4Q5HA

Shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
169
structure length
169
Chain Sequence
AEPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function, protein binding
molecule keywords Protein kinase OspG
publication title Structural Basis for the Inhibition of Host Protein Ubiquitination by Shigella Effector Kinase OspG.
pubmed doi rcsb
source organism Shigella sonnei
total genus 53
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q5hA01
1XBAA 1HOWA 2C6TA 2W4KA 5J79A 5C4LA 1K3AA 2WMSA 2YWPA 4DFYA 3COIA 2WEIA 1U46A 5AR5A 3ZM9A 4MAOA 3OHTA 2UW0A 1FVTA 4FNYA 1V0BA 4IWOA 4JJRA 5E1SA 2VTNA 2W1ZA 2OZAB 4YJOA 1Q3DA 4BGGA 4PMSA 5I9WA 3FMKA 4D0XA 2X8DA 4FKVA 2YDIA 4NM7A 4DEBA 4JG8A 3KEXA 4FX3A 2BR1A 4CFUA 1WCCA 3CY2A 5IA2A 2XK6A 2ETRA 2PVHA 4NCTA 4WBBB 4WG5A 5ACKA 3FQSA 4TZRA 4YHFA 4AX8A 4BVUA 1QCFA 4RVTA 4TWPA 3K3IA 4RGJA 4QTBA 3QTWA 4C36A 3PA4A 4D4YA 2XIKA 4KIQA 2PWLA 3R83A 1KSWA 3W33A 5AP5A 3ZU7A 5C01A 3KK9A 3VS6A 3ZRLA 3TNQB 4GT5A 4DTKA 3CTJA 3VUIA 2PMNX 3BU3A 4I93A 4HGEA 5A6NA 3FEGA 2J7TA 4M12A 3OS3A 4TWNA 2JDVA 3OWLA 3D0EA 1BLXA 1WVWA 4JVGA 4WG4A 3GI3A 3ELJA 4GRBA 4YJPA 1KE6A 1Q5KA 2QVSE 3R04A 2X8IA 2XKCA 4S32A 5FM3A 3W2QA 4GJ3A 2PUIA 4W9XA 3H9OA 1UWHA 4X3FA 5HIDA 2OJGA 3R1NA 3OOMA 2W5AA 3MDYA 5I9XA 2ZV8A 2H34A 4G16A 2ZMDA 1ZYCA 2W99B 3ORNA 3QKMA 2QHNA 2VRXA 3DNEA 3ZFXA 2E2BA 1W82A 3G90X 1E9HA 4F7SA 3PE1A 4F63A 4HVHA 3R8UA 4CQEA 4F6UA 5HD4A 4GKHA 4B6LA 1RW8A 1R0PA 3UZPA 2IW6A 3QD4A 5ANOA 2X2MA 4P5ZA 3GENA 5HHWA 2IWIA 2GS6A 3MS9A 4DTBA 4JBQA 3A60A 4B7TA 2ZDTA 3PVUA 3UG2A 2HOGA 3VWAA 4O6EA 2P2HA 2QOOA 3NYVA 2CKPA 1OIUA 4IJ9A 3ROCA 3WBLA 4AN2A 3LFDA 3NCGA 4O0WA 1NVQA 4RSSA 4ANMA 2X4ZA 3HV6A 5DIAA 3ZO3A 1GJOA 2BCJA 3Q5ZA 3I79A 3TEIA 5L6WL 1W84A 2PZRA 3DT1A 4OTRA 5F94A 3CCNA 3OWKA 4G6LA 4R6VA 4X3FB 3RPSA 4BZOA 3QXPA 2J51A 2J90A 5H8EA 4FZ6A 4CV9A 2BDFA 2WOTA 3PPJA 1PY5A 3JS2A 5JKGA 1GZKA 4OT5A 1CKPA 5KZIA 3PIZA 1ZZLA 4WD5A 4IB0A 3A61A 2PY3A 4V0GA 3QTXA 2C5NA 4P2KA 4YZCA 3R7IA 3V8TA 2QO9A 4G1WA 4U40A 1H1WA 3DK6A 1OL1A 5L2QA 3BWJA 3FMHA 5AV0A 2HXQA 2J2IB 1JAMA 3C4ZA 4TL0A 3LFEA 3MIAA 2GFSA 3RP9A 4UWCA 4WKQA 4YHTA 4ZSEA 3T8OA 3DLZA 4JAIA 5JZNA 4C3PA 4DG0E 2ZYBA 2A4LA 4FNZA 2PZYA 2R7BA 4UMRA 1OKVA 1NVSA 4C02A 4RIYA 4C3FA 4EKKA 4UY9A 4MHAA 4ID7A 4ALWA 3QC4A 5J9YA 4KBKA 3WI6A 4CFMA 3NS9A 3EJ1A 5K9IA 4HPTE 3HNGA 2XBAA 5EW3A 3RBWA 4LMUA 1G8SA 4OAUC 3DGKA 3AT4A 4Y46A 3P79A 4V0GB 2VU3A 4WNKA 3QWJA 4EZ5A 2C3IB 3NIZA 4I3ZA 5EOLA 4ACHA 3QGWA 1NT2A 5KE0A 4MWHA 5HZNA 2JIUA 2BAKA 2C30A 3G9LX 5AM7A 5BVDA 5FQDC 3I7CA 5AR8A 4JRVA 1UU7A 3HRFA 5HCZA 5AV3A 5HORA 1WVYA 4USDA 1OBDA 3Q04A 4PPAA 2NRYA 5IA0A 2VV9A 1E1XA 3BX5A 4IM0A 3U4UA 4HVSA 3G6GA 5M4CA 2CMWA 4Y72A 4ZSLA 3C5IA 1URCA 4BC6A 4F6WA 3BV3A 1Z5MA 4G9RA 2J5FA 5CZIA 5AUZA 3SLSA 4KWPA 5IH5A 2BRHA 2P33A 4Y5QA 1FMKA 3JVRA 1XO2B 3MH3A 4ZMFA 3II5A 1IA9A 3RZFA 4RX8A 2DQ7X 2W17A 4QT1A 4RIYB 4F99A 3V5TA 5IUGA 2J0KA 3OFMA 4TN6A 4EOJA 4LI5A 3MH2A 4H1MA 4J97A 3SRVA 4X2KA 3T3VA 2YIRA 4JXFA 1JWHA 4F0GA 5ICPA 5IQCA 4JBVA 1GY3A 2HAKA 2UZEA 3DKFA 2HWPA 3IW4A 3S1HA 2R3OA 4XOYA 4EWQA 2JDRA 1KOAA 4IC7A 1H28A 4IZ7A 3EKKA 4FZFB 4CZYB 3F3WA 5FWKK 1PKDA 4I6HA 4OTIA 3PFQA 3I0QA 1J7IA 2BPMA 1M2RA 5HESA 2PVNA 5TR6A 3TIYA 4KINA 3PVBA 3DAKA 4XLIA 2EXMA 3BHHA 2WMTA 4QO9A 3BLRA 3L9PA 3W8LA 1YXTA 2A27A 2B9HA 4TYIA 5TT7A 4BICA 2P0CA 3E64A 3HV7A 3G0EA 4FV6A 3BV2A 3UIUA 4OTPA 3ID6C 1OKZA 2W06A 5KNJA 5LQFA 4AU8A 4W4XA 4RJ7A 4KIKA 4O7TA 3P9JA 1TVOA 3LFBA 5HTBA 4W8EA 4O84A 3PIYA 1E1VA 4DGNA 5E9EA 2JITA 3LXPA 4YJSA 2J0LA 3SRVB 3VJNA 5KMOA 4EOSA 3EZRA 4IE9A 2QOHA 2UVZA 1WMKA 3GU6A 4X7QA 2EVAA 5DYJA 4G5JA 4EBVA 4EOIA 3CD3A 4RX5A 5CEKA 4W4WA 5KZ0A 3FAAA 4FIIA 2O65A 4PF4A 4AXAA 3KRLA 3VBWA 5IQHA 2YCFA 4S34A 5M06A 3DKOA 4GIIA 3BCEA 4JX3A 3NUYA 3PXQA 4L43A 3UG1A 1R0EA 3KU2A 2QONA 2VTPA 4A06A 5EH0A 2C3JA 3G33A 3C4FA 3FI3A 3QZFA 3S0OA 5AUWA 3V6RA 4C4IA 4BDCA 4DGGA 3BGZA 3SG8A 2X9EA 1H1QA 3AC1A 3F3ZA 4RIOA 1JSUA 5ANIA 4KIKB 4EHVA 2XZSA 4BDJA 3UTOA 5I0BA 4FKWA 1IEPA 4CT2A 5AEPA 3HECA 3UGCA 5A46A 4OAVB 1Q41A 2JDOA 3O7LD 2OIBA 3DPKA 4FOCA 1XBBA 2P2IA 2NPQA 3EKNA 4V05A 3VUMA 3W55A 5KBQA 2ZB0A 4M68A 2VWZA 4FNWA 2X4FA 5AADA 3TV6A 4CLIA 2WMWA 1WBNA 3HMPA 1VYZA 3NR9A 4C37A 3TUDA 3BEGA 1S9IA 1YOJA 5DH3A 5DVRA 1IAJA 3HMMA 3ODZX 5LMKC 4B8LA 2WMXA 4GFGA 5CT7A 4J95A 3RVGA 2O0UA 4GUBA 4IAKA 3SOAA 3LKMA 4JG6A 3CQUA 2F2CB 3EIDA 5EOBA 2GNJA 4D5KA 2IPXA 4BIBA 2ITOA 5ACBC 2ZDUA 2OK1A 3IDPA 3VHKA 2YZAA 2BDJA 2QU5A 2RFDA 2VX3A 4IAFA 1Q97A 4E5BA 4RFYA 3V01A 4FSZA 2HW6A 3B8RA 3D5VA 3EYHA 1JKTA 4OUCA 4EORA 1JSVA 3AGLA 4U5JA 1I09A 4IAIA 4C58A 2R3JA 3PUPA 5I3RA 1XQZA 3E7OA 3KVWA 4WA9A 3F5GA 3W2PA 4Z3VA 3NVMB 4M69B 1Q4LA 2F9GA 5HE0A 3WF9A 3MWUA 1Q8UA 4IM2A 3DQXA 3PP0A 5DE2A 4AUAA 1IRKA 4RZVA 3RTPA 1ZYLA 2PUUA 3DTWA 4EH7A 3ZYAA 4FEVA 5IQDA 4XV9A 3FLNC 2XNGA 4J96A 4PMPA 2Z02A 4ZOGA 4RFZA 5JGBA 3LFFA 4IQ6A 4G6NA 4BDBA 3A8WA 5AP4A 2HK5A 2JEDA 3FL5A 4YLJA 3SXFA 4I20A 4RIWA 1YXVA 4G3CA 4L44A 4EOLA 2BKKA 1J7LA 3M11A 4BDIA 3A62A 3O8UA 4ZTSA 2W05A 2R5TA 4FV5A 4RRVA 3PLAE 3FKOA 1ZMVA 4U80A 1J7UA 3LCSA 2YCSA 3MGYA 3EOCA 4O81A 2QR8A 2VWUA 3FBVA 3HV5A 3NAXA 4DH1A 3HKOA 2G2HA 3D83A 4XEYA 3ATSA 2OFVA 1F5QA 1H08A 5FEEA 2W0JA 5FEQA 4O0RA 3RHKA 4A9UA 4O7WA 2R3IA 3VRZA 3ITZA 3NSZA 5JSMA 4BZNA 4QQ5A 2PTKA 4ACMA 4DEGA 3JXWA 3BLQA 4HVIA 5I5ZA 2WXVA 3BLHA 3C4EA 5J8IA 2ZV9A 3OY1A 3PJ1A 4B0GA 3AGMA 4J71A 4C4GA 2BTSA 3DBDA 3R7GA 4L52A 3R01A 4HW7A 4BCGA 4R3PA 3SDJA 5B2LA 3L9LA 5BUEA 3LW0A 4NJ3A 4XP3A 3TNHA 1H1PA 4HYSA 2I0HA 4FZ7A 4V01A 3ORZA 3DKGA 4YJRA 5I9YA 4RIWB 3EH9A 4QMLA 4I0RA 1PXOA 5ETCA 4CEGA 5FTOA 3C5UA 3SD0A 4ZZNA 4L8MA 4D5HA 4IC8A 4I92A 4H58A 5JFXA 2YM3A 5M09A 1SNXA 2X7FA 5AUUA 4NUSA 3NPCA 3QRKA 2IZSA 4KRCA 4PTEA 5FBOA 3TCPA 3GOPA 2ZM4A 3UOKA 4EOPA 4PNIA 3E8CA 5AMNA 4EI4A 1YOMA 2UZVA 2OBJA 5L4QA 1NVRA 2EXCX 3MFSA 4BI1A 4R7HA 5CZHA 3VS1A 5A4CA 1W0XC 4ZZOA 4ZLOA 5LOHA 2F2UA 4DC2A 3GC0A 1U54A 2JGZA 2WQMA 4E7WA 2OH4A 2X7GA 3N9XA 2B54A 3QQJA 4FK6A 2YDKA 4FKPA 3RAHA 4L42A 1Q62A 2J4ZA 4V04A 3ZC6A 4IACA 3TI1A 3V6SA 1U59A 3AXWA 5J95A 3LFQA 3C9WA 4JX7A 3FLSA 4FG7A 3PZEA 4FIEA 3SQQA 4N57A 5BVNA 2XK7A 3R30A 3RPVA 3QUPA 4U42A 3EQFA 4LYNA 4YTIA 4MX9A 4FNXA 3EFKA 2UZTA 4I5HA 3UO5A 3IW6A 3O51A 2E9PA 3I1AA 5IA5A 3LQ3A 3FZOA 2YN8A 3R2BA 3ZZEA 4BCMA 4MF0A 3ZLWA 2XIYA 4WUNA 1B6CB 5FP6A 2ZOQA 3DDPA 3TN8A 5L2IA 2Z8CA 3E8DA 4AZSA 4AW5A 4CG9A 1GOLA 3UO6A 1NY3A 2XCHA 3HP5A 4MBJA 3E3BX 1OUKA 4LOPA 5EYKA 2X81A 3QUEA 4CMTA 2XIRA 5KHXA 4BZDA 1ZY4A 3UMXA 3VRYA 3FLYA 2B7AA 2F7XE 2JDTA 3IDBA 3I81A 3NLBA 1K9AA 1U54B 3P4KA 3KMUA 4KSQA 4M66A 3VS5A 4AA4A 4BCNA 2R3MA 3FC1X 4N70A 3E93A 3ZBFA 4EQMA 5CEMA 5JFVA 2CN8A 4F9AA 3BEAA 3E92A 3TKHA 3GT8A 5IQGA 4FG9A 1REKA 2JKKA 3E8NA 4O7ZA 5DG5A 3W2RA 5DT4A 3F2RA 4I1ZA 4B4LA 4O7SA 1BUHA 3FLZA 3DJ6A 4JOAA 1PXNA 4YLKA 3ZFMA 4FSRA 3QQFA 5DBXA 1A48A 4OBQA 3L8XA 4N0SA 2VO0A 1MUOA 2QOLA 1U4DA 1JLUE 2BFYA 3L8SA 5HVYA 4AN3A 5HTCA 4FL3A 4PMTA 5DNRA 2JIIA 4FUYA 3T9IA 2Z7QA 4GVAA 4BWXA 3KXMA 4GKIA 4U97A 3NUXA 3JY9A 4IXPA 4GYGA 1IAHA 5HGIA 1XJDA 3OT8A 4FEWA 4FA2A 3EQGA 4YZ9A 3UYTA 1ZOGA 4L7FA 4EH4A 5KUPA 3MA6A 4XBUA 2BHEA 1YVJA 2E9VA 3O7LB 5L8KA 3QTUA 4CD0A 4EC9A 4J7BA 1PKGA 4BDHA 2UW8A 4GT4A 2FSMX 5DLSA 4USFA 3EZVA 3U6IA 4PDPA 3D94A 4FV1A 2H96A 4FV9A 4OTGA 4FV7A 4DF3A 1B39A 5EDRA 1CTPE 2J6MA 2ITTA 1OPLA 3SW4A 2WU7A 2C1BA 2R0IA 3LCOA 4W9WA 3QYZA 2JFLA 2WGJA 3GU4A 1Z57A 2XRUA 3F3UA 4IADA 4O82A 4FG8A 4MK0A 5EI6A 3TV4A 4ACDA 2PVJA 2Y6OA 1H07A 2QLUA 2W4OA 3O23A 4LUEA 3BWFA 5B7VA 3FLWA 4KUJA 1M7QA 1URWA 3KF7A 4C62A 4C34A 2C5YA 2IJMA 3EQBA 4ZK5A 3KXXA 4Q5HA 5LMBA 3HA6A 5D9HA 3MBLA 5A4TA 3NYOA 2YFXA 3R9DA 5J1VA 3NEWA 4ZLYA 5IA1A 5EYCA 3SVVA 1PXLA 1Q8WA 1Q99A 4W8DA 3P7CA 2V7OA 3V8SA 2NO3A 3PA5A 5AJQA 3TZMA 5DMZA 2KULA 5EW9A 1LP4A 1OECA 1OB3A 5IMEA 5CF6A 1PMEA 4UX9A 2HZNA 4N4SA 5BX0A 4FTCA 3SXRA 3ZZWA 3ORLA 5FXRA 2BMCA 2C3KA 2C0TA 3NVKI 3EN7A 3BHTA 3OCTA 3K3JA 3OZ6A 5JQ8A 4RVLA 1IA8A 3UVRA 3PPKA 4GU9A 1BKXA 3G5DA 3UJGA 5FDPA 2FYSA 2EB2A 4BTJA 1TQMA 4FTMA 4D2PA 5CTPA 4UB7A 1OBGA 4FEUA 3JR1A 3GCUA 4BCQA 5J87A 4YNEA 3A7FA 4DLJA 4I5MA 4KNBA 1MRVA 3KREA 4JR7A 3AMBA 3P86A 2WFYA 4FSNA 4EOOA 5H8BA 3MFTA 5EFQA 3P78A 2VO3A 4AT5A 4C2VA 3SAYA 5EM5A 4LGHA 4FL2A 1TKIA 4CMOA 4IFGA 1V0OA 1GZNA 5GJFA 3R8MA 3H4JA 2B1PA 3DNDA 2GMXA 2X6EA 3D15A 4K1BA 4DG2E 3RM6A 5AUVA 4YU2A 4Q2AA 1OPKA 2GNGA 2YM6A 5I3OA 2IG7A 4BBEA 4QYEA 2V0DA 2C6OA 4CTCA 3NRMA 2WIHA 4QMNA 1WBSA 3UNJA 3NZ0A 1ZWSA 4H3QA 5H9BA 2OI4X 2IZUA 4TYEA 5IG1A 3R73A 3IPHA 5IQEA 5FEDA 1OL6A 1PXJA 4ASDA 2QKRA 5IDNA 4FT5A 5GNKA 2Y4IC 3Q53A 3CTQA 2QHMA 4U3ZA 1FINA 2UZWE 3LM5A 4UMUA 3GU8A 4YC8A 3AOXA 3OTVA 4NIFB 1IASA 2GDOA 2WB8A 2A0CX 5CANA 2GS2A 2BZJA 3CQWA 4UMPA 5KHWA 4FTRA 4MCVA 4LGGA 3LJ2A 4MF1A 2IVTA 4BKZA 3H9FA 1P4FA 5M55A 2YIYA 4C4JA 3FY2A 4P5QA 3SC1A 4DAWA 5J7BA 5KKRC 3NW6A 2BIKB 2Z7SA 4F6SA 5CI6A 2O5KA 3OC1A 3DDQA 3LPBA 1JSTA 2ITVA 2ZMCA 2ZJWA 3Q6WA 5LXMA 4L3PA 1XH6A 3P7AA 4QPAA 4DH3A 1UU3A 2V7AA 3I4BA 3KK8A 3UO4A 4AZVA 5CU3A 3A7JA 4DFLA 4E8AA 2WZJA 5CASA 4G34A 2GHLA 5A14A 3IG7A 5B0XA 3RPRA 1W7HA 2C6IA 4KB8A 4C0TA 4FT7A 2JDSA 1VJYA 4CYJA 2CCHA 2HENA 2WMVA 2X9FA 2CDZA 3R0TA 3GU5A 4D2WA 4O0YA 3FV8A 2E9NA 4FTOA 3PY0A 3A4OX 4DG3E 5GIPE 3M42A 4I6FA 4WRSA 1NXKA 4LRMA 1VZOA 5IA3A 1JNKA 3SG9A 3HP2A 4M3QA 3EQIA 4PDSA 4Q5EA 3KA0A 2W1GA 4TW9A 4YZNA 4F9BA 4OBOA 4P4CA 4ANSA 3DXQA 2PZPA 4FTJA 4RLLA 5AX3A 4BHZA 2YLEA 3CPBA 3CKWA 3BHUA 4I6QA 2GU8A 3JYAA 3VF9A 5J1WA 1BX6A 3LM0A 3UMWA 3VHEA 3MJ2A 5DGZA 1PXPA 3QD3A 2CGWA 3QLGA 5ANDA 4ACGA 1YHWA 4K18A 5ANKA 5E7RA 5AP1A 5BQ0A 3UIBA 5KX8A 5CAUA 2Y6MA 5HVKA 5HX8A 2VN9A 3CTHA 4IX4A 5BUJA 4OTQA 3KL8A 3MVHA 4H1JA 1H00A 4DEEA 4JS8A 5AV2A 3WE8A 3DA6A 4U45A 4L01A 4KS8A 4IFCA 3ZDIA 2FSTX 4X2FA 4LMNA 4L53A 5HKMA 1T45A 3R00A 3PY3A 4PY1A 3HZTA 4O7RA 5F20A 4DTAA 2BDWA 3D14A 5ETFA 2I1MA 4WSYA 3UP2A 2CCIA 4RX7A 3UP7A 3COMA 4IW0A 5GIOE 3A8XA 4E4LA 3WZDA 4TWOA 3E8EA 4YJTA 5AR4A 5HCXA 5BMSA 5F95A 3RCDA 4MD9E 4MXZA 3G0FA 2ITWA 4TT7A 4U81A 3PXKA 3ENMA 3MTLA 4DT8A 5AP0A 3R28A 4G6OA 4ZJJA 4BY9E 5HOAA 5EDQA 3GP0A 3UYSA 1G5SA 3F5UA 3CGOA 4F1MA 4J8NA 2CNUA 2R3GA 2C68A 3VC4A 4RC3A 4ZTHA 3EMGA 4CSVA 4CNHA 5HE2A 1ZMUA 4X2GA 2W1EA 1SVEA 3SW7A 1Q24A 2E9UA 5M51A 4L6QA 4TKSA 1Y8YA 5C1QB 3U55A 3BYMA 2WIPA 3UDBA 4K6ZA 3DCVA 2R0UA 3BIZA 2I40A 4YJQA 2BRBA 2QOQA 3PG3A 4FTAA 1CM8A 3QGYA 2C6MA 2BAQA 2XF0A 3FLQA 3RM7A 4D1XA 1OM1A 5CAQA 4ANLA 2ERKA 2GHGA 4ZP5A 4ZAUA 2ITYA 3RPYA 5FTQA 5ANJA 1GZ8A 5CNOA 3ZO2A 5L8JA 2JC6A 3MH0A 4O0TA 1CDKA 4FZAB 3MVLA 2BZIB 4M67A 3IO7A 2PVMA 3GC7A 4TYJA 1Y6BA 4RJ5A 3GNIB 5FRIA 4AGUA 3DJ5A 4FZDB 3DFCB 4IVAA 4U3YA 4D58A 5KMNA 3BYOA 1ZARA 4XS2A 1OIQA 2QG5A 3CPCA 5EG3A 4AG8A 4E6QA 4HYIA 3QC9A 4ZTRA 3C4XA 4M8TA 2OJ9A 4YZMA 1M2PA 5CAVA 5CVFA 5H2UA 2YDJA 3FDNA 3FSFA 1ATPE 4A9SA 5M08A 3FKNA 2W1FA 3PTGA 4D4VA 5FGKA 2W1CA 3EN4A 4EJ7A 2R3HA 3TNPC 2C0IA 3E3PA 4X3FC 3TTIA 4F4PA 2JBOA 4KKHA 1UWJA 4BKYA 4ASXA 4NM0A 1IG1A 4JDIA 2X1NA 3TZ9A 5FDXA 3PXZA 1JKSA 1A06A 5AIKA 2PVRA 4ZTQA 2LAVA 4O7YA 5TOZA 3ZFYA 1YRPA 4FSWA 2W4JA 5DPVA 3WF7A 2QOCA 5A3XA 3W18A 2IVSA 2FSOX 4ANOA 1YWVA 4Y73A 3R63A 3MIYA 2CNQA 4UYNA 3Q32A 3VQHA 2ONLA 2WD1A 5T3QA 2EB3A 4NSTA 5JFSA 2EXEA 1PRYA 2YEXA 3NIEA 1WBVA 2DS1A 4MD8E 2WTKB 1BYGA 3TJCA 4HJOA 4HGTA 4E6CA 2WTDA 2QKWB 1STCE 4GMYA 3U87A 2HZIA 5M57A 3UC4A 1OIRA 2I6LA 4F65A 3RK7A 3VUDA 2YM8A 3CEKA 4O2PA 3QHWA 5CAOA 3GOKA 4YZDA 1UKIA 5AX9A 1P14A 2VX0A 4A07A 3LFNA 2ETKA 3L9NA 3TUBA 5HO6A 3OBJA 5CU4A 4DEHA 3EQHA 4NW5A 3NW7A 2VTQA 4RC4A 4YC3A 2YLFA 3BGPA 3U4WA 3IQ7A 4RX9A 3UVQA 4BCFA 4IVBA 4BYJA 4IH8A 5G6VA 2YIQA 5LWNA 3Q4TA 4FTQA 5C4KA 5M4UA 4NTTA 4EEVA 5CLPA 3R7UA 1YDRE 4RWKA 3ATTA 4LV8A 4BTFA 4LL0A 2WELA 3GXLA 4EK6A 1WBOA 4PDOA 1YWNA 4A9RA 3S2PA 2SRCA 2Q0BA 3ZLXA 4F0IA 4MQ1A 4YPSA 3CBLA 4GK2A 3FXXA 3FPQA 2V22A 5KMIA 1FGIA 2WQBA 4NEUA 4EWHA 2QU6A 4U43A 3TV7A 3QTIA 1WBTA 3OOGA 3Q2MA 4QQCA 2PZIA 5LVMA 2QOIA 4QMZA 4FKSA 3RPOA 5LJJA 3VW6A 5JRQA 3ORTA 1JKLA 3MY0A 3ZM4A 3I60A 3KY2A 3MPTA 4AF3A 5BPYA 4S30A 3R9OA 3H0YA 3UBDA 4GG5A 3UOJA 5FM2A 2RL5A 3DTCA 5JGDA 4KAOA 4QRCA 4R1YA 3LLTA 4B9DA 4R1VA 4DH5A 2Y0AA 3OXIA 5D1JA 4DEAA 3ODYX 1CKJA 3PRFA 4EHEA 4F09A 5L6PA 3ORIA 1ZOEA 2XKDA 2YIWA 5K5NA 2ITUA 1OITA 4U6RA 4ZEGA 5L2TA 4C2WA 2OIDA 2V62A 2W9ZB 3RAWA 3PPZA 1MQ4A 2WTVA 3F7WA 3ALNA 4BN1A 3R6XA 4FICA 3EQRA 4XYFA 3CY3A 5GINE 2OZOA 3HL7A 3VS2A 2WMBA 4IWDA 3RAKA 4YTFA 4AGWA 3L9MA 4FKLA 2ITZA 1G3NA 4NYEA 3S95A 2G01A 3MB7A 3HMOA 3IGOA 4RC2A 5JQ5A 5LARA 2VTSA 3OF0A 3BRBA 3BPRA 4E4MA 1PYEA 2JFMA 2GCDA 4K9YA 3MY1A 4LFIA 3BQCA 3D5UA 3VIDA 1G8AA 2XNBA 5FUTA 3FZPA 3GQIA 1H01A 4FSYA 5L3AA 1PYXA 2XNOA 4LM5A 3Q4UA 4YO6A 3R8LA 1ZZ2A 4GK3A 4OGRA 3VN9A 5GZAA 4DEDA 5LMKA 2YISA 1MRYA 3BBWA 1UV5A 4FVQA 5LVNA 1UVRA 3AC2A 4FV3A 3WZJA 2BAJA 3NCZA 4GG7A 4PL5A 3WIGA 4AW2A 4BKJA 3VJOA 2FGIA 3PJ8A 3NUSA 4Y5HA 1GZOA 1R39A 3P23A 3QTZA 4R8QA 5E1EA 5F4NA 4XG8A 4D0WA 4Z9LA 1SVHA 3Q52A 4KS7A 3KCFA 4QP9A 4NTSA 4X2NA 4JG7A 3TG1A 1W98A 2R64A 3D2KA 4IWQA 1UKHA 4QP1A 2CSNA 4E6AA 5DFPA 5AR3A 5K3YA 4BGHA 3ZEPA 4DEIA 5IH4A 1Q61A 2VWXA 5HLPA 3U6JA 5CSVA 4ZTLA 5K0KA 3VF8A 3PYYA 5HICA 2OXDA 3IOPA 3QKKA 4CLJA 5E8XA 2WMRA 3V5WA 3V5PA 2XBJA 4AFEA 3UQGA 5BUIA 3AD4A 5CXHA 2FA2A 3EN9A 3L8VA 4R78A 4U8ZA 4QTCA 3W2SA 4I23A 3Q6UA 4NK9A 3RWQA 3B2WA 4YURA 4FV8A 3HGKA 4ZY5A 4XG7A 4MNFA 5CQWA 2OF4A 3QTRA 5L2WA 4I41A 4X6QC 4XV2A 3QD0A 2FH9A 2R4BA 4Z7HA 1MP8A 4A9YA 3R2YA 1YOLA 5F1ZA 4QP8A 3TACA 1JPAA 5GJGA 3TXOA 3L8PA 3VBXA 4I4EA 3IK3A 1L8TA 1PXKA 3DK7A 3KRWA 3Q60A 2J5EA 2HZ4A 4BF2A 2HELA 3LAUA 3F6XA 3V5QA 2QURA 2WMQA 2KTYA 3ORXA 3THBA 2QOKA 3GQLA 3QCXA 3BBTB 2GS7A 4HYUA 1X8BA 2FSLX 3PSDA 3QF9A 4WNPA 5ETAA 3V5LA 4HZRA 3A7GA 4X2JA 3VBVA 3MN3A 5LVOA 3KXHA 5E92A 4QYGA 4D55A 2R9SA 4JI9A 4FSMA 4QP6A 3P0MA 4GSBA 3O17A 4O0UA 5IEYA 2CHLA 4XP0A 1KE8A 3G51A 5CEQA 4LRJA 5IEXA 3N51A 5I9VA 4YHJA 5EHOA 1IR3A 5CENA 2J0MB 4RVMA 3QA0A 1JKKA 3UE4A 2B0QA 4MEDA 4ZSGA 2ITXA 4ENYA 2YABA 3EYGA 3NW5A 4M97A 4RA5A 4AOTA 5EYMA 2QC6A 4QYFA 5AUYA 3KN6A 3QKLA 3QLFA 2XCKA 4DLIA 1OIYA 1GIIA 3PIXA 4A4LA 4C8BA 2F4JA 4OTFA 3VS0A 2A19B 4AW1A 5DI1A 3AC4A 5D7VA 4BHNA 4EYJA 4KKGA 2AC3A 3NUNA 4PWNA 3LIJA 4YR8A 2XK8A 3PJCA 2IZRA 3D5WA 4DCEA 3RWPA 3KGAA 3F66A 2C6EA 3BQRA 2B52A 4ANBA 4CG8A 3MESA 1RQQA 2OFUA 3WF6A 3Q9XA 4MD7E 4ZIMA 3A4PA 4QMXA 5AR2A 5EQYA 4ZS4A 5BVWA 4G3FA 5LWMA 3ACJA 4AAAA 3ZHPC 1H8FA 2UZDA 3DZOA 4KBAA 4YTHA 2CGXA 3OUKA 2VUWA 4K33A 4QP7A 3R8ZA 4B99A 3FMMA 2BILB 4RQVA 1BMKA 4MXOA 2YAKA 4MYGA 4BWKA 5M4FA 3ANRA 3CC6A 4PTCA 2RFEA 2VWWA 4ORKA 4TTHB 2A2AA 2YERA 4BBFA 4FSTA 3HA8A 5AIRA 5DOSA 3AD5A 2QCSA 3QX2A 3MI9A 5EQEA 3ORKA 5M53A 3FI8A 3BE9A 4YSMA 4QD6A 2V5QA 3FC2A 4EL9A 1U5RA 1QPEA 3PDTA 3LQ8A 3QQKA 4R77A 2WMUA 5IQAA 3S4QA 1H4LA 1FBNA 4XG9A 1GIHA 2IZTA 5CYIA 2XYUA 4FIFA 3OXZA 5EDPA 5EM6A 4YO4A 5KO1A 3DBCA 3T9TA 4JL9A 4CCUA 1SYKA 4XG3A 5D7AA 3WZEA 3ETAA 2RG6A 3CIKA 4GV1A 4PPCA 5IEVA 4XJ0A 4X3JA 4CV8A 2VX1A 3HUCA 2R2PA 5E8YA 3S3IA 3U9NA 3PY1A 4F08A 3DBEA 3TNWA 1W83A 3G9NA 2Q0NA 3FJQE 3BKBA 4GS6A 4S2ZA 2OXYA 3FI2A 4QPMA 4Z55A 4L45A 3OCSA 3PJ2A 3QZIA 3AMYA 4JR3A 4E93A 2V55A 2VTTA 3NNWA 4O7NA 3E62A 3PVGA 5ANEA 2XIZA 3D4QA 1FVRA 4JNWA 2I0VA 4ZTMA 4XHKB 2QR7A 4F9CA 4ZSJA 4FK3A 3AMAA 3CJGA 4F70A 3R1QA 4H05A 2X2LA 4EK3A 2I0EA 3W1FA 4EH8A 3C4CA 2XVDA 2Y9QA 5HBHA 2IO6A 4ALUA 4S31A 5EK7A 2VAGA 2GQGA 2VWBA 5HNBA 1YKRA 4HNFA 3DXNA 3NWWA 2UZBA 3PSBA 3QYWA 4L7SA 5GJDA 4WUAA 5IISA 4DFBA 5FG8A 3Q4CA 2XJ2A 4EUUA 1UNLA 4Y85A 3ZTXA 3DBQA 3OEZA 1WZYA 5DR9A 2J50A 3TKUA 3VNTA 4DCAA 4A4OA 4ZXTA 5HE3A 4BCKA 5M07A 4FTIA 1FOTA 4TWCA 1SNUA 4F1TA 4FTLA 3C51A 2B55A 1KOBA 5EM7A 3OD6X 2G15A 3I6WA 4N6ZA 3RCJA 4AFJA 5AP2A 3SA0A 4O7VA 4DITA 3SGCA 4M14A 3Q5IA 4PP9A 3U51A 3KQ7A 1TQIA 1APME 4PRJA 3G15A 2AUHA 1Y8GA 4L9IA 4C33A 4DFZE 4BCHA 4FVRA 4FKRA 4ZY6A 4XUFA 4XG2A 4C61A 3ENHA 4FGRA 3C1XA 3UOHA 4NM3A 3F3VA 4RBLA 4JIAA 5AUTA 4U44A 4G5PA 5E8WA 5B2MA 2XK9A 3IONA 3RHXA 4D1ZA 5CI7A 5TO8A 4L67A 4R5SA 3RZBA 4AGCA 2ERZE 3QALE 2XM8A 4PTGA 4TNDA 1S9JA 4FC0A 5CEOA 3CGFA 4BCIA 3RNYA 3R1SA 4F1OA 3GC8A 3E5AA 4BI2A 1DAWA 2GHMA 3CKXA 3HLLA 5ANGA 2WO6A 3KXNA 4YGAA 2GTMA 5CEIA 3OCBA 5LCKA 3FYJX 2XA4A 4IZAA 2RF9A 2AC5A 2JKOA 2ZV7A 4AT4A 1W8CA 3N4TA 1AGWA 2BKZA 4O0SA 5EHLA 5K5XA 3ULZA 1F0QA 3HRBA 5EYDA 2UVYA 3FXWA 4XRLA 5DR2A 1Y6AA 5AWMA 2XH5A 3EQDA 4I24A 4MWIA 3R9HA 2VO7A 2R3QA 5JK3A 1FQ1B 2J0JA 4CZUA 4PV0A 5HI2A 2UW3A 1PJKA 4M7IA 3LHJA 4IX3A 2XNNA 2C5XA 3ZDUA 5CSXA 4ENXA 4XOZA 3LMIA 4QMYA 3C7QA 4GVJA 4DFXE 4C59A 5D10A 3ZUTA 4ZMEA 2FUMA 2YIXA 3GB2A 4O96A 4FYOA 5AV4A 1QPCA 5CALA 4RLKA 2RFNA 3QD2B 4RPVA 4A4XA 2BALA 4WIHA 4U41A 2EWAA 3C0IA 3MY5A 4HCUA 4RIXA 4DHFA 4DINA 4ZJVA 2UW5A 4FKTA 1FVVA 4K11A 4X0MA 3LMGA 2O63A 2VTHA 5HG9A 3KCKA 3JPVA 2CNVA 4DA5A 4FV4A 3B2TA 4C57A 2BRMA 4TNBA 2IN6A 3F9NA 4LV5A 3O96A 4PMMA 3OP5A 3LVPA 4QMSA 3A99A 5LVLA 3OW3A 3QRJA 5DEWA 2B4SB 4YJVA 3MTFA 3COKA 1Y91A 4A9TA 1R78A 5AP3A 5JN2A 2ZV2A 4OLIA 4TY1A 5IUHA 2A1AB 3OWPA 4NWMA 3B8QA 3PE2A 1OL2A 2E9OA 4ZZMA 4W4YA 5BVEA 4EOQA 1XH7A 3POOA 3C0HA 4RT7A 2PMIA 5G1XA 3I0OA 4BDFA 2QG7A 2EU9A 2QO2A 2UZNA 5E4HA 5DRBA 3LFSA 3VUGA 4K8AA 4IANA 4BCOA 4FKIA 3EQCA 1QL6A 2XYNA 4I4FA 5AAEA 2P55A 4BB4A 4PL4A 3FMDA 4RIXB 3SXSA 4CMUA 1LPUA 4IMYA 3HDMA 3L1SA 4FTNA 4AS0A 4H3BA 3TIZA 2VWYA 2P3GX 3DXPA 4MNEA 5E8SA 3BZ3A 4CFNA 1FPUA 4FBXA 4L3LA 5C27A 4BDEA 2XIXA 4LG4A 4NZWB 3I6UA 5CEPA 2W1HA 4WHZA 4BL1A 3KXZA 4GJ2A 4J53A 5KBRA 3IW7A 5B2KA 3ORMA 3R22A 4OTWA 2B9IA 4RWLA 3KULA 3LCDA 4RJ8A 5C9CA 2R3KA 3ZEWA 2OLCA 5A4QA 3VBTA 4Z7GA 3WE4A 3BYVA 1REJA 1I44A 2IW8A 3VUTA 3D2IA 5CSPA 1O6YA 4O6LA 3ALOA 1LR4A 2BROA 3PXRA 2XNPA 5HBJA 3O71A 2PE1A 4GFOA 1BL6A 1OL5A 4MXYA 3R9NA 4KIOA 4ZS0A 2PVKA 4Z16A 3VW8A 4TPTA 5HQ0A 4CZTA 3Q2JA 4BTKA 2HYYA 3FYKX 5AM6A 4E73A 1DI9A 4AN9A 4AZTA 5J9ZA 2C6LA 4XBRA 4XX9A 3OMVA 3KF4A 3QQGA 1QPDA 4L00A 2YHVA 4IAZA 2QOBA 4MXXA 4MVFA 5FXQA 4CFXA 3PJ3A 4L68A 2R3RA 4IAAA 2HY0A 3KMMA 3F5XA 4DN5A 4UALA 4E1ZA 2DWBA 4J1RA 4WOVA 4B8MA 3HAMA 4TYHA 4YC6A 3VO3A 3LCKA 4FIGA 3KULB 4O1PA 3RI1A 2W9FB 3ZONA 3EL8A 2BRGA 3NNVA 4DH7A 5GZ8A 3DBFA 3R7EA 2R3FA 4QMVA 4R7BA 1M2QA 2UW4A 3TWJA 2BFXA 3FMNA 3PP1A 3OXTA 3N4VA 5EM8A 3WF8A 5HTIA 2OSCA 2YACA 3E88A 2X2KA 3EN6A 4EOMA 4EZ7A 5D12A 4C7TA 3EHAA 4C35A 4L46A 4KA3A 5AP7A 3Q3BA 2DUVA 4XP2A 4FKQA 2H9VA 5J9LA 3OCGA 1YI3A 1LEZA 4HOKA 3ZOSA 3W10A 1CMKE 3QQHA 4BI0A 1VYWA 1OGUA 1QPJA 1YXSA 2PK9A 4O1OA 1H24A 5E90A 4CQGA 2JIVA 3BHYA 3ZS5A 4EBWA 4EUTA 3FUPA 4DFUA 2OW3A 3CD8A 4I0SA 4QNAA 3VAPA 4GCJA 4RZWA 3WZUA 2PUPA 4APCA 4XNEA 4RQKA 5T6KA 3UIMA 2GNIA 3AC8A 4FEQA 2BUJA 3MPAA 5DT0A 1YW2A 4HVGA 1Z9XA 3AD6A 4BCJA 1PMNA 4P90A 4FMQA 4TYHB 5JFWA 1O6KA 4MKCA 3UNKA 3AC5A 4BDDA 1YI4A 1ZAOA 2BHHA 3WOWA 4GFMA 3NGAA 4FYNA 3RKBA 3BHVA 3C50A 4KRDA 5HG5A 3VVHA 3OT3A 4ALVA 4EH3A 2YCQA 5M4IA 2WHBA 5AV1A 3FZ1A 3GCSA 5EQPA 1BI8A 4CXAA 4G3GA 2PE2A 3GUBA 1J91A 1LEWA 1OI9A 1XKKA 4F7JA 4FL1A 1ZMWA 1XR1A 3WZKA 3ZC5A 3FMJA 2Z7LA 3K54A 2ACXA 3IS5A 4AGDA 4EQCA 1AQ1A 2JD5A 4OR5A 3R8VA 4FEXA 3EL7A 3IGGA 5JEBA 2C6DA 3G2FA 3V8WA 3P1AA 4BBMA 4NCTC 1UU9A 4Q9ZA 3PLSA 2VWVA 4AP7A 5ITAA 3Q9WA 3SKCA 2XJ0A 2Z60A 1ZYSA 3QU0A 3VUHA 2UW7A 3RALA 5HU9A 2VD5A 3QBNA 3U54A 3M1SA 4UEUA 3LCTA 4QMOA 4WNMA 5J7HA 5FD2A 4O27B 3DY7A 4DE4A 2W5HA 3SV0A 4UBAA 2XM9A 4I5PA 3D5XA 4IX6A 2G9XA 3BE2A 2B9JA 1RE8A 4FIJA 5AA8A 5HU3A 1KV1A 5HEZA 4AE6A 4R3RA 2Y7JA 1KUTA 2UVXA 3HDNA 3HV3A 3P08A 1V1KA 4NKSA 2QODA 2YA9A 3WF5A 1PHKA 3LOKA 4GUEA 5CVGA 4E5AX 4LQMA 1O9UA 1JQHA 4RG0A 1AD5A 4MQ2A 3UC3A 4H3PA 3NYNA 4AOJA 4O22A 4IHPA 1PF8A 3CQEA 4FKJA 3TJDA 5K0XA 3HX4A 5HX6A 1OL7A 5E91A 4EQUA 2BVAA 3JUHA 4PPBA 2X39A 2XRWA 3TUCA 4ITJA 2I0YA 4WSQA 3R8PA 2XKFA 3VULA 5I4NA 3HMIA 4LUDA 2XNMA 5KMLA 4CGAA 4L3JA 3AT2A 4O2ZA 4MBIA 3JY0A 4NT4A 1KE9A 4FKGA 5DR6A 5IQIA 5C26A 2IW9A 5DHJA 4DT9A 4E26A 4JLCA 2PVYA 3BU5A 3BYUA 5FXSA 3KRRA 4GH2A 4YP8A 2PVLA 4EH5A 4UXQA 4XRJA 5BVKA 1H0VA 2FVDA 2OU7A 2PPQA 5TF9A 3W2CA 3LJ0A 1RJBA 1VEBA 2WQNA 5IUIA 3LMHA 4PL3A 4JQ7A 4BWPA 5K4IA 4YMJA 3IDCA 4D9UA 2VTRA 2BTRA 4TYGA 2HY81 3DAJA 3MV5A 4QP4A 3FI4A 4JT3A 4D2SA 4K77A 1ZY5A 2WTKC 4FOBA 4IIRA 4PDYA 2C3LA 4NU1A 4P7EA 3H0ZA 3OY3A 3T3UA 4RJ3A 4UZDA 5FTGA 4F64A 3A2CA 1MQBA 1VR2A 3K2LA 3PG1A 5E8ZA 1EH4A 3MVJA 3O2MA 4H36A 2GNFA 5HIBA 5JRSA 2J0IA 1K2PA 2R3PA 4J8MA 5IMXA 3LE6A 3QCSA 5M56A 4EC8A 2QNJA 3VS3A 1OKWA 4XV1A 4AWIA 5TE0A 4EK5A 2C5VA 4TXCA 1UA2A 1ZOHA 4FODA 2XUUA 3D9VA 3KB7A 4FV0A 1FGKA 4I6BA 3ULIA 3Q9ZA 5CX9A 3ZLYA 3U6HA 1P4OA 3KRJA 3NNUA 3ZSGA 3AC3A 5BNJA 1YWRA 3OWJA 3QQLA 2B9FA 1H27A 1FMOE 4GU6A 4FV2A 2W96B 3LQ5A 2CN5A 3MH1A 5HG7A 5IF1A 4QTEA 3FWQA 2CLQA 5FP5A 4D2RA 5AR7A 1U5QA 3UQCA 2PMOX 4HCVA 4QP3A 5DT3A 5JT2A 4O86A 3PSCA 1JOWB 1OMWA 2ITQA 4PQNA 3UODA 3FSKA 2XKEA 4UXLA 1PW2A 5CF4A 5HLNA 5L2SA 2W5BA 4EH9A 2CJMA 2ONLC 5JGAA 3TKIA 3WILA 4AT3A 5IQBA 4F0FA 2C69A 4FT3A 4DH8A 1BL7A 4R5YA 5LMAA 2O2UA 4BIDA 3FHIA 4QMUA 1ERKA 2HW7A 3DKCA 4G9CA 2W1IA 3MFRA 4UZHA 5CAPA 4CTBA 5EHYA 3UPXA 2OXXA 5KMMA 3KC3A 4UWYA 5M44A 3QZGA 3DB8A 4IAYA 4Y8DA 4KBCA 4CVAA 3FZRA 1M52A 2PE0A 2O8YA 4O21A 4E5WA 3M2WA 1XH9A 2YJSA 4BRXA 4LRKA 3FE3A 3CJFA 3CP9A 5AA9A 1CSNA 4ZJIA 1XH8A 3C4WA 3DLSA 4JDKA 4PX6A 3QRTA 5L6OA 2VTLA 3IKAA 4DBXA 2BZHB 3H30A 1DM2A 4FVPA 4RFMA 3NUPA 3QFVA 5E8TA 3PVWA 4A7CA 2YM7A 2RFSA 4K0YA 4YSJA 5A4LA 3RNIA 4XG6A 1WBPA 4J52A 1GIJA 5FLFA 4GW8A 3IOKA 3ZUVA 4ANNA 3ZXTA 3P5KA 3HAVA 4F7LA 3O8TA 1GNGA 5CT0A 4EJNA 2CKOA 3GFWA 3BYSA 4JBOA 4QTAA 3ANQA 4LOOA 4FTTA 4CFFA 4G2FA 2F57A 2X6DA 2UW6A 3ZCLA 3UIXA 3Q96A 4DYMA 4QNYA 4PP7A 4ZSAA 2WPAA 3QAME 5BMMA 2W1DA 5HNGA 3HRCA 2XEZA 3LXLA 2YM5A 1XH5A 3IECA 2PL0A 3NX8A 3KN5A 4FTKA 4G17A 4ITHA 4M0YA 5IPJA 5ETIA 2OJJA 5IKWA 4WNOA 3R9RA 1A9UA 3RK5A 4EK4A 1WFCA 1CKIA 5CWZA 4C4HA 4YTCA 4RMZA 5T68A 1WBWA 1PMVA 2XP2A 3H3CA 1LUFA 3KVXA 4W4VA 3VS4A 4O0XA 4EONA 4EHGA 4LL5A 4H39A 4ITIA 3DOGA 5EI2A 3NUUA 2WKMA 1SVGA 4FR4A 1QMZA 3H9RA 4IB5A 5J5TA 3R71A 3O0GA 3VQUA 2YJRA 2Y8OA 4BDKA 5CQUA 4O83A 4WO5A 2XS0A 5A6OA 3EFLA 2QI8A 2YM4A 2CGVA 4QMTA 2F49A 3SOCA 3TM0A 2VGOA 3F5PA 4UN0C 5GZ9A 4M84A 1J1CA 3ERKA 1PXMA 1JVPP 3REPA 3RK9A 5CU6A 3VBQA 2PVFA 4F9YA 4RJ6A 5CF5A 4GL9A 4M69A 2DYLA 3A7HA 4YZBA 5CU0A 1UU8A 3NAYA 2VGPA 2VNYA 3OBGA 5HLWA 4DGOA 3DQWA 4J99A 4BR3A 1OVEA 2NRUA 3ZMMA 4QP2A 1F3MC 2GFCA 3HVCA 3ZSHA 2GSFA 3COHA 2YCRA 4YJUA 2HXLA 3UZTA 1T46A 3UQFA 4IX5A 2WTCA 3TT0A 1H25A 1H1RA 3WIKA 2CKQA 3GFEA 3WYXA 3PWYA 3TDWA 1XBCA 2UZLA 3R7VA 3QCYA 4II5A 5CU2A 2CLXA 4X6RA 4KKEA 1YDTE 3NYXA 2ZB1A 2CGUA 2RGPA 3F2AA 4CKRA 2IVUA 1RDQE 3ZO1A 2YITA 5LVPA 4FI1A 4JAJA 4NFNA 4QMWA 5IZFA 2WAJA 4J98A 3CSVA 3OVVA 4Y83A 3OTUA 4DBNA 5DEYA 1R3CA 5C8KA 5JMSA 4QMMA 4IVCA 4KSPA 3RAIA 1Q8TA 5CVHA 1KE7A 3WARA 1XWSA 4FTUA 4YLLA 3QXOA 4JDJA 4NKAA 1ZYDA 2RIOA 1V0PA 4QMQA 3FMLA 1M7NA 4M13A 2PU8A 3SHEA 3P7BA 5HVJA 4RA4A 3QCQA 2OJIA 3TZ8A 3GGFA 4RJ4A 3UOLA 4FSUA 4IDTA 2XB7A 3DAEA 2ETMA 4FF8A 5AAFA 3TL8A 4EOKA 1ZLTA 2VO6A 5IDPA 2O3PA 1DI8A 2ITPA 4C38A 4ERKA 3EWHA 2OICA 2RSVA 2R7IA 2G2FA 2WTIA 3LZBA 2PMLX 5HE1A 4IDVA 4Q9SA 3N4UA 2JAVA 4KABA 3MJ1A 1HCKA 3QX4A 4FT0A 4U9AA 3KMWA 1M17A 4MBLA 4I5CA 4XMOA 3EFJA 2NNWB 2BZKB 3E87A 3MA3A 3AQVA 3I5ZA 3O50A 4M0ZA 3FZTA 3LXKA 4RWIA 1NA7A 3HMNA 2WTWA 4ONAA 5JZJA 2WU6A 3FKLA 3TDVA 5EI8A 5H8GA 2ESMA 2NP8A 3UZRA 3PRIA 1J1BA 4IZ5A 4QYHA 5A4EA 2ITNA 1ZXEA 3LXNA 3GC9A 3OROA 4I22A 5AP6A 3F82A 1YQJA 3QUDA 4WT6A 3UNZA 2UW9A 5IU2A 3BGQA 4O0VA 4AZFA 2JAMA 3D7TA 3LFAA 3W32A 3GCVA 2F7EE 3HV4A 4D28A 5J5SA 3NDMA 3QQUA 4DGMA 4DFNA 4ZLZA 1Y57A 5K4JA 1YXXA 4XLVA 4FE2A 5FBNC 2OO8X 1TQPA 4O91A 4EZ3A 2C5OA 1B38A 1YHVA 4CRSA 2GTNA 5E8VA 1OZ1A 1JBPE 2VTAA 3FL4A 5H3QA 5A54A 3BI6A 5I9UA 2X8EA 3IW8A 2ZM1A 2GPHA 5DA3A 4HYHA 5CY3A 4ASZA 3GEQA 4KIPA 5HG8A 2Z7RA 5HBEA 2XK4A 4CT1A 2FB8A 3GVUA 2VTIA 2GNLA 2JLDA 3DFAA 4NW6A 4X21A 1KV2A 3NUAA 2ZAZA 5C8MA 3PXFA 3CS9A 3PWDA 4U7ZA 2UZUE 3D7ZA 2XMYA 4USEA 1UNHA 4UMTA 1P5EA 3FXZA 5KCVA 2LGCA 3R7YA 4IVDA 3TTJA 4E6DA 4CKJA 5CNNA 1HCLA 4BGQA 3CE3A 3FY0A 3QA8A 3VS7A 1YDSE 3EFWA 3D7TB 3K5VA 3MPMA 3CR0A 3F7ZA 4D2VA 4BYIA 4EHZA 5EW8A 3ZH8A 4F7NA 1XH4A 2WNTA 3HYHA 4IJPA 2VNWA 5A9UA 4RWJA 2FO0A 3HEGA 1ZRZA 1GAGA 2OG8A 1J3HA 3EB0A 1Q8YA 2R3NA 4YNOA 2OIQA 2WEVA 5E8UA 4F9WA 3PA3A 4NM5A 4HCTA 4YBKA 4MH7A 5GHVA 3QWKA 2O64A 4JRNA 2GNHA 2Z2WA 4UYAA 4BFMA 3V04A 3I5NA 3LJ1A 2J9MA 4CYIA 3MSSA 1H26A 2JKMA 4FKOA 4C4EA 4ZTNA 3FPMA 3QHRA 5CS6A 4CFVA 5L8LA 4I0TA 5DN3A 3UVPA 4AZEA 3BU6A 2WQEA 3TNIA 1WVXA 1H0WA 3KKVA 2WMAA 5LCJA 3RGFA 1SZMA 1KWPA 2YZLA 2BIYA 4XH6A 5BYLA 4EKLA 4CRLA 4JDHA 4IB3A 4DGLC 1OKYA 3MW1A 2EUFB 4G3DA 4E4NA 2HCKA 1WAKA 4JQ8A 1DAYA 1YI6A 4C4FA 2H6DA 5BYZA 3PZHA 1O6LA 2UZOA 3NNXA 3FZSA 3KFAA 2X0GA 4TRLA 3ZXZA 3ZRMA 4HGSA 2HZ0A 2OGVA 2QO7A 3E7VA 3EN5A 4M15A 4NFMA 3CLYA 2HWOA 1Q8ZA 2JBPA 2GQSA 2Q83A 5HIEA 4GEOA 4LGDA 4CFWA 5HO8A 3RJCA 5EKOA 4NL0A 2PYWA 4EK8A 4QMPA 2VZ6A 4NH1A 4UWBA 3ROYA 2Y4PA 3V3VA 4CKIA 4E4XA 5IA4A 5AFVA 2OWBA 3A7IA 2C47A 2ZVAA 3OG7A 4ERWA 1KE5A 4WBOA 4I94A 4QOXA 3U8WA 4AW0A 4QTDA 5CXZA 4ANQA 4XG4A 2I7QA 4D4RA 3HUBA 5AAGA 4IZYA 2QOFA 4IM3A 2CPKE 4N6YA 4R3CA 5C8NA 2C0OA 3CXWA 3QTSA 2R3LA 4E3CA 3R21A 5TKDA 3ORPA 3LFCA 4O38A 3V5JA 5CSHA 2PSQA 4D4SA 2H8HA 5BVFA 2PUNA 1DS5A 4E20A 3DB6A 4MXAA 4QPSA 2ZM3A 2BRNA 2QQ7A 4GK4A 4HGLA 4IBMA 3QL8A 4QYYA 3U9CA 5HO7A 4HNIA 3FQEA 4HPUE 3RMFA 5BVOA 4BCPA 4FSQA 4QQJA 3VUKA 3DZQA 4OTDA 3VBYA 4ZY4A 3FQHA 4BIEA 3MYGA 3FMEA 4PUZA 4IWPA 4YPDA 4YJNA 4AOIA 3DK3A 2GQRA 2JKQA 4GYIA 2P4IA 2UV2A 3DV3A 3WYYA 2XJ1A 3OEFX 3ZSIA 1ND4A 3R7OA 2HIWA 2OJFE 4AA0A 1ZYJA 2YAAA 3Q9YA 1MRUA 2CKEA 3TZ7A 3KRXA 4JBPA 2VTOA 4GT3A 4JQEA 1BI7A 4OW8A 3W8QA 3GCQA 1Q3WA 4U0IA 4FUXA 3E63A 5EKNA 2AYPA 3QZHA 4GIHA 4FT9A 2C4GA 3ET7A 3I7BA 5D41A 3ZLSA 4AZWA 3F61A 3ZO4A 4U79A 4NIFA 4QQTA 4NJDA 1R1WA 4UMQA 4FGBA 4ARKA 3ZBXA 3LLAA 3DU8A 1H1SA 1YHSA 2QLQA 2REIA 3AG9A 4K2RA 3W16A 5D11A 5JH6A 4O7LA 3C0GA 3W2OA 4Y95A 4AACA 4EH6A 4BDAA 2WTJA 3KXGA 4APPA 4WG3A 2IVVA 2C1AA 3F3TA 4YUQA 2Y4IB 4FKUA 4LOQA 3JVSA 5CSWA 3ZUUA 4KD1A 4BTMA 4OBPA 1PMUA 2YWVA 2F7ZE 4YBJA 4JIKA 4C3RA 4IB1A 4D2TA 3MVMA 2C6KA 4D1SA 4PNKA 3BELA 4CCBA 4AQCA 1OPJA 2VTJA 2X7OA 2PULA 3F69A 1XHAA 3MB6A 4EYMA 3F2NA 4RVKA 4S33A 1P2AA 3O8PA 2OKRA 1PXIA 1SMHA 2OF2A 3DJ7A 3GU7A 3ACKA 3QTQA 3V51A 1OUYA 5KKRB 2VTMA 4XCUA 5HD7A 2WQOA 2RKUA 5F9EA 4R7IA 1L3RE 3R1YA 4FIHA 5CF8A 2UUEA 3Q4ZA 5BYYA 2B53A 3K5UA 1UNGA 2RG5A 4MXCA 2WOUA 2VWIA 3SX9A 5KMJA 5DRDA 2XK3A 4OT6A 3AT3A 4UV0A 4G31A 5IQFA 3S00A 3G6HA 3IW5A 4ASEA 3OUNB 5DWRA 4AA5A 2OZAA 5IH6A 3C13A 3GBZA 3RINA 2G2IA 1SM2A 4I21A 4EH2A 3EQPA 4BDGA 3F88A 4WRGA 5I9ZA 4IEBA 4MNEB 2XNEA 5HNIX 2W7XA 4ACCA 1YXUA 3FHRA 3MFUA 3OW4A 2QD9A 3DS6A 3R02A 4XV3A 3NMUF 3POZA 2G1TA 1M14A 2PHKA 4HZSA 4HVDA 3PXYA 2XEYA 2OH0E 4OTHA 3UPZA 3QRIA 5AUXA 5HCYA 5C03A 2PZ5A 1NW1A 3ZRKA 5KMKA 4MTAA 4G3EA 4D9TA 3H10A 4AE9A 3QRUA 3GCPA
chains in the Genus database with same CATH superfamily
1XBAA 1HOWA 2C6TA 3W0NA 2W4KA 5J79A 5C4LA 1K3AA 2WMSA 2YWPA 4DFYA 3W0OA 3COIA 2WEIA 1U46A 5AR5A 3ZM9A 4MAOA 3OHTA 2UW0A 1FVTA 4FNYA 1V0BA 4IWOA 4JJRA 5E1SA 2VTNA 2W1ZA 2OZAB 4YJOA 1Q3DA 4BGGA 4PMSA 5I9WA 3FMKA 4D0XA 2X8DA 4FKVA 2YDIA 4NM7A 4DEBA 4JG8A 3KEXA 4FX3A 2BR1A 4CFUA 1WCCA 3CY2A 5IA2A 2XK6A 2ETRA 2PVHA 4NCTA 4WBBB 4WG5A 5ACKA 3FQSA 4TZRA 4YHFA 4AX8A 4BVUA 1QCFA 4RVTA 4TWPA 3K3IA 4RGJA 4QTBA 3QTWA 4AAYA 4C36A 3PA4A 4D4YA 2XIKA 4KIQA 2PWLA 3R83A 1KSWA 3W33A 5AP5A 3ZU7A 5C01A 3KK9A 3VS6A 3ZRLA 3TNQB 4GT5A 4DTKA 3CTJA 3VUIA 2PMNX 3BU3A 4I93A 4HGEA 5A6NA 3FEGA 2J7TA 4M12A 3OS3A 4TWNA 2JDVA 3OWLA 3D0EA 1BLXA 1WVWA 4JVGA 4WG4A 3GI3A 3ELJA 4GRBA 4YJPA 1KE6A 1Q5KA 2QVSE 3R04A 2X8IA 2XKCA 4S32A 5FM3A 3W2QA 4GJ3A 2PUIA 4W9XA 3H9OA 1UWHA 4X3FA 5HIDA 2OJGA 3R1NA 3OOMA 2W5AA 3MDYA 5I9XA 2ZV8A 2H34A 4G16A 2ZMDA 1ZYCA 2W99B 3ORNA 3QKMA 2QHNA 2VRXA 3DNEA 3ZFXA 2E2BA 1W82A 3G90X 1E9HA 4F7SA 3PE1A 4F63A 4HVHA 3R8UA 4CQEA 4F6UA 5HD4A 4GKHA 4B6LA 1RW8A 1R0PA 3UZPA 2IW6A 3QD4A 5ANOA 2X2MA 4P5ZA 3GENA 5HHWA 2IWIA 2GS6A 3MS9A 4DTBA 4JBQA 2XAOA 3A60A 4B7TA 2ZDTA 3PVUA 3UG2A 2HOGA 3VWAA 4O6EA 2P2HA 2QOOA 3NYVA 2CKPA 1OIUA 4IJ9A 3ROCA 3WBLA 4AN2A 2IEWA 3LFDA 3NCGA 4O0WA 1NVQA 4RSSA 4ANMA 2X4ZA 3HV6A 5DIAA 3ZO3A 1GJOA 2BCJA 3Q5ZA 3I79A 3TEIA 5L6WL 1W84A 2PZRA 3DT1A 4OTRA 5F94A 3CCNA 3OWKA 4G6LA 4R6VA 4X3FB 3RPSA 4BZOA 3QXPA 2J51A 2J90A 5H8EA 4FZ6A 4CV9A 2BDFA 2WOTA 3PPJA 1PY5A 3JS2A 5JKGA 1GZKA 4OT5A 1CKPA 5KZIA 3PIZA 1ZZLA 4WD5A 4IB0A 3A61A 2PY3A 4V0GA 3QTXA 2C5NA 4P2KA 4YZCA 3R7IA 3V8TA 2QO9A 4G1WA 4U40A 1H1WA 3DK6A 1OL1A 5L2QA 3BWJA 3FMHA 5AV0A 2HXQA 2J2IB 1JAMA 3C4ZA 4TL0A 3LFEA 2A98A 3MIAA 2GFSA 3RP9A 4UWCA 4WKQA 4YHTA 4ZSEA 3T8OA 3DLZA 4JAIA 5JZNA 4C3PA 4DG0E 2ZYBA 2A4LA 4FNZA 2PZYA 2R7BA 4UMRA 1OKVA 1NVSA 4C02A 4RIYA 4C3FA 4EKKA 4UY9A 4MHAA 4ID7A 4ALWA 3QC4A 5J9YA 4KBKA 3WI6A 4CFMA 3NS9A 3EJ1A 5K9IA 4HPTE 3HNGA 2XBAA 5EW3A 3RBWA 4LMUA 1G8SA 4OAUC 3DGKA 3AT4A 4Y46A 3P79A 4V0GB 2VU3A 4WNKA 3QWJA 4EZ5A 2C3IB 3NIZA 4I3ZA 5EOLA 4ACHA 3QGWA 1NT2A 5KE0A 4MWHA 5HZNA 2JIUA 2BAKA 2C30A 3G9LX 5AM7A 5BVDA 5FQDC 3I7CA 5AR8A 4JRVA 1UU7A 3HRFA 5HCZA 5AV3A 5HORA 1WVYA 4USDA 1OBDA 3Q04A 4PPAA 2NRYA 5IA0A 2VV9A 1E1XA 3BX5A 4IM0A 3U4UA 4HVSA 4LDTA 3G6GA 5M4CA 2CMWA 4Y72A 4ZSLA 3C5IA 1URCA 4BC6A 4F6WA 3BV3A 1Z5MA 4G9RA 2J5FA 5CZIA 5AUZA 3SLSA 4KWPA 5IH5A 2BRHA 2P33A 4Y5QA 1FMKA 3JVRA 1XO2B 3MH3A 4ZMFA 3II5A 1IA9A 3RZFA 4RX8A 2DQ7X 2W17A 4QT1A 4RIYB 4F99A 3V5TA 5IUGA 2J0KA 3OFMA 4TN6A 4EOJA 4LI5A 3MH2A 4H1MA 4J97A 3SRVA 4X2KA 3T3VA 2YIRA 4JXFA 1JWHA 4F0GA 5ICPA 5IQCA 4JBVA 1GY3A 2HAKA 2UZEA 3DKFA 2HWPA 3IW4A 3S1HA 2R3OA 4XOYA 4EWQA 2JDRA 1KOAA 4IC7A 1H28A 4IZ7A 3EKKA 4FZFB 4CZYB 4BJJA 3F3WA 5FWKK 1PKDA 4I6HA 4OTIA 4AXDA 3PFQA 3I0QA 1J7IA 2BPMA 1M2RA 5HESA 2PVNA 5TR6A 3TIYA 4KINA 3PVBA 3DAKA 4XLIA 2EXMA 3BHHA 2WMTA 4QO9A 3BLRA 3L9PA 3W8LA 1YXTA 2A27A 2B9HA 4TYIA 5TT7A 4BICA 2P0CA 3E64A 3HV7A 3G0EA 4FV6A 3BV2A 3KIOC 3UIUA 4OTPA 3ID6C 1OKZA 2W06A 5KNJA 5LQFA 4AU8A 4W4XA 4RJ7A 4KIKA 4O7TA 3P9JA 1TVOA 3LFBA 5HTBA 4W8EA 4O84A 3PIYA 1E1VA 4DGNA 5E9EA 2JITA 3LXPA 4YJSA 2J0LA 3SRVB 3VJNA 5KMOA 4EOSA 3EZRA 4IE9A 2QOHA 2UVZA 1WMKA 3GU6A 4X7QA 2EVAA 5DYJA 4G5JA 4EBVA 4EOIA 3CD3A 4RX5A 5CEKA 4W4WA 5KZ0A 3FAAA 4FIIA 2O65A 2X0QA 4PF4A 4AXAA 4BJJB 3KRLA 3VBWA 5IQHA 2YCFA 4S34A 5M06A 3DKOA 4GIIA 3BCEA 4JX3A 3NUYA 3PXQA 4L43A 3UG1A 1R0EA 3KU2A 4DHJA 2QONA 2VTPA 4A06A 5EH0A 2C3JA 3G33A 3C4FA 3FI3A 1OGYA 3QZFA 3S0OA 5AUWA 3V6RA 4C4IA 4BDCA 4DGGA 3BGZA 3SG8A 2X9EA 1H1QA 3AC1A 3F3ZA 4RIOA 1JSUA 5ANIA 4KIKB 4EHVA 2XZSA 4BDJA 3UTOA 5I0BA 4FKWA 1IEPA 4CT2A 5AEPA 3HECA 3UGCA 5A46A 4OAVB 1Q41A 2JDOA 3O7LD 2OIBA 3DPKA 4FOCA 1XBBA 2P2IA 2NPQA 3EKNA 4V05A 3VUMA 3W55A 5KBQA 2ZB0A 4M68A 2VWZA 4FNWA 2X4FA 5AADA 3TV6A 4CLIA 2WMWA 1WBNA 3HMPA 1VYZA 3NR9A 4C37A 3TUDA 3BEGA 1S9IA 1YOJA 5DH3A 5DVRA 1IAJA 3HMMA 3ODZX 5LMKC 4B8LA 2WMXA 4GFGA 5CT7A 4QDVA 4J95A 3RVGA 2O0UA 4GUBA 4IAKA 3SOAA 3LKMA 4JG6A 3CQUA 2F2CB 3EIDA 5EOBA 2GNJA 4D5KA 2IPXA 4BIBA 2ITOA 5ACBC 2ZDUA 2OK1A 3IDPA 3VHKA 2YZAA 2BDJA 2QU5A 2RFDA 2VX3A 4IAFA 1Q97A 4E5BA 4RFYA 3V01A 4FSZA 2HW6A 3B8RA 3D5VA 3EYHA 1JKTA 4OUCA 4EORA 1JSVA 3AGLA 4U5JA 1I09A 4IAIA 4C58A 2R3JA 3PUPA 5I3RA 1XQZA 3E7OA 3KVWA 4WA9A 3F5GA 3W2PA 4Z3VA 3NVMB 4M69B 1Q4LA 2F9GA 5HE0A 3WF9A 3MWUA 1Q8UA 4IM2A 3DQXA 3PP0A 5DE2A 4AUAA 1IRKA 4RZVA 3RTPA 1ZYLA 2PUUA 3DTWA 4EH7A 3ZYAA 4FEVA 5IQDA 4XV9A 3FLNC 2XNGA 4J96A 4PMPA 2Z02A 4ZOGA 4RFZA 5JGBA 3LFFA 4IQ6A 4G6NA 4BDBA 3A8WA 5AP4A 2HK5A 2JEDA 3FL5A 4YLJA 3SXFA 4I20A 4RIWA 1YXVA 4G3CA 4L44A 4EOLA 2BKKA 1J7LA 3M11A 2ZFYA 4BDIA 3A62A 3O8UA 4ZTSA 2W05A 2R5TA 4FV5A 4RRVA 3PLAE 3FKOA 1ZMVA 4U80A 1J7UA 3LCSA 2YCSA 3MGYA 3EOCA 4O81A 2QR8A 2VWUA 3FBVA 3HV5A 3NAXA 3W0SA 4DH1A 3HKOA 2G2HA 3D83A 4XEYA 3ATSA 2OFVA 1F5QA 1H08A 5FEEA 2W0JA 5FEQA 4O0RA 3RHKA 4A9UA 3BL7A 4O7WA 2R3IA 3VRZA 3ITZA 3NSZA 5JSMA 4BZNA 4QQ5A 2PTKA 4ACMA 4DEGA 3JXWA 3BLQA 4HVIA 5I5ZA 2WXVA 3BLHA 3C4EA 5J8IA 2ZV9A 3OY1A 3PJ1A 4B0GA 3AGMA 4J71A 4C4GA 2BTSA 3DBDA 3R7GA 4L52A 3R01A 4HW7A 4BCGA 4R3PA 3SDJA 5B2LA 3L9LA 5BUEA 3LW0A 4NJ3A 4XP3A 3TNHA 1H1PA 4HYSA 2I0HA 4FZ7A 4V01A 3ORZA 3DKGA 4YJRA 5I9YA 4RIWB 3EH9A 4QMLA 4I0RA 1PXOA 5ETCA 4CEGA 5FTOA 3C5UA 3SD0A 4ZZNA 4L8MA 4D5HA 4IC8A 4I92A 4H58A 5JFXA 2YM3A 5M09A 1SNXA 2X7FA 5AUUA 4NUSA 3NPCA 3QRKA 2IZSA 4KRCA 4PTEA 5FBOA 3TCPA 3GOPA 2ZM4A 3UOKA 4EOPA 4PNIA 3E8CA 5AMNA 4EI4A 1YOMA 2UZVA 2OBJA 5L4QA 3BL9A 1NVRA 2EXCX 3MFSA 4BI1A 4R7HA 5CZHA 3VS1A 5A4CA 1W0XC 4ZZOA 4ZLOA 5LOHA 2F2UA 4DC2A 3GC0A 1U54A 2JGZA 4JMQA 3VONA 2WQMA 4E7WA 2OH4A 2X7GA 3N9XA 2B54A 3QQJA 4FK6A 2YDKA 4FKPA 3RAHA 4L42A 1Q62A 2J4ZA 4V04A 3ZC6A 4IACA 3TI1A 3V6SA 1U59A 3AXWA 5J95A 3LFQA 3C9WA 4JX7A 3FLSA 4FG7A 3PZEA 4FIEA 3SQQA 4N57A 5BVNA 2XK7A 3R30A 3RPVA 3QUPA 4U42A 3EQFA 4LYNA 4YTIA 4MX9A 4FNXA 3EFKA 2UZTA 4I5HA 3UO5A 3IW6A 3O51A 2E9PA 3I1AA 5IA5A 3LQ3A 3FZOA 2YN8A 3R2BA 3ZZEA 4BCMA 4MF0A 3ZLWA 2XIYA 4WUNA 1B6CB 5FP6A 2ZOQA 3DDPA 3TN8A 5L2IA 2Z8CA 3E8DA 4AZSA 4AW5A 4CG9A 1GOLA 3UO6A 1NY3A 2XCHA 3HP5A 3AKLA 4MBJA 3E3BX 1OUKA 4LOPA 5EYKA 2X81A 3QUEA 4CMTA 2XIRA 5KHXA 4BZDA 1ZY4A 3UMXA 3VRYA 3FLYA 2B7AA 2F7XE 2JDTA 3IDBA 3I81A 3NLBA 1K9AA 1U54B 3P4KA 3KMUA 4KSQA 4M66A 3VS5A 4AA4A 4BCNA 2R3MA 3FC1X 4N70A 3E93A 3ZBFA 4EQMA 5CEMA 5JFVA 2CN8A 4F9AA 3BEAA 3E92A 3TKHA 3GT8A 5IQGA 4FG9A 1REKA 2JKKA 3E8NA 4O7ZA 5DG5A 3W2RA 5DT4A 3F2RA 4I1ZA 4B4LA 4O7SA 1BUHA 3FLZA 3DJ6A 4JOAA 1PXNA 4YLKA 3ZFMA 4FSRA 3QQFA 5DBXA 1A48A 4OBQA 3L8XA 4N0SA 2VO0A 1MUOA 2QOLA 1U4DA 1JLUE 2BFYA 3L8SA 5HVYA 4AN3A 5HTCA 4FL3A 4PMTA 5DNRA 2JIIA 4FUYA 3T9IA 2Z7QA 4GVAA 4BWXA 3KXMA 4GKIA 4U97A 3NUXA 3JY9A 4IXPA 4GYGA 1IAHA 5HGIA 1XJDA 3OT8A 4FEWA 4FA2A 3EQGA 4YZ9A 3UYTA 1ZOGA 4L7FA 4EH4A 5KUPA 3MA6A 4XBUA 2BHEA 1YVJA 2E9VA 3O7LB 5L8KA 3QTUA 4CD0A 4EC9A 4J7BA 1PKGA 4BDHA 2UW8A 4GT4A 2FSMX 5DLSA 4USFA 3EZVA 3U6IA 4PDPA 3D94A 4FV1A 2H96A 4FV9A 4OTGA 4FV7A 4DF3A 1B39A 4DHZA 5EDRA 1CTPE 2J6MA 2ITTA 1OPLA 3SW4A 2WU7A 2C1BA 2R0IA 3LCOA 4W9WA 3QYZA 2JFLA 2WGJA 3GU4A 1Z57A 2XRUA 3F3UA 4IADA 4O82A 4FG8A 4MK0A 5EI6A 3TV4A 4ACDA 2PVJA 2Y6OA 1H07A 2QLUA 2W4OA 3O23A 4LUEA 3BWFA 5B7VA 3FLWA 4KUJA 1M7QA 1URWA 3KF7A 4C62A 4C34A 2C5YA 2IJMA 3EQBA 4ZK5A 3KXXA 4Q5HA 5LMBA 3HA6A 5D9HA 3MBLA 5A4TA 3NFFB 3NYOA 2YFXA 3R9DA 5J1VA 3NEWA 4ZLYA 5IA1A 5EYCA 3SVVA 1PXLA 1Q8WA 1Q99A 4W8DA 3P7CA 2V7OA 3V8SA 2NO3A 3PA5A 5AJQA 3TZMA 5DMZA 2KULA 5EW9A 1LP4A 1OECA 1OB3A 5IMEA 5CF6A 1PMEA 4UX9A 2HZNA 4N4SA 5BX0A 4FTCA 3SXRA 3ZZWA 3ORLA 5FXRA 2BMCA 2C3KA 2C0TA 3NVKI 3EN7A 3BHTA 3OCTA 3K3JA 3OZ6A 5JQ8A 4RVLA 1IA8A 3UVRA 3PPKA 4GU9A 1BKXA 3G5DA 3UJGA 5FDPA 2FYSA 2EB2A 4BTJA 1TQMA 4FTMA 4D2PA 5CTPA 4UB7A 1OBGA 4FEUA 3JR1A 3GCUA 4BCQA 5J87A 4MUQA 4YNEA 3A7FA 4DLJA 4I5MA 4KNBA 1MRVA 3KREA 4JR7A 3AMBA 4AXCA 3P86A 2WFYA 4FSNA 4EOOA 5H8BA 3MFTA 5EFQA 3P78A 2VO3A 4AT5A 4C2VA 3SAYA 5EM5A 4LGHA 4FL2A 1TKIA 4CMOA 4IFGA 1V0OA 1GZNA 5GJFA 3R8MA 3H4JA 2B1PA 3DNDA 2GMXA 2X6EA 3D15A 4K1BA 4DG2E 3RM6A 5AUVA 4YU2A 4Q2AA 1OPKA 2GNGA 2YM6A 5I3OA 2IG7A 4BBEA 4QYEA 2V0DA 2C6OA 4CTCA 3NRMA 2WIHA 4QMNA 1WBSA 3UNJA 3NZ0A 3W0MA 1ZWSA 4H3QA 5H9BA 2OI4X 2IZUA 2X0PA 4TYEA 5IG1A 3R73A 3IPHA 5IQEA 5FEDA 1OL6A 1PXJA 4ASDA 2QKRA 5IDNA 4FT5A 5GNKA 2Y4IC 3Q53A 3CTQA 2QHMA 4U3ZA 1FINA 2UZWE 3LM5A 4UMUA 3GU8A 4YC8A 3AOXA 3OTVA 4NIFB 1IASA 2GDOA 2WB8A 2A0CX 5CANA 2GS2A 2BZJA 3CQWA 4UMPA 5KHWA 2XAMA 4FTRA 4MCVA 4LGGA 3LJ2A 4MF1A 2IVTA 4BKZA 3H9FA 4FRFA 1P4FA 5M55A 2YIYA 4C4JA 3FY2A 4P5QA 3SC1A 4DAWA 5J7BA 5KKRC 3NW6A 2BIKB 2Z7SA 4F6SA 5CI6A 2O5KA 3OC1A 3DDQA 3LPBA 1JSTA 2ITVA 2ZMCA 2ZJWA 3Q6WA 5LXMA 4L3PA 1XH6A 3P7AA 4QPAA 4DH3A 1UU3A 2V7AA 3I4BA 3KK8A 3UO4A 4AZVA 5CU3A 3A7JA 4DFLA 4E8AA 2WZJA 5CASA 4G34A 2GHLA 5A14A 3IG7A 5B0XA 3RPRA 1W7HA 2C6IA 4KB8A 4C0TA 4FT7A 2JDSA 1VJYA 4CYJA 2CCHA 2HENA 2WMVA 2X9FA 2CDZA 3R0TA 3GU5A 4D2WA 4O0YA 3FV8A 2E9NA 4FTOA 3PY0A 3A4OX 4DG3E 5GIPE 3M42A 4I6FA 4WRSA 1NXKA 4LRMA 1VZOA 5IA3A 1JNKA 3SG9A 3HP2A 4M3QA 3EQIA 4PDSA 4Q5EA 3KA0A 2W1GA 4TW9A 4YZNA 4F9BA 4OBOA 4P4CA 4ANSA 3DXQA 2PZPA 4FTJA 4RLLA 5AX3A 4BHZA 2YLEA 3CPBA 3CKWA 3BHUA 4I6QA 2GU8A 3JYAA 1VLRA 3VF9A 5J1WA 1BX6A 3LM0A 3UMWA 3VHEA 3MJ2A 5DGZA 1PXPA 3QD3A 2CGWA 3QLGA 5ANDA 4ACGA 1W2FA 1YHWA 4K18A 5ANKA 5E7RA 5AP1A 3UIBA 5BQ0A 5CAUA 5KX8A 2Y6MA 5HVKA 5HX8A 2VN9A 3CTHA 4IX4A 5BUJA 4OTQA 3KL8A 3MVHA 4H1JA 1H00A 4DEEA 4JS8A 5AV2A 3WE8A 3DA6A 4U45A 4L01A 4KS8A 4IFCA 3ZDIA 2FSTX 4X2FA 4LMNA 4L53A 5HKMA 1T45A 3R00A 3PY3A 4PY1A 3HZTA 4O7RA 5F20A 4DTAA 2BDWA 3D14A 5ETFA 2I1MA 4WSYA 3UP2A 2CCIA 4RX7A 3UP7A 3COMA 4IW0A 5GIOE 3A8XA 4E4LA 3WZDA 4TWOA 3E8EA 4YJTA 5AR4A 5HCXA 5BMSA 5F95A 3RCDA 4MD9E 4MXZA 3G0FA 2ITWA 4TT7A 4U81A 3PXKA 3ENMA 3MTLA 4DT8A 5AP0A 3R28A 4G6OA 4ZJJA 4BY9E 5HOAA 5EDQA 3GP0A 3UYSA 1G5SA 3F5UA 3CGOA 4F1MA 4J8NA 2CNUA 2R3GA 2C68A 3VC4A 4RC3A 4ZTHA 3EMGA 4CSVA 4CNHA 5HE2A 1ZMUA 4X2GA 2W1EA 1SVEA 3SW7A 1Q24A 2E9UA 5M51A 4L6QA 4TKSA 1Y8YA 5C1QB 3U55A 3BYMA 2WIPA 3UDBA 4K6ZA 3DCVA 2R0UA 3BIZA 2I40A 4YJQA 2BRBA 2QOQA 3PG3A 4FTAA 1CM8A 3QGYA 2C6MA 2BAQA 2XF0A 3FLQA 3RM7A 4D1XA 2XARA 1OM1A 5CAQA 3TYKA 4ANLA 2ERKA 2GHGA 4ZP5A 4ZAUA 2ITYA 3RPYA 5FTQA 5ANJA 1GZ8A 5CNOA 3ZO2A 5L8JA 2JC6A 3MH0A 4O0TA 1CDKA 4FZAB 3MVLA 2BZIB 3NFGB 4M67A 3IO7A 2PVMA 3GC7A 4TYJA 1Y6BA 4RJ5A 3GNIB 5FRIA 4AGUA 3DJ5A 4FZDB 3DFCB 4IVAA 4U3YA 4D58A 5KMNA 3BYOA 1ZARA 4F78A 4XS2A 1OIQA 2QG5A 3CPCA 5EG3A 4AG8A 4E6QA 4HYIA 3QC9A 4ZTRA 3C4XA 3PUFC 4M8TA 2OJ9A 4YZMA 1M2PA 5CAVA 5CVFA 5H2UA 2YDJA 3FDNA 3FSFA 1ATPE 4A9SA 5M08A 3FKNA 2W1FA 3PTGA 4D4VA 5FGKA 2W1CA 3EN4A 4EJ7A 2R3HA 3TNPC 2C0IA 3E3PA 4X3FC 3TTIA 4F4PA 2JBOA 4KKHA 1UWJA 4BKYA 4ASXA 4NM0A 1IG1A 4JDIA 2X1NA 3TZ9A 5FDXA 3PXZA 1JKSA 1A06A 5AIKA 2PVRA 4ZTQA 2LAVA 4O7YA 5TOZA 3ZFYA 1YRPA 4FSWA 2W4JA 5DPVA 3WF7A 2QOCA 5A3XA 3W18A 2IVSA 2FSOX 4ANOA 1YWVA 4Y73A 3R63A 3MIYA 2CNQA 4UYNA 3Q32A 3VQHA 2ONLA 2WD1A 5T3QA 2EB3A 4NSTA 5JFSA 2EXEA 1PRYA 2YEXA 3NIEA 1WBVA 2DS1A 4MD8E 2WTKB 1BYGA 3TJCA 4HJOA 4HGTA 4E6CA 2WTDA 2QKWB 1STCE 4GMYA 3U87A 4FJVA 2HZIA 5M57A 3UC4A 1OIRA 1W2DA 2I6LA 4F65A 3RK7A 3VUDA 2YM8A 3CEKA 4O2PA 3QHWA 5CAOA 3GOKA 4YZDA 1UKIA 5AX9A 1P14A 2VX0A 4A07A 3LFNA 4DHIB 2ETKA 3L9NA 3TUBA 5HO6A 3OBJA 5CU4A 4DEHA 3EQHA 4NW5A 3NW7A 2VTQA 4RC4A 4YC3A 2YLFA 3BGPA 3U4WA 3IQ7A 4RX9A 3UVQA 4BCFA 4IVBA 4BYJA 4IH8A 5G6VA 2YIQA 5LWNA 3Q4TA 4FTQA 5C4KA 5M4UA 4NTTA 4EEVA 5CLPA 3R7UA 1YDRE 4RWKA 3ATTA 4LV8A 4BTFA 4LL0A 2WELA 3GXLA 4EK6A 1WBOA 4PDOA 1YWNA 4A9RA 3S2PA 2SRCA 2Q0BA 3ZLXA 4F0IA 4MQ1A 4YPSA 3CBLA 4GK2A 3FXXA 3FPQA 2V22A 5KMIA 1FGIA 2WQBA 4NEUA 4EWHA 2QU6A 4U43A 3TV7A 3QTIA 1WBTA 3OOGA 3Q2MA 4QQCA 2PZIA 5LVMA 2QOIA 4QMZA 4FKSA 3RPOA 5LJJA 3VW6A 5JRQA 3ORTA 1JKLA 3MY0A 3ZM4A 3I60A 3KY2A 3MPTA 4AF3A 5BPYA 4S30A 3R9OA 3H0YA 3UBDA 4GG5A 3UOJA 5FM2A 2RL5A 3DTCA 5JGDA 4KAOA 4QRCA 4R1YA 3LLTA 4B9DA 4R1VA 4DH5A 2Y0AA 3OXIA 5D1JA 4DEAA 3ODYX 1CKJA 3PRFA 4EHEA 4F09A 5L6PA 3ORIA 1ZOEA 2XKDA 2YIWA 5K5NA 2ITUA 1OITA 4U6RA 4ZEGA 5L2TA 4C2WA 2OIDA 2V62A 2W9ZB 3RAWA 3PPZA 1MQ4A 2WTVA 3F7WA 3ALNA 4BN1A 3R6XA 4FICA 3EQRA 4XYFA 3CY3A 5GINE 2OZOA 3HL7A 3VS2A 2WMBA 4IWDA 3RAKA 4YTFA 4AGWA 3L9MA 4FKLA 2ITZA 1G3NA 4NYEA 3S95A 2G01A 3MB7A 3HMOA 3IGOA 4RC2A 5JQ5A 5LARA 2VTSA 3OF0A 3BRBA 3BPRA 4E4MA 1PYEA 2JFMA 2GCDA 4K9YA 3MY1A 4LFIA 3BQCA 3D5UA 3VIDA 1G8AA 2XNBA 5FUTA 3FZPA 3GQIA 1H01A 4FSYA 5L3AA 1PYXA 2XNOA 4LM5A 3Q4UA 4YO6A 3R8LA 1ZZ2A 4GK3A 4OGRA 3VN9A 5GZAA 4DEDA 5LMKA 2YISA 1MRYA 3BBWA 1UV5A 4FVQA 5LVNA 1UVRA 3AC2A 4FV3A 3WZJA 2BAJA 3NCZA 4GG7A 4PL5A 3WIGA 4AW2A 4BKJA 3VJOA 2FGIA 3PJ8A 3NUSA 4Y5HA 1GZOA 1R39A 3P23A 3QTZA 4O4DA 4R8QA 5E1EA 5F4NA 4XG8A 4D0WA 4Z9LA 1SVHA 3Q52A 4KS7A 3KCFA 4QP9A 4NTSA 4X2NA 4JG7A 3TG1A 1W98A 2R64A 3D2KA 4IWQA 1UKHA 4QP1A 1TZDA 2CSNA 4E6AA 5DFPA 5AR3A 5K3YA 4BGHA 3ZEPA 4DEIA 5IH4A 1Q61A 2VWXA 5HLPA 3U6JA 5CSVA 4ZTLA 5K0KA 3VF8A 3PYYA 5HICA 2OXDA 3IOPA 3QKKA 4CLJA 5E8XA 2WMRA 3V5WA 3V5PA 2XBJA 4AFEA 3UQGA 5BUIA 3AD4A 5CXHA 2FA2A 3EN9A 3L8VA 4R78A 4U8ZA 4QTCA 3W2SA 4I23A 3Q6UA 4NK9A 3RWQA 3B2WA 4YURA 4FV8A 3HGKA 4ZY5A 4XG7A 4MNFA 5CQWA 2OF4A 3QTRA 5L2WA 4I41A 4X6QC 4XV2A 3QD0A 2FH9A 2R4BA 4Z7HA 1MP8A 4A9YA 3R2YA 1YOLA 5F1ZA 4QP8A 3TACA 1JPAA 5GJGA 3TXOA 3L8PA 3VBXA 4I4EA 3IK3A 1L8TA 1PXKA 3DK7A 3KRWA 3Q60A 2J5EA 2HZ4A 4BF2A 2HELA 3LAUA 3F6XA 3V5QA 2QURA 2WMQA 2KTYA 3ORXA 3THBA 2QOKA 3GQLA 3QCXA 3BBTB 2GS7A 4HYUA 1X8BA 2FSLX 3PSDA 3QF9A 4WNPA 5ETAA 3V5LA 4HZRA 3A7GA 4X2JA 3VBVA 3MN3A 5LVOA 3KXHA 5E92A 4QYGA 4D55A 2R9SA 4JI9A 4FSMA 4QP6A 3P0MA 4GSBA 3O17A 4O0UA 5IEYA 2CHLA 4XP0A 1KE8A 3G51A 5CEQA 4LRJA 5IEXA 3N51A 5I9VA 4YHJA 5EHOA 1IR3A 5CENA 2J0MB 4RVMA 3QA0A 1JKKA 3UE4A