQA 5I9VA 5FWKK 3BE2A 2GMXA 2Z60A 2VO0A 3F3TA 3QZIA 4L45A 3R7GA 2CKPA 3O7LB 4FTQA 1KE5A 5D1JA 5AV4A 3CS9A 3IG7A 2VWXA 2JLDA 1XQZA 3R9HA 5BVFA 3SDJA 4O7SA 4NM5A 4K11A 4BC6A 4IWQA 5AP7A 4F7SA 2QCSA 3R8PA 5K5NA 3CSVA 4F9CA 3QX4A 2VU3A 2GS7A 4C62A 1PF8A 2QKRA 4HGTA 2X7FA 2EXMA 4XV3A 4YMJA 4JG8A 3CR0A 5CTPA 5I0BA 1OVEA 2X9EA 2ZYBA 5DOSA 3F69A 1GZNA 3NAYA 3Q32A 2RF9A 5FBOA 4UMRA 3LQ8A 4PDPA 5H8EA 3OHTA 5L6WL 3OZ6A 5H3QA 4OBOA 2PK9A 3KMUA 3DDPA 4E4MA 3UPZA 3DOGA 3ZU7A 3BQRA 4ZOGA 1S9IA 3NYXA 1SNUA 3FWQA 3TDVA 3QQKA 4IVAA 2X0GA 3LVPA 3REPA 4FTTA 3LCKA 2WU6A 5KBRA 5FG8A 4O82A 4U0IA 2WTVA 3R7EA 1VYWA 2BVAA 2J0KA 3VS3A 3JS2A 4FIIA 4FIHA 4CEGA 4PL4A 2JIVA 3I7CA 2OJJA 3RAHA 3MESA 4TRLA 1OUKA 5DNRA 2UV2A 1SZMA 4YHJA 3GU8A 4BCMA 4MQ1A 4ERWA 3Q52A 2YIRA 2A2AA 5HTBA 5K5XA 4IWDA 1OZ1A 5J9YA 4C33A 4FVRA 4ANBA 2JDRA 4O86A 2I0VA 3S95A 2Y7JA 4YJQA 1JNKA 4LFIA 5JFXA 5M4FA 4UYNA 4OTQA 5CEOA 3JY9A 5AAGA 4F70A 3EZRA 4CQGA 4L67A 4ORKA 3EYHA 4BIDA 2YN8A 4RWJA 2F7ZE 2ZMDA 4I24A 3PJ1A 3W2QA 4KKGA 5AV3A 4BDHA 4MXCA 4UEUA 4O7TA 4O21A 4XG4A 2CPKE 1OL2A 2E9NA 2W17A 5HG9A 4ZEGA 3NUUA 4GEOA 4NU1A 1OIQA 1VZOA 5CVFA 3H0YA 4Y85A 3TNQB 4AACA 4BI1A 5AA9A 4ZS4A 2GDOA 2QR7A 1H25A 4WD5A 5GZ9A 3UQCA 3MPTA 3RM6A 4XG9A 3BGQA 1QPCA 5HEZA 5BYZA 3LOKA 3CQEA 4FL2A 4DINA 2ITUA 4YSJA 3MB6A 5BVDA 4X7QA 4YURA 4ACMA 1BMKA 4IM3A 2CLQA 4EQMA 3RNIA 4F0FA 4F1OA 5A6NA 3E8DA 4OTHA 4DCEA 3R0TA 2W0JA 1T46A 3DKGA 3HMNA 1FQ1B 3QD0A 4IH8A 4LGHA 4P90A 4NT4A 2HYYA 2VTTA 5LVNA 1PMUA 1UNGA 3HYHA 3VRZA 2J0LA 4ALUA 4DGLC 2WIPA 3RCJA 3GU6A 2ACXA 4FEQA 1CSNA 2OO8X 2W1EA 4XG2A 2ERKA 3QTIA 4IAZA 1ZY4A 3ODYX 3I6WA 2CCHA 4Z7HA 1W8CA 4C3PA 1FMKA 4QT1A 4IM2A 2WMBA 2GTMA 1G5SA 3SXRA 4NK9A 2P2IA 3ZSGA 2YITA 4RIWA 2JITA 5E8ZA 2XCHA 4FTCA 2QLQA 3NCGA 4FR4A 2C69A 2J5FA 3ANQA 3DK7A 3IGGA 4LUEA 5AIKA 3LMHA 4MBIA 4J7BA 3FZ1A 2C68A 3NUSA 2ZDUA 2VWBA 3EQRA 3HLLA 4I93A 5HNIX 2XK6A 4BY9E 3CXWA
chains in the Genus database with same CATH superfamily
2HIWA 3DS6A 3GB2A 5D9HA 4RJ4A 4LOOA 3WZEA 5J5TA 1WFCA 2VTQA 3LCOA 3FZTA 3FYJX 4RJ8A 4JS8A 1OKZA 2FVDA 3OWPA 2IG7A 3DBQA 3DAKA 3QX2A 4PDSA 2BRHA 3EWHA 3VUTA 3OOMA 4D5KA 4FIGA 2R5TA 4FG9A 5TKDA 4FV9A 5L2QA 2QOLA 3UC4A 2OZAA 3AD5A 2I0HA 2Z7SA 3QTWA 4IVBA 4FA2A 1G8AA 4IB1A 3H10A 4MK0A 4QTCA 4C02A 3LKMA 4MWIA 3N4TA 4FTKA 4FEUA 2V7OA 4YSMA 3K2LA 3O7LD 3LCSA 3ZONA 4BTKA 4MBLA 3E92A 4GMYA 4QYYA 5IUHA 4R7BA 1DM2A 5HORA 3JVRA 3DAJA 3IONA 4EOMA 4UX9A 4N70A 2WOUA 5CVGA 4ZTNA 3VBTA 5HU3A 3CQWA 3A99A 3PIZA 4IB0A 4ZTQA 4XG6A 3D94A 2RG6A 4H3QA 5CF4A 3TL8A 4QMLA 2W5AA 4ITIA 5IKWA 4WG4A 2C5NA 1IEPA 5AV1A 4DEHA 4LV8A 4W4YA 5AP1A 1RJBA 5DRBA 1JLUE 1PJKA 1QMZA 2WD1A 3NIZA 5CAOA 5EKOA 3R1NA 4GCJA 3BE9A 3QLFA 4RX8A 3Q9XA 3FQHA 1Y8GA 1W98A 4IZAA 4AG8A 4B7TA 2RG5A 5AUTA 3Q2JA 5CY3A 4HYHA 4FTLA 1GZ8A 3C7QA 4IZ7A 2OXXA 4LM5A 3AKJA 4FJVA 5CSXA 3OXZA 4NTTA 4U79A 2PTKA 5LARA 2C6OA 3GFWA 4E4NA 3MDYA 4TT7A 5IA4A 4FKWA 4EOSA 4QTBA 3P7AA 5EDQA 4C36A 4BCQA 5D41A 4BCFA 4XRJA 2ITYA 5FD2A 3BL9A 2WTKB 4GS6A 4JLCA 4CRLA 1NA7A 2W1FA 3AC1A 3WZDA 4EC9A 5J1WA 4MXZA 5JKGA 4EQCA 5IH6A 1JVPP 3ORTA 5AUZA 2OK1A 4TYIA 4GG5A 3DLZA 4MBJA 4F64A 5CU4A 5GINE 5J79A 4K9YA 2F4JA 4HVGA 2A19B 3VVHA 4YZDA 3V5LA 5HLNA 3D4QA 5I9YA 2OIDA 2RKUA 4NWMA 3QUPA 4PV0A 4U97A 5JEBA 4NZWB 3OD6X 4RX7A 3QWJA 3ERKA 2VTOA 4IMYA 4WRGA 3BBTB 2UZNA 2V55A 5F1ZA 2YFXA 4FC0A 5ICPA 3A62A 4BBEA 4E6AA 5CI7A 2FSOX 3C13A 3I79A 4XLIA 1YXSA 5M53A 4CZTA 4TZRA 3FI4A 3HX4A 3DKFA 3FI8A 2W06A 5JH6A 1MUOA 2HZ4A 2FSTX 2QLUA 3LFFA 1AD5A 4C4IA 2R0IA 5AA8A 3NYVA 5HLPA 4D2SA 4MTAA 1WVXA 3N4UA 2FSLX 2O2UA 2QHNA 1GNGA 1U5QA 3W33A 3ZXTA 5EQYA 1J7LA 2XNPA 3BU6A 4KIQA 3RHKA 5CEPA 5EYKA 2ZM1A 4BN1A 2WQOA 3G0FA 3LZBA 3ZO1A 2H96A 4PTEA 1BYGA 3DGKA 2PUIA 5IQCA 4E3CA 3PPKA 4BYIA 4TWPA 3MN3A 4NSTA 4YZNA 2PL0A 3QKKA 5FM3A 4TYHA 3ZBXA 3QALE 1PYEA 2C3LA 4O2ZA 4RIXA 2JDTA 3HAMA 2UZWE 4TKSA 2BMCA 3OCTA 4O0VA 2W1HA 3GVUA 4YC6A 3DXPA 2V7AA 5I4NA 5F4NA 3UIUA 2OBJA 2CLXA 5HO7A 4PMMA 3FI3A 2BDFA 4QMMA 2WTDA 5CT0A 5E8YA 5LXMA 5LJJA 1MQ4A 2BDWA 2OFUA 3N51A 2PMNX 4CZYB 4PX6A 3EIDA 3EQPA 1Q8ZA 1ZWSA 3QQGA 2IZRA 2OU7A 2B9IA 1H27A 4FTOA 3WIKA 4AE9A 5M55A 4BWPA 4ERKA 2W9FB 4D4RA 4C2WA 4GFOA 3RK7A 2IZSA 1ZOHA 4CMOA 2BZIB 5AMNA 4NJ3A 4U8ZA 5DYJA 1DI8A 2GHLA 2XNGA 5M06A 5DRDA 2C6DA 4PTGA 1YI3A 3VUMA 4ANSA 4LV5A 4UMUA 3QQFA 5IDPA 2BILB 4FL3A 5E1EA 3ZO3A 2PHKA 2RL5A 4RVLA 3V3VA 3PPZA 3ZEPA 4D1SA 5KMOA 3QQUA 4IX5A 4CMUA 4BYJA 5AAEA 5HG5A 2JBPA 2XKEA 4FKGA 3K5UA 2OF2A 1OIYA 2HZ0A 4O4FA 4F6SA 4MNFA 2JGZA 4LDTA 1UU8A 4M84A 4E5AX 4ZLZA 1J7UA 3FXXA 4GT5A 1V0PA 3KULA 3QZGA 4EH3A 1IG1A 4ALVA 1GJOA 4FSZA 1H07A 3EQDA 5LOHA 3O50A 4FOBA 4ZJJA 3HP2A 2KULA 5CEIA 4DH7A 3DK3A 5KO1A 1V0BA 4FKIA 2HY0A 2V0DA 3IPHA 3U9NA 5HBEA 3R1QA 4JAIA 3EMGA 4QP2A 4RJ5A 4CT1A 2I0YA 2X0PA 4FTAA 4B8MA 1Z5MA 4WNKA 2IW8A 5IEVA 1FVVA 1UVRA 1M7NA 4DBXA 3BLHA 1KE6A 5A4CA 1XHAA 1VR2A 2FA2A 4M7IA 4HCUA 2OKRA 4RQVA 3ZDIA 3MVHA 2PSQA 5ETFA 3NCZA 5BUEA 4N57A 2OIQA 2QQ7A 3AC8A 3LPBA 4RIXB 4FV1A 5D7AA 5L3AA 4IHPA 4OT5A 3VBVA 5LQFA 4O7WA 1V0OA 3PXRA 4OBPA 4F63A 1JQHA 2VRXA 3C4WA 3AG9A 3DZOA 3SLSA 4EOKA 5LCJA 1G8KA 4PF4A 3KXHA 4FF8A 3MH0A 3RGFA 5L2WA 4OR5A 2XKCA 2W1IA 2CN5A 3A7HA 4G1WA 5T6KA 3A4OX 3OTUA 5GHVA 5EHOA 4X2KA 3UQGA 3E64A 5JZNA 4E93A 5I9XA 1H01A 4AZEA 4KIKB 4X6RA 1H0WA 1M2QA 4S32A 3O5AA 3ZUTA 4BDAA 5BYLA 2XK8A 4LMNA 3I4BA 2QOFA 3QUEA 2CGWA 3CJFA 2VAGA 3O23A 4FGBA 3VJOA 4QTDA 4G2FA 3QUDA 2RFNA 1B38A 4II5A 4L8MA 4ZLYA 5EFQA 4HZSA 3TEIA 4B6LA 5JFWA 3F82A 3QKLA 5EM5A 4AZSA 1UKIA 4F7LA 2P0CA 2VTSA 3IDPA 3ZZEA 2O65A 3LCDA 3SXFA 3ZBFA 2ZOQA 3NZ0A 3COMA 4I5HA 4RWKA 4JRVA 1OL7A 2W1DA 5AJQA 5L4QA 4KAOA 3UMWA 1UKHA 4CRSA 5EYCA 2G15A 2ITNA 4DFNA 4ZJIA 4BL1A 4NCTA 2HW7A 3BEAA 5DR6A 3KEXA 1H26A 4OTFA 1DS5A 2BZHB 4BCKA 3QXPA 4FV0A 4MD9E 4DH8A 4DLJA 3OY3A 5K4IA 3KULB 4QOXA 3BYOA 3VBYA 4XG7A 3A7FA 2ETKA 4AW2A 3BEGA 2UW4A 1QPDA 3KA0A 4QMYA 1OUYA 3KFAA 4MYGA 4BRXA 4G34A 3FBVA 3VQHA 1BLXA 3JXWA 3Q5ZA 4O4EA 4MCVA 3CTJA 2ZAZA 3CEKA 2QO7A 5IQFA 4FIJA 2X8EA 2W4KA 5CAUA 4IWOA 2JFMA 4RC2A 3D7TA 1JWHA 4MQ2A 4X2FA 4HPTE 4O0TA 4EOQA 1TFFA 1ZYCA 4DLIA 3ZSIA 5HI2A 2GFSA 3PVWA 1V1KA 1PW2A 3WYXA 3A8WA 4ENXA 5LWNA 1XR1A 4E1ZA 2PU8A 5K0KA 4NKSA 3QTQA 4O91A 4BGGA 3E8EA 4DFZE 3Q4ZA 3W32A 2CKOA 4ZZNA 5BVEA 2WNTA 1YOJA 4PY1A 1Q8YA 1OM1A 4WO5A 4XYFA 5IA2A 5J7BA 4R8QA 4OW8A 2WGJA 3HDNA 4I5CA 1TQIA 3ELJA 3B8QA 4XG3A 4ZSJA 4F6WA 3E93A 4DHJA 4LQMA 4FSNA 3TM0A 5CI6A 2XIKA 4FT0A 4AE6A 1U54B 2HXLA 1M2PA 1OPJA 4XEYA 5HO6A 2YJRA 2BTRA 5AP6A 2ITVA 2FSMX 2FGIA 2YIXA 3MFSA 3F3VA 4GFGA 3GC7A 4Q5EA 4QRCA 4KRCA 4YTFA 2R7IA 5HZNA 4EH2A 4FT5A 2QOHA 4GT4A 4JNWA 1KOBA 3ZUVA 5CLPA 1O9UA 4Y8DA 3PVGA 3QFVA 4FEXA 1SNXA 3AC3A 3F3UA 3BV2A 4CV9A 2R3MA 3GC0A 4O1OA 4OLIA 4RPVA 2GS6A 4AW1A 3UVRA 3TDWA 4ANOA 1OKWA 5E7RA 3LXPA 4D58A 4TY1A 3ZLXA 4GUEA 3ZFXA 1U5RA 2SRCA 4JBOA 4HPUE 2PE0A 3HV5A 4CV8A 2WMVA 3GFEA 3WF8A 3FPQA 5AR2A 3O71A 2P3GX 3Q4TA 2PVKA 4AAAA 2QG5A 2XM8A 4MNEB 5E91A 1O6KA 3RHXA 4KINA 2C4GA 3QQLA 4ONAA 4OTWA 2IEWA 4RZVA 4V0GA 4ZAUA 4OT6A 4BDEA 4S34A 4AXCA 2WTWA 2UW0A 2XJ1A 3H0ZA 5E8SA 5JZJA 3FC1X 4L52A 4EK8A 3D7TB 4A9UA 2QO9A 4BKYA 1OGUA 4CTCA 1HCLA 2HY81 4EWHA 2PUNA 4BJJA 4F7JA 3PFYA 2Z2WA 3IQ7A 3LM0A 3P86A 2QHMA 1LEZA 3KREA 3MV5A 4A9YA 4K0YA 5AUYA 4JBVA 5JRSA 4D1XA 3VHKA 3JUHA 4KS7A 4WOVA 4FV6A 4GL9A 3GOKA 4ZTRA 5J95A 4A4OA 3R9DA 3DBFA 2Q0NA 3D5WA 4C4GA 2QOCA 1REJA 2B54A 5HCZA 1B39A 2YM7A 5CU6A 3W8LA 4YJOA 3S2PA 3I60A 4E26A 5CALA 4EEVA 3DB6A 3EB0A 4YPDA 3DK6A 4OUCA 3TXOA 5ITAA 4OTRA 5TT7A 3FC2A 5L8KA 1WBNA 5IUIA 1JAMA 4C0TA 5ANDA 2R3RA 4FV5A 2J51A 2WMXA 5A46A 2Y4IC 2BTSA 3R8VA 3HRBA 5L8LA 4I6BA 4AGCA 3QCYA 4YNEA 3WILA 4B99A 5A6OA 2QOKA 4RG0A 1M7QA 3HKOA 4DDIA 3MBLA 3IDBA 4DG0E 4JQ8A 4GYGA 5FUTA 3IECA 3FXZA 1QPEA 4DBNA 4U3ZA 4EL9A 3SD0A 4UN0C 3PYYA 4FICA 2BHEA 4J8NA 4C4HA 1PRYA 2FB8A 4ZXTA 4BTJA 5HIEA 2PMLX 4FSUA 3R30A 3NMUF 2ZM4A 5LCKA 4Y95A 2E9UA 4RJ3A 4E73A 1URCA 1R78A 4F4PA 3BYVA 3V6SA 4J97A 4JT3A 2HCKA 3EJ1A 4AXAA 2X81A 2Z7LA 5EW8A 5G6VA 2C1AA 2BZKB 4A7CA 4F9WA 1Q8UA 4N0SA 3P0MA 3UTOA 1J1CA 4MD7E 1JSVA 2UW3A 3HUCA 1UNLA 5AM6A 2CKQA 2WQNA 4FUXA 2IJMA 3PG1A 3BQCA 4I1ZA 2G2FA 3IDCA 4G5PA 3FLWA 4FZ7A 1BX6A 3FUPA 3HUBA 4GW8A 4BTMA 3OTVA 4BICA 3P08A 4FT9A 1YWVA 1XH4A 3PXYA 5CNNA 1OI9A 4F7NA 4FT7A 4F9BA 2BFXA 4IDVA 3EFKA 4RBLA 3LJ1A 3E63A 4GU9A 1OBDA 3R83A 2ITPA 5B7VA 1NY3A 4EJ7A 2OH4A 1FOTA 3FLSA 3ALNA 4G6NA 4JX3A 4KD1A 2X2LA 1PKGA 1OL5A 4BI0A 4KSPA 2GNLA 1UNHA 4USDA 4BHNA 2IO6A 3F66A 3Q2MA 3CD8A 4N6ZA 1H4LA 3ENMA 4FSTA 2IPXA 1R3CA 3FKNA 3SGCA 3W8QA 2Y6OA 4HGLA 4EOLA 5A54A 5E8TA 5CAQA 4R5YA 3WIGA 2I40A 2OIBA 3RALA 3RJCA 3VUIA 2XK7A 5DFPA 4BDKA 1I44A 2F7EE 3DNEA 5CEQA 1ZRZA 3W16A 3JY0A 4QP8A 2XIYA 5TE0A 3CC6A 2BROA 3G9NA 3FMKA 1NW1A 3JR1A 4JQEA 3QTXA 2NP8A 4XV2A 3IS5A 2QONA 1VEBA 4NW6A 3VBXA 3TTIA 4CFNA 1SVGA 2PZIA 1TVOA 5ANGA 4LRKA 3SXSA 4BI2A 3DNDA 2YLEA 1P5EA 2WTIA 5CVHA 5KHXA 5E9EA 2R3LA 5HE1A 4QP9A 2YCSA 3RPYA 1IAHA 4UXQA 4C4EA 2XNBA 4YJVA 5HICA 2HXQA 3RMFA 3F2NA 4FZDB 5IA0A 4ZLOA 2PE1A 3QQHA 3UNZA 5A4EA 3KCKA 1GAGA 4ZY6A 3RP9A 4WG3A 4AAYA 2YM3A 3NR9A 3MH3A 3FL5A 4P4CA 4EOOA 2XZSA 1YWNA 3DU8A 3FZSA 4IAFA 5J7HA 3B8RA 3OW4A 5E8XA 5JMSA 3G0EA 3QWKA 4IJ9A 3HRFA 4JXFA 2ITWA 3A60A 1YWRA 1L8TA 3OCBA 3PSBA 4MXOA 3U6JA 4YTIA 3GUBA 4TN6A 4EYJA 3EN4A 5HG7A 5M07A 5FEEA 2YZLA 4NCTC 5BMSA 2W96B 3UDBA 4CCUA 2X6EA 2ZDTA 4C2VA 4FG8A 3GNIB 3U8WA 3OEFX 3OT3A 4WSYA 3U54A 4QTEA 4JAJA 4FK6A 5EG3A 3C5IA 2JDVA 4EH6A 2YAKA 1CKJA 2J0JA 3BX5A 3FJQE 4UXLA 4FEWA 4F1MA 2PVJA 2YLFA 1H28A 3FAAA 1WBTA 4WKQA 5IA1A 2C0OA 1GIIA 2PVMA 5AM7A 3L8SA 4M69B 2BUJA 1XH8A 1GIHA 5AV2A 5BUIA 3UO5A 4RVKA 4ZK5A 2BKKA 3UDSA 3A7JA 3QKMA 4RFZA 4S2ZA 4C59A 3V5PA 5IQIA 1JBPE 1F3MC 2ONLA 2W1CA 3UVPA 3EFWA 4BBFA 4A9RA 2J50A 3JVSA 3WARA 2BRMA 1E1XA 4EK5A 2YIWA 3I1AA 1FGIA 2GPHA 3PRIA 4IDTA 5AUWA 1ST4A 4CG9A 1WBWA 4EHZA 3T8OA 3DKCA 4JIKA 2OSCA 4RIYB 1XH6A 3RK5A 3RKBA 3NVKI 1JKSA 3QC4A 3E8NA 3ORZA 1FMOE 2XKFA 3POZA 5LVLA 1TQMA 2CGUA 3K3IA 4GT3A 3ZC6A 2X8IA 3OXIA 3MVMA 3IGOA 3DQXA 3QRKA 4U81A 2QODA 2O8YA 2VX0A 1IR3A 3KF7A 2E9VA 3O8PA 4EBVA 4GK4A 1PXIA 3KMWA 5J8IA 5HTIA 4JDKA 2ITQA 4RLLA 4EKKA 3KVWA 2WTCA 3E87A 4ZTMA 3QLGA 3TUBA 1NVRA 3ULZA 4GIIA 4IM0A 4AGUA 4WBBB 1XMLA 3V5JA 3VO3A 2H34A 2OW3A 2YWPA 3O17A 3O96A 4IC7A 3QHWA 5AR8A 4I4FA 3AMYA 2C30A 4UZHA 3BIZA 4CMTA 4MF1A 4ANQA 4CLJA 3S4QA 1OPKA 3BPRA 5K9IA 5GZAA 2O63A 5KZ0A 2VWUA 3DPKA 3PG3A 1T45A 3AGMA 3D0EA 3TG1A 3PUFC 3QYZA 2EUFB 4TNBA 4D55A 4E6CA 2X7OA 3FHIA 4ACCA 3IW6A 3LFQA 4NL0A 1Q3DA 2VV9A 2W1ZA 1DAWA 4QNAA 4XV1A 4YO6A 4D0WA 3EFJA 5CX9A 4O22A 3W0OA 4M14A 4QP3A 1ZMVA 2UVZA 3GP0A 4WRSA 4IVDA 5CXZA 4EHEA 2BR1A 4RJ6A 4CKRA 4MF0A 5M09A 4X3FA 2VTHA 3C9WA 2WQMA 5EM6A 3GQIA 4AT3A 4R6VA 4C35A 4QNYA 4V04A 2H6DA 4W4VA 3NNUA 2UUEA 4UYAA 3ZM4A 3E62A 4CG8A 4UV0A 1UV5A 4IX4A 2YCQA 3KC3A 3BGPA 2QR8A 3HNGA 2B1PA 3W55A 3G5DA 3FMHA 3KXGA 3RCDA 5LMAA 1DAYA 4BGHA 1HCKA 1XH9A 5JGAA 2UZUE 3V6RA 2X0QA 5JFSA 3ZFMA 1YKRA 2IF8A 1ZMWA 4I21A 4OTDA 1YI4A 4R3CA 4MAOA 1KE7A 4GVJA 5FEDA 4RT7A 4E6QA 4NJDA 2X4ZA 2EB3A 5FDXA 3PY3A 4ID7A 3U87A 4J53A 5HIBA 4XOYA 1PXLA 2HZNA 2GNIA 2XNEA 3F5XA 4PMTA 4O27B 4C38A 2C3KA 4L9IA 1X8BA 4CTBA 2LGCA 3KQ7A 3O8TA 5DEWA 4O7RA 5JQ8A 2KTYA 4LMUA 4X3JA 4G5JA 5IQDA 2UVYA 4DTKA 2ESMA 3IKAA 4QEBA 3DFAA 3BBWA 1SVEA 4N6YA 4O2PA 3RWPA 2VWVA 1FVRA 4EOJA 3AT4A 3L9PA 3UE4A 2X7GA 2XARA 3TTJA 1H1RA 3EQCA 1M52A 4RMZA 1BI7A 4UMPA 3F2RA 4PDYA 3G51A 4FUYA 3EH9A 4YTHA 2IW6A 1NVQA 3TI1A 2R3OA 5C03A 4AGWA 4GK3A 3KXNA 4WNOA 3D7ZA 4EORA 1G3NA 2BFYA 2IWIA 5GIOE 3R8MA 2ETMA 2G2IA 5IQGA 3O51A 2BIYA 3EL7A 1Q61A 2XM9A 2VTAA 5HD7A 5BVOA 4U3YA 3R7YA 3W0MA 3TACA 3R63A 3C4EA 4XV9A 4OAUC 4UY9A 5AP0A 3ML1A 3RM7A 5JN2A 1H1WA 4FMQA 4BDFA 5IA5A 4AP7A 2C47A 4RIWB 4KBKA 3DFCB 5DBXA 5E4HA 1ND4A 4IX3A 2XH5A 2YDKA 2R3PA 2J0MB 4HYIA 3TZ7A 2XMYA 5JFVA 2BAJA 4FSMA 5C9CA 4E4XA 5EOLA 5DGZA 2WKMA 3C4CA 4X2JA 4AOJA 3PXQA 4AX8A 1OIUA 5AR5A 3MIYA 3PA4A 4PPAA 3VF9A 3LAUA 4YU2A 4FV3A 3U9CA 2GHMA 4DG3E 2LAVA 4ALWA 3LMIA 1ZY5A 4D2TA 5CANA 3F7WA 1J1BA 4UWYA 3R9NA 4QMPA 1WBSA 3BYSA 3GU4A 4PPCA 3GBZA 5DI1A 1WVWA 4QMQA 5CQWA 3OWJA 3G6HA 1IA9A 5D10A 5E90A 3PA5A 3RPSA 2OZAB 4GUBA 2O3PA 3ZLSA 2OI4X 1W82A 2W1GA 3P7BA 3ZYAA 3AOXA 4G3EA 5IMEA 3P78A 3TMOA 1B6CB 2CGXA 4AOIA 3BGZA 2XAMA 3M11A 2ITTA 1Q4LA 5EW3A 1MQBA 1ZOGA 3HV7A 4RSSA 4ZMFA 4ZTLA 1OITA 1GOLA 2QG7A 4KA3A 4LRMA 2JKQA 2VD5A 2JBOA 2XIXA 4QO9A 3ZO4A 4CXAA 2XYNA 4FYNA 5F9EA 5M56A 5C8MA 3W0PA 4B0GA 3V5QA 5L2IA 1Q3WA 1P4OA 4CLIA 4RQKA 4IVCA 3MGYA 2VX1A 2X0OA 3QGWA 4O96A 3ROYA 3ZS5A 5EDRA 2UZOA 4YC8A 3VBQA 4G16A 4NM3A 5HE3A 4HOKA 1SM2A 4G3DA 5CSWA 1VYZA 2IW9A 1JSUA 3GGFA 5F95A 3UO4A 3P4KA 5KBQA 3I0QA 5FEQA 4BHZA 3U6IA 5K4JA 2HWOA 4XS2A 5CU2A 1YDSE 5EW9A 4P7EA 4P5ZA 3W1FA 2JFLA 2OJFE 5EI6A 4R7HA 4ANMA 3BHHA 3MPAA 5CWZA 3F7ZA 4H1MA 4JBQA 4TWOA 4CYIA 5HLWA 2QC6A 3D14A 3IW7A 4MXYA 4I0RA 3W18A 4AWIA 4BF2A 3NUNA 4D2WA 3FYKX 4IB3A 3FPMA 4D4VA 3QA0A 3UG1A 3EN9A 1A48A 5KUPA 4EK4A 4HW7A 2HW6A 2F7XE 2OJ9A 3Q9WA 4IFGA 4XH6A 4CSVA 4EH5A 4FIEA 4FTUA 5L2TA 2A98A 5HKMA 4CFFA 4K8AA 4PUZA 5E8VA 5I3RA 2GNHA 3DAEA 5I9UA 4E5BA 3EFLA 2UZBA 3DCVA 1K2PA 3NUXA 4YLKA 2YJSA 4YJTA 5D11A 5ANIA 2NO3A 2I6LA 3RPRA 5M51A 3EKKA 3PVBA 3QCSA 4L53A 4AF3A 5C4LA 3GU7A 4ZZMA 5LVOA 3LXNA 4FKPA 1PXJA 2B53A 4C8BA 5DE2A 2UZTA 2CDZA 5KMIA 2CNUA 3EQGA 4CZUA 2WU7A 3BYMA 3P7CA 4U43A 1VJYA 4O7NA 3HVCA 3LFNA 4FKRA 3FQEA 3PFQA 1BUHA 3V04A 3V8WA 2W4OA 2Y6MA 4LGGA 4TYJA 4RX5A 5EI2A 3DBEA 3R8UA 4ITJA 3UP2A 5JT2A 3BU5A 4I6LA 4APPA 2ONLC 2OFVA 3I5ZA 1J91A 4O1PA 1Q5KA 1K3AA 4FKTA 4D5HA 1YXTA 4W8DA 3G2FA 2J0IA 3PZEA 2WQEA 4F99A 2JD5A 3W2RA 4YO4A 5M08A 3NSZA 5CT7A 2QU6A 4BIBA 3GENA 4ZSEA 2WQBA 4LUDA 3C4FA 3W0RA 3I7BA 4WIHA 4QQCA 5EH0A 3E5AA 3TV6A 5BX0A 4MHAA 4RA4A 5IUGA 2IZUA 2YACA 2J4ZA 3MS9A 3KRRA 1W83A 4G6LA 1UWJA 3TIYA 4BCJA 4LI5A 4OTIA 5HCXA 1OBGA 4XP3A 2CCIA 3QA8A 4TYHB 5KMLA 4U40A 2AC3A 2B9HA 4NH1A 1MP8A 4GRBA 4PMSA 2JKKA 2NPQA 3DTWA 3E7OA 3EKNA 3RZBA 2OJGA 4RGJA 1KV1A 3ULIA 3C51A 3ET7A 3G9LX 4BCPA 2RGPA 4F1TA 3ETAA 2Y4IB 2P2HA 4H36A 4QP1A 3ORXA 4O7ZA 4DHIB 3PLSA 3LLTA 1R39A 4FSRA 1W84A 2XUUA 4KBCA 1UWHA 4UALA 3VUHA 3M1SA 2ERZE 4BZOA 5C01A 3LW0A 4M68A 5CNOA 5DT3A 4F08A 2UW8A 3MTLA 4MD8E 1YDRE 4J52A 3KL8A 5FXRA 3OXTA 3TNWA 4EOPA 4XX9A 2B4SB 4PL5A 1WVYA 2C5YA 5CU3A 4EYMA 4FSQA 4JQ7A 4EUUA 3OBJA 3QTUA 3UZPA 4TL0A 3WBLA 2DQ7X 2XEYA 4HYUA 4AOTA 3NFGB 1H1QA 3HMPA 1OGYA 2NYAA 3QXOA 3AKKA 4I6QA 1TZDA 4I22A 3Q9YA 3KMMA 4JG6A 3FY2A 4X3FC 4ASZA 5HBHA 4YJUA 5ETAA 4XP2A 2X4FA 1PXOA 2HELA 2W4JA 3F5UA 4TYEA 5DH3A 3ZMMA 4NYEA 4Y5QA 2YIYA 4L42A 4QYEA 4RFMA 4Y83A 2AEGA 3L9MA 3HMIA 2PVLA 2YCFA 3HV3A 4IEBA 3T3VA 4RJ7A 3QU0A 3S1HA 2YERA 3NYNA 3ORIA 4I6HA 3DJ5A 4MVFA 4AN9A 4C4FA 4ZS0A 1OECA 4Z16A 2XIRA 3VRYA 3GXLA 2DS1A 4DC2A 3F2AA 2IVUA 4EZ7A 4OTGA 2YM4A 1PHKA 3VUDA 3SAYA 2F2CB 1W7HA 2GSFA 2PVRA 4G3GA 4WNMA 4PMPA 3P79A 4M3QA 2ITXA 4A9SA 1F5QA 2C5XA 2Y9QA 2JKOA 3NW7A 4PPBA 3FV8A 5M57A 1U59A 3C0IA 1I09A 4K1BA 2UZLA 4HVDA 3MJ1A 2XJ2A 4AQKA 3A2CA 3UOHA 1CMKE 3KGAA 3FSFA 4NEUA 1Q8WA 4YZBA 4ZY5A 2HOGA 1P4FA 4EZ3A 3GCSA 5GJFA 3VS7A 3TN8A 4AXDA 5LMKA 4KIOA 1UU3A 2JAVA 5F94A 3WF6A 3ITZA 3NYOA 5BVWA 3RVGA 3KRLA 3COHA 3E3BX 4FIFA 4G3CA 4CCBA 3VS0A 4FEVA 4K77A 3UZTA 2VTLA 2E9PA 1YXUA 3KCFA 4JR7A 2GFCA 3R21A 4Y46A 4W4XA 5E92A 2W9ZB 2XA4A 4O7VA 4U6RA 3S3IA 4QYHA 2C6MA 2QI8A 3QRIA 2R3GA 3CP9A 2YDJA 4LYNA 3V01A 4GJ3A 2W05A 5TF9A 4AA5A 4F65A 4ZSAA 4JRNA 5L6OA 2GNGA 2B0QA 1WCCA 4KNBA 3QL8A 3VNTA 4JJRA 4LGDA 1ZYJA 4K2RA 3UOLA 4DHFA 4XHKB 3UDZA 4BR3A 2QNJA 4O4CA 5CEKA 3PXFA 1IASA 2PZPA 3ZDUA 2VO6A 4J1RA 1IAJA 4L43A 3LFCA 4GV1A 3AQVA