2JKKA

Focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
258
Chain Sequence
RDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Fak Kinase in Complex with Tae226 and Related Bis-Anilino Pyrimidine Inhibitors Reveal a Helical Dfg Conformation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 82
structure length 258
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jkkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jkkA01
3E3PA 1OUYA 4AT3A 2Y7JA 3E92A 2PTKA 3SRVA 3UNJA 2A27A 3KL8A 4E20A 3CIKA 3TXOA 5LVOA 4G9CA 5FQDC 3TJDA 3EN7A 2E2BA 2YIYA 2XH5A 4LOPA 4Z7HA 5L2TA 3D83A 3O96A 4GU6A 3RNYA 3T9IA 3H30A 4C33A 4FSUA 4D1SA 4CLIA 3F2NA 4HNIA 4BCNA 2IPXA 2ESMA 2VTLA 5AA8A 1GOLA 1WMKA 3FLNC 3LIJA 5L2WA 4S33A 3PWDA 3QGWA 4OTWA 2IG7A 2XIRA 2HIWA 3TIYA 5CI7A 3PVBA 3PXKA 4DFLA 4YGAA 5AMNA 1KE7A 1VEBA 4R1YA 2XK8A 3DAEA 2A1AB 3UYTA 4DYMA 5I9ZA 3V6SA 4IZ7A 2W99B 4W9WA 4XLVA 2V55A 5C27A 4FUYA 2O3PA 4G6LA 4HPUE 4MYGA 4YO6A 4ZTNA 5IA5A 5B2MA 2YAAA 2BZKB 3PIZA 3DTCA 4WRSA 3JUHA 1VR2A 4BI2A 4F64A 1E9HA 2BTRA 3QQUA 4Z9LA 1H8FA 3GC9A 1DAYA 3V8SA 4BHZA 4O27B 4KRDA 3ROYA 2C69A 3RPSA 3SC1A 5CU4A 4C57A 3SD0A 4J98A 2EXCX 4G5JA 1WBTA 2HOGA 1IA9A 3UO4A 4QQ5A 3U6IA 4UMQA 4QTBA 4GG5A 5BX0A 3R63A 4BYJA 4BGHA 3FZRA 5AP0A 2PVLA 4RQKA 3VJOA 3VUIA 2C0OA 4D2RA 1SVHA 4R7BA 2YLFA 1J7LA 5KUPA 4AE9A 3C13A 4FYNA 1JKSA 1SZMA 5E92A 1P4OA 4ZP5A 3PXQA 4CFNA 4DFUA 1NT2A 3KQ7A 4IX5A 4IAZA 4TWPA 3QQGA 4YZMA 3RAHA 5C4LA 4DLIA 2WAJA 3L9MA 2P4IA 3WBLA 4BTKA 5H3QA 5HE0A 5AR3A 3SQQA 4I5MA 3NMUF 4RMZA 4QQJA 4JRVA 2ERZE 2WTVA 1YW2A 2W0JA 5HZNA 1YHVA 1B38A 2W1EA 3R7IA 3ORTA 3KN6A 2YM6A 1CDKA 3LW0A 2OJIA 3QLGA 5FWKK 4MD9E 5J9YA 1Q4LA 3NW7A 4CTCA 3VW8A 5EYCA 2BIKB 2OBJA 2R5TA 3LZBA 4QD6A 3IDCA 3PIYA 4M97A 3CPCA 4PRJA 3R7YA 1Q8ZA 5H9BA 4MF1A 4I5PA 2V7AA 4CKJA 3R7EA 1PKGA 2Y6MA 4GVJA 5JK3A 2VTMA 4D2PA 3OOGA 2B0QA 3QL8A 3W2QA 5FXSA 3KRXA 4MEDA 5KMJA 4QNAA 4KNBA 3KRRA 4ACGA 4WNMA 1OPKA 1M7NA 4GT3A 5FDPA 1KOAA 2GNJA 1OL1A 3IONA 4ARKA 2WGJA 4KUJA 3MY0A 5CU0A 3VW6A 4DH3A 3QQKA 2Z7RA 4AACA 2E9VA 3RINA 4RVLA 4DEDA 3EL7A 3LFQA 3F7ZA 4NIFB 5DN3A 5L6OA 3OEZA 3R7UA 1YI4A 2F2CB 4FI1A 4MAOA 3IG7A 4ZLOA 4RWKA 3LMHA 4A4OA 2BRMA 2OF4A 2C0TA 2XUUA 3VS0A 3PP0A 5IQIA 1BUHA 4G3CA 5ETIA 4O7WA 4USEA 4O86A 4BI0A 3WF6A 4S31A 4F65A 3OHTA 1YHSA 3LCOA 1YXSA 3VJNA 1H1PA 2YFXA 5I9XA 2QOHA 2W1FA 1H08A 1OM1A 4GL9A 4UZHA 2LGCA 4C4HA 2WMWA 2Y4PA 4R1VA 3DBQA 4EH5A 1BYGA 2YM7A 3A7GA 4M66A 3RHXA 3L8XA 2QNJA 3H9OA 3W16A 4C8BA 5M53A 4HVHA 4FTJA 5L8LA 2UZNA 4RC2A 3NUXA 4O0YA 2R3JA 3MB6A 1DAWA 2OFVA 3ULZA 4G3FA 3EQBA 5IZFA 2X81A 3B2WA 2RG5A 1B39A 4DG0E 2WMXA 4EH6A 3O51A 3R1QA 4HYHA 3CY3A 3H3CA 4FC0A 3V3VA 4BDGA 2HCKA 4ZY4A 3ZDUA 3I5NA 5E8WA 4ZXTA 3LAUA 4LQMA 3HV3A 5HTCA 2PE1A 3UVRA 4C4EA 3QZGA 2ITWA 3OCSA 4FUXA 4LG4A 3EJ1A 3PZHA 4K2RA 5EOLA 3HUCA 5AIRA 5TF9A 3G9LX 4IB5A 5EQYA 3RWQA 1WBSA 2CNQA 5IQBA 2WTJA 2QG5A 3PSBA 1GNGA 4AX8A 1O6YA 1DI8A 4BDDA 2W7XA 4J53A 4HGLA 3FXWA 1PXIA 4O96A 3FQHA 3VUMA 5HU3A 4FODA 2VTAA 1Q8YA 3OWLA 2XK7A 4L45A 4QP8A 4W8DA 4AAAA 5A46A 3DZOA 2ZOQA 3L8PA 3MA3A 4D2SA 4EHEA 3VHKA 3KRLA 4LMNA 3SW7A 5I9UA 3UPXA 5BUIA 4YJOA 4XP3A 4A9SA 4AZVA 2QI8A 5E91A 5HX8A 2R2PA 5KNJA 4WNOA 3D15A 2ONLA 1FINA 5AR7A 3VUGA 1ERKA 4GYIA 1W8CA 4DA5A 5ANGA 3HEGA 4DITA 1V0BA 3MIAA 4YR8A 3KCKA 4I6QA 5DNRA 4D9UA 5LVPA 3QUEA 1UV5A 2A4LA 4FTUA 4P7EA 5C9CA 3ZHPC 1PKDA 3LJ1A 3ZH8A 5M57A 5IQEA 4UXLA 3DKFA 3MVHA 4JAIA 4CV9A 5B2KA 2UW0A 2WTCA 4E1ZA 4QQTA 2YITA 4G3GA 2NNWB 4DC2A 2I1MA 5A4QA 4GH2A 3MFTA 2WEVA 3KMMA 1OKWA 3MTLA 1KE8A 4FV4A 5DFPA 5JGDA 5AUYA 3DK6A 4AE6A 4DN5A 3GCPA 4XOYA 3LLTA 2PZPA 2GSFA 3GB2A 4JDIA 3E63A 4KAOA 3MN3A 5HCZA 4GK4A 4CYJA 4RRVA 5D7VA 3O17A 4NYEA 3AGLA 3IO7A 4FKIA 4EONA 3RPYA 4F7NA 4R3PA 5AUVA 4XV3A 5FLFA 4UZDA 3VS5A 4HYUA 2UZDA 1A9UA 4IM3A 4KS7A 2X8EA 3R7GA 1RW8A 3Q60A 4AQCA 3QUPA 3ZM9A 3F5GA 2A2AA 4CFVA 3CGFA 3A60A 3HV5A 3FC1X 4QMSA 4I20A 1YKRA 4C3PA 4GFMA 3AD4A 1Y6AA 1H24A 5CS6A 5E8VA 2VTSA 4RFYA 3PG1A 2XNPA 4E4XA 2ZVAA 5AX3A 4JI9A 3CPBA 3TDWA 2YHVA 2VU3A 4IX3A 1YXUA 5TOZA 5CEKA 2P55A 4XG6A 4ZS0A 4BGGA 4DFNA 2CMWA 5BVOA 2XB7A 3NUYA 4X2GA 4HCTA 4D55A 3DTWA 2ZMDA 3AQVA 4OTHA 4H3PA 2XNOA 3UIXA 2J5EA 4KIOA 2C6MA 4BCGA 4WNPA 4AGUA 4H58A 5KMNA 3DBDA 4J71A 3MI9A 4FEWA 4IB1A 2H96A 5IUIA 3NNXA 1JKTA 3RTPA 4I6BA 4MWIA 3V5LA 2VD5A 3MBLA 2Z7QA 3PY0A 3POOA 2BRNA 4CXAA 4RX7A 4TZRA 3O50A 4BC6A 2CGWA 4IX4A 4AW1A 1V1KA 4JG6A 3UVPA 3COIA 4YLKA 2WQEA 2BR1A 3HX4A 3NCGA 4X21A 4C02A 4C38A 4BCOA 3DKGA 3NAXA 3PLSA 4LOOA 5FP5A 2IZRA 4ID7A 4MBIA 4EYMA 4FTTA 4PTGA 4HPTE 2C6KA 3I0OA 3OBGA 4IB0A 4R7HA 4MQ1A 3U55A 5CANA 1ZWSA 3T8OA 4GCJA 4QMOA 5F95A 3I5ZA 4FTIA 4L52A 3R04A 3TNQB 4I4EA 5L4QA 4R3CA 2JC6A 4GT4A 2V22A 4EI4A 4EQMA 5FM2A 2OWBA 3C5UA 4PNIA 4BF2A 1U54B 4EQCA 2ZAZA 5ANDA 5JN2A 4O22A 4QTCA 4K8AA 3QQFA 4OBQA 4F9BA 5ANJA 4R78A 4ERKA 4L00A 5JGAA 2YLEA 3EMGA 2YERA 3HMMA 3GVUA 1OIRA 3LCDA 4GV1A 3RP9A 3E7VA 2O2UA 4TKSA 3D7ZA 1WFCA 3LXKA 5T3QA 2R7BA 4HCUA 2UW8A 3QTQA 4BWXA 5CEPA 3FMLA 5IEXA 5L2IA 2CKEA 5BVWA 4JX3A 4KKEA 2O5KA 4TT7A 1UU3A 2EU9A 3F3ZA 1YXXA 4EOMA 1Q8UA 5DE2A 4NL0A 3H0YA 3V5WA 3D14A 4PL3A 5FXQA 5EYMA 5A4EA 4FG9A 4OGRA 5HICA 4XP0A 2VX3A 2WMVA 4DEBA 1Y57A 3AC1A 4UV0A 4EOSA 1H27A 4I6FA 2RIOA 4CMUA 5HO8A 2JKQA 3R01A 2C6OA 1O9UA 3DNDA 3FMKA 4JJRA 4X3FA 5DGZA 4C0TA 4EOPA 5ITAA 3NUAA 5G6VA 2H6DA 1P2AA 3FEGA 1W7HA 4ZLYA 2UZLA 5GINE 4WRGA 4G9RA 1YDTE 2XBJA 5EK7A 2C4GA 3MPTA 3KULA 3QCSA 4X7QA 3BYOA 3UG2A 3D7TB 3OVVA 5LMBA 2XNEA 4FTKA 3TCPA 4FKUA 2CNVA 4L9IA 2BHHA 1DM2A 2QD9A 3ZRKA 3FMEA 4CKRA 3Q5ZA 3ERKA 1OB3A 3QXOA 4YURA 4NM0A 5AP1A 3SOAA 5I3RA 4ZJJA 4EUTA 4X3FC 2WQMA 1Q61A 4IZYA 2OU7A 4GSBA 2R3PA 4PL4A 4WOVA 4ZSLA 3K54A 5HVKA 2UUEA 4L8MA 4FA2A 3E8DA 3HMIA 3R2BA 3RK7A 2HELA 4FKRA 3ZXTA 2X0GA 4EKKA 2PUIA 3HL7A 4D5KA 1UA2A 4IQ6A 4XG9A 2OIBA 3OS3A 4FK3A 2KTYA 5T6KA 2XNBA 4BZDA 3FHRA 4BFMA 3EN4A 4IDVA 5AV4A 4D4RA 2J9MA 3P7CA 3VVHA 3I1AA 2VGPA 4AN9A 3DK3A 3OXZA 2IVSA 4M67A 5JFSA 4K77A 3A62A 1QPEA 5IQCA 4AZSA 3HYHA 2ZJWA 5D41A 4HCVA 4I21A 2BILB 3DDQA 4G2FA 4P4CA 5JRQA 4BR3A 3H9FA 3I7BA 3MH1A 4RBLA 3OW4A 2XA4A 5T68A 5DR6A 4RIYA 3HDNA 1FVRA 3ROCA 4F0FA 4KSQA 1Q3DA 2C6LA 2HZIA 4FICA 3ZRMA 4N57A 3BV3A 5L2QA 1U5QA 3AT3A 2XBAA 4PMMA 1PY5A 3LJ2A 3WZKA 3ALOA 3VBWA 3DB8A 3VS1A 3QKMA 3I60A 4CT1A 2Y0AA 4EBVA 5AR5A 2VWYA 3KXZA 3U9CA 1QPDA 4IAKA 4QMUA 3CKWA 4C7TA 3NW5A 5A4CA 1Q24A 2QR8A 1H07A 1H26A 3II5A 4FMQA 2W5BA 3KC3A 5LVMA 4TW9A 5DYJA 1JSTA 4E6CA 2C5OA 2VTQA 4YZCA 5CZIA 5AM7A 2QOBA 1F0QA 3JVSA 2WNTA 5DVRA 3G15A 3UVQA 3ZEWA 1HCLA 3BIZA 5EI2A 4EK8A 4FGRA 3FZ1A 3PXRA 5HESA 4DEGA 5KE0A 4QMWA 3SX9A 1IASA 3HECA 4XX9A 1Y8GA 4RLLA 3W10A 2GS6A 3R1SA 2C6DA 4ZY5A 4ZTQA 1PXKA 5AV1A 3EFLA 4NEUA 3NLBA 4HZRA 3QTUA 4IM2A 3R73A 1TQPA 1OECA 3KULB 4PDPA 4UY9A 2JBOA 4L3PA 2RKUA 2X4ZA 4MNEB 3HRCA 3OY3A 4IBMA 5H2UA 4XG7A 3E8NA 1GZ8A 4FL3A 3WOWA 3VBTA 1UNGA 4CQEA 5FUTA 3G33A 4I23A 2BHEA 3D4QA 4I5CA 4YZNA 4CZUA 2KULA 3NYNA 3JR1A 3MVMA 3QTRA 2YISA 4BRXA 4ACDA 5JKGA 5AUZA 4BTJA 4MXZA 3Q4UA 3PZEA 4G16A 4M69A 3F82A 5J9LA 2I7QA 3A99A 1V0OA 2W1CA 2WTDA 3EN9A 3OFMA 2G2HA 3ZLXA 4APCA 4ASXA 1ZZLA 4LV8A 2JBPA 3NSZA 3LFDA 4MXCA 2IZSA 1J7UA 3V01A 4L3LA 5A4LA 3FI4A 5IEYA 5CAUA 1CMKE 1XH7A 4IC8A 3BLHA 4ZLZA 3U6JA 3R7VA 3TN8A 3PRIA 3NNWA 4GRBA 3LCKA 4E4LA 3BU3A 3E8EA 4A07A 2Y4IC 1J7IA 3LPBA 5F4NA 4RIYB 4BDJA 5DWRA 2EVAA 4LYNA 4PDSA 2ITYA 4NK9A 5HNBA 2CCHA 3QU0A 4ASDA 4R6VA 2VNYA 3GC8A 4YMJA 3TKIA 4D5HA 2XEYA 4YJUA 4M14A 2UZEA 1KE6A 5CQUA 2QCSA 4ZTHA 4U79A 4BB4A 4FL1A 2WU6A 5KMOA 4FBXA 2R3RA 3E87A 4XV2A 4JOAA 2PU8A 1UU7A 1YOJA 4LOQA 4QYFA 5HVYA 5HE1A 3QBNA 4IWOA 2JDOA 2VWZA 3IPHA 4CCBA 3DKOA 4IDTA 3CD3A 3PXFA 4RWJA 3ZUVA 4F9WA 3EN5A 3CTHA 3MFSA 3OBJA 3BBTB 4M3QA 3P23A 2XNNA 4EK5A 3CP9A 3OT8A 3RAKA 4EJNA 5LARA 4TN6A 1BI7A 2G2FA 4FKLA 2B9HA 5HHWA 4B8LA 2CKOA 4A4XA 5M44A 2ZB1A 5B7VA 2IW6A 3BE2A 4IAFA 3FYKX 4CFMA 4F0GA 1FQ1B 5CY3A 4PDOA 4EZ3A 4L46A 5CVGA 4DAWA 4TWCA 5ACKA 3C4XA 5AUWA 4XP2A 4Y72A 1AQ1A 1FMOE 3MH2A 1ZARA 2G9XA 5EG3A 2CGXA 4Y73A 2VWXA 2W4KA 2C30A 3RBWA 4O6LA 4C3RA 5LVLA 2B53A 2PVYA 4RG0A 2XKEA 4AXAA 5IEVA 2VUWA 1WBWA 2BTSA 3JY0A 4QT1A 4UN0C 3ZMMA 3KCFA 1YRPA 3VWAA 4O84A 3LOKA 3TNHA 3CKXA 3UBDA 3F3WA 3GU5A 4IE9A 2R3GA 2J4ZA 2Z2WA 3DGKA 5AAFA 2BKKA 4QNYA 4CVAA 2R9SA 5LMKA 2YDJA 2JDSA 4KS8A 2A0CX 2OZAB 3L8VA 3QRJA 3FMNA 4TYIA 4XG2A 2B52A 3DJ7A 3GU4A 4DFXE 4D4YA 3V5JA 2ETKA 2XNGA 3DU8A 3NX8A 3UP2A 2UZWE 3PVUA 4KINA 4LM5A 5M55A 2OXDA 4IWQA 3VS3A 2B55A 4O82A 4FV7A 4C34A 3DJ6A 4USDA 3GCQA 4U40A 2WMUA 4QMQA 2R7IA 1M7QA 4MH7A 5IQGA 2J50A 4AF3A 3D5WA 3P0MA 4YUQA 1KOBA 3OROA 1JPAA 3NPCA 4TXCA 3OD6X 5BUJA 3W2CA 3SW4A 5IISA 1MUOA 1XH5A 3EOCA 3O8UA 1GZNA 2CDZA 2FSMX 4AGWA 3ORKA 4E4MA 1JAMA 2JAVA 4U8ZA 5M4UA 3KXMA 1NY3A 1APME 2C6IA 3ETAA 1K3AA 2R64A 2P2IA 3DAJA 2C1AA 3FL4A 4J1RA 5F20A 2P0CA 4J8NA 3CSVA 4DF3A 3DXPA 4TRLA 3IK3A 1UNLA 4QO9A 3PSCA 4EH3A 5D7AA 3AMBA 2QHMA 4FSNA 3P08A 4LRKA 3Q96A 4G3DA 5IMXA 1K2PA 2QOQA 2ZDUA 4XUFA 2R3LA 5CSVA 2AC5A 4ZSEA 3N4VA 3W55A 3FKNA 3R1NA 5DRBA 3FE3A 5KMMA 5IUGA 2WMBA 5GZAA 3IECA 1WVWA 3F3TA 3P4KA 3EFWA 3QKKA 4G6OA 1Q3WA 4QMZA 4V04A 2ETMA 4RWIA 2WMTA 3D5XA 2QKWB 4IACA 4UALA 5HO7A 4F9AA 1URCA 4OTGA 5HE3A 5EH0A 5AAGA 4ZZOA 2OKRA 2C3LA 4YZDA 5CNOA 1EH4A 2ACXA 4Z7GA 1CKPA 5CU2A 5A14A 5CU6A 4EUUA 4ZY6A 4QMTA 2A19B 5AV3A 3NNUA 1YWNA 2WOUA 3KKVA 2OH0E 1Z9XA 3WZDA 2BDJA 3G0EA 4L43A 3DFAA 3DXQA 2W1ZA 3KY2A 3IKAA 4OLIA 4EEVA 1ZYSA 5KMKA 3EKNA 2UZBA 1GIHA 3WARA 5C8KA 4Z3VA 2R0UA 4QYGA 4Y85A 4I6HA 3PUPA 2DWBA 4B7TA 3OT3A 3FAAA 3QD3A 3BZ3A 2XM9A 3R71A 2J0KA 2ONLC 2YM5A 4IXPA 2QOLA 4TYHA 4BCHA 3U6HA 4K33A 4WIHA 2VWVA 5HE2A 5LMKC 4JBQA 4RJ6A 2PE0A 3FY2A 3RAIA 2R3MA 5ETCA 2HENA 2I0HA 4HYIA 4FEXA 3PWYA 1R0PA 2I40A 1UU9A 1TVOA 5C4KA 3TM0A 5BVNA 2FSOX 2Z7LA 4QMPA 3QQLA 1XJDA 2GHGA 3ODZX 2W4OA 3ZC5A 2G01A 5J1VA 3MPMA 2UVXA 2GMXA 3TI1A 2BDFA 2VV9A 3D0EA 4YLLA 3C0IA 2RGPA 1JKKA 1YI3A 2IVVA 4BDHA 1RE8A 1BL7A 4FTCA 3SG8A 2IVTA 3UODA 4RX8A 4IM0A 3R21A 3P7BA 3ZZWA 1KE9A 3QRIA 3TZMA 5J9ZA 3KXHA 3V51A 3WI6A 3GCVA 4N6YA 1F3MC 3C7QA 4V0GA 4DFZE 4ORKA 1NVRA 4GK2A 4RIWB 2PVNA 4X2NA 4H1JA 4D4SA 3UC3A 5EHOA 5L6WL 1T45A 4HGSA 3S2PA 5IU2A 3WZJA 1GY3A 3CR0A 3IS5A 4ANNA 4II5A 3JS2A 3QXPA 2DYLA 2AUHA 2X2MA 3OOMA 4AU8A 5K4JA 5EDPA 2QU5A 3N51A 3QHRA 3KXXA 2DS1A 1ZOHA 4S30A 3ANQA 3E62A 4FF8A 2IJMA 1IA8A 1QPJA 4RVKA 4E3CA 3BHYA 4NKSA 3NS9A 4HOKA 4BWPA 2IO6A 3VULA 4JL9A 4E6QA 5HG8A 1MP8A 3GU6A 1IRKA 4PMTA 3W2PA 3DDPA 4NZWB 2I0EA 4NTSA 3NUPA 2QO7A 2E9PA 2BDWA 3PPZA 4FSRA 4K0YA 4FIJA 4FSZA 4CFXA 3R8VA 4BBEA 3FQSA 3KREA 5J95A 1OUKA 4ANQA 3VUDA 3VF9A 3ZUTA 2C3IB 5M4CA 2FO0A 3H4JA 1QL6A 2W96B 5E8ZA 4ZEGA 3BGZA 3ZYAA 3EFJA 3E64A 4HGEA 4JG8A 4TYHB 3ZSHA 5BVFA 3RCJA 4AW5A 1UWHA 3A7IA 5AIKA 4A9YA 2OI4X 2J0IA 2V62A 3ZO1A 4U97A 2IZUA 1AD5A 3FZOA 3F5XA 4LUEA 3F61A 3MIYA 3EKKA 4DGGA 2GCDA 5IDPA 4PDYA 2QOFA 1OPLA 1SNUA 2W9ZB 3QUDA 4O0VA 4A9TA 4EK6A 3OG7A 4E5AX 2FB8A 1WVYA 4DH5A 5CENA 4M7IA 4DCEA 4DBNA 2VTRA 2CLQA 4RVMA 2C5YA 1H28A 3DNEA 4JRNA 4L42A 4NM7A 4XNEA 3BE9A 3UOKA 4O7YA 3A7JA 3TG1A 3D7TA 3FV8A 5AP3A 4F7JA 4UWBA 2X9EA 5HD4A 2PVFA 3D94A 3ZSGA 3KU2A 4EH4A 2ZV8A 4FKJA 2PVKA 2NO3A 2WIPA 3OXTA 4MD8E 3PA5A 4OT6A 4RGJA 4W4WA 5HG7A 2CSNA 3CQWA 4C61A 5CF6A 5IA1A 4FNZA 2CKPA 1U4DA 3ACKA 3QGYA 4NT4A 3IQ7A 4F4PA 1UNHA 2RFNA 4FV6A 4XG3A 5KZ0A 3IGOA 2QHNA 3PG3A 3UQCA 3OCTA 4OAVB 2UZVA 4DLJA 2CHLA 4BKZA 1IAHA 1VJYA 2QO9A 5BVDA 3VBYA 4AFJA 3AGMA 3PJ3A 4UBAA 4H36A 4E7WA 5LOHA 2WD1A 3B8RA 3W33A 4EH7A 3WYYA 3C9WA 1KV2A 4BBFA 5A3XA 5KMLA 5E1EA 2YWPA 3GXLA 3T3UA 5HU9A 3CCNA 5DI1A 1U54A 1STCE 2R3HA 2R4BA 3F6XA 2QOCA 4U81A 4IX6A 4XHKB 4X2JA 5CSXA 4YJQA 4TTHB 4H3BA 4N0SA 4U42A 5D12A 4I0RA 3AMAA 3WF8A 3EQPA 2W06A 3CLYA 3MGYA 4BDCA 3NZ0A 4DEIA 4O7TA 4APPA 2VTTA 3RWPA 4RJ4A 4O1OA 3Q32A 2OSCA 4LI5A 4GS6A 3Q6WA 4NW6A 4LGGA 2XM8A 4C37A 4DH8A 5BNJA 2XKDA 3HA6A 4L7FA 3LM5A 5AUUA 3N9XA 4FKWA 4CG9A 4JLCA 1VYZA 3QC4A 4GIHA 4GW8A 4JVGA 3BU5A 4U7ZA 5G1XA 4BCJA 4CRLA 4FV8A 5A54A 1PXJA 5F9EA 3QAME 4RFMA 1PYXA 3ORMA 3V04A 4EOIA 2GQGA 3NDMA 2PZRA 3DBCA 2YJSA 3KVWA 5I9YA 3Q2JA 4TNDA 3V6RA 3Q5IA 3S1HA 4FEVA 4Q9ZA 4JDKA 5CF8A 3TZ8A 4C4GA 4EHZA 3UGCA 1T46A 4W4XA 3L9PA 4G17A 4BIBA 2YM8A 3TNWA 4H1MA 4E5BA 1M2PA 2PY3A 4NUSA 3OWKA 3DPKA 5GIOE 5GIPE 3SHEA 4GEOA 5E90A 4JQEA 3PE2A 5EM7A 4ONAA 4YC8A 4YU2A 3MFRA 3R8ZA 2VO7A 3FKLA 5GZ8A 4EZ5A 3TDVA 2WO6A 3W1FA 2J90A 5HBEA 3CY2A 4GFGA 2XEZA 4DH7A 4LV5A 3R00A 4FSQA 3HRFA 1JOWB 1NVQA 5IA2A 4XEYA 5JQ8A 4N70A 2VX1A 1TQMA 3FMHA 4IHPA 4O6EA 1PF8A 2UW3A 5EDRA 4DGNA 2DUVA 1SVEA 1Q62A 3FQEA 3ZEPA 4UWCA 5E8YA 3KA0A 4GKIA 1OVEA 3NVMB 3SG9A 4CT2A 4ZSAA 3E5AA 2Y9QA 3EQDA 3RKBA 3R9DA 4D9TA 1SMHA 5IQDA 5JZJA 2GPHA 2W1IA 3R30A 2WTIA 5CT7A 2XP2A 3B2TA 3S0OA 3DLSA 3NVKI 2J0MB 4UB7A 5KKRC 5IPJA 1W0XC 2HXQA 1JWHA 4CFUA 4EKLA 3C5IA 4JBPA 5BYYA 1WBVA 2BUJA 4U41A 5J87A 4WT6A 4DINA 3E7OA 4LL0A 3G6HA 3T3VA 5JFWA 1VYWA 5AA9A 4MKCA 4BKJA 5IMEA 2G15A 4XCUA 4O81A 2X8DA 4FNWA 2WPAA 4IWDA 5K0KA 2OICA 3QF9A 2FYSA 2OW3A 2PVJA 3EQIA 3Q6UA 5CVFA 3VS2A 3OCGA 4NJDA 4NKAA 1I09A 4Y83A 2PYWA 4EH9A 4ZZMA 5J8IA 4BGQA 4FG7A 5D11A 4KA3A 4QMYA 3VS6A 2X1NA 3PJ8A 4IVDA 2GFSA 3F3UA 3IDBA 4FV1A 4L68A 4B0GA 5TKDA 3VHEA 3SXFA 4WKQA 1ZAOA 4FL2A 5GJFA 3P1AA 3FLSA 3LFAA 4EOKA 4C2VA 3ATSA 2QKRA 2I6LA 2OLCA 5AJQA 2UVYA 2XNMA 3KRJA 3VBQA 1XBCA 3SOCA 5LJJA 3GQLA 4ANMA 1IG1A 3E88A 3AC4A 4CFWA 1L8TA 2XIZA 4DFYA 4MNEA 1NXKA 4FTAA 4W8EA 3ZO4A 1SVGA 2E9NA 3QTIA 3OTVA 3DS6A 5DA3A 4ZTMA 4MBJA 2Z7SA 2GNHA 2Q0BA 3A61A 4P90A 4RJ3A 2XIXA 4YBJA 4IZAA 4AT4A 3LCSA 3QWKA 4DEHA 3AXWA 3F7WA 2XJ2A 2XJ0A 3Q3BA 1OBGA 5KCVA 1QMZA 5CLPA 5EDQA 3EH9A 1ZRZA 2WEIA 3R28A 4YJNA 4AW0A 4MCVA 4EK4A 3ZBFA 4ASEA 3BBWA 2G1TA 4M69B 4ZAUA 2Q83A 3ORNA 1H1RA 4GK3A 1Q5KA 3SDJA 2W5AA 1ZOGA 5DEWA 1XH4A 4QMLA 3WIGA 3OWJA 4F7LA 4TYEA 3V8WA 3TACA 5L6PA 3PVGA 4ZIMA 1M14A 2CCIA 5FEQA 3BYMA 5M09A 5K0XA 3MVLA 1R78A 4FIIA 3PP1A 3QTXA 2JAMA 4IW0A 3SLSA 4K11A 2OJ9A 2V5QA 1GZOA 3ZS5A 4EHGA 2V7OA 3OF0A 4EOOA 4S32A 3F66A 3FKOA 4HGTA 5FEEA 3I6UA 4A4LA 4DGMA 4EQUA 3WZEA 5TO8A 1Q99A 2WMSA 4UEUA 3ZC6A 1IAJA 5D1JA 1NA7A 2OZOA 2OIQA 3LXLA 5HTIA 3GU8A 5CU3A 4CQGA 3VBVA 2VTOA 4J99A 5HIEA 5ANEA 3DBFA 4JX7A 4L67A 3AC5A 4QMNA 5LCJA 5GZ9A 4V01A 2OH4A 5IQFA 3G5DA 4IVBA 4Q2AA 1MQBA 2YEXA 3BQCA 3SRVB 2C47A 4ERWA 2VTNA 4BDAA 2GU8A 1J91A 3A7FA 4GMYA 3WF5A 2GNGA 4ZK5A 4DEAA 1PMUA 2B9FA 3SA0A 4BZNA 3GC7A 3ZLYA 5HGIA 5JQ5A 4R7IA 4DBXA 4OBOA 3R8UA 4DHFA 4BCPA 2CN8A 3AMYA 1SM2A 2J0LA 1R0EA 4U5JA 4RJ7A 4IFGA 1WCCA 4O2ZA 4W4VA 3S95A 1KSWA 4MF0A 4ZOGA 1PYEA 5HG9A 3F9NA 1BLXA 2QOIA 3OTUA 3U8WA 2BRHA 2O0UA 4I41A 4R77A 3DKCA 1M17A 3CJFA 2PPQA 2UZUE 3AD6A 4DGOA 4BDEA 4XMOA 5L2SA 1TKIA 3NGAA 3HV4A 4M13A 4E4NA 3O7LD 2ZYBA 1RDQE 4QMMA 1H1SA 4XS2A 1GZKA 4IH8A 4USFA 2XYNA 5BMMA 4Q5EA 3UOLA 3BHVA 3SGCA 3A7HA 3BWFA 5ACBC 2FH9A 5CAPA 3L9NA 4XLIA 5CT0A 5DEYA 3PA4A 3KEXA 4QTDA 4D58A 4AZEA 1X8BA 2HYYA 2R3FA 4M68A 5GHVA 5IQHA 1WBPA 2VX0A 3RPRA 5AUXA 3TJCA 4ANBA 3TL8A 3FBVA 4WD5A 5I9VA 2BZJA 2OIDA 3C4FA 4FKPA 4MWHA 4WG3A 4YP8A 3NUSA 4NCTA 4ALWA 4K18A 3GFWA 4MTAA 2XK6A 5J1WA 3FZSA 5FD2A 5C01A 1PMEA 2W5HA 2ZM1A 3QYWA 4O91A 3NUNA 3FXZA 5BPYA 4LGHA 1PRYA 1M2RA 3OEFX 3UIUA 4CLJA 4FT9A 4OUCA 2ZB0A 3MB7A 2C3JA 4K9YA 1J1BA 2YM4A 3MJ1A 4I3ZA 4XG8A 3RPOA 4ANSA 4BKYA 1PHKA 5CYIA 4YTIA 4O7RA 5EW8A 4RPVA 2UW4A 4D1XA 5FG8A 2ITZA 4ZZNA 4DTAA 3ZOSA 1REJA 4KBKA 2Y6OA 1OL5A 4G1WA 4I24A 2WQBA 3UOJA 2YIXA 5A9UA 3EWHA 3FYJX 3Q9ZA 3REPA 3VIDA 4YTCA 4QP7A 2O65A 3MPAA 3MWUA 3ODYX 4OTRA 2WQNA 3ZBXA 5FBNC 4A06A 4LMUA 3UO5A 3P7AA 4EOLA 2ETRA 5I4NA 5IA3A 4BL1A 5M07A 1OL6A 4FGBA 2W17A 3R22A 2VWUA 3SXSA 1F5QA 4OW8A 2WTKB 3TV4A 2B9JA 3BYUA 3A8WA 2PMOX 4BZOA 3GNIB 3M42A 3VNTA 4XG4A 3NEWA 3EQFA 3PJ2A 4M8TA 3ZCLA 1A48A 2IVUA 2JKKA 5CEIA 3LKMA 3LFFA 5KMIA 3O7LB 1MRVA 2WELA 4I5HA 4EYJA 4FV0A 4JQ8A 4QTEA 4Y5HA 4ENYA 2WTKC 1OKVA 3LQ8A 4IADA 4BN1A 4DT9A 3SAYA 4BICA 4UYAA 3C0HA 2WU7A 3HMPA 4XH6A 3F2AA 4FIGA 3Q4ZA 3IGGA 4F9CA 2X7FA 3OY1A 3ORXA 1KWPA 4FZFB 3IDPA 4RQVA 5DIAA 3CTQA 5CWZA 4QP1A 4H39A 4YJVA 3HLLA 3VQHA 4C58A 5EQPA 3BHTA 3PY1A 3PJ1A 5EW3A 4AOJA 4AA5A 1R3CA 1CM8A 3QTSA 3MY1A 5AP6A 4O83A 3QLFA 2F4JA 3K5UA 2R0IA 4IVAA 4PUZA 4U43A 3A8XA 2OO8X 4MXYA 4QPAA 1Y91A 4BYIA 2B54A 5E1SA 2PMNX 4BIEA 1ATPE 3CEKA 4R5SA 3TEIA 4L6QA 1OGUA 4AOIA 2UW7A 5AEPA 4EORA 3KVXA 1NW1A 5C26A 4FKSA 3NYXA 4R3RA 4WNKA 4M12A 3CBLA 2YABA 2C68A 2ZV9A 4FNYA 4Z55A 3HUBA 1FPUA 1Q8WA 2P33A 4PPBA 1OZ1A 1OIYA 2NP8A 5KHXA 3ZU7A 2ZM3A 2XKCA 3WE8A 3VS4A 2BRBA 3ENHA 3KN5A 5LCKA 5EKOA 3EQHA 5HKMA 4KIKB 1MRUA 1JVPP 4GG7A 3R8PA 5FGKA 4A7CA 3QKLA 3QRUA 3NW6A 1ZZ2A 4BVUA 1O6KA 4FKTA 3RJCA 2OFUA 2ITVA 2UZTA 4NJ3A 3T9TA 1R39A 4YC3A 4BDBA 1Z5MA 3DOGA 5AAEA 5BQ0A 5AM6A 3C51A 3DAKA 4NSTA 3DB6A 1GIJA 1Q41A 1XH8A 2XCKA 4EWHA 4TYJA 4F7SA 2C6EA 3LE6A 1OITA 3U4UA 5M06A 1GIIA 5DT0A 3EZVA 4WO5A 4M0YA 2VTIA 3G0FA 2JIIA 3HMOA 5AR2A 3IOPA 4JDJA 4ACHA 4B99A 5M4FA 4LRJA 4RIWA 3TTJA 4I0TA 4RX5A 3EL8A 4RC3A 1OPJA 3BEGA 2RG6A 3QQJA 3S4QA 3UE4A 1J3HA 3M11A 3C4EA 4PNKA 1W82A 5A4TA 2ITTA 2VTHA 1ZMWA 2HY81 4ZTSA 3UQFA 4KSPA 3UJGA 5AWMA 2WXVA 3NCZA 1W83A 3UZPA 2VNWA 3PA3A 1YI6A 4TNBA 5AR4A 3TZ9A 3LQ5A 3M2WA 1U46A 4B6LA 3MH3A 1XQZA 3R0TA 4ACCA 3LM0A 3B8QA 3R9RA 4M15A 3PPJA 4J95A 1E1VA 2PZ5A 3P5KA 3P78A 5E8UA 1PMNA 2QODA 3S3IA 4RIXB 1JSUA 4FKGA 3C0GA 5EFQA 3PRFA 4PY1A 2J51A 5CNNA 2H8HA 4ALUA 3AD5A 4F70A 1YXTA 3C50A 3BEAA 2GS2A 4FIEA 1H4LA 1JBPE 2YCRA 3IW5A 4O38A 4AA4A 3FMDA 4C4FA 4TPTA 2GFCA 3FSFA 3QCQA 4IB3A 3ZXZA 3MYGA 2CKQA 3LVPA 5EM8A 1P14A 4U80A 3W32A 5AFVA 2YIQA 1UKHA 1P4FA 3EB0A 5FBOA 4O0TA 2WKMA 3CE3A 1OKZA 4QMXA 3OWPA 3MS9A 4QQCA 3R2YA 1FGIA 3BKBA 3G9NA 4UWYA 3R7OA 4KIKA 3GENA 4D1ZA 3KGAA 3IW8A 1G8SA 3ORIA 4YNEA 4J8MA 3COMA 5C8MA 3NRMA 3LFEA 1UU8A 3O23A 2F7ZE 4P2KA 3R83A 4AOTA 1TQIA 3ZFYA 2XK3A 4BCQA 4NCTC 1H01A 4UXQA 3UOHA 2CGUA 3PPKA 4FYOA 4I0SA 3BQRA 5D10A 3CTJA 3EZRA 5J5TA 2E9UA 1WBOA 4PTCA 4QMVA 2QG7A 2ITUA 2HXLA 3PDTA 5CALA 4IAAA 2BIYA 3KXGA 4Y5QA 3QD4A 5L3AA 4MHAA 2QU6A 2HWPA 4ITIA 5EM5A 4G34A 4NFNA 3DK7A 3ANRA 4C62A 4NM3A 1OIQA 4IJPA 2R3KA 3NYOA 1FVTA 2C5VA 4RWLA 1YOLA 3FLYA 3F88A 4BBMA 3FC2A 3KRWA 1SYKA 2JDRA 3MY5A 4OTQA 2JGZA 2XZSA 2O64A 3EQGA 4QP2A 4RT7A 3PE1A 2VWWA 1YWVA 3HZTA 4HVDA 4FR4A 4FV9A 3TUDA 2XYUA 5CSWA 5CF4A 2UW9A 4HW7A 1ND4A 2EWAA 3PIXA 4JXFA 4YJTA 2HWOA 4O7SA 2YIRA 4FE2A 1YDSE 3COKA 3W2SA 3Q52A 3C4WA 5HD7A 3DV3A 5HI2A 4NU1A 3WIKA 3HVCA 3F5PA 5JEBA 5DMZA 3UNKA 4JIAA 4RIOA 4FTNA 1ZYLA 3FI8A 2X6DA 2JD5A 2VZ6A 3N4TA 4TL0A 5IH5A 4MX9A 3MVJA 4O7ZA 3D2IA 5AX9A 4RJ5A 4U6RA 5DT4A 3V5QA 3MTFA 2WOTA 4FV3A 3KF4A 3Q04A 4QP6A 3U51A 5IUHA 4DG3E 3ZONA 3LQ3A 3VO3A 4Z16A 2BZHB 5DR9A 4BCFA 1FOTA 2YAKA 2QOKA 3RK9A 4FK6A 1L3RE 2YCQA 4FTQA 4WG5A 3O8PA 3GGFA 4AT5A 3E93A 2IW9A 3TNIA 3IOKA 3WILA 4ZTRA 3H10A 4UYNA 1ZMVA 2GQSA 4O0SA 4HJOA 2XMYA 5FXRA 4BDFA 3FXXA 5I9WA 4MXXA 3OXIA 4CV8A 5JRSA 1LEZA 5HVJA 5M4IA 3CQEA 2QLQA 4ACMA 1WVXA 2AYPA 1LPUA 2NPQA 2X7OA 3BHUA 4HZSA 4JBOA 2JFLA 4S2ZA 4U3ZA 3M1SA 3OC1A 1M52A 3GEQA 5H8GA 1SNXA 3RI1A 3QZHA 1OBDA 3DA6A 2DQ7X 3FLWA 5E8SA 4ZSGA 3PVWA 2GQRA 3OCBA 3TV7A 1PXPA 5DRDA 5HLPA 2JITA 3ZLWA 5F1ZA 5ANOA 4CNHA 4QOXA 4YZ9A 1JNKA 1OL2A 1IEPA 1PXLA 3HV6A 1WAKA 4IJ9A 3VQUA 5HNIX 3QALE 3RPVA 4XYFA 2PUUA 3DJ5A 3HGKA 4AZTA 1WZYA 5DLSA 4AFEA 3UG1A 4O0UA 4ZJIA 3R1YA 4GJ3A 4DEEA 4I4FA 3VRYA 3DZQA 4BHNA 5CASA 3LCTA 1R1WA 2FSLX 2WHBA 4NWMA 4Q9SA 2HW6A 4TWNA 3UC4A 5HTBA 2VTPA 1ZYCA 5KO1A 3DBEA 4BWKA 1XBBA 4BI1A 3W18A 4RLKA 3QFVA 5EM6A 4ANOA 3THBA 4FX3A 4PTEA 4EC8A 2GTNA 5JMSA 3R6XA 4JDHA 4D0WA 1OIUA 4GVAA 2X4FA 4XV9A 5CZHA 2OXYA 2J0JA 3CS9A 2YJRA 2WMAA 3VF8A 3CQUA 5LWNA 2WIHA 2R3OA 3FMJA 2HAKA 5HLWA 5JT2A 4FKQA 4MD7E 5EKNA 1O6LA 3QWJA 1Q8TA 5E7RA 4BCKA 5BMSA 2IZTA 4U0IA 4WUAA 5CEMA 3FHIA 2YDKA 4ZMEA 4XV1A 4FEQA 4F1TA 2ITQA 3GT8A 1YHWA 3PFQA 4JBVA 5CTPA 3VS7A 3QCYA 2XJ1A 4K6ZA 4GT5A 4OTDA 5GJGA 3MSSA 4FSMA 4YBKA 5AP5A 5K4IA 2WFYA 1YWRA 2GHLA 4OR5A 1U59A 2QLUA 4JQ7A 2G2IA 1G8AA 3AT2A 4YHFA 1FMKA 5FDXA 3ZFMA 5H8EA 2R3QA 5BVEA 4CTBA 2RL5A 2B4SB 2XIYA 3G6GA 4W4YA 4D4VA 5I3OA 2HW7A 5JGBA 5LXMA 3UPZA 2C5NA 3MW1A 4DT8A 4ZMFA 3ZM4A 4F63A 3RMFA 2OGVA 3VUKA 5IF1A 3K3JA 4NM5A 3HRBA 2VO3A 4CYIA 4J52A 4MXOA 5JZNA 5BVKA 3BLRA 4AG8A 2YCFA 2PMIA 2X6EA 3UP7A 3NIZA 3ZSIA 3TKUA 3KFAA 4EWQA 4AUAA 2GS7A 4AZWA 2PSQA 4E73A 4EH8A 4D2WA 1OMWA 1UKIA 2W1GA 3IW6A 3CGOA 5CAVA 3G90X 3MV5A 3FSKA 3GOKA 2ZDTA 4KWPA 5AV2A 4BDKA 4EH2A 1BMKA 4N4SA 1XH6A 2BZIB 3LMGA 2X39A 2XVDA 3DQXA 4PWNA 3TV6A 4E6AA 2EB3A 2OF2A 3IW4A 2ITPA 3E8CA 2PMLX 3CC6A 3MDYA 4ITHA 5CVHA 3ZTXA 3PLAE 3U4WA 4DTBA 2NRYA 4WHZA 3G51A 3MH0A 2CLXA 4TYGA 4XOZA 3VRZA 4YSJA 3BCEA 3QQHA 4WG4A 3QHWA 5EYDA 4AA0A 3Q2MA 3AC8A 4GJ2A 4AP7A 4MVFA 4A9UA 2YM3A 5BUEA 4M84A 5GJDA 5TT7A 4EOJA 5M51A 2ERKA 2PVMA 5TE0A 5K5XA 2VAGA 4FVQA 1JLUE 2GNFA 1FGKA 5CQWA 5AUTA 3LMIA 3O2MA 3GU7A 4HVIA 4O7LA 2E9OA 4P5QA 2ZM4A 1B6CB 4AS0A 4EK3A 3E3BX 3POZA 3NNVA 5EHYA 3F2RA 3BHHA 5AV0A 2J6MA 3GCSA 3KXNA 3OUKA 3O71A 1H0WA 3OMVA 3Q9WA 3PXZA 5HCXA 3TWJA 4PMPA 5ICPA 5K5NA 3K5VA 4UMRA 4EHVA 1LP4A 4AGDA 3FPMA 3QCXA 4YPDA 4KB8A 1NVSA 2QONA 4BCMA 2XCHA 3VUHA 4IC7A 5IA4A 5KX8A 1ZY4A 2QO2A 4FOBA 4UX9A 3QA0A 2RFEA 5HEZA 3S00A 2VWIA 3GCUA 4E8AA 2QC6A 4B8MA 2R3IA 3EHAA 4H05A 2HZ4A 1PW2A 5K3YA 3UZRA 1P5EA 3LFBA 2OG8A 3GC0A 5HLNA 4YZBA 5DT3A 4ANLA 1OI9A 3AG9A 4EL9A 3QC9A 3SVVA 4YJPA 4PPCA 2OZAA 4RX9A 3RZFA 3V5PA 3K3IA 4YJSA 3R9HA 5EW9A 3TNPC 2WZJA 4RVTA 2EB2A 2F9GA 2VO0A 4D0XA 4F6SA 1M2QA 3HAVA 2PVHA 2PVRA 4L53A 2BKZA 2XS0A 4MBLA 4ALVA 5FTQA 1MQ4A 5AADA 2JKMA 3GP0A 3LXNA 5A6NA 4PPAA 3W8QA 3TUBA 3ULIA 4UMPA 2ITNA 3R02A 3ENMA 4O7VA 2PHKA 3RHKA 3I0QA 4HYSA 3VAPA 2PWLA 4CCUA 3MA6A 2FGIA 5E8TA 3EYGA 4G6NA 4QP3A 5IG1A 2I0VA 2P2HA 2P3GX 3RVGA 3HNGA 4NFMA 3SV0A 4UMUA 5KBRA 4JNWA 1BKXA 5AP7A 2JIUA 4FZDB 2HY0A 3L8SA 2UZOA 3MFUA 1XH9A 3ACJA 3ORLA 1ZYJA 1VZOA 4OTPA 4PL5A 3U87A 4E93A 4F09A 3EQCA 4PQNA 1QPCA 2PK9A 4C35A 1HOWA 2RFSA 5LQFA 3EYHA 3DCVA 4ZTLA 2F57A 2B9IA 2F49A 4KBAA 4X6QC 3KMUA 4P5ZA 2RFDA 3AT4A 2OJFE 2R3NA 4LFIA 2QQ7A 1CSNA 4FSYA 3DFCB 1FBNA 5K9IA 4L7SA 4KIQA 4PP9A 5EHLA 3P9JA 2BPMA 2FUMA 2ITOA 5B0XA 4NIFA 3ZFXA 2Z60A 4JIKA 4YO4A 4YJRA 5AP2A 3LFSA 4N6ZA 1E1XA 2J2IB 3BYSA 2Y4IB 2WQOA 4FEUA 5IDNA 3DT1A 3PSDA 1XKKA 2QURA 4WSQA 4U9AA 5CI6A 3ORPA 2GHMA 3BELA 5DG5A 3WE4A 5DBXA 4F0IA 3UMXA 1W84A 1Z57A 2BVAA 4F1OA 1H0VA 2PUNA 2PZYA 1J1CA 3HDMA 4YTHA 2YZLA 5JFVA 1PXOA 2CN5A 3ZUUA 4KIPA 1HCKA 4FTLA 1PJKA 2VTJA 3QTZA 4RIXA 4RJ8A 2WMQA 4ZSJA 3O8TA 5AP4A 1V0PA 3RGFA 3RAWA 4CGAA 3PYYA 1K9AA 5KBQA 5E9EA 4C36A 2PULA 1Y6BA 4PP7A 2BAJA 4XRJA 4WUNA 2W05A 3NIEA 4D2VA 4FT0A 2UW5A 4YSMA 5ETAA 4FKOA 4GUEA 5FP6A 3FDNA 5FRIA 4LRMA 3D5UA 5ANKA 1REKA 2WTWA 4X3JA 5FEDA 4BDIA 3LJ0A 3QX2A 3I7CA 2X9FA 3NR9A 3PXYA 5E4HA 3GUBA 5DR2A 2OJGA 4ZS4A 3FL5A 3OW3A 3R9NA 1YVJA 4I22A 2ZV2A 4O0WA 5KKRB 3SKCA 4RZWA 3HAMA 3UQGA 4ZJVA 4LUDA 2X2KA 3CJGA 3FI2A 5IH6A 1XR1A 2JEDA 4YLJA 5HORA 4CMTA 3Q9XA 5ETFA 3DLZA 3CD8A 4FSTA 5F94A 5I5ZA 3TTIA 4AGCA 5EQEA 1H25A 3HA8A 2C0IA 4OT5A 2PE2A 4F6UA 3PTGA 4C4JA 3JYAA 3A2CA 5H8BA 5IQAA 5AR8A 4HVSA 3IW7A 1H00A 4RA4A 2YCSA 5J79A 3V8TA 4C4IA 3ELJA 4JG7A 5EOBA 1RQQA 1CKIA 2WMRA 4I93A 4F99A 3UO6A 4IMYA 4KKGA 2OK1A 3BRBA 4X2KA 3HKOA 3ID6C 4FNXA 4R5YA 2B7AA 2BALA 2VN9A 3ITZA 4V0GB 1JKLA 4DFBA 5ANIA 2XK4A 3WF9A 2VGOA 2W1DA 4I94A 3HV7A 4O2PA 3KF7A 4MXAA 4XRLA 2Y8OA 3BV2A 3HP5A 4TY1A 2BAKA 4OAUC 4MNFA 3V5TA 1ZYDA 2PL0A 2XRUA 4IIRA 4QRCA 5EI6A 4V05A 5LWMA 4CRSA 3ZDIA 3TIZA 1YDRE 3BPRA 4J7BA 2VRXA 2VO6A 4FT5A 2YACA 3MJ2A 2CPKE 4TWOA 4XBUA 3VUTA 3F3VA 2H34A 3W2OA 2NRUA 1LEWA 4AW2A 3COHA 2GTMA 2QVSE 5J5SA 3ZO3A 2YDIA 3CXWA 3A4PA 4RSSA 1G3NA 2O63A 4ITJA 1UVRA 2ZMCA 3RCDA 4EJ7A 3FY0A 3OUNB 3PY3A 3JVRA 1PXNA 3ZLSA 2LAVA 3P86A 2AC3A 3ZO2A 2YIWA 2H9VA 3ORZA 3N4UA 2UV2A 4AZFA 3I79A 5EYKA 3QD2B 2GNIA 2OJJA 4IAYA 3W8LA 4WBOA 4DH1A 2BCJA 4B4LA 3FZTA 3GOPA 5HOAA 2X2LA 3A4OX 4JT3A 3KB7A 4FVRA 1YOMA 2PZIA 4C3FA 1AGWA 5HIDA 3BX5A 2JDTA 2I0YA 3EIDA 4FZAB 3NAYA 5FTOA 3C4ZA 4PX6A 4GUBA 5EI8A 3RZBA 4G31A 3AC3A 5BYZA 3KMWA 3Q9YA 3GI3A 4CZTA 4YPSA 3TT0A 3I4BA 1JQHA 4EC9A 2FA2A 4Y46A 5GNKA 5M08A 5HQ0A 1BL6A 2CGVA 4CMOA 5B2LA 2C1BA 5HO6A 2JIVA 4FVPA 4U44A 3JPVA 3AOXA 3HMNA 4L44A 1PMVA 3O0GA 2XF0A 3U9NA 4M0ZA 5FM3A 3Q4CA 1I44A 2JKOA 3BGQA 4J96A 3ATTA 3F5UA 1XHAA 3FLQA 1KUTA 1IR3A 2F7EE 4FZ7A 3FWQA 1U5RA 4O0XA 5CX9A 3LFNA 1LR4A 3QRKA 5CXHA 3OP5A 4RA5A 1QCFA 3UTOA 4IAIA 4CSVA 2W4JA 3F69A 3FZPA 2C5XA 4IANA 3QA8A 4IVCA 4DTKA 5A6OA 4L3JA 4FIHA 5DOSA 4BIDA 4EZ7A 3LLAA 5CAQA 4CZYB 4WBBB 4FV2A 3D2KA 1G5SA 4R8QA 5HCYA 5KZIA 2XRWA 3L1SA 5CEQA 4QPMA 3TZ7A 4L01A 3ZZEA 2X8IA 1DS5A 3RM6A 2Z8CA 4FTMA 3RM7A 4EBWA 4G3EA 1OKYA 2BROA 3BGPA 3R9OA 4CKIA 4JR7A 2ZV7A 3QZFA 5CEOA 1FVVA 3FPQA 5BYLA 2BAQA 1A06A 4JS8A 5CF5A 1RJBA 3HP2A 3VN9A 5HX6A 1JSVA 4LGDA 4KKHA 4AN2A 5C03A 3UDBA 3FI3A 2X7GA 5TR6A 4XJ0A 4AN3A 3RALA 4HVGA 5FTGA 1PXMA 4CG8A 3QRTA 5HBHA 4BTMA 4FZ6A 3RK5A 2BFXA 3UIBA 2RF9A 2XIKA 5C8NA 4FT7A 5E8XA 5LMAA 2XKFA 2EXMA 1BI8A 2UW6A 4X6RA 3BLQA 4CEGA 4B9DA 3EFKA 2VWBA 3BWJA 2ITXA 4F1MA 4JR3A 4D28A 3QD0A 4I1ZA 4C2WA 4KBCA 3FUPA 4F08A 1XWSA 2JLDA 3ZRLA 3NYVA 4OTIA 3K2LA 4GU9A 2CNUA 1DI9A 3GBZA 4CFFA 3D9VA 2JFMA 3C4CA 3QX4A 4H3QA 4X3FB 4X0MA 4KD1A 3H0ZA 4QPSA 2J7TA 3OZ6A 4WSYA 5DHJA 3DXNA 4BTFA 4UMTA 4DG2E 3Q53A 5JSMA 2QOOA 4FTRA 4O21A 3NUUA 5HG5A 3G2FA 5J7HA 3U54A 3FJQE 1KV1A 3VBXA 5CSHA 2V0DA 5LVNA 2GNLA 2HZNA 2JDVA 4DGLC 3SXRA 4C59A 4E26A 2PUPA 3FLZA 4FSWA 4RC4A 5IH4A 2F2UA 2FVDA 4KABA 3UZTA 4DCAA 2B1PA 3P79A 4OTFA 5CAOA 4YC6A 3RNIA 5DH3A 4IWPA 2YZAA 4GFOA 4QTAA 4S34A 2O8YA 4W9XA 2BFYA 4E6DA 3NWWA 3Q4TA 2YWVA 5D9HA 4E5WA 4FIFA 4EOQA 1ZLTA 4GYGA 5DPVA 2F7XE 3TUCA 1BX6A 2UVZA 3W2RA 4PV0A 1ZOEA 2IN6A 2GDOA 5HNGA 3LFCA 3AC2A 3LXPA 1XO2B 2REIA 5J7BA 3DY7A 3UYSA 3GFEA 4FKVA 4FOCA 4A9RA 3D5VA 3BI6A 3EQRA 4O0RA 4JAJA 4YTFA 1GAGA 4YNOA 3QZIA 2HZ0A 3WYXA 3C1XA 4PF4A 2BRGA 1S9JA 2C3KA 3L9LA 4OBPA 4Y8DA 4IFCA 1Y8YA 4Y95A 4G5PA 4YHJA 1MRYA 4FT3A 4U45A 4FV5A 1GJOA 3EN6A 4ENXA 3DQWA 4BCIA 3VC4A 2C6TA 3JY9A 3UNZA 2W9FB 4NW5A 3UIMA 4O7NA 3I81A 4IZ5A 2RSVA 4GIIA 3QYZA 4HNFA 3FMMA 4CD0A 3ALNA 1WBNA 4RZVA 5C1QB 4BY9E 2EXEA 5HIBA 2OXXA 4Q5HA 3I6WA 4J97A 3WZUA 4GKHA 4QYYA 4DE4A 2YA9A 2FSTX 2BMCA 4K1BA 1ZMUA 4LL5A 4RFZA 4QP9A 3KK8A 4KRCA 3LHJA 4QYEA 2IWIA 5CXZA 5IA0A 2XK9A 5HBJA 4NH1A 1UWJA 3QTWA 3R8LA 1S9IA 3BYVA 3MESA 4U3YA 5KHWA 5M56A 2EUFB 3H9RA 4FG8A 4QYHA 2SRCA 1CKJA 1H1QA 1KE5A 5I0BA 2W1HA 3R8MA 3BU6A 1ZXEA 3PJCA 4ASZA 5CSPA 1URWA 2CJMA 5JH6A 1LUFA 2YN8A 3JXWA 4FTOA 3TKHA 4MQ2A 4IEBA 1CTPE 1W98A 3UMWA 5JFXA 1XBAA 4XBRA 2WB8A 4WA9A 4AWIA 1Q97A 4MK0A 4X2FA 3WF7A 4YHTA 4PMSA 2Q0NA 5L8JA 1H1WA 5IKWA 4F9YA 2IW8A 1ZY5A 2J5FA 3KK9A 4O1PA 5L8KA 4NTTA 2Z02A 4F6WA 4I92A 4QP4A 4D2TA 3GQIA 1OL7A 2QR7A 1YXVA 3ET7A 1YQJA 2HK5A
chains in the Genus database with same CATH superfamily
3E3PA 1OUYA 4AT3A 2Y7JA 3E92A 2PTKA 3SRVA 3UNJA 2A27A 3KL8A 4E20A 3CIKA 3TXOA 5LVOA 4G9CA 5FQDC 3TJDA 3EN7A 2E2BA 2YIYA 2XH5A 4LOPA 4Z7HA 5L2TA 3D83A 3O96A 4GU6A 3RNYA 3T9IA 3H30A 4C33A 4FSUA 4D1SA 4CLIA 3F2NA 4HNIA 4BCNA 2IPXA 2ESMA 2VTLA 5AA8A 1GOLA 1WMKA 3FLNC 3LIJA 5L2WA 4S33A 3PWDA 3QGWA 4OTWA 2IG7A 2XIRA 2HIWA 3TIYA 5CI7A 3PVBA 3PXKA 4DFLA 4YGAA 5AMNA 1KE7A 1VEBA 4R1YA 2XK8A 3DAEA 2A1AB 3UYTA 4DYMA 5I9ZA 3V6SA 4IZ7A 2W99B 4W9WA 4XLVA 2V55A 5C27A 4FUYA 2O3PA 4G6LA 4HPUE 4MYGA 4YO6A 4ZTNA 5IA5A 5B2MA 2YAAA 2BZKB 3PIZA 3DTCA 4WRSA 3JUHA 1VR2A 4BI2A 4F64A 1E9HA 2BTRA 3QQUA 4Z9LA 1H8FA 3GC9A 1DAYA 3V8SA 4BHZA 4O27B 4KRDA 3ROYA 2C69A 3RPSA 3SC1A 5CU4A 4C57A 3SD0A 4J98A 2EXCX 4G5JA 1WBTA 2HOGA 1IA9A 3UO4A 4QQ5A 3U6IA 1ST4A 4UMQA 4QTBA 4GG5A 5BX0A 3R63A 4BYJA 4BGHA 3FZRA 5AP0A 2PVLA 4RQKA 3VJOA 3VUIA 2C0OA 4D2RA 1SVHA 4R7BA 2YLFA 1J7LA 5KUPA 1W2CA 4AE9A 4BJJB 3C13A 4FYNA 1JKSA 1SZMA 5E92A 1P4OA 4ZP5A 3PXQA 4CFNA 4DFUA 1NT2A 2XAMA 3KQ7A 4IX5A 4IAZA 4TWPA 3QQGA 4YZMA 3RAHA 5C4LA 4DLIA 2WAJA 3L9MA 2P4IA 3WBLA 4BTKA 5H3QA 5HE0A 5AR3A 3SQQA 4I5MA 3NMUF 4RMZA 4QQJA 4JRVA 2ERZE 2WTVA 1YW2A 2W0JA 5HZNA 1YHVA 1B38A 2W1EA 3R7IA 3ORTA 3KN6A 2YM6A 1CDKA 3LW0A 2OJIA 3QLGA 5FWKK 4MD9E 5J9YA 1Q4LA 3NW7A 4CTCA 3VW8A 5EYCA 2BIKB 2OBJA 2R5TA 3LZBA 4QD6A 3IDCA 3PIYA 4M97A 3CPCA 4PRJA 3R7YA 1Q8ZA 5H9BA 4MF1A 4I5PA 2V7AA 4CKJA 3R7EA 1PKGA 2Y6MA 4GVJA 5JK3A 2VTMA 4D2PA 3OOGA 2B0QA 3QL8A 3W2QA 5FXSA 3KRXA 4MEDA 5KMJA 4QNAA 4KNBA 3KRRA 4ACGA 4WNMA 1OPKA 1M7NA 4GT3A 5FDPA 1KOAA 2GNJA 1OL1A 3IONA 4ARKA 2WGJA 4KUJA 3MY0A 5CU0A 3VW6A 4DH3A 3QQKA 2A98A 2Z7RA 4AACA 2E9VA 3RINA 4RVLA 4DEDA 3EL7A 2XALA 3LFQA 3F7ZA 4NIFB 5DN3A 5L6OA 3OEZA 3R7UA 1YI4A 2F2CB 4FI1A 4MAOA 3IG7A 4ZLOA 4RWKA 3LMHA 4A4OA 2BRMA 2OF4A 2C0TA 2XUUA 3VS0A 3PP0A 5IQIA 1BUHA 4G3CA 5ETIA 3ML1A 4USEA 4O7WA 4O86A 4BI0A 3WF6A 4S31A 4F65A 3OHTA 1YHSA 3LCOA 1YXSA 3VJNA 1H1PA 2YFXA 5I9XA 2QOHA 2W1FA 1H08A 1OM1A 4GL9A 4UZHA 2LGCA 4C4HA 2WMWA 2Y4PA 4R1VA 3DBQA 4EH5A 1BYGA 2YM7A 3W0OA 3A7GA 4M66A 3RHXA 3L8XA 2QNJA 3H9OA 3W16A 4BJJA 4C8BA 5M53A 4HVHA 4FTJA 5L8LA 2UZNA 4RC2A 1XMMA 3NUXA 4O0YA 2R3JA 3MB6A 1DAWA 2OFVA 3ULZA 4G3FA 3EQBA 5IZFA 2X81A 3B2WA 2RG5A 1B39A 4DG0E 2WMXA 4EH6A 3O51A 3R1QA 4HYHA 3CY3A 3H3CA 4FC0A 3V3VA 4BDGA 2HCKA 4ZY4A 3ZDUA 3I5NA 5E8WA 4ZXTA 3LAUA 4LQMA 3HV3A 5HTCA 2PE1A 3UVRA 4C4EA 3QZGA 2ITWA 3OCSA 4FUXA 4LG4A 3EJ1A 3PZHA 4K2RA 5EOLA 3HUCA 5AIRA 5TF9A 3G9LX 4IB5A 5EQYA 3RWQA 1WBSA 2CNQA 5IQBA 2WTJA 2QG5A 3PSBA 1GNGA 4AX8A 1O6YA 1DI8A 4BDDA 2W7XA 4J53A 4HGLA 3FXWA 1PXIA 4O96A 3FQHA 3VUMA 5HU3A 4FODA 2VTAA 1Q8YA 3OWLA 2XK7A 4L45A 4QP8A 4W8DA 4AAAA 5A46A 3DZOA 2ZOQA 3L8PA 3MA3A 4D2SA 4EHEA 3VHKA 3KRLA 4LMNA 3SW7A 5I9UA 3UPXA 5BUIA 4YJOA 4XP3A 4A9SA 4AZVA 2QI8A 5E91A 5HX8A 4I6LA 2R2PA 5KNJA 4WNOA 3D15A 2ONLA 1FINA 5AR7A 3VUGA 1ERKA 4GYIA 1W8CA 4DA5A 5ANGA 3HEGA 4DITA 1V0BA 3MIAA 4YR8A 3KCKA 4I6QA 5DNRA 4D9UA 5LVPA 3QUEA 1UV5A 2A4LA 4FTUA 4P7EA 5C9CA 3ZHPC 1PKDA 3LJ1A 3ZH8A 5M57A 5IQEA 4UXLA 3DKFA 3MVHA 4JAIA 4CV9A 5B2KA 2UW0A 2WTCA 4E1ZA 4QQTA 2YITA 4G3GA 2NNWB 4DC2A 2I1MA 5A4QA 4GH2A 3MFTA 2WEVA 3KMMA 1OKWA 3MTLA 1KE8A 4FV4A 5DFPA 5JGDA 5AUYA 3DK6A 4AE6A 4DN5A 3GCPA 4XOYA 3LLTA 2PZPA 2GSFA 3GB2A 4JDIA 3E63A 4KAOA 3MN3A 5HCZA 4GK4A 4CYJA 4RRVA 5D7VA 3O17A 4NYEA 3AGLA 3IO7A 4FKIA 4EONA 3RPYA 4QEBA 4F7NA 4R3PA 5AUVA 4XV3A 5FLFA 4UZDA 3VS5A 4HYUA 2UZDA 1A9UA 4IM3A 4KS7A 2X8EA 3R7GA 1RW8A 3Q60A 4AQCA 3QUPA 3ZM9A 3F5GA 2A2AA 4CFVA 3CGFA 3A60A 3HV5A 3FC1X 4QMSA 4I20A 1YKRA 4C3PA 4GFMA 3AD4A 1Y6AA 1H24A 5CS6A 5E8VA 2VTSA 4RFYA 3PG1A 2XNPA 4E4XA 2ZVAA 5AX3A 4JI9A 3CPBA 3TDWA 2YHVA 2VU3A 4IX3A 1YXUA 5TOZA 5CEKA 2P55A 4XG6A 4ZS0A 4BGGA 4DFNA 2CMWA 5BVOA 2XB7A 3NUYA 4X2GA 4HCTA 4D55A 3DTWA 2ZMDA 3AQVA 4OTHA 4H3PA 2XNOA 3UIXA 2J5EA 4KIOA 2C6MA 4BCGA 4WNPA 4AGUA 4H58A 5KMNA 3DBDA 4J71A 3MI9A 4FEWA 4IB1A 2H96A 5IUIA 3NNXA 1JKTA 3RTPA 4I6BA 4MWIA 3V5LA 2VD5A 3MBLA 2Z7QA 3PY0A 3POOA 2BRNA 4CXAA 4RX7A 4TZRA 3O50A 4BC6A 2CGWA 4IX4A 4AW1A 1V1KA 4JG6A 3UVPA 3COIA 4YLKA 2WQEA 2BR1A 3HX4A 3NCGA 4X21A 4C02A 4C38A 4BCOA 3DKGA 3NAXA 3PLSA 4LOOA 5FP5A 2IZRA 4ID7A 4MBIA 4EYMA 4FTTA 4PTGA 4HPTE 2C6KA 3I0OA 3OBGA 4IB0A 4R7HA 4MQ1A 3U55A 5CANA 1ZWSA 3T8OA 4GCJA 4QMOA 5F95A 3I5ZA 4FTIA 4L52A 3R04A 3TNQB 4I4EA 5L4QA 4R3CA 2JC6A 4GT4A 2V22A 4EI4A 4EQMA 5FM2A 2OWBA 3C5UA 4PNIA 4BF2A 1U54B 4EQCA 2ZAZA 5ANDA 5JN2A 4O22A 4QTCA 4K8AA 3QQFA 4OBQA 4F9BA 5ANJA 4R78A 4DHIB 4ERKA 4L00A 1G8JA 5JGAA 2YLEA 3EMGA 2YERA 3HMMA 3GVUA 1OIRA 3LCDA 4GV1A 3RP9A 3E7VA 4DHZA 2O2UA 4TKSA 3D7ZA 1WFCA 3LXKA 5T3QA 2R7BA 4HCUA 2UW8A 3QTQA 4BWXA 5CEPA 3FMLA 5IEXA 5L2IA 2CKEA 5BVWA 4JX3A 4KKEA 2O5KA 4TT7A 1UU3A 2EU9A 3F3ZA 1YXXA 4EOMA 1Q8UA 5DE2A 4NL0A 3H0YA 3V5WA 3D14A 4PL3A 5FXQA 5EYMA 5A4EA 4FG9A 4OGRA 5HICA 4XP0A 2VX3A 2WMVA 4DEBA 1Y57A 3AC1A 4UV0A 4EOSA 1H27A 4I6FA 2RIOA 4CMUA 5HO8A 2JKQA 3R01A 2C6OA 1O9UA 3DNDA 3FMKA 4JJRA 4X3FA 5DGZA 4C0TA 4EOPA 5ITAA 3NUAA 5G6VA 2H6DA 1P2AA 3FEGA 1W7HA 4ZLYA 2UZLA 5GINE 4WRGA 4G9RA 1YDTE 2XBJA 5EK7A 2C4GA 3BL9A 4QDEA 3MPTA 3KULA 3QCSA 4X7QA 3BYOA 3UG2A 3D7TB 3OVVA 5LMBA 2XNEA 4FTKA 3TCPA 4FKUA 2CNVA 4L9IA 2BHHA 1DM2A 2QD9A 3ZRKA 3FMEA 4CKRA 3Q5ZA 3BLAA 3ERKA 1OB3A 3QXOA 4YURA 4NM0A 5AP1A 3SOAA 5I3RA 4ZJJA 4EUTA 4X3FC 2WQMA 1Q61A 4IZYA 2OU7A 4GSBA 2R3PA 4PL4A 4WOVA 4ZSLA 3K54A 5HVKA 2UUEA 4L8MA 4FA2A 3E8DA 3HMIA 3R2BA 3RK7A 2HELA 4FKRA 3ZXTA 2X0GA 4EKKA 2PUIA 3HL7A 4D5KA 1UA2A 4IQ6A 4XG9A 2OIBA 3OS3A 4FK3A 2KTYA 5T6KA 2XNBA 4BZDA 3FHRA 4BFMA 3EN4A 4IDVA 5AV4A 4D4RA 2J9MA 3P7CA 3VVHA 3I1AA 2VGPA 4AN9A 3DK3A 3OXZA 2IVSA 4M67A 5JFSA 4K77A 3A62A 1QPEA 5IQCA 4AZSA 3HYHA 2ZJWA 4LDTA 5D41A 4HCVA 4I21A 2BILB 3DDQA 4G2FA 4P4CA 5JRQA 4BR3A 3H9FA 3I7BA 3MH1A 4RBLA 3OW4A 2XA4A 5T68A 5DR6A 4RIYA 3HDNA 1FVRA 3ROCA 4F0FA 4KSQA 1Q3DA 2C6LA 2HZIA 4FICA 3ZRMA 4N57A 3BV3A 5L2QA 1U5QA 3AT3A 2XBAA 4PMMA 1PY5A 3LJ2A 3WZKA 3ALOA 3VBWA 3DB8A 3VS1A 3QKMA 3I60A 4CT1A 2Y0AA 4EBVA 5AR5A 2VWYA 3KXZA 3U9CA 1QPDA 4IAKA 4QMUA 3CKWA 4C7TA 3NW5A 5A4CA 1Q24A 2QR8A 1H07A 1H26A 3II5A 4FMQA 2W5BA 3KC3A 5LVMA 4TW9A 5DYJA 1JSTA 4E6CA 2C5OA 2VTQA 4YZCA 5CZIA 5AM7A 2QOBA 1F0QA 3JVSA 2WNTA 5DVRA 3G15A 3UVQA 3ZEWA 1HCLA 3BIZA 5EI2A 4EK8A 4FGRA 3FZ1A 3PXRA 5HESA 4DEGA 5KE0A 4QMWA 3SX9A 1IASA 3HECA 4XX9A 1Y8GA 4RLLA 3W10A 2GS6A 3R1SA 2C6DA 4ZY5A 4ZTQA 1PXKA 5AV1A 3EFLA 4NEUA 3NLBA 4HZRA 3QTUA 4IM2A 3R73A 1TQPA 1OECA 3KULB 4PDPA 4UY9A 2JBOA 4L3PA 2RKUA 2X4ZA 4MNEB 3HRCA 3OY3A 4IBMA 5H2UA 4XG7A 3E8NA 1GZ8A 4FL3A 3WOWA 3VBTA 1UNGA 4CQEA 5FUTA 3G33A 4I23A 2BHEA 3D4QA 4I5CA 4YZNA 4CZUA 2KULA 3NYNA 3JR1A 3MVMA 3QTRA 2YISA 4BRXA 4ACDA 5JKGA 5AUZA 4BTJA 4MXZA 3Q4UA 3PZEA 4G16A 4M69A 3F82A 5J9LA 2I7QA 3A99A 1V0OA 2W1CA 2WTDA 3EN9A 3OFMA 2G2HA 3ZLXA 4APCA 4ASXA 1ZZLA 4LV8A 2JBPA 3NSZA 3LFDA 4MXCA 2IZSA 1J7UA 3V01A 4L3LA 5A4LA 2X0OA 3FI4A 5IEYA 5CAUA 1CMKE 1XH7A 4IC8A 3BLHA 4ZLZA 3U6JA 3R7VA 3TN8A 3PRIA 3NNWA 4GRBA 3LCKA 4E4LA 3BU3A 3E8EA 4A07A 2Y4IC 1J7IA 3LPBA 5F4NA 4RIYB 4BDJA 5DWRA 2EVAA 4LYNA 4PDSA 2ITYA 4NK9A 5HNBA 2CCHA 3QU0A 4ASDA 4R6VA 2VNYA 3GC8A 4YMJA 3TKIA 4D5HA 2XEYA 4YJUA 4M14A 2UZEA 1KE6A 5CQUA 2QCSA 4ZTHA 4U79A 4BB4A 4FL1A 2WU6A 5KMOA 4FBXA 2R3RA 3E87A 4XV2A 4JOAA 2PU8A 1UU7A 1YOJA 4LOQA 4QYFA 5HVYA 5HE1A 3QBNA 4IWOA 2JDOA 2VWZA 3IPHA 4CCBA 3DKOA 4IDTA 3CD3A 3PXFA 4RWJA 3ZUVA 4F9WA 3EN5A 3CTHA 3MFSA 3OBJA 3BBTB 4M3QA 3P23A 2XNNA 4EK5A 3CP9A 3OT8A 3RAKA 4EJNA 5LARA 4TN6A 1BI7A 2G2FA 4FKLA 2B9HA 5HHWA 4B8LA 2CKOA 4A4XA 5M44A 2ZB1A 5B7VA 2IW6A 3BE2A 4IAFA 3FYKX 4CFMA 4F0GA 1FQ1B 5CY3A 4PDOA 4EZ3A 4L46A 5CVGA 4DAWA 4TWCA 5ACKA 3C4XA 5AUWA 4XP2A 4Y72A 1AQ1A 1FMOE 3MH2A 1ZARA 2G9XA 5EG3A 2CGXA 4Y73A 2VWXA 2W4KA 2C30A 3RBWA 4O6LA 4C3RA 5LVLA 2B53A 2PVYA 4RG0A 2XKEA 4AXAA 5IEVA 2IEWA 2VUWA 1WBWA 2BTSA 3JY0A 4QT1A 4UN0C 3ZMMA 3KCFA 1YRPA 4AXCA 3VWAA 4O84A 3LOKA 3TNHA 3CKXA 3UBDA 3F3WA 3GU5A 4IE9A 2R3GA 2J4ZA 2Z2WA 3DGKA 5AAFA 2BKKA 4QNYA 4CVAA 2R9SA 5LMKA 2YDJA 2JDSA 4KS8A 2A0CX 2OZAB 3L8VA 3QRJA 3FMNA 4TYIA 4XG2A 2B52A 3DJ7A 3GU4A 4DFXE 4D4YA 3V5JA 2ETKA 2XNGA 3DU8A 3NX8A 3UP2A 2UZWE 3PVUA 4KINA 4LM5A 5M55A 2OXDA 4IWQA 3VS3A 2B55A 4O82A 4FV7A 4C34A 3DJ6A 4USDA 3GCQA 4U40A 2WMUA 4QMQA 2R7IA 1M7QA 4MH7A 5IQGA 2J50A 4AF3A 3D5WA 3P0MA 4YUQA 1KOBA 3OROA 1JPAA 3NPCA 4TXCA 3OD6X 5BUJA 3W2CA 4DDGA 3SW4A 5IISA 1MUOA 1XH5A 3EOCA 3O8UA 1GZNA 2CDZA 2FSMX 4AGWA 3ORKA 4E4MA 1JAMA 2JAVA 4U8ZA 5M4UA 3KXMA 1NY3A 4AXEA 1APME 2C6IA 3ETAA 1K3AA 2R64A 2P2IA 3DAJA 2C1AA 3FL4A 4J1RA 5F20A 2P0CA 4J8NA 3CSVA 4DF3A 3DXPA 4TRLA 3IK3A 1UNLA 4QO9A 3PSCA 4EH3A 5D7AA 3AMBA 2QHMA 4FSNA 3P08A 4LRKA 3Q96A 4G3DA 5IMXA 1K2PA 2QOQA 2ZDUA 4XUFA 2R3LA 5CSVA 2AC5A 4ZSEA 3N4VA 3W55A 3FKNA 3R1NA 5DRBA 3FE3A 5KMMA 5IUGA 2WMBA 5GZAA 3IECA 1WVWA 3F3TA 3P4KA 3EFWA 3QKKA 4G6OA 1Q3WA 4QMZA 4V04A 2ETMA 4RWIA 2WMTA 3D5XA 2QKWB 4IACA 4UALA 5HO7A 4F9AA 1URCA 4OTGA 5HE3A 5EH0A 5AAGA 4ZZOA 2OKRA 2C3LA 4YZDA 4AQKA 5CNOA 1EH4A 2ACXA 4Z7GA 3O5AA 1CKPA 5CU2A 5A14A 4LV7A 5CU6A 3TYKA 4EUUA 4ZY6A 4QMTA 2A19B 5AV3A 3NNUA 1YWNA 2WOUA 3KKVA 2OH0E 1Z9XA 3WZDA 2BDJA 3G0EA 4L43A 3DFAA 3DXQA 2W1ZA 3KY2A 3IKAA 4OLIA 4EEVA 1ZYSA 5KMKA 3EKNA 2UZBA 1GIHA 3WARA 5C8KA 4Z3VA 2R0UA 4QYGA 4Y85A 4I6HA 3PUPA 2DWBA 4B7TA 3OT3A 3FAAA 3QD3A 3BZ3A 2XM9A 3R71A 2J0KA 2ONLC 2YM5A 4IXPA 2QOLA 4TYHA 4BCHA 3U6HA 4K33A 4WIHA 2VWVA 5HE2A 5LMKC 4JBQA 4RJ6A 2PE0A 3FY2A 3RAIA 2R3MA 5ETCA 2HENA 2I0HA 4HYIA 4FEXA 3PWYA 1R0PA 2I40A 1UU9A 1TVOA 5C4KA 3TM0A 5BVNA 2FSOX 2Z7LA 4QMPA 3QQLA 1XJDA 2GHGA 3ODZX 2W4OA 3ZC5A 2G01A 5J1VA 3MPMA 2UVXA 2GMXA 3TI1A 2BDFA 2VV9A 3D0EA 4YLLA 3C0IA 2RGPA 1JKKA 1YI3A 2IVVA 4BDHA 1RE8A 1BL7A 4FTCA 3SG8A 2IVTA 3UODA 4RX8A 4IM0A 3R21A 3P7BA 3ZZWA 1KE9A 3QRIA 3TZMA 5J9ZA 3KXHA 3V51A 3WI6A 3GCVA 4N6YA 1F3MC 3C7QA 4V0GA 4DFZE 4ORKA 3AKJA 1NVRA 4GK2A 4RIWB 2PVNA 4X2NA 4H1JA 4D4SA 3UC3A 5EHOA 5L6WL 1T45A 4HGSA 3S2PA 5IU2A 4O4DA 3WZJA 1GY3A 3CR0A 3IS5A 4ANNA 4II5A 3JS2A 3QXPA 2DYLA 2AUHA 2X2MA 3OOMA 4AU8A 5K4JA 5EDPA 2QU5A 3N51A 3QHRA 3KXXA 2DS1A 1ZOHA 4S30A 3ANQA 3E62A 4FF8A 2IJMA 1IA8A 1QPJA 4RVKA 4E3CA 3BHYA 4NKSA 3NS9A 4HOKA 4BWPA 2IO6A 3VULA 4JL9A 4E6QA 5HG8A 1MP8A 3GU6A 1IRKA 4PMTA 3W2PA 3DDPA 4NZWB 2I0EA 4NTSA 3NUPA 2QO7A 2E9PA 2BDWA 3PPZA 4FSRA 4K0YA 4FIJA 4FSZA 4CFXA 3R8VA 4BBEA 3FQSA 3KREA 5J95A 1OUKA 4ANQA 3VUDA 3VF9A 3ZUTA 2C3IB 5M4CA 2FO0A 3H4JA 1QL6A 2W96B 5E8ZA 4ZEGA 3BGZA 3ZYAA 3EFJA 3E64A 4HGEA 4JG8A 4TYHB 3ZSHA 5BVFA 2XANA 3RCJA 4AW5A 1UWHA 3A7IA 5AIKA 4A9YA 2OI4X 2J0IA 2V62A 3ZO1A 4U97A 2IZUA 1AD5A 3FZOA 3F5XA 4LUEA 3F61A 3MIYA 3EKKA 4DGGA 2GCDA 5IDPA 4PDYA 2QOFA 1OPLA 1SNUA 2W9ZB 3QUDA 4O0VA 4A9TA 4EK6A 3OG7A 4E5AX 2FB8A 1WVYA 4DH5A 5CENA 4M7IA 4DCEA 4DBNA 2VTRA 2CLQA 4RVMA 2C5YA 1H28A 3DNEA 4JRNA 4L42A 4NM7A 4XNEA 3BE9A 3UOKA 4O7YA 3A7JA 3TG1A 3D7TA 3FV8A 5AP3A 4F7JA 4UWBA 2X9EA 5HD4A 2PVFA 3D94A 3ZSGA 3KU2A 4EH4A 2ZV8A 4FKJA 2PVKA 2NO3A 2WIPA 3OXTA 4MD8E 3PA5A 4OT6A 4RGJA 4W4WA 5HG7A 2CSNA 3CQWA 4C61A 5CF6A 5IA1A 4FNZA 4JMQA 2CKPA 1U4DA 3ACKA 3QGYA 4NT4A 3IQ7A 4F4PA 1UNHA 2RFNA 4FV6A 4XG3A 5KZ0A 3IGOA 2QHNA 3PG3A 3UQCA 3OCTA 4OAVB 2UZVA 4DLJA 2CHLA 4BKZA 1IAHA 1VJYA 2QO9A 5BVDA 3VBYA 4AFJA 3AGMA 3PJ3A 4UBAA 4H36A 4E7WA 5LOHA 2WD1A 3B8RA 3W33A 4EH7A 3WYYA 3C9WA 1KV2A 4BBFA 5A3XA 5KMLA 5E1EA 2XARA 2YWPA 3GXLA 3T3UA 5HU9A 3CCNA 5DI1A 1U54A 1STCE 2R3HA 2R4BA 3F6XA 2QOCA 4U81A 4IX6A 4XHKB 4X2JA 5CSXA 4YJQA 4TTHB 4H3BA 4N0SA 4U42A 5D12A 4I0RA 3AMAA 3WF8A 3EQPA 2W06A 3CLYA 3MGYA 4BDCA 3NZ0A 4DEIA 4O7TA 4APPA 2VTTA 3RWPA 4RJ4A 4O1OA 3Q32A 2OSCA 4LI5A 4GS6A 3Q6WA 4NW6A 4LGGA 2XM8A 4C37A 4DH8A 5BNJA 3NFGB 2XKDA 3HA6A 4L7FA 3LM5A 5AUUA 3N9XA 4FKWA 4CG9A 4JLCA 1VYZA 3QC4A 4GIHA 4GW8A 4JVGA 3BU5A 4U7ZA 5G1XA 4BCJA 4CRLA 4FV8A 5A54A 1PXJA 5F9EA 3QAME 4RFMA 1PYXA 3ORMA 3V04A 4EOIA 2GQGA 3NDMA 2PZRA 3DBCA 2YJSA 3KVWA 5I9YA 3Q2JA 4TNDA 3V6RA 3Q5IA 3S1HA 4FEVA 4Q9ZA 4JDKA 5CF8A 3TZ8A 4C4GA 4EHZA 3UGCA 1T46A 4W4XA 3L9PA 4G17A 4BIBA 2YM8A 3TNWA 4H1MA 4E5BA 1M2PA 2PY3A 4NUSA 3OWKA 3DPKA 5GIOE 5GIPE 3SHEA 4GEOA 5E90A 4JQEA 3PE2A 5EM7A 4ONAA 4YC8A 4YU2A 3MFRA 3R8ZA 2VO7A 3FKLA 5GZ8A 4EZ5A 3TDVA 2WO6A 3W1FA 2J90A 5HBEA 3CY2A 4GFGA 2XEZA 4DH7A 4LV5A 3R00A 4FSQA 3HRFA 1JOWB 1NVQA 5IA2A 4XEYA 5JQ8A 4N70A 2VX1A 1TQMA 3FMHA 4IHPA 4O6EA 1PF8A 2UW3A 5EDRA 4DGNA 2DUVA 1SVEA 1Q62A 3FQEA 3ZEPA 4UWCA 5E8YA 3KA0A 4GKIA 1OVEA 3NVMB 3SG9A 4CT2A 4ZSAA 3E5AA 2Y9QA 3EQDA 3RKBA 3R9DA 4D9TA 1SMHA 5IQDA 5JZJA 2GPHA 2W1IA 3R30A 2WTIA 5CT7A 2XP2A 3B2TA 3S0OA 3DLSA 3NVKI 2J0MB 4UB7A 5KKRC 5IPJA 1W0XC 2HXQA 1JWHA 4CFUA 4EKLA 3C5IA 4JBPA 5BYYA 1WBVA 2BUJA 4U41A 5J87A 4WT6A 4DINA 3E7OA 4LL0A 3G6HA 3T3VA 5JFWA 3KIOC 1VYWA 5AA9A 4MKCA 4BKJA 5IMEA 2G15A 4XCUA 4O81A 2X8DA 4FNWA 2WPAA 4IWDA 5K0KA 3UDTA 2OICA 3QF9A 2FYSA 2OW3A 2PVJA 3EQIA 3Q6UA 5CVFA 3VS2A 3OCGA 4NJDA 4NKAA 1I09A 4Y83A 2PYWA 4EH9A 4ZZMA 5J8IA 4BGQA 4FG7A 5D11A 4KA3A 4QMYA 3VS6A 2X1NA 3PJ8A 4IVDA 2GFSA 3F3UA 3IDBA 4FV1A 4L68A 4B0GA 5TKDA 3VHEA 3SXFA 4WKQA 1ZAOA 4FL2A 5GJFA 3P1AA 3FLSA 3LFAA 4EOKA 4C2VA 3ATSA 2QKRA 2I6LA 2OLCA 5AJQA 2UVYA 2XNMA 3KRJA 3VBQA 3NFFB 1XBCA 3SOCA 5LJJA 3GQLA 4ANMA 1IG1A 3E88A 3AC4A 4CFWA 1L8TA 2XIZA 4DFYA 4MNEA 1NXKA 4FTAA 4W8EA 3ZO4A 1SVGA 2E9NA 3QTIA 3OTVA 3DS6A 5DA3A 4ZTMA 4MBJA 2Z7SA 2GNHA 2Q0BA 3A61A 4P90A 4RJ3A 2XIXA 4YBJA 4IZAA 4AT4A 3LCSA 3QWKA 4DEHA 3AXWA 3F7WA 2XJ2A 2XJ0A 3Q3BA 1OBGA 3TMOA 5KCVA 1QMZA 5CLPA 5EDQA 3EH9A 1ZRZA 1W2FA 2WEIA 3R28A 4YJNA 4MCVA 4AW0A 4EK4A 3ZBFA 4ASEA 3BBWA 2G1TA 4M69B 4ZAUA 2Q83A 3ORNA 1H1RA 4GK3A 1Q5KA 3SDJA 2W5AA 1ZOGA 5DEWA 1XH4A 4QMLA 3WIGA 3OWJA 4F7LA 4TYEA 3V8WA 3TACA 5L6PA 3PVGA 4ZIMA 1M14A 3W0MA 2CCIA 5FEQA 3BYMA 5M09A 5K0XA 3MVLA 1R78A 4FIIA 3PP1A 3QTXA 2JAMA 4IW0A 3SLSA 2X0QA 4K11A