2JKKA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
258
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 82
structure length 258
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkkA01
3KVXA 1WBVA 1WMKA 2W1GA 3QCSA 1M2QA 4F64A 4YZNA 4GJ2A 3S4QA 5C8MA 4AS0A 5LMKC 4BB4A 4RVLA 4LUDA 3GUBA 5HLNA 4P7EA 4G31A 4EH5A 4LQMA 2YM8A 4F6SA 5IUGA 5ANKA 3OT3A 4G17A 1GIJA 5D9HA 5DLSA 4A9TA 2P2IA 5J9YA 4C37A 5TT7A 2G2HA 4FSZA 4C34A 4QPAA 4TWPA 4V0GA 3KF7A 5IDPA 2GDOA 5D7VA 2I40A 3BEGA 3OCSA 4DGLC 3FJQE 3TZ9A 3UP7A 4OTDA 2XIZA 5TO8A 4E6AA 3JVSA 5HEZA 3VUGA 1OPLA 4QMLA 2Y4IB 3FXZA 2XIRA 5CXZA 2V22A 4RT7A 4EOOA 3OF0A 1YI6A 4J97A 4QP4A 4PF4A 2BKZA 2HZ4A 3L1SA 3EZRA 3C50A 4KBCA 3U54A 1L3RE 3Q3BA 3QTXA 5CU2A 3SLSA 2PPQA 1AQ1A 1DAYA 2JDRA 1WVWA 4ZSEA 3RCDA 2C6IA 4FEQA 4ANNA 2HW6A 5E1EA 1SYKA 3LMIA 4YC8A 5TR6A 4ZEGA 1H0WA 3MDYA 3HA8A 3LFAA 2OSCA 2QLUA 1W84A 2P55A 3QRUA 4C4HA 3BGZA 4IX5A 1WZYA 2HWPA 1S9IA 1FVTA 1KV1A 2RL5A 2VWYA 2W9ZB 4IZ7A 1JBPE 5L8JA 4BGHA 2FSTX 2QHNA 2ERZE 4O7ZA 4KIKB 5IQGA 2E9VA 4RIOA 1H4LA 3FC1X 4CFMA 4ARKA 5D1JA 2IN6A 4N6YA 5CEQA 4FODA 5EG3A 5FXSA 4FT0A 1QCFA 4QQ5A 4F0IA 4O81A 3KXNA 4CV8A 2C30A 3U51A 4FIGA 4UB7A 4HVHA 1KOAA 1OUKA 1LEWA 4O6LA 4BCNA 2IO6A 2GSFA 5HU9A 5E1SA 2Y4PA 2JKKA 4JQEA 2ZM4A 5CANA 2YERA 3L8XA 3HGKA 2P33A 3QRTA 5IUHA 4QT1A 3IDCA 4QMVA 3FSKA 5LCJA 4D2RA 2W5BA 5EW8A 3R21A 5TF9A 4QMMA 4CKIA 4GVAA 3P86A 3R9OA 3F88A 4NYEA 4HPTE 4IC8A 3VUMA 2OW3A 4FKWA 1M17A 3LAUA 2ITPA 2HXLA 4A4XA 5JZNA 3FKOA 4LMNA 5HG8A 4AW2A 4U9AA 4XG7A 3EKKA 3MPMA 4JIKA 2QR7A 4O21A 5EYKA 3ORXA 5AUUA 2J90A 4OTGA 3NLBA 4FZAB 5E8VA 1U4DA 3DAKA 4MBLA 2ZV9A 3WF5A 4DHFA 3Q4CA 4YZCA 3TDWA 2WPAA 4IMYA 3EN9A 3V5WA 4WIHA 1OECA 3D15A 3VQHA 2X2KA 2JEDA 1M52A 2VRXA 3IONA 4IZAA 3GQIA 3U9NA 4ZY4A 4NKAA 5CEIA 4LV8A 4Y72A 5FM3A 2F49A 1W7HA 3NUPA 3JS2A 4RA5A 4DGGA 5D7AA 3FI8A 4M3QA 2VX0A 3DS6A 3PSDA 4YLJA 2OIBA 5C8NA 2Z7QA 1R1WA 4R3CA 4EK6A 1VJYA 5IISA 3TG1A 4EQMA 4D55A 4KIPA 3QGYA 5EDRA 5M4FA 4L67A 4RJ4A 2VWUA 2V5QA 3CQUA 4FYNA 4P4CA 3ZO1A 3CGFA 2PY3A 4IDVA 4O2ZA 4PMSA 2PL0A 2WMRA 3TEIA 3Q5ZA 3C4WA 2AYPA 2F7XE 4EH6A 2W96B 4MKCA 3IG7A 4WNKA 4BKZA 5CAQA 3RWPA 3H9RA 3Q4ZA 4QMTA 2VGOA 1F0QA 4ZS4A 3N4UA 4YHTA 3FI3A 4FSTA 3JUHA 2WEIA 4LRJA 2CLQA 3LFEA 4CTCA 3LQ3A 4TWOA 1URWA 3ROCA 2HCKA 3G9NA 1BX6A 1NVQA 3D5VA 3PSCA 4ZS0A 1JSTA 5JEBA 2X4ZA 1OM1A 5C8KA 5HU3A 5AUZA 3Q04A 5CY3A 4O0UA 3VC4A 2OJIA 4EL9A 3WILA 2X0GA 4QYEA 2F9GA 3A7IA 2F7EE 3FL4A 3PIXA 4BBEA 2XMYA 4V05A 1RQQA 5HNIX 4RSSA 3NX8A 2I0VA 5EI6A 2JKMA 1EH4A 2BFYA 2WGJA 4B99A 4ENXA 4YU2A 5KMJA 2UZNA 3E7VA 1YKRA 4D9UA 2O3PA 3SXFA 3WZJA 3UOJA 4O91A 5DWRA 3TM0A 1YDSE 4F6UA 2B7AA 5EKNA 4NIFB 4D0XA 4C4GA 4OBOA 3HRBA 5CQUA 1UA2A 5IEYA 4J53A 2ITNA 4X3FC 3CR0A 3DBDA 2WMBA 2J0KA 3EFWA 2PTKA 4HYSA 3AC3A 2FVDA 3C0HA 4JBQA 2YWPA 1JSUA 3PE1A 3RGFA 3C51A 2IVVA 4AN2A 3PP1A 4ACHA 4YPSA 3E88A 4U3YA 3TKHA 4JIAA 3HMPA 2O0UA 3ZM4A 3ZOSA 3DQWA 4YJQA 3TWJA 4G3GA 4O0WA 4FVRA 4TPTA 4MVFA 4ZTLA 4AE6A 4FSQA 2IZRA 5ETCA 3B2WA 3LFNA 4AX8A 1W0XC 3W8QA 1G8AA 5AX9A 3QQUA 2PYWA 1JKSA 3ZC5A 2C6LA 5IA4A 3UMWA 4E6QA 2I6LA 3MYGA 4J8MA 2ONLA 4F65A 3E87A 2PUUA 3DK3A 3P08A 4NCTA 4ANMA 3II5A 4ZSLA 1Y6AA 2G2FA 3IGOA 3PIYA 4QO9A 5EYCA 3VUIA 5L2IA 4JOAA 5J9LA 4M0YA 3ORKA 3UNJA 2VTOA 1WBWA 5HD4A 4MQ1A 3EN6A 2UW6A 4M97A 4E1ZA 2ZOQA 1YI4A 3RPYA 1ZMVA 4ACMA 5FTOA 4DITA 2R3LA 3O71A 5DN3A 2BVAA 1T46A 3R2YA 3VBWA 3HV3A 2BROA 2UV2A 3WE4A 2VWVA 2XIKA 5GZ9A 4U81A 1SNXA 2B1PA 5HE2A 4DLIA 4MXAA 4R77A 5HLWA 3P79A 1CKPA 4EK4A 5LVOA 2VNYA 5B2KA 5HI2A 2UW0A 3TACA 3U8WA 4F7LA 5EYMA 3MY5A 4QMWA 4IACA 4X6QC 4AGCA 4EOLA 1PY5A 3HV6A 3DXPA 4O7VA 3MH2A 4KB8A 4IM2A 4QNYA 5DR2A 3FDNA 2H9VA 4I5MA 3SRVB 3BYSA 1XH9A 2PZRA 3TNWA 4EQUA 3RPOA 4DFUA 3DTWA 3NCGA 3L8SA 4IAFA 3SOAA 4OTFA 3MVHA 3D5WA 4WG5A 3QQFA 3KXGA 4XUFA 2O8YA 5CNNA 5D12A 3RAIA 3UNZA 2X2LA 4ZOGA 2BTRA 4BDHA 4WBBB 2O64A 3WF9A 4I94A 4E4LA 2PMNX 2EWAA 4O22A 3W18A 4Q2AA 2XVDA 4XV2A 5L3AA 3DB8A 4XEYA 4ANLA 3PP0A 3P0MA 1OIUA 3HV5A 5BX0A 1WBSA 3QQHA 2XJ0A 5HTCA 4FKLA 4CMUA 4FKOA 3WIGA 3ZMMA 4RA4A 4FSRA 5DHJA 3FQSA 3MTLA 5FGKA 3QZIA 3BV2A 3F69A 3UIBA 3C5UA 3DDQA 4IM0A 4AT5A 4F0FA 2VWXA 3FMLA 3RK5A 2UVYA 4R8QA 4FTNA 2WMTA 2R64A 5AAEA 5I3OA 3PXQA 5AR7A 4QQTA 4RBLA 4FSMA 4HZRA 2UZDA 1U5QA 1Q8TA 1OPJA 3M11A 2C6KA 4WSYA 3G51A 4EZ5A 3BU6A 1OL2A 2XYUA 2J0MB 2JDTA 3P7CA 5M4IA 2XS0A 4FI1A 5EI2A 4ZTRA 5IQCA 5JFSA 4BCKA 3R0TA 2P3GX 3H30A 3FLYA 2X39A 1FVRA 2R3HA 4JX7A 5AJQA 3R1NA 3SD0A 4FKJA 4ZJIA 5JFWA 3WE8A 5LVNA 2QNJA 3A61A 3G6GA 3O8UA 3R7OA 4NL0A 3DY7A 1MRUA 3QRIA 5ICPA 2JITA 4L7SA 3HAMA 4CG9A 3EQCA 4KAOA 3QX4A 5M51A 4BDIA 3NUAA 5CVFA 5KKRB 4TNBA 3PLSA 4G5JA 1RW8A 4GT4A 4MAOA 3K2LA 1ZYSA 4AP7A 4O1PA 2Z2WA 3SKCA 3DLZA 3UC4A 4A4LA 4YJOA 4DFYA 5EKOA 3V5PA 4FEVA 1BL7A 5A4QA 2PMIA 4EEVA 4IB1A 2WZJA 2YJSA 3S00A 4OTIA 3ATSA 2B55A 4X21A 5K9IA 2HENA 4NUSA 3PPZA 4UXLA 1H24A 3R04A 2ZAZA 2YWVA 1OI9A 4N6ZA 1OITA 1IEPA 3SG8A 2YAKA 4BIBA 5KO1A 3TDVA 3TZ7A 3ZXZA 3R73A 4BGGA 2BALA 3LCKA 3FI2A 4RC2A 2XUUA 3MGYA 4IB5A 4FSWA 4MXXA 4AXAA 2CGVA 4FL2A 1PKDA 3ZZEA 3MIAA 5HO6A 4ANOA 4F7NA 2C5VA 3MFRA 1ZMUA 4J7BA 3POOA 4F70A 1VZOA 1JAMA 4GT3A 2XCHA 4QP8A 3TL8A 4M69A 4JBOA 5HESA 2BKKA 1FPUA 2X8DA 5EM6A 5K4IA 4USEA 4EC8A 3BX5A 3FMHA 4L00A 1ND4A 2YIYA 4KUJA 5BVNA 3VHKA 5DOSA 4WG3A 4LRKA 5AV0A 2GQSA 4BKYA 2J0JA 5A6OA 1APME 2EB2A 3GFWA 4X2NA 1ERKA 5LMAA 1OBDA 1R39A 4GJ3A 1OKYA 2I0EA 2UUEA 3KB7A 1IA9A 4ID7A 5LWMA 4DFNA 3QQJA 4KWPA 4RIXA 3LFSA 4RZVA 2XNPA 4BR3A 4BVUA 2WTCA 5A3XA 2GNFA 4PY1A 4XG8A 4MNFA 2B4SB 5DFPA 4FK6A 1NA7A 4XG9A 3G0FA 1T45A 5JT2A 4NSTA 2CPKE 5LQFA 5CASA 2CKEA 2W1ZA 2ZM1A 3QKMA 3MTFA 5H9BA 4L3JA 5M55A 3VNTA 2YM6A 4G9CA 4BBMA 2HYYA 3H4JA 4I41A 3VN9A 4CD0A 4DCAA 3PVGA 4WRSA 2WNTA 4QP1A 1W98A 4RLKA 2PVJA 5CALA 3QTUA 5FDPA 2VTSA 2XA4A 4NM5A 4E6CA 2C1AA 3OOMA 2IW9A 4KINA 3AOXA 5LXMA 2IPXA 3BGQA 3P7BA 3R1SA 4AWIA 3F5XA 4M12A 3ZTXA 3SOCA 5IQIA 2XKFA 4FV6A 2BIYA 1OIRA 2ZV8A 4E4MA 4BBFA 4X2JA 3NSZA 4IE9A 3I1AA 3ZONA 4L42A 4YNOA 1J3HA 3GU7A 1Q3DA 5EW9A 3MH1A 2ITQA 4K8AA 5HLPA 3P4KA 4DGOA 4YLKA 2B9JA 3LCOA 4S33A 3F2RA 4GMYA 4NT4A 4L8MA 1GAGA 4FKRA 1NXKA 4PMPA 3D5UA 3N4VA 5HX6A 1Y57A 3K3IA 4Y73A 2XNNA 4AZVA 2C5XA 4D1XA 2YHVA 3DOGA 3BE2A 3ZO4A 4IAIA 4O84A 2WOUA 1ZXEA 2Z7RA 3E62A 4DT8A 1LPUA 3QFVA 4FUYA 5J87A 3CKWA 4RQVA 2B9HA 5AR2A 3Q32A 2JLDA 4GS6A 5CEKA 3W2SA 4JT3A 2RFNA 4NM7A 2IW8A 5L8LA 3DXNA 4BCJA 4U0IA 4QYFA 1MRYA 1BI8A 4QMSA 4YJSA 4Q9ZA 4QP9A 4L6QA 5IA1A 1GY3A 1PXNA 4XV9A 2ZDUA 3GXLA 3RPRA 4LUEA 1J7LA 3LFFA 2B9FA 5LWNA 2PVNA 3JR1A 2AC5A 1ZRZA 4ZP5A 1JLUE 5HG5A 5KX8A 4HNFA 4IHPA 3EMGA 1XWSA 4NW6A 2G2IA 1XBAA 2JAMA 2WIHA 4G9RA 5DG5A 2VTQA 3WZUA 4CGAA 2HW7A 2WEVA 3LJ2A 4YZDA 1NVRA 4L01A 2BRNA 2G1TA 2JAVA 3R1QA 4GYGA 3ERKA 4V04A 5F20A 4GU9A 4Z7GA 1MQ4A 5IA5A 2E2BA 3HV7A 3MFTA 4ZZMA 1REJA 3KXXA 2GHMA 2AUHA 4HYIA 3SRVA 1R3CA 1OKWA 4YZ9A 4U8ZA 4BWPA 5JFXA 4FEXA 5J79A 3PRIA 2RF9A 3NS9A 4QQCA 3PG1A 4YMJA 3QZFA 5ACKA 3QWKA 4HJOA 5I5ZA 1Y8GA 5HIDA 3OOGA 4DFBA 2XIYA 4QMQA 2OH0E 2PUPA 3F6XA 4MWHA 3CXWA 4O2PA 2YCSA 4KABA 2J4ZA 3ZLSA 3MI9A 4IZYA 4AA0A 2GNJA 3TV4A 3CLYA 3CQWA 3G2FA 1H1PA 4MYGA 3MW1A 3VBQA 2WMXA 2X8EA 3EQPA 4K77A 4KKGA 1JOWB 3E3PA 1JQHA 3DGKA 3ZYAA 4F09A 3ID6C 3NIZA 3D7TA 4FGRA 4FV7A 3E63A 2PVRA 3ZO3A 5FBNC 4JBPA 4ACGA 1FMKA 3EQRA 4X6RA 4YUQA 5KZIA 3KVWA 2IVTA 4IM3A 4CT1A 1U46A 4AOTA 3NZ0A 5ANGA 4E5BA 2EXCX 2QU6A 3MY1A 4FTOA 4MCVA 5EK7A 3F3WA 2BTSA 1HCLA 4D4RA 3BBWA 4YTIA 4BDKA 3VUTA 1S9JA 2ETKA 4UXQA 2FSOX 4H1JA 3RAKA 3R7GA 4K9YA 4EI4A 1Q5KA 4RG0A 2E9NA 3PVUA 3C9WA 3ZHPC 1VYWA 2YJRA 5HGIA 3KQ7A 1H08A 2YZLA 5B2MA 3A7JA 3TNIA 3S0OA 3TIYA 1J1CA 4I6FA 3HV4A 2PE1A 5GHVA 2VAGA 4ITJA 4UBAA 3KN6A 5B7VA 2QI8A 3BEAA 3WZDA 4F63A 5EM5A 5LVPA 4EH2A 4ZY5A 3NNVA 3Q2JA 2EXEA 4L3PA 4CZTA 1FGIA 4R6VA 2B53A 5BUJA 2BRGA 3GB2A 3BHYA 3P5KA 4DTBA 3F2AA 5JH6A 2GS2A 4KBAA 4NM3A 3ANRA 5CU4A 2HAKA 3P9JA 5BMSA 4MBIA 4CV9A 2ZB0A 4MNEB 3V5QA 1FVVA 2XKEA 3EHAA 4ACCA 4MK0A 3F2NA 3UBDA 3ODZX 5FP5A 4AW0A 4AW5A 2YM7A 3FQEA 3OXIA 3DZOA 4MBJA 5HNBA 2FYSA 2UVZA 3H0ZA 2V0DA 2HZ0A 2GS7A 1WFCA 4AOJA 5JZJA 4GUEA 4O0YA 3AMBA 4ASDA 3KN5A 1HCKA 4PTGA 5D41A 4AT4A 2WO6A 4WRGA 5GJGA 4BI2A 3GC9A 4EQCA 4Q5HA 4AAAA 3FMMA 3F5PA 1R0PA 2BRMA 2QOOA 2XK4A 4I4FA 4IB3A 2IJMA 3UOKA 4H36A 4TT7A 4QOXA 3SW7A 4UY9A 4OAVB 3RTPA 2H34A 3L9PA 4CVAA 4JR7A 2BZKB 4MTAA 3OTVA 4YSMA 1OPKA 3BKBA 3F66A 5CI6A 4CKJA 5AA8A 3H10A 3A7FA 2P4IA 2RFEA 3Q6WA 3W33A 1KE7A 2ZVAA 5AM7A 4FTQA 1XO2B 1ZOEA 2ACXA 4FVQA 4U44A 3R8LA 4CZUA 1M14A 4K1BA 2C6DA 5KE0A 3VS1A 1Q4LA 3VUDA 1IAHA 3LLAA 5E8UA 4EUTA 4RX7A 2ONLC 4A9SA 2XIXA 3TZMA 4AUAA 4ZMEA 1PXPA 3ZH8A 4RJ7A 2XNGA 4HYHA 3GC7A 4EOJA 4EWHA 2VTNA 5GZ8A 3LQ5A 5AP3A 3IKAA 4PV0A 4USDA 4K18A 4CYJA 4DFZE 4RWKA 4EK3A 5I9WA 3NDMA 3PA3A 4FV8A 4QPMA 5CS6A 4KS8A 4BDCA 3O8TA 3BIZA 3PVBA 3QALE 1Q8ZA 2CGUA 4OBQA 2CN5A 2W1IA 4MX9A 3QTSA 1YWNA 2YIWA 4ZSGA 3W1FA 4CNHA 4NZWB 3RMFA 4IADA 4A07A 2UZTA 5T68A 1JKKA 1GZ8A 4BGQA 3LQ8A 3KRXA 3MPTA 4F1OA 5AAGA 2HELA 4A9YA 1Q24A 5CAOA 4BCOA 3SAYA 3TZ8A 4YBJA 5AEPA 4X0MA 4CFWA 4EC9A 5DT3A 2OWBA 4WG4A 5KNJA 4CFXA 1BKXA 3R8ZA 5A4EA 3D2IA 3KF4A 1WVYA 4CFNA 4DA5A 4O27B 4U80A 4E6DA 4LGHA 2BPMA 2R3GA 5HX8A 3PDTA 2PE0A 3IW7A 4UWBA 1NVSA 3F7WA 2VO0A 5I4NA 2NO3A 2R3QA 2W7XA 4PNKA 3W2PA 4FEUA 4FNYA 4ALUA 1A06A 2C6OA 1AD5A 2W4KA 3MB6A 3F3VA 3QD3A 3PJ3A 4RGJA 5TE0A 2FSLX 2VO3A 1UU9A 3DJ6A 3MY0A 4LOPA 2WELA 2XM9A 4ASEA 4C2VA 2XJ2A 2O63A 2OH4A 4FTUA 4AZSA 2BAQA 3ORMA 3I0QA 3OEZA 3ORTA 5AIRA 2VTHA 4O96A 4Z9LA 3QBNA 3PXRA 4RX8A 5ACBC 4A9RA 4B4LA 2ZV2A 3VVHA 2XCKA 3GCUA 2UVXA 1FMOE 4G3EA 3FYKX 4EH9A 3BHUA 3OEFX 1ZYJA 1GNGA 4TYGA 1UWHA 3OD6X 5K3YA 4EOIA 1Q41A 3R83A 3MWUA 4ZY6A 1FOTA 4EH3A 4JG7A 4IX3A 3CCNA 4E20A 2VGPA 4YSJA 4O0TA 2FUMA 3NGAA 4JG6A 4YO6A 3V5JA 3AC4A 3BV3A 4BIEA 5J5TA 2VNWA 2R3RA 3O96A 5IZFA 3TIZA 1JNKA 2YDIA 1SM2A 3K3JA 3KRJA 4FKUA 3ZRLA 3DT1A 3ORNA 4BF2A 5K4JA 3R8UA 4GFMA 5AP5A 2H6DA 5KMKA 1JPAA 1I44A 5CNOA 5AFVA 5LVMA 4BTFA 4WKQA 1Q3WA 2QG5A 4JDIA 4OTQA 2WQMA 3QD4A 4QMPA 1KSWA 4PRJA 1PYXA 3EKNA 3FKNA 2RIOA 3FMJA 3KGAA 3FZRA 4AFJA 4DEAA 2GQRA 1H1RA 5FXRA 3TJDA 3L9LA 2VTRA 3QAME 5M57A 2R3OA 5FQDC 2F2UA 1UKIA 2BZIB 2WTVA 4FZFB 3IW4A 4L9IA 2OI4X 4V0GB 4E5AX 5C26A 3FYJX 5L6OA 4PPAA 3CP9A 2OFUA 4MF1A 4IEBA 4PX6A 3NNUA 4I1ZA 3A2CA 2H8HA 4AFEA 5IQAA 3AGLA 5EOLA 4RWIA 2R4BA 2CHLA 4DH7A 3PRFA 1CM8A 1RE8A 1XR1A 3HMOA 1SVEA 3FZTA 5FEDA 4C57A 4D2SA 2BAJA 2C3LA 2VTPA 4FK3A 3F61A 3I7CA 4PP9A 4QNAA 3ZUTA 5J1VA 3P1AA 2UZEA 3GBZA 3LXLA 3GU4A 1XH6A 3LIJA 5J95A 4E4NA 4EJNA 3QRKA 1ZARA 2W5AA 3G6HA 4MD9E 4C2WA 3NR9A 4O7LA 3MIYA 3RHKA 3UG1A 1VR2A 3DFAA 4EOMA 4R7HA 4GU6A 4NW5A 5E8ZA 2ETRA 2XNBA 5HVKA 2WU6A 4AG8A 4E5WA 3GFEA 4JI9A 4PMMA 5M56A 3OUNB 4BDBA 3QXOA 4F1TA 5IH5A 5HG9A 5CSXA 2Y9QA 3QYWA 4Q5EA 2JIUA 3FZOA 4BI1A 4BZNA 4ZTNA 3H3CA 4JBVA 4WOVA 4N57A 4DH5A 5ETFA 3ZC6A 4BZOA 3LCTA 1V0OA 3MSSA 3CD3A 4FX3A 4Y8DA 4KIKA 5HOAA 4KIOA 3GEQA 4IH8A 4MQ2A 4RLLA 5CTPA 4HYUA 4NTTA 4L7FA 3L9MA 5CLPA 1XH7A 2QHMA 4C33A 4RZWA 1FGKA 2RFSA 4BY9E 4U40A 4DEHA 4TYEA 5CSWA 2C68A 2VWBA 2ITOA 3MA3A 5AIKA 4BDDA 5EDPA 1P5EA 4R5SA 4XG2A 3RK9A 4FT3A 2J51A 3ZEWA 1RDQE 5KMLA 1UKHA 4GIIA 3KEXA 3LFBA 4TWNA 4Y95A 3ZBFA 1P14A 2REIA 3GP0A 2QR8A 4B8MA 3FY0A 4N4SA 4UN0C 2WMUA 3PIZA 4W4YA 4Y46A 4NKSA 5ETAA 1BMKA 3LKMA 4UEUA 3U6HA 3OCTA 2Z7LA 4EH7A 4PP7A 5F94A 3ITZA 3TNQB 1U59A 3V51A 3VW8A 1Z57A 4L3LA 1VYZA 1PMNA 3AD5A 3DK7A 2NP8A 3OWJA 3AMAA 5L6PA 1REKA 4FTTA 1B6CB 4M66A 1JWHA 3WF8A 4LGDA 5K0KA 2P0CA 4KKEA 2YZAA 1Y8YA 1PW2A 1Z9XA 2YM3A 2XK7A 4EKLA 5AV2A 2Y4IC 5CAVA 4U7ZA 3VJOA 3QL8A 2G9XA 2E9UA 4W8DA 3IPHA 2VD5A 1URCA 3BYOA 3HEGA 4TRLA 2Q0NA 5GZAA 3CY2A 1Q99A 3KULB 2JIIA 3TTIA 5ANIA 3ZUUA 3NIEA 4HZSA 3KRLA 4CCBA 4FIEA 3BYUA 3O51A 4FV0A 4GH2A 2EUFB 2Y0AA 3R9HA 3UYTA 2HY0A 4A9UA 5AP0A 2OF2A 4JDKA 5HICA 3ZLXA 4D1ZA 5BVEA 2DUVA 3FV8A 2ETMA 3GENA 5DEWA 3EYHA 5AR3A 3Q2MA 1Y6BA 3W10A 4DBNA 2JGZA 2X7GA 5AWMA 3NRMA 5J7BA 4I6BA 4AA4A 4D5KA 2W4JA 1YRPA 1GZNA 2V7OA 2PSQA 4PNIA 5TOZA 4C02A 3F5GA 4JAJA 4XX9A 3UQCA 2IZTA 3FPMA 3CJFA 4ASXA 2W06A 5J8IA 4BFMA 3AD4A 4NM0A 1XQZA 3OP5A 4YJRA 2R3PA 4F9CA 4K6ZA 4TWCA 1KUTA 2QO9A 4J71A 5FTGA 1YXXA 2CCIA 4AOIA 3UPZA 5LCKA 4A4OA 4O7YA 2UW9A 2PMOX 3VQUA 2R7BA 3ODYX 3QWJA 2O5KA 1O6YA 4AACA 4C61A 5CU3A 2CKOA 4HCTA 1Q8WA 3C1XA 4RX5A 3RBWA 4DEGA 4U42A 3PVWA 3IDPA 4CRLA 2B0QA 3H0YA 1CTPE 4HVGA 2VX3A 2JIVA 5I0BA 3BHTA 2QKWB 3N51A 5M53A 3V04A 3R6XA 3MVJA 1Q8YA 4F9BA 3CIKA 4RVMA 1DS5A 4O83A 3NVKI 5AMNA 2I1MA 4WSQA 5H8BA 5AR8A 3EH9A 2XH5A 4WNMA 5E91A 4FICA 3UE4A 2YIXA 3FHRA 4QYYA 3PYYA 5DPVA 3TN8A 3HAVA 2A4LA 4FOBA 5FLFA 1B39A 4RPVA 1ZY4A 3ZBXA 4BL1A 4D4SA 4F9WA 5DNRA 3NEWA 1IG1A 3VS0A 3HDMA 4O86A 2GNHA 3DJ7A 3I81A 3V8SA 2J50A 3VF9A 2PZPA 3VS5A 3FMNA 2QOHA 4RRVA 4DH8A 4U3ZA 4BDJA 2VV9A 4Y85A 1SNUA 1QPCA 4JQ7A 5EHOA 4NU1A 5I9VA 3BWFA 3KU2A 4GK3A 4IB0A 3FPQA 5M44A 3UO4A 2ZB1A 5D11A 4RC3A 4MNEA 5I9ZA 3LXKA 3V8TA 4TYHB 5IF1A 2GFCA 1G5SA 4U43A 3FQHA 3QTIA 4GFGA 5L4QA 3QD0A 5CXHA 2CMWA 3THBA 4OUCA 4HVDA 4D5HA 2CLXA 2XKCA 1Y91A 3EQBA 3ZSGA 4ZSAA 5CI7A 1KOBA 1ZOHA 2WHBA 2C47A 3NYVA 5HTBA 1QL6A 5DA3A 3A60A 4G6OA 3W2OA 5JMSA 3RALA 2HOGA 1O6LA 3PZHA 2XNOA 4FNXA 4RQKA 2FH9A 3QQKA 4NCTC 3D2KA 4BDAA 4BKJA 5IMXA 4TN6A 5HE0A 3DKGA 3OBGA 4EOQA 3F7ZA 3RVGA 2WD1A 2DYLA 3UOLA 3LM5A 3ENMA 2GNGA 1OL7A 3P7AA 3GGFA 4OTRA 4E7WA 4JDJA 2R3MA 3RAHA 2PUIA 4RJ6A 3I6WA 3A7HA 3Q60A 3LM0A 4D9TA 3MV5A 1ZZLA 2BRHA 3POZA 4GKIA 3LFCA 5BVKA 3RCJA 1MRVA 3TUCA 5AR4A 3U9CA 4G3DA 2PE2A 4BCGA 3F3UA 2UW4A 1TQMA 4GRBA 2I7QA 5HQ0A 1YDTE 4YC6A 2XK9A 4G1WA 3VS2A 3VRYA 4D1SA 2RG5A 2IVSA 2XK3A 3PY0A 5DR9A 2I0YA 4F9AA 3FUPA 3LMGA 4U41A 5HCYA 2WTKB 3MFSA 4XLVA 3RNYA 2GU8A 4EORA 2QONA 1PKGA 3JY0A 3Q96A 2HY81 4QMNA 4OLIA 3G33A 4GL9A 1RJBA 1XH8A 4I93A 4W4VA 5C03A 4BI0A 4PPBA 4QYHA 5HE3A 1E9HA 3QHWA 4IVDA 3VBTA 4S34A 4BCMA 1PJKA 3V5LA 1QPJA 3NUSA 4GIHA 4IFGA 2DQ7X 4UMQA 2VTTA 2X1NA 2X7OA 5E90A 3QC4A 2BZJA 2E9PA 5FWKK 4DFXE 2PZYA 3OMVA 4E26A 4F7SA 4Y83A 2GTMA 4KKHA 4FV4A 4DN5A 4YPDA 5AUXA 2OLCA 3NUNA 3NNXA 3KK8A 1PMEA 4NH1A 3ZEPA 4YJVA 4X3FB 2BHEA 2C0IA 4YHJA 4ANBA 1YQJA 2OJJA 5HO8A 5CEOA 5CT0A 5KMIA 5H3QA 4WNOA 5DH3A 3UIMA 4MF0A 3JXWA 3LXNA 3FZSA 2ITVA 3D9VA 4L53A 2C0TA 5F4NA 3I4BA 4E4XA 4LMUA 3RK7A 5A4TA 1QPDA 4QTBA 1BI7A 3OY1A 4ORKA 2YCQA 2WQOA 3COIA 4ZJVA 3QQGA 4M69B 3WYYA 4NIFA 3PY1A 4KS7A 4BCHA 3O8PA 1JVPP 3W2QA 2QVSE 3NUXA 2QLQA 4M7IA 1R78A 4WO5A 3LMHA 4KSQA 2BDJA 4FTCA 3IS5A 3BCEA 4CLIA 3KA0A 4G5PA 3R9DA 3RZFA 4M0ZA 4EKKA 1DAWA 3GC8A 3M42A 1ZZ2A 4YP8A 3ZFYA 3LCDA 4ACDA 2W9FB 4OAUC 1G8SA 3AXWA 4H05A 2FO0A 4PDOA 3BHHA 2HWOA 3EL7A 4BZDA 4U6RA 2YISA 3CJGA 4J95A 1U54A 3FHIA 3COKA 3UVPA 3RINA 4G3CA 2JDSA 4YURA 5JQ8A 4ZLZA 3UODA 4P5QA 5FG8A 2FSMX 5A9UA 2Y6OA 2X8IA 3R8VA 4LM5A 2PULA 2C6TA 3E3BX 3IECA 3ULIA 3UTOA 5CEMA 4DGNA 1Q97A 4JS8A 4K2RA 3KULA 4DG2E 3LE6A 1JSVA 5EHYA 4ZK5A 2VWIA 2UZBA 3EL8A 3PLAE 2OG8A 2GS6A 4QYGA 5JRSA 3SX9A 2WIPA 3PXZA 4QP3A 2ITYA 3VBXA 4DTAA 3SG9A 3NMUF 3DB6A 3W32A 5M4UA 4AT3A 4ZAUA 2XB7A 5J5SA 3FMKA 3EQDA 3PA4A 2Y8OA 3QKLA 4QTEA 4IJPA 4BHZA 5IQDA 4UZHA 2ZDTA 3WIKA 4ITHA 4APPA 4L52A 1K3AA 1YVJA 3FSFA 3PJ1A 4GSBA 4RMZA 3D4QA 4O7NA 3OW4A 4DF3A 4AN9A 2FA2A 4D2WA 3FMEA 2A27A 2OJFE 4BYJA 2G01A 4DEDA 4QP7A 2BR1A 5E8XA 4EYMA 3EN5A 1DI8A 3IOKA 4KRDA 1TKIA 3ZU7A 4M84A 3LHJA 2QOLA 2WQBA 3BHVA 2PVHA 4AGUA 4RIWB 3S3IA 2OU7A 3CQEA 3BBTB 4DINA 4C36A 3QUPA 5KBRA 3PXFA 4L44A 5F9EA 2PK9A 4IZ5A 1LR4A 4N0SA 5L6WL 4DFLA 2XNEA 5EQEA 3QCYA 2RGPA 3HYHA 4WT6A 3AMYA 3RJCA 5F1ZA 3E8CA 1YXSA 5J7HA 3TUBA 4FIHA 3BLHA 4I24A 4I0RA 2ERKA 3LW0A 4PMTA 2C5OA 4I0TA 3RM6A 3E8DA 4AGWA 4BWXA 4CT2A 3GVUA 3I7BA 2EU9A 3OWLA 1UWJA 2W5HA 4IAAA 3K5VA 3VUKA 3ZSIA 2OKRA 2R0IA 4C8BA 3PXKA 3AC2A 4AGDA 2GNIA 3RZBA 1FQ1B 1KE5A 2UW3A 4NTSA 3A4OX 3UQFA 3QTQA 3O17A 4FV2A 5E8YA 3CTJA 2YA9A 2X81A 4FG9A 2OXXA 5EW3A 4ZIMA 4C4EA 2VU3A 5I9XA 3ZFMA 5AADA 4FTAA 3GOKA 4O0RA 3OWPA 4ZTHA 3WARA 4IVAA 3KXMA 3G90X 2QURA 3PZEA 2FB8A 4FGBA 3R00A 5A46A 4ZJJA 3DAEA 4GK4A 5KKRC 4HVIA 2VTLA 3CD8A 1KWPA 3FLZA 5HTIA 5DMZA 3C4FA 1W83A 3FZPA 4LL0A 4UX9A 4L45A 5IH4A 4Z3VA 4FTJA 3R2BA 1MUOA 3H9FA 5BVDA 4Y5HA 4J96A 1ZY5A 5DRBA 5AP7A 5ANJA 3FLSA 3C0IA 5IUIA 4X2GA 5M07A 2WFYA 4S30A 4FV5A 1F5QA 2VTMA 4FA2A 2CN8A 2YAAA 1DM2A 3PA5A 2QCSA 5DRDA 5HKMA 1J7IA 1F3MC 4LL5A 3ELJA 3O0GA 2C6EA 4PL4A 4IFCA 4HW7A 4I23A 2WMWA 5JKGA 3C4CA 3QQLA 4FSNA 4I22A 4QTDA 5T3QA 2IG7A 1GIHA 4YTFA 2XK6A 4FIIA 4EJ7A 5CQWA 1UU8A 4C35A 3E92A 2AC3A 4CMOA 1PYEA 4KBKA 5AR5A 2C1BA 3MJ1A 4CKRA 3BWJA 3UIUA 4BDFA 2YABA 3PG3A 4H3BA 4IDTA 2QODA 4DYMA 5FUTA 4IANA 2C0OA 4MD7E 3QTWA 1PMUA 2PZ5A 2Z60A 3QC9A 4J99A 4LOQA 4UMTA 2YN8A 4QPSA 5E8WA 5JGBA 2JBOA 3BLQA 1PMVA 2A19B 5EQPA 5C01A 5K0XA 4XJ0A 2EXMA 4FBXA 4FKTA 2WMSA 5IA3A 4HCVA 3VAPA 1GZKA 3GI3A 3FC2A 3ZXTA 3G15A 1FINA 2R3NA 5J9ZA 3UO6A 2W0JA 1Q61A 2WTKC 3OG7A 3PE2A 4FL3A 3ZDIA 4C59A 1XJDA 4TYJA 2IW6A 3E93A 4DTKA 4IAYA 3OCBA 4QTCA 3AT2A 1YOMA 3KL8A 2ZMDA 4EOKA 3KMUA 4D58A 4X7QA 4XS2A 5M06A 3TKUA 3A62A 3MFUA 3SXRA 2R3IA 3V6RA 4C4IA 3N4TA 2GPHA 4AA5A 1ZYCA 2JFLA 2VWWA 4U5JA 4X3JA 3EZVA 5I9YA 1H1QA 1M7QA 2LAVA 2VO7A 3SV0A 1UNLA 3DTCA 5I9UA 1H8FA 1SMHA 3ANQA 4FTRA 4FSYA 3EQHA 3AT4A 3PY3A 1UVRA 4S2ZA 3BU3A 1PHKA 3KXZA 2NRYA 2OGVA 3HMIA 2B54A 3WI6A 5FBOA 4KSPA 4XV3A 2XP2A 3BRBA 4XP2A 2GHLA 4D4YA 3HP5A 2PVLA 1H27A 3R8MA 5L2TA 2C3JA 2ZMCA 3R9RA 2VX1A 3FEGA 4RIYB 2WTWA 5IA0A 4JDHA 3D94A 3R7EA 4UMPA 1LUFA 4NJDA 4APCA 3BQRA 2QOQA 4G3FA 3QHRA 4KA3A 4ERWA 2R0UA 3DBEA 4WBOA 4DC2A 3FE3A 5JRQA 2QOFA 5L2SA 5HIBA 2VUWA 3CY3A 3NNWA 4PTCA 4TKSA 3Q9YA 4HOKA 4BTJA 5IG1A 4OTWA 4IBMA 3S95A 3CC6A 5AM6A 5HZNA 3KRWA 2Y6MA 4Z55A 3T8OA 3A8XA 3HDNA 3R28A 3T9IA 3WBLA 3CSVA 4R5YA 5LJJA 3R7VA 1AGWA 4FEWA 3UVRA 5CAPA 3KKVA 3SC1A 5HHWA 3EOCA 2C5YA 3HNGA 2VTAA 4FKPA 2UW8A 5DYJA 4EBVA 4P2KA 3T9TA 3AD6A 4Y5QA 3ZZWA 3PJ2A 4C0TA 2XEYA 2F4JA 4XCUA 4CG8A 2X9EA 5AV4A 4H3PA 5EOBA 3U6IA 4FR4A 1BYGA 4I0SA 4DH3A 4MWIA 1B38A 1OL6A 3FZ1A 4XLIA 3UG2A 3O2MA 4M13A 2YM5A 3EJ1A 5F95A 3OW3A 1WCCA 5CF5A 2R2PA 3VO3A 2DWBA 3CGOA 5EYDA 3NYOA 2EVAA 4CSVA 2RG6A 2KTYA 4IAKA 2Q0BA 4I6QA 2J9MA 4FG8A 4YZBA 5HCXA 3LCSA 3I5ZA 4PPCA 3RAWA 4FTMA 3D0EA 2F7ZE 2GHGA 5EM7A 4JQ8A 1QPEA 4LOOA 4R7BA 5AV1A 2OXDA 4IWDA 5IH6A 4IQ6A 2J5FA 3LFQA 4PUZA 3PWDA 3LZBA 4C62A 4TW9A 4RIWA 4RFYA 3TV6A 4BTMA 2R9SA 2XKDA 5E4HA 3SQQA 2ITWA 2WB8A 4QMOA 2LGCA 5DGZA 1UU3A 2CSNA 3P78A 5AUWA 2HK5A 4JLCA 2QD9A 3SDJA 3ZO2A 4AN3A 4TL0A 3VS7A 2NNWB 4O0VA 4MXZA 3R7IA 4QTAA 5DI1A 2IVUA 3W55A 3Q53A 3R8PA 1XBBA 3DKOA 5KUPA 3QLGA 1OKZA 2B52A 5AP1A 1H01A 4I5HA 4M68A 3ORPA 3COHA 3SA0A 2Q83A 1LP4A 1OBGA 2YLEA 4FYOA 4EOPA 3V3VA 3F9NA 4W8EA 4XMOA 5G1XA 4CQEA 3PXYA 4A7CA 3MPAA 5FXQA 3IW5A 1LEZA 2OK1A 4JNWA 3DCVA 3KXHA 3D83A 1V0PA 2PWLA 3DBCA 3DJ5A 2WTIA 3GU8A 3OHTA 4L46A 3EFJA 4FZ6A 4CLJA 3D7TB 3D7ZA 4LGGA 5CVHA 1OUYA 4CYIA 4IVBA 3HLLA 2H96A 2BDFA 2X6DA 3OWKA 4QMZA 3QF9A 1OVEA 4F1MA 3AQVA 2JFMA 3FY2A 2ZV7A 3IOPA 1ZOGA 5K5XA 2W1DA 3DKFA 1IA8A 2V7AA 4I4EA 1MQBA 4PQNA 4OTHA 5KCVA 4PDSA 1JKLA 1UNGA 4UMRA 2V55A 3HZTA 4IW0A 1P4FA 4FZDB 3S2PA 3TJCA 1WBTA 2JDOA 4RVTA 3VULA 5B0XA 5BVOA 5CF4A 3HP2A 4NFNA 4LV5A 1PXMA 2R3FA 3AC5A 4QQJA 4YR8A 2V62A 4EOSA 3DDPA 3NCZA 3VW6A 4ZSJA 3KMWA 1TQPA 3Q4TA 1O6KA 4GCJA 1GIIA 2XRWA 5DT4A 3E64A 1YI3A 3CTHA 4YJUA 3C4ZA 1XH4A 4H39A 4IX6A 3RWQA 2OZOA 5FD2A 4CEGA 4D4VA 4DG0E 3EWHA 4BDEA 4BN1A 3HVCA 4HGSA 5HBJA 1PXKA 2BCJA 5EH0A 5CENA 4FKIA 4OW8A 3NVMB 4XYFA 4EH4A 5JQ5A 5BVWA 1GZOA 3R01A 3REPA 1SVGA 3UPXA 3S1HA 3BZ3A 3Q9ZA 2B9IA 3ZSHA 2KULA 1H1SA 4FZ7A 4A06A 1OB3A 1KE6A 1J1BA 3UDBA 4CFFA 5IEVA 4CZYB 2RKUA 3LJ1A 5A54A 5IA2A 4EUUA 1NT2A 2NPQA 1SVHA 2J0IA 1W8CA 2HIWA 3EN4A 3MVMA 4JL9A 5LARA 3VBYA 4YJTA 3KY2A 5CZIA 3KK9A 2X6EA 2YCFA 4FV9A 2ITTA 4UYNA 2BILB 2YITA 3ZDUA 4P5ZA 3RP9A 5BNJA 2PVFA 1J91A 1I09A 2GCDA 3OXTA 5CX9A 5GJFA 4L43A 4EHVA 1JKTA 1CDKA 3I0OA 4CMTA 1M7NA 3QA8A 5KMMA 4DEBA 4LYNA 3UZPA 3UJGA 5L8KA 4IWQA 3QU0A 3C4EA 2DS1A 2HZIA 1K2PA 5AP2A 1UU7A 3OROA 4J1RA 3ZLWA 2XM8A 5AP4A 4BWKA 4M14A 5GNKA 3GCPA 2PVMA 4LG4A 4ZTSA 5M08A 3ZM9A 3L8VA 3LXPA 2CNQA 4ONAA 3L8PA 4QP6A 5JSMA 4EWQA 4UZDA 5KBQA 4D2VA 4DAWA 3QCXA 2CCHA 3GCQA 3EQGA 4NEUA 3HRFA 3MS9A 5FM2A 3NUYA 4JJRA 2CKQA 3AGMA 3OUKA 5DBXA 4DT9A 1IR3A 4JRVA 1A9UA 4FUXA 4YC3A 4PWNA 3R02A 3UGCA 3E8EA 5E8SA 3FLWA 4F7JA 4HNIA 4JXFA 2WAJA 4RIYA 2ITZA 1H07A 2J5EA 1ZLTA 3K5UA 5M09A 3G5DA 3R9NA 5JFVA 2GFSA 3C7QA 3PTGA 4XG3A 5CSHA 2PVYA 3R7UA 1TQIA 1YXTA 5C4LA 4MH7A 1OIYA 3B2TA 4C3RA 3V5TA 2VTJA 3U87A 3ET7A 3MVLA 2UZOA 4YZMA 1K9AA 3ULZA 2OBJA 3PPKA 4UWCA 1H0VA 3R30A 5IEXA 3UIXA 4FF8A 1YW2A 4FTIA 4LRMA 4C7TA 4GKHA 3FXWA 4HGTA 5EHLA 1H25A 5BPYA 4ZTQA 3CBLA 5IQBA 5ANDA 3FMDA 3M2WA 3NWWA 2F57A 4WA9A 2JKQA 3ZLYA 5A4LA 5E9EA 3BE9A 2PU8A 3GQLA 3FWQA 3QGWA 4ZLYA 3MESA 3NW6A 4MXOA 4XBUA 2IWIA 3UMXA 3ZRMA 4YLLA 2G15A 4YO4A 2WTJA 4XOZA 4ALWA 2Z8CA 4EHZA 3KCFA 4H58A 1P2AA 5IMEA 1UV5A 3VHEA 4QD6A 3R63A 4UV0A 4BTKA 4O82A 3ROYA 3EQFA 4S31A 3T3UA 4PL3A 4BICA 1OL5A 5HO7A 1WBNA 2QOBA 1QMZA 2XF0A 4EZ7A 5BYLA 4DBXA 2X2MA 4FG7A 4ZZOA 3VIDA 3UNKA 1PRYA 4WHZA 4FNZA 4L68A 3GU5A 1Q8UA 4I6HA 3B8RA 2XK8A 3NW7A 4IXPA 4M67A 5TKDA 3VS4A 1PXLA 1PF8A 3A7GA 3PWYA 3RNIA 3I6UA 3TTJA 3RI1A 5EQYA 1R0EA 4B9DA 3SVVA 3DBFA 4W4WA 2BAKA 4CFVA 4FTLA 4XHKB 4GYIA 1CMKE 3FLNC 2QG7A 1XKKA 5C9CA 4C4FA 4DEEA 3C13A 4NJ3A 3DFCB 2C4GA 3GCVA 2HZNA 4HGLA 4H1MA 4F08A 4DEIA 1YHSA 2I0HA 3Q9XA 3F3TA 4MHAA 5M4CA 4IJ9A 4QMXA 2W1HA 2QOCA 3IGGA 1MP8A 3E7OA 4OBPA 4IVCA 5L2QA 4D2PA 4GW8A 4JX3A 1OL1A 4RX9A 3TUDA 3HX4A 1YHWA 4FKGA 4B6LA 3P23A 5ITAA 1SZMA 5ANOA 1BLXA 4ZXTA 5CWZA 4PTEA 4BYIA 3AT3A 5G6VA 4IX4A 3MH3A 5DEYA 3QUEA 3N9XA 4RFZA 4B8LA 4TYIA 5IKWA 4C4JA 3TI1A 5GIPE 2W1EA 5B2LA 4GEOA 4AZFA 4UWYA 4HPUE 3BLRA 2OF4A 3I79A 4YNEA 4XG4A 1XBCA 5KZ0A 4EZ3A 2ZYBA 4CQGA 3TKIA 1ZAOA 3QKKA 5AUYA 3DKCA 2CDZA 2O65A 4TXCA 1KE9A 4RWLA 3CPBA 5HE1A 2UW7A 4FV3A 3SXSA 4O7SA 3FBVA 1YWRA 3C0GA 2ZM3A 4GT5A 4RIXB 2YDJA 4X2KA 2X7FA 3DLSA 3ZFXA 4FVPA 5AAFA 5HD7A 2PMLX 5IQEA 4RVKA 2BDWA 2RSVA 3QZHA 4B0GA 4GUBA 3NUUA 1ZWSA 2BHHA 4OR5A 4W4XA 2J6MA 2WU7A 3U55A 5HORA 1H28A 2VZ6A 3LOKA 5HBHA 5HG7A 4ANQA 3CS9A 5LMKA 1L8TA 4YHFA 4AZWA 4BIDA 4AQCA 4PDPA 2W05A 3MH0A 3QZGA 4C38A 3AC1A 3EB0A 1J7UA 3TXOA 1UNHA 4PL5A 4AU8A 4KRCA 1GJOA 4JRNA 3WZKA 3OT8A 3QCQA 1P4OA 3VJNA 2Z7SA 3DNEA 3M1SA 5D10A 4NK9A 4FV1A 3FKLA 4MXCA 2C6MA 3UVQA 4BDGA 4CRSA 3T3VA 4ZLOA 2XNMA 4WUNA 2Z02A 1U5RA 4IAZA 5KMNA 3VRZA 4S32A 1CKJA 2WQNA 3ORLA 4X3FA 2W1FA 4KIQA 3QLFA 2BIKB 4EH8A 4O0XA 2OZAB 3LFDA 5C27A 4XP3A 4AE9A 2GNLA 5BUEA 5AUVA 4YTHA 3G0EA 5CYIA 4R3PA 3ZRKA 2ITXA 4FMQA 3H9OA 2WMVA 3CKXA 1M2PA 2C5NA 3SHEA 4F6WA 4K11A 4XP0A 3DBQA 2UZUE 3BELA 2CJMA 3GC0A 4E8AA 4ERKA 2E9OA 3F5UA 2UZWE 4FOCA 4II5A 3V01A 1CKIA 3W16A 5FEEA 3WOWA 1WBOA 4U45A 3VS6A 5GIOE 2XRUA 4J8NA 5CVGA 3RPSA 3L9NA 3UZTA 3DPKA 5C1QB 3HMNA 2UZLA 1V1KA 4FKQA 1YXUA 3BYVA 3CE3A 4TYHA 1W82A 2YIQA 4HGEA 2P2HA 3A4PA 4GG5A 2OFVA 4BCPA 2BMCA 4UYAA 4OT6A 5AX3A 3W8LA 1X8BA 5CU0A 1O9UA 5ANEA 4EHEA 2WMAA 3TNPC 4ZZNA 5FRIA 3EQIA 3MBLA 1HOWA 4FT9A 5BYZA 3W2CA 4I92A 5IPJA 3A8WA 3TV7A 2QOIA 2UZVA 5HNGA 2W1CA 5BUIA 1A48A 3R1YA 3EFLA 2QC6A 2X9FA 1YOLA 2NRUA 2JC6A 4XOYA 5IU2A 2WQEA 3LJ0A 3GCSA 4QRCA 2XJ1A 5C4KA 4I20A 3JYAA 4D28A 4GVJA 3FL5A 4O38A 4XBRA 5FTQA 4FKVA 1WAKA 2JD5A 4G16A 1TVOA 3DV3A 4I5CA 4B7TA 1KV2A 2ITUA 3QYZA 3RPVA 2YEXA 3LPBA 3NAXA 5HVJA 4I5PA 4KNBA 5L2WA 3NAYA 4EBWA 2YLFA 2YCRA 4FTKA 3TNHA 5A6NA 4CCUA 1M2RA 3PPJA 4TTHB 4AZTA 4XRLA 2CKPA 4MEDA 3OBJA 5J1WA 3QUDA 4JAIA 4TZRA 3HECA 5KMOA 1YXVA 1XHAA 2EB3A 3IDBA 3UP2A 4F0GA 3RM7A 3E8NA 2VN9A 3QD2B 3UQGA 2F2CB 4YGAA 4FT5A 2QO7A 3G9LX 3SW4A 2GQGA 3U4UA 2W17A 3DA6A 3DZQA 1PXOA 4O7TA 2JDVA 4JR3A 3BPRA 4K33A 4FL1A 1OIQA 3DK6A 3NYNA 4R78A 5E8TA 5ETIA 3EIDA 3CTQA 3ZUVA 4C58A 3VBVA 2YM4A 4D0WA 3ZS5A 3WF7A 3MA6A 3UYSA 1NW1A 3DXQA 1YOJA 4YJNA 3C4XA 3DQXA 2QOKA 4ZMFA 5AV3A 4DG3E 2YIRA 4GG7A 2WXVA 4DE4A 3IW6A 2XEZA 2BZHB 5A4CA 3QTZA 3E5AA 4XNEA 3Q9WA 5DVRA 2SRCA 1Z5MA 5H8EA 3OC1A 4R1YA 2OIDA 5AUTA 2XBJA 1Q62A 2OIQA 3MJ2A 3QRJA 4EK5A 3WYXA 4XG6A 4ENYA 4Z16A 4NFMA 2CGXA 4PDYA 2A0CX 1H00A 3VS3A 3COMA 4ZTMA 4OTPA 4F4PA 3D5XA 4RJ8A 2JBPA 3MB7A 5FDXA 4MXYA 1NY3A 3R71A 4E73A 3LVPA 3ALOA 3GT8A 5HIEA 3I5NA 3WZEA 2J0LA 3BYMA 1BL6A 4WD5A 4M8TA 3OTUA 3FI4A 3OFMA 4AF3A 5BMMA 3O50A 3QA0A 2GMXA 1BUHA 4FNWA 1E1XA 2BRBA 1YDRE 4LFIA 1DI9A 3PUPA 4WUAA 3FAAA 5KHXA 1STCE 5EDQA 2R3KA 3HUBA 5JGDA 4IC7A 3EYGA 3BGPA 2BUJA 5E92A 1WVXA 2Y7JA 1OGUA 3U6JA 3RHXA 4RJ5A 3ALNA 4FKSA 4U97A 5AA9A 3RKBA 3R22A 4ALVA 2O2UA 5E7RA 3ENHA 2RFDA 4O0SA 2J2IB 4M15A 4YBKA 3W2RA 1IASA 1ZYDA 3GNIB 5CZHA 5DT0A 3U4WA 3VUHA 4Z7HA 4O1OA 4UMUA 4DCEA 3ETAA 5LOHA 4W9XA 4FE2A 2W4OA 2HXQA 5CSVA 2PUNA 4G6LA 4OT5A 2WOTA 4G2FA 4YTCA 2UW5A 4O7RA 3IO7A 3PJ8A 4FSUA 3O23A 4HCUA 3QTRA 5AP6A 5JGAA 5DR6A 3QXPA 4KD1A 3DU8A 5T6KA 3UO5A 4OGRA 3QX2A 3ZCLA 5FEQA 3DNDA 4WNPA 5EM8A 2A2AA 3K54A 5KHWA 2YDKA 4EYJA 1ZMWA 3UOHA 2YACA 4O6EA 5HCZA 3ACKA 2ESMA 2QO2A 4IWPA 4XV1A 3ACJA 2XBAA 3Q4UA 5IQHA 5GJDA 5H2UA 4DGMA 4XH6A 1H1WA 4J98A 4EK8A 2BFXA 3CPCA 3HKOA 3IQ7A 3OS3A 3PFQA 3Q6UA 4W9WA 5CT7A 5HVYA 4F99A 4CTBA 4BC6A 4GFOA 3UC3A 4DLJA 4MD8E 3BQCA 1OMWA 2OO8X 1CSNA 3IK3A 2C3IB 3HMMA 1OZ1A 4C3FA 3HUCA 5CF8A 4J52A 5K5NA 5I3RA 3OZ6A 3TT0A 3LLTA 4GK2A 4O7WA 4QMUA 3KRRA 4F9YA 4XRJA 4X2FA 4QMYA 3V6SA 3NPCA 5CF6A 4HVSA 4YJPA 2IZSA 2VTIA 3UZRA 5BVFA 2C69A 4BCIA 3A99A 4JVGA 3GOPA 3PSBA 3DAJA 3ORZA 2R5TA 5CEPA 1YHVA 1H26A 4ITIA 4UALA 4LI5A 5LMBA 1OKVA 3NYXA 2R3JA 4FT7A 3Q5IA 2OXYA 4E3CA 1U54B 4Q9SA 5JK3A 3KREA 4IIRA 5CAUA 3EFKA 5JN2A 2OZAA 1PXJA 4K0YA 3TCPA 1V0BA 3HRCA 4H3QA 4N70A 2XZSA 5IDNA 2VO6A 4ASZA 4BCFA 4C3PA 2ZJWA 3FXXA 3GU6A 3OVVA 4G34A 3KCKA 3V8WA 3D14A 4RJ3A 4USFA 2FGIA 2R7IA 3F82A 5GINE 2JKOA 1WBPA 2IZUA 2QKRA 3HA6A 4G6NA 5BYYA 5CSPA 3PJCA 4V01A 2CNUA 4NWMA 1IRKA 3ORIA 3KFAA 1ATPE 3FLQA 3OY3A 2OJ9A 5A14A 2WMQA 5BQ0A 1KE8A 1IAJA 3OCGA 4I21A 3VF8A 4BCQA 4GV1A 4RFMA 2QQ7A 4D2TA 4ANSA 5FP6A 1E1VA 4CXAA 4CFUA 4FIFA 3SGCA 4IWOA 1YWVA 3MN3A 4I3ZA 4FC0A 5IQFA 5LVLA 5DIAA 3BI6A 2XYNA 3AG9A 3BU5A 3VWAA 3Q52A 2GTNA 3NW5A 4DH1A 3F3ZA 5CU6A 3WF6A 2YFXA 1G3NA 3ATTA 2OICA 4RC4A 4R3RA 2W99B 1FBNA 4TNDA 5HBEA 2J7TA 3O7LD 5EFQA 2CNVA 1GOLA 4P90A 3JVRA 2PHKA 2WKMA 3O7LB 3JPVA 4AZEA 4QP2A 3R7YA 5DE2A 5H8GA 4BHNA 3OXZA 4TY1A 3B8QA 4E93A 1XH5A 3CEKA 4FIJA 3EN7A 2PZIA 5EI8A 4EHGA 2OJGA 3AC8A 2WTDA 3HL7A 2VWZA 1VEBA 3KMMA 1ZYLA 4R1VA 4EONA 2CGWA 4RWJA 3IW8A 2QU5A 3JY9A 4R7IA 3I60A 4JG8A 4BRXA 4U79A 3KC3A 4AW1A 2X4FA 1PXIA 2PVKA 3C5IA 2C3KA 2A1AB
chains in the Genus database with same CATH superfamily
3KVXA 1WBVA 1WMKA 2W1GA 3QCSA 1M2QA 4F64A 4YZNA 4GJ2A 3S4QA 5C8MA 4AS0A 5LMKC 4BB4A 4RVLA 4LUDA 3GUBA 4DDGA 5HLNA 4P7EA 4G31A 4EH5A 4LQMA 2YM8A 4F6SA 5IUGA 5ANKA 3OT3A 4G17A 1GIJA 5D9HA 5DLSA 4A9TA 2P2IA 5J9YA 4C37A 5TT7A 2G2HA 4FSZA 4C34A 4QPAA 4TWPA 4V0GA 3KF7A 5IDPA 2GDOA 5D7VA 2I40A 3BEGA 3OCSA 4DGLC 3FJQE 3TZ9A 3UP7A 4OTDA 2XIZA 5TO8A 4E6AA 3JVSA 5HEZA 3VUGA 1OPLA 4QMLA 2Y4IB 3FXZA 2XIRA 5CXZA 2V22A 4RT7A 4EOOA 3OF0A 1YI6A 4J97A 4QP4A 4PF4A 2BKZA 2HZ4A 3L1SA 3EZRA 3C50A 4KBCA 3U54A 1L3RE 3Q3BA 3QTXA 5CU2A 3SLSA 2PPQA 1AQ1A 1DAYA 2JDRA 1WVWA 4ZSEA 3RCDA 2C6IA 4FEQA 4ANNA 2HW6A 5E1EA 1SYKA 3LMIA 4YC8A 2A98A 5TR6A 4ZEGA 1H0WA 3MDYA 3HA8A 3LFAA 2OSCA 2QLUA 1W84A 2P55A 3QRUA 4C4HA 3BGZA 4IX5A 1WZYA 2HWPA 1S9IA 1FVTA 1KV1A 2RL5A 2VWYA 2W9ZB 4IZ7A 1JBPE 5L8JA 4BGHA 2FSTX 2QHNA 2ERZE 4O7ZA 4KIKB 5IQGA 2E9VA 4RIOA 1H4LA 3FC1X 4CFMA 4ARKA 5D1JA 2IN6A 4N6YA 5CEQA 4FODA 5EG3A 5FXSA 4FT0A 1QCFA 4QQ5A 4F0IA 4O81A 3KXNA 4CV8A 2C30A 3U51A 4FIGA 4UB7A 4HVHA 1KOAA 1OUKA 1LEWA 4O6LA 4BCNA 2IO6A 2GSFA 5HU9A 5E1SA 2Y4PA 2JKKA 4JQEA 2ZM4A 5CANA 2YERA 3L8XA 3HGKA 2P33A 3QRTA 5IUHA 4QT1A 3IDCA 4QMVA 3FSKA 5LCJA 4D2RA 2W5BA 5EW8A 3R21A 5TF9A 4QMMA 4CKIA 4GVAA 3P86A 3R9OA 3F88A 4NYEA 4HPTE 4IC8A 3VUMA 2OW3A 4FKWA 1M17A 3LAUA 2ITPA 2HXLA 4A4XA 5JZNA 3FKOA 4LMNA 5HG8A 4AW2A 4U9AA 4XG7A 3EKKA 3MPMA 4JIKA 2QR7A 4O21A 3P5JC 5EYKA 3ORXA 5AUUA 2J90A 4OTGA 3AKKA 3NLBA 4FZAB 5E8VA 1U4DA 3DAKA 4MBLA 2ZV9A 3WF5A 4DHFA 3Q4CA 4YZCA 3TDWA 2WPAA 4IMYA 3EN9A 3V5WA 4WIHA 1OECA 3D15A 3VQHA 2X2KA 2JEDA 1M52A 2VRXA 3IONA 4IZAA 3GQIA 3U9NA 4ZY4A 4NKAA 5CEIA 2AEGA 4LV8A 4Y72A 5BV3A 5FM3A 2F49A 3BL7A 1W7HA 3NUPA 3JS2A 4RA5A 4DGGA 5D7AA 3FI8A 4M3QA 2VX0A 3DS6A 3PSDA 4YLJA 2OIBA 5C8NA 2Z7QA 1R1WA 4R3CA 4EK6A 1VJYA 5IISA 3TG1A 4EQMA 4D55A 4KIPA 3QGYA 5EDRA 5M4FA 4L67A 2XAMA 4RJ4A 2VWUA 2V5QA 3CQUA 4FYNA 4P4CA 3ZO1A 4DDIA 3CGFA 2PY3A 4IDVA 4O2ZA 4PMSA 4BJJA 2PL0A 3TYKA 2WMRA 3TEIA 3Q5ZA 3C4WA 2AYPA 2F7XE 4EH6A 2W96B 4MKCA 3W0PA 3IG7A 4WNKA 4BKZA 5CAQA 3RWPA 3H9RA 3Q4ZA 4QMTA 2VGOA 1F0QA 4ZS4A 3N4UA 4YHTA 3FI3A 4FSTA 3JUHA 2WEIA 4LRJA 2CLQA 3LFEA 4CTCA 3LQ3A 4TWOA 1URWA 3W0MA 3ROCA 2HCKA 3G9NA 4O4EA 1BX6A 1NVQA 3D5VA 3PSCA 4ZS0A 1JSTA 5JEBA 2X4ZA 1OM1A 5C8KA 5HU3A 5AUZA 3Q04A 5CY3A 4O0UA 3VC4A 2OJIA 4EL9A 3WILA 2X0GA 4QYEA 2F9GA 3A7IA 2F7EE 3FL4A 3PIXA 4BBEA 2XMYA 4V05A 1RQQA 5HNIX 4RSSA 3NX8A 2I0VA 5EI6A 2JKMA 1EH4A 2BFYA 2WGJA 4B99A 4ENXA 4YU2A 5KMJA 2UZNA 3E7VA 1YKRA 4D9UA 2O3PA 3SXFA 3WZJA 3UOJA 4O91A 5DWRA 3TM0A 1YDSE 4F6UA 2B7AA 5EKNA 4NIFB 4D0XA 4C4GA 4OBOA 3HRBA 5CQUA 1UA2A 5IEYA 4J53A 2IF8A 2ITNA 3CR0A 3DBDA 4X3FC 2WMBA 2J0KA 3EFWA 2PTKA 4HYSA 3AC3A 2FVDA 3C0HA 4JBQA 2YWPA 1JSUA 3PE1A 3RGFA 3C51A 2IVVA 4AN2A 3PP1A 4ACHA 4YPSA 3E88A 4U3YA 3TKHA 4JIAA 3HMPA 2O0UA 4O4DA 3ZM4A 3DQWA 4YJQA 3TWJA 3ZOSA 4G3GA 4O0WA 4FVRA 4TPTA 4MVFA 4ZTLA 4AE6A 4FSQA 2IZRA 5ETCA 3B2WA 3LFNA 4AX8A 1W0XC 3W8QA 1G8AA 5AX9A 3QQUA 2PYWA 1JKSA 3ZC5A 2C6LA 5IA4A 3UMWA 4E6QA 2I6LA 3MYGA 4J8MA 2ONLA 4F65A 3E87A 2PUUA 3DK3A 3P08A 4NCTA 4ANMA 3II5A 4ZSLA 1Y6AA 2G2FA 3IGOA 3PIYA 4QO9A 5EYCA 3VUIA 5L2IA 4JOAA 5J9LA 4M0YA 3ORKA 3UNJA 2VTOA 1WBWA 5HD4A 4MQ1A 3EN6A 2UW6A 4M97A 4E1ZA 2ZOQA 1YI4A 3RPYA 1ZMVA 4ACMA 5FTOA 4DITA 2R3LA 3O71A 5DN3A 2BVAA 1T46A 3R2YA 3VBWA 3HV3A 2BROA 2UV2A 3WE4A 2VWVA 2XIKA 5GZ9A 4U81A 1SNXA 2B1PA 5HE2A 4DLIA 4MXAA 4R77A 5HLWA 3P79A 1CKPA 4EK4A 5LVOA 2VNYA 5B2KA 5HI2A 2UW0A 3TACA 3U8WA 4F7LA 5EYMA 3MY5A 4QMWA 4IACA 4X6QC 4AGCA 4EOLA 1PY5A 3HV6A 3DXPA 4O7VA 3MH2A 4KB8A 4IM2A 4QNYA 5DR2A 3FDNA 2H9VA 4FRFA 4I5MA 3SRVB 3BYSA 1XH9A 2PZRA 3TNWA 4EQUA 3RPOA 4DFUA 3DTWA 3NCGA 3L8SA 4IAFA 3SOAA 4OTFA 3MVHA 3D5WA 4WG5A 3QQFA 3KXGA 4XUFA 2O8YA 5CNNA 5D12A 3RAIA 3UNZA 2X2LA 4ZOGA 2BTRA 4BDHA 4WBBB 2O64A 3WF9A 4I94A 4E4LA 2PMNX 2EWAA 4O22A 3W18A 4Q2AA 2XVDA 4XV2A 5L3AA 3DB8A 4XEYA 4ANLA 3PP0A 3P0MA 1OIUA 3HV5A 5BX0A 1WBSA 3QQHA 2XJ0A 5HTCA 4FKLA 4CMUA 4FKOA 3WIGA 3ZMMA 4RA4A 4FSRA 5DHJA 3FQSA 3MTLA 5FGKA 3QZIA 3BV2A 3F69A 3UIBA 3C5UA 3DDQA 4IM0A 4AT5A 4F0FA 2VWXA 3FMLA 3RK5A 2UVYA 4R8QA 4FTNA 2WMTA 2R64A 5AAEA 5I3OA 3PXQA 5AR7A 4QQTA 4RBLA 4FSMA 4HZRA 2UZDA 1U5QA 1Q8TA 1OPJA 3M11A 2C6KA 4WSYA 3G51A 4EZ5A 3BU6A 1OL2A 2XYUA 2J0MB 2JDTA 3P7CA 5M4IA 2XS0A 4FI1A 5EI2A 4ZTRA 5IQCA 5JFSA 4BCKA 3R0TA 2P3GX 3H30A 3FLYA 2X39A 1FVRA 2R3HA 4JX7A 5AJQA 3R1NA 3SD0A 4FKJA 4ZJIA 5JFWA 3WE8A 5LVNA 2QNJA 3A61A 3G6GA 3O8UA 3R7OA 4NL0A 3DY7A 1MRUA 3QRIA 5ICPA 2JITA 4L7SA 3HAMA 4CG9A 3EQCA 4KAOA 3QX4A 5M51A 4BDIA 3NUAA 5CVFA 5KKRB 4TNBA 3PLSA 4G5JA 1RW8A 4GT4A 4MAOA 3K2LA 1ZYSA 4AP7A 4O1PA 2Z2WA 3SKCA 3DLZA 3UC4A 4A4LA 4YJOA 4DFYA 5EKOA 3V5PA 4FEVA 1BL7A 5A4QA 2PMIA 4EEVA 4IB1A 2WZJA 2YJSA 3S00A 4OTIA 3ATSA 2B55A 4X21A 5K9IA 2HENA 4NUSA 3PPZA 4UXLA 1H24A 3R04A 2ZAZA 2YWVA 1OI9A 4N6ZA 1OITA 1IEPA 3SG8A 2YAKA 4BIBA 5KO1A 3TDVA 3TZ7A 3ZXZA 3R73A 4BGGA 2BALA 3LCKA 3FI2A 4RC2A 2XUUA 3MGYA 4IB5A 4FSWA 4MXXA 4AXAA 2CGVA 4FL2A 1PKDA 3ZZEA 3MIAA 5HO6A 4ANOA 4F7NA 2C5VA 3MFRA 1ZMUA 4J7BA 3POOA 4F70A 1VZOA 1JAMA 4GT3A 2XCHA 4QP8A 3TL8A 4M69A 4JBOA 5HESA 2BKKA 1FPUA 2X8DA 5EM6A 5K4IA 4USEA 4EC8A 3BX5A 3FMHA 4L00A 1ND4A 2YIYA 4KUJA 5BVNA 3VHKA 5DOSA 4WG3A 4LRKA 5AV0A 2GQSA 4BKYA 2J0JA 5A6OA 1APME 2EB2A 3GFWA 4X2NA 1ERKA 5LMAA 1OBDA 1R39A 4GJ3A 1OKYA 2I0EA 2UUEA 3KB7A 1IA9A 4ID7A 5LWMA 4DFNA 3QQJA 4KWPA 4RIXA 3LFSA 4RZVA 2XNPA 4BR3A 4BVUA 2WTCA 5A3XA 2GNFA 4PY1A 4XG8A 4MNFA 2B4SB 5DFPA 4FK6A 1NA7A 4XG9A 3G0FA 1T45A 5JT2A 4NSTA 2CPKE 5LQFA 5CASA 2CKEA 2W1ZA 2ZM1A 3QKMA 3MTFA 5H9BA 4L3JA 5M55A 3VNTA 2YM6A 4G9CA 4BBMA 2HYYA 3H4JA 4I41A 3VN9A 4CD0A 4DCAA 3PVGA 4WRSA 2WNTA 4QP1A 1W98A 4RLKA 2PVJA 5CALA 3QTUA 5FDPA 2VTSA 2XA4A 4NM5A 4E6CA 2C1AA 3OOMA 2IW9A 4KINA 3AOXA 5LXMA 2IPXA 3BGQA 3P7BA 3R1SA 4AWIA 3F5XA 4M12A 3ZTXA 3SOCA 5IQIA 2XKFA 4FV6A 2BIYA 1OIRA 2ZV8A 4E4MA 4BBFA 4X2JA 3NSZA 4IE9A 3I1AA 3ZONA 4L42A 4YNOA 1J3HA 3GU7A 1Q3DA 5EW9A 3MH1A 2ITQA 4K8AA 5HLPA 3P4KA 4DGOA 4YLKA 2B9JA 3LCOA 4S33A 3F2RA 4GMYA 4NT4A 4L8MA 1GAGA 4FKRA 1NXKA 4PMPA 3D5UA 3N4VA 5HX6A 1Y57A 3K3IA 4Y73A 2XNNA 4AZVA 2C5XA 4D1XA 2YHVA 3DOGA 3BE2A 3ZO4A 4IAIA 4O84A 2WOUA 1ZXEA 2Z7RA 3E62A 4DT8A 1LPUA 3QFVA 4FUYA 5J87A 3CKWA 4RQVA 2B9HA 5AR2A 3Q32A 2JLDA 4GS6A 5CEKA 3W2SA 4JT3A 2RFNA 4NM7A 2IW8A 5L8LA 3DXNA 4BCJA 4U0IA 4QYFA 1MRYA 1BI8A 2IEWA 4QMSA 4YJSA 4QP9A 4Q9ZA 4L6QA 5IA1A 1GY3A 1PXNA 4XV9A 2ZDUA 3GXLA 3RPRA 1OGYA 4LUEA 1J7LA 3LFFA 2B9FA 5LWNA 2PVNA 3JR1A 2AC5A 1ZRZA 4ZP5A 1JLUE 5HG5A 5KX8A 4HNFA 4IHPA 4BJJB 3EMGA 1XWSA 4NW6A 2G2IA 1XBAA 2JAMA 2WIHA 4G9RA 5DG5A 2VTQA 3WZUA 4CGAA 2HW7A 2WEVA 3LJ2A 4YZDA 1NVRA 4L01A 2BRNA 2G1TA 2JAVA 3R1QA 4GYGA 3ERKA 4V04A 5F20A 4GU9A 4Z7GA 1MQ4A 5IA5A 2E2BA 3HV7A 3MFTA 4ZZMA 1REJA 3KXXA 2GHMA 2AUHA 4HYIA 3SRVA 1R3CA 1OKWA 4YZ9A 4U8ZA 4BWPA 5JFXA 4FEXA 5J79A 3PRIA 2RF9A 3NS9A 4QQCA 3PG1A 4YMJA 3QZFA 5ACKA 3QWKA 4HJOA 5I5ZA 1Y8GA 5HIDA 3OOGA 4DFBA 2XIYA 4QMQA 2OH0E 2PUPA 3F6XA 4MWHA 3CXWA 4O2PA 2YCSA 4KABA 2J4ZA 3ZLSA 3MI9A 4IZYA 4AA0A 2GNJA 3TV4A 3CLYA 3CQWA 3G2FA 1H1PA 4MYGA 3MW1A 3VBQA 2WMXA 2X8EA 3EQPA 4K77A 4KKGA 1JOWB 3E3PA 1JQHA 3DGKA 3ZYAA 4F09A 3ID6C 3NIZA 3D7TA 4FGRA 4FV7A 3E63A 2PVRA 3ZO3A 5FBNC 4JBPA 4ACGA 1W2DA 1FMKA 3EQRA 4X6RA 4YUQA 5KZIA 3KVWA 2IVTA 4IM3A 4CT1A 1U46A 4AOTA 3NZ0A 5ANGA 4E5BA 2EXCX 2QU6A 3MY1A 4FTOA 4MCVA 5EK7A 3F3WA 2BTSA 1HCLA 4D4RA 3BBWA 4YTIA 4BDKA 3VUTA 1S9JA 2ETKA 4UXQA 2FSOX 4H1JA 3RAKA 3R7GA 4K9YA 4EI4A 1Q5KA 4RG0A 2E9NA 3PVUA 3C9WA 3ZHPC 1VYWA 2YJRA 5HGIA 3KQ7A 1H08A 2YZLA 5B2MA 3A7JA 3TNIA 3S0OA 3TIYA 1J1CA 4I6FA 3HV4A 2PE1A 5GHVA 2VAGA 4ITJA 4UBAA 3KN6A 5B7VA 2QI8A 3BEAA 3WZDA 4F63A 5EM5A 5LVPA 4EH2A 4ZY5A 3NNVA 3Q2JA 2EXEA 4L3PA 4CZTA 1FGIA 4R6VA 2B53A 5BUJA 2BRGA 3GB2A 3BHYA 3P5KA 4DTBA 3F2AA 5JH6A 2GS2A 4KBAA 4NM3A 3ANRA 5CU4A 2HAKA 3P9JA 5BMSA 4MBIA 1ST4A 4CV9A 2ZB0A 4MNEB 3V5QA 1FVVA 2XKEA 3EHAA 4ACCA 4MK0A 3F2NA 3UBDA 3ODZX 5FP5A 4AW0A 4AW5A 2YM7A 3FQEA 3OXIA 3DZOA 4MBJA 5HNBA 2FYSA 2UVZA 3H0ZA 2V0DA 2HZ0A 2GS7A 1WFCA 4AOJA 5JZJA 4GUEA 4O0YA 3AMBA 4ASDA 3KN5A 1HCKA 4PTGA 5D41A 4AT4A 2WO6A 4WRGA 5GJGA 4BI2A 3GC9A 4EQCA 4Q5HA 4AAAA 3FMMA 3F5PA 1R0PA 2BRMA 2QOOA 2XK4A 4I4FA 4IB3A 2IJMA 3UOKA 4H36A 4TT7A 4QOXA 3SW7A 4UY9A 4OAVB 3BL9A 4JMQA 3RTPA 2H34A 3L9PA 4CVAA 4JR7A 2BZKB 4MTAA 3OTVA 4YSMA 1OPKA 3BKBA 3F66A 5CI6A 4CKJA 5AA8A 3H10A 3A7FA 2P4IA 2RFEA 3Q6WA 3W33A 1KE7A 2ZVAA 5AM7A 4FTQA 1XO2B 1ZOEA 2ACXA 4FVQA 4U44A 3R8LA 4CZUA 1M14A 4K1BA 2C6DA 5KE0A 3VS1A 1Q4LA 3VUDA 1IAHA 3LLAA 5E8UA 4EUTA 4RX7A 2ONLC 4A9SA 2XIXA 3TZMA 4AUAA 3PFYA 1PXPA 3ZH8A 4ZMEA 4RJ7A 2XNGA 4HYHA 3GC7A 4EOJA 4EWHA 2VTNA 5GZ8A 3LQ5A 5AP3A 3IKAA 4PV0A 4USDA 4K18A 4CYJA 4DFZE 4RWKA 4EK3A 5I9WA 3NDMA 3PA3A 4FV8A 4QPMA 5CS6A 4KS8A 4BDCA 3O8TA 3BIZA 3PVBA 3QALE 1Q8ZA 2CGUA 4OBQA 2CN5A 2W1IA 4MX9A 3QTSA 1YWNA 2YIWA 4ZSGA 3W1FA 4CNHA 4NZWB 3RMFA 4IADA 4A07A 2UZTA 5T68A 1JKKA 1GZ8A 4BGQA 3LQ8A 3KRXA 3MPTA 4F1OA 5AAGA 2HELA 4A9YA 1Q24A 5CAOA 4BCOA 3SAYA 3TZ8A 4YBJA 5AEPA 4X0MA 4CFWA 4EC9A 5DT3A 2OWBA 4WG4A 5KNJA 4CFXA 1BKXA 3R8ZA 5A4EA 3D2IA 3KF4A 1WVYA 4CFNA 4DA5A 4O27B 4U80A 4E6DA 4LGHA 2BPMA 2R3GA 5HX8A 3PDTA 2PE0A 3IW7A 4UWBA 1NVSA 3F7WA 2VO0A 5I4NA 2NO3A 2R3QA 2W7XA 4PNKA 3W2PA 4FEUA 4FNYA 4ALUA 1A06A 2C6OA 1AD5A 2W4KA 3MB6A 3F3VA 3QD3A 3PJ3A 4RGJA 5TE0A 2FSLX 2VO3A 1UU9A 3DJ6A 3MY0A 4LOPA 2WELA 2XM9A 4ASEA 4C2VA 2XJ2A 2O63A 2OH4A 4FTUA 4AZSA 2BAQA 3ORMA 3I0QA 3OEZA 3ORTA 5AIRA 2VTHA 4O96A 4Z9LA 3QBNA 3PXRA 4RX8A 5ACBC 4A9RA 4B4LA 2ZV2A 3VVHA 2XCKA 3GCUA 2UVXA 1FMOE 4G3EA 3FYKX 4EH9A 3BHUA 3OEFX 1ZYJA 1GNGA 4TYGA 1UWHA 3OD6X 5K3YA 4EOIA 1Q41A 3R83A 3MWUA 4ZY6A 1FOTA 4EH3A 4JG7A 4IX3A 3CCNA 4E20A 2VGPA 4YSJA 4O0TA 2FUMA 3NGAA 4JG6A 4YO6A 3V5JA 3AC4A 3BV3A 4BIEA 5J5TA 2VNWA 2R3RA 3O96A 5IZFA 3TIZA 1JNKA 2YDIA 1SM2A 3K3JA 3KRJA 4FKUA 3ZRLA 3DT1A 3ORNA 4BF2A 5K4JA 3R8UA 4GFMA 5AP5A 2H6DA 5KMKA 1JPAA 1I44A 5CNOA 5AFVA 5LVMA 4BTFA 4WKQA 1Q3WA 2QG5A 4JDIA 4OTQA 2WQMA 3QD4A 4QMPA 1KSWA 4PRJA 1PYXA 3EKNA 3FKNA 2RIOA 3FMJA 3KGAA 3FZRA 4AFJA 4DEAA 2GQRA 1H1RA 5FXRA 3TJDA 3L9LA 2VTRA 3QAME 5M57A 2R3OA 5FQDC 2F2UA 1UKIA 2BZIB 2WTVA 4FZFB 3IW4A 4L9IA 2OI4X 4V0GB 4E5AX 5C26A 3FYJX 5L6OA 4PPAA 3CP9A 2OFUA 4MF1A 4IEBA 4O4CA 3NNUA 4I1ZA 3A2CA 2H8HA 4PX6A 4AFEA 5IQAA 3AGLA 5EOLA 4RWIA 2R4BA 2CHLA 2XALA 4DH7A 3PRFA 1CM8A 1RE8A 1XR1A 3HMOA 1SVEA 3FZTA 5FEDA 4C57A 4D2SA 2BAJA 2C3LA 2VTPA 4FK3A 3F61A 3I7CA 4PP9A 4QNAA 3ZUTA 5J1VA 3P1AA 2UZEA 3GBZA 3LXLA 3GU4A 1XH6A 3LIJA 5J95A 4E4NA 4EJNA 3QRKA 1ZARA 2W5AA 3G6HA 4MD9E 4C2WA 3NR9A 4O7LA 3MIYA 3RHKA 3UG1A 1VR2A 3DFAA 4EOMA 4R7HA 4GU6A 4NW5A 5E8ZA 2ETRA 2XNBA 5HVKA 2WU6A 4AG8A 4E5WA 3GFEA 4JI9A 4PMMA 5M56A 3OUNB 4BDBA 3QXOA 4F1TA 5IH5A 5HG9A 5CSXA 2Y9QA 3QYWA 4Q5EA 2JIUA 3FZOA 4BI1A 4BZNA 4ZTNA 3H3CA 4JBVA 4WOVA 4N57A 4DH5A 5ETFA 3ZC6A 4BZOA 3LCTA 1V0OA 3MSSA 3CD3A 4FX3A 4Y8DA 4KIKA 5HOAA 4KIOA 3GEQA 4IH8A 4MQ2A 4RLLA 5CTPA 4HYUA 4NTTA 4L7FA 3L9MA 5CLPA 1XH7A 2QHMA 4C33A 4RZWA 1FGKA 2RFSA 4BY9E 4U40A 4DEHA 4TYEA 5CSWA 2C68A 2VWBA 2ITOA 3MA3A 5AIKA 4BDDA 5EDPA 1P5EA 4R5SA 4XG2A 3RK9A 4FT3A 2J51A 3ZEWA 1RDQE 5KMLA 1UKHA 4GIIA 3KEXA 3LFBA 4TWNA 4Y95A 3ZBFA 1P14A 3O5AA 2REIA 3GP0A 2QR8A 4B8MA 3FY0A 4N4SA 4UN0C 2WMUA 3PIZA 4W4YA 4Y46A 4NKSA 5ETAA 1BMKA 3LKMA 4UEUA 3U6HA 3OCTA 2Z7LA 4EH7A 4PP7A 5F94A 3ITZA 3TNQB 1XMLA 1U59A 3V51A 3VW8A 1Z57A 4L3LA 1VYZA 1PMNA 3AD5A 3DK7A 2NP8A 3OWJA 3AMAA 5L6PA 1REKA 4FTTA 1B6CB 4M66A 1JWHA 3WF8A 4LGDA 5K0KA 2P0CA 4AAYA 4KKEA 2YZAA 1Y8YA 1PW2A 1Z9XA 2YM3A 2XK7A 4EKLA 5AV2A 2Y4IC 5CAVA 4U7ZA 3VJOA 3QL8A 2G9XA 2E9UA 4W8DA 3IPHA 2VD5A 1URCA 3BYOA 3HEGA 4TRLA 2Q0NA 5GZAA 3CY2A 3TMOA 1Q99A 3KULB 2JIIA 3TTIA 5ANIA 3ZUUA 3NIEA 4HZSA 3KRLA 4CCBA 4FIEA 3BYUA 3O51A 4FV0A 4GH2A 2EUFB 2Y0AA 3R9HA 3UYTA 2HY0A 4A9UA 5AP0A 2OF2A 4JDKA 5HICA 3ZLXA 4D1ZA 5BVEA 2DUVA 3FV8A 2ETMA 3GENA 5DEWA 3EYHA 5AR3A 3Q2MA 1Y6BA 3W10A 4DBNA 2JGZA 2X7GA 5AWMA 3NRMA 5J7BA 4I6BA 4AA4A 4D5KA 2W4JA 1YRPA 1GZNA 2V7OA 2PSQA 4PNIA 5TOZA 4C02A 3F5GA 4JAJA 4XX9A 3UQCA 2IZTA 3FPMA 3CJFA 4ASXA 2W06A 5J8IA 4BFMA 3AD4A 4NM0A 1XQZA 3OP5A 4YJRA 2R3PA 4F9CA 4AXDA 4K6ZA 4TWCA 1KUTA 2QO9A 4J71A 5FTGA 1YXXA 2CCIA 4AOIA 3UPZA 5LCKA 4A4OA 4O7YA 2UW9A 2PMOX 3VQUA 2R7BA 3ODYX 3QWJA 2O5KA 1O6YA 4AACA 4C61A 4I6LA 5CU3A 2CKOA 4HCTA 1Q8WA 3C1XA 2X0QA 4RX5A 3RBWA 4DEGA 4U42A 3PVWA 3IDPA 4CRLA 2B0QA 3H0YA 1CTPE 4HVGA 2VX3A 2JIVA 5I0BA 3BHTA 2QKWB 3N51A 5M53A 3V04A 3R6XA 3MVJA 1Q8YA 4F9BA 3CIKA 4RVMA 1DS5A 4O83A 3NVKI 5AMNA 2I1MA 4WSQA 5H8BA 5AR8A 3EH9A 2XH5A 4WNMA 5E91A 4FICA 3UE4A 2YIXA 3FHRA 4QYYA 3PYYA 5DPVA 3TN8A 3HAVA 2A4LA 4FOBA 5FLFA 1B39A 4RPVA 1ZY4A 3ZBXA 4BL1A 4D4SA 4F9WA 5DNRA 3NEWA 1IG1A 3VS0A 3HDMA 4O86A 2GNHA 3DJ7A 3I81A 3V8SA 2J50A 3VF9A 2PZPA 3VS5A 4MUQA 3FMNA 2QOHA 4RRVA 4DH8A 4U3ZA 4BDJA 2VV9A 3W0RA 4Y85A 1SNUA 1QPCA 4JQ7A 5EHOA 4NU1A 5I9VA 3BWFA 3KU2A 4GK3A 4IB0A 3FPQA 5M44A 3UO4A 2ZB1A 5D11A 4RC3A 4MNEA 5I9ZA 3LXKA 3V8TA 4TYHB 5IF1A 2GFCA 1G5SA 4U43A 1ST0A 3FQHA 3QTIA 4GFGA 5L4QA 3QD0A 5CXHA 2CMWA 3THBA 4OUCA 4HVDA 4D5HA 2CLXA 2XKCA 1Y91A 3EQBA 3ZSGA 4ZSAA 5CI7A 1KOBA 1ZOHA 2WHBA 2C47A 3NYVA 5HTBA 1QL6A 5DA3A 3A60A 4G6OA 3W2OA 5JMSA 3RALA 2HOGA 1O6LA 3PZHA 2XNOA 4FNXA 4RQKA 2FH9A 3QQKA 4NCTC 3D2KA 4BDAA 4BKJA 5IMXA 4TN6A 5HE0A 3DKGA 3OBGA 4EOQA 3F7ZA 3RVGA 2WD1A 2DYLA 3UOLA 3LM5A 3ENMA 2GNGA 1OL7A 3P7AA 3GGFA 4OTRA 4E7WA 4JDJA 2R3MA 3RAHA 2PUIA 4RJ6A 3I6WA 3A7HA 3Q60A 3LM0A 4D9TA 3MV5A 1ZZLA 2BRHA 3POZA 4GKIA 3LFCA 5BVKA 3BLAA 3RCJA 1MRVA 3TUCA 5AR4A 3U9CA 4G3DA 2PE2A 4BCGA 3F3UA 2UW4A 1TQMA 4GRBA 2I7QA 5HQ0A 1YDTE 4YC6A 2XK9A 4G1WA 3VS2A 3VRYA 4D1SA 2RG5A 2IVSA 2XK3A 3PY0A 5DR9A 2I0YA 4F9AA 3FUPA 3LMGA 4U41A 5HCYA 2WTKB 3MFSA 4XLVA 3RNYA 2GU8A 4EORA 2QONA 1PKGA