4HVDA

Jak3 kinase domain in complex with 2-cyclopropyl-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((s)-1,2,2-trimethyl-propyl)-amide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
276
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title 3-Amido Pyrrolopyrazine JAK Kinase Inhibitors: Development of a JAK3 vs JAK1 Selective Inhibitor and Evaluation in Cellular and in Vivo Models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 276
sequence length 287
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hvdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hvdA01
2QNJA 3QF9A 3NUSA 3RKBA 4YC3A 3DS6A 1GIHA 3MY5A 3EQIA 4FV1A 5JGAA 3QC4A 4RPVA 4U6RA 4BVUA 2UW3A 3QD4A 5LMKA 2X39A 2PE1A 1Q3WA 4GUEA 3W18A 3EYGA 2OO8X 4C4HA 2NP8A 2XUUA 1R0PA 3ETAA 3LXPA 3ZSIA 4CT1A 1AD5A 3A7IA 4ZY5A 4F65A 2ESMA 2OZAB 4MF1A 5CT0A 1JKKA 1OB3A 2XNGA 4O38A 1CM8A 4X3FB 4DGGA 4EK8A 1VZOA 1CSNA 2IZRA 4FNZA 2F9GA 5FTGA 3S2PA 1R39A 1QCFA 4GYGA 3RI1A 3G90X 1QMZA 2WMTA 2YWPA 3P7CA 2RKUA 3RWPA 1BI7A 2CJMA 4K6ZA 4YJRA 5E8VA 3V6SA 4EK3A 4YO4A 4I92A 3BRBA 2C3LA 4FT5A 2B55A 4UB7A 3R7YA 3OCSA 5GINE 4CCUA 1R3CA 2V7AA 3NIEA 3OZ6A 2BR1A 2VTTA 2WMUA 4UXLA 4UMUA 2BFYA 5I9XA 4FSTA 1J1BA 2HELA 4OTRA 5ETIA 3Q5IA 2GNIA 2IZTA 5ETCA 2ERZE 2B1PA 2XRUA 3N9XA 3PYYA 1OI9A 2QKRA 1H1PA 4WNKA 4IADA 3Q4CA 1APME 2OJGA 2W06A 2EB3A 3H0YA 2E9OA 4X3FC 3SW4A 3TNPC 4DYMA 4CRSA 2VX1A 2OU7A 4U80A 4QPAA 4ZZMA 5AAGA 2XK3A 5TE0A 4RIXA 3QAME 4B7TA 4F08A 1YI4A 3OFMA 3FI8A 3R01A 3RTPA 4CFXA 4FTTA 3CQUA 4XEYA 3ATTA 3BCEA 4I0SA 3DKCA 3ODYX 4X6QC 3F9NA 2QHMA 2OJ9A 1Q24A 3OY3A 1DAYA 4O91A 3SHEA 5BVOA 4YZ9A 4ZSEA 3F3WA 4FT3A 3WE4A 4E5WA 4XRLA 2H6DA 1DS5A 5C01A 1PY5A 4O96A 4ZSGA 2VO3A 4FL2A 4O2ZA 4ANMA 3QCSA 2GHGA 4NW6A 2VO6A 5CX9A 4CKJA 4LV5A 2YZAA 4QNYA 5IISA 4G34A 2X2LA 4I23A 4U42A 5J1VA 5DE2A 3OXIA 3Q3BA 2HXLA 4YC6A 2C6EA 3RNIA 4N4SA 3TI1A 3A4OX 5FXQA 2W1CA 5KNJA 2B0QA 5ETAA 4BRXA 3C7QA 1YXVA 5J5TA 3NDMA 4DEIA 3WBLA 4R7IA 3F61A 3ORKA 4P5ZA 5HG9A 2J0LA 5CQWA 4HVIA 3SLSA 3QCXA 3EL7A 3S95A 5J5SA 4A4XA 4BFMA 5KMOA 4MF0A 2OF4A 3PSDA 2P4IA 3C50A 3R2BA 4GH2A 5EFQA 3ZXTA 3NVKI 1PJKA 3HRBA 1B39A 4JG8A 2UW7A 3A8XA 2VWUA 4XV3A 3VBYA 3BYVA 4YTFA 4RC4A 3DGKA 4ANSA 1WBVA 2JAVA 3GC7A 1ZY4A 3LCTA 4IWDA 4WUNA 4B8MA 3O51A 5EQEA 4YLKA 1OZ1A 4YNOA 4AA0A 3EHAA 3E3BX 4IZ5A 3WOWA 4M0ZA 4DEHA 3L9LA 4Y95A 4ZTHA 4C2WA 2PU8A 4IDTA 4RZVA 3R8PA 2PMLX 3QUEA 4MXZA 2BHEA 3W32A 1RJBA 1ZYDA 3PJ1A 4QNAA 1J91A 4O83A 4DITA 2B9JA 3FQEA 2EXEA 2WMRA 5FXSA 4PF4A 4YJUA 3F5GA 3QBNA 5FBOA 5IDNA 4J53A 2JDTA 3W1FA 5AWMA 3EZRA 3CTQA 4BGHA 4C59A 2G1TA 1UU8A 1JNKA 3CQEA 2JGZA 4RVTA 1CKJA 3NUAA 3AD6A 4RQKA 4LOQA 4E6AA 5HOAA 4L44A 2FH9A 1E1XA 1LEWA 3HDNA 4JIAA 3VHEA 3JR1A 2R3QA 1ZWSA 3NYXA 5AV2A 3WYYA 4AAAA 1IAHA 4D28A 4FZ7A 5IMEA 4PDOA 1H1RA 3PP0A 4EHEA 1M2RA 3FSKA 4ITIA 3PTGA 4B0GA 1HCLA 2XVDA 4IW0A 4I0TA 4IAZA 2Y8OA 3MFUA 5TF9A 2PUUA 5E9EA 1U5RA 1YW2A 3HZTA 4JLCA 5D1JA 5E91A 3O71A 4BCOA 2PPQA 5EI8A 4YP8A 3ORLA 2O65A 2G2IA 4BCQA 5HGIA 1YDRE 3QTZA 2V55A 4RWIA 2PWLA 4M14A 2R3GA 5LVOA 4EOJA 3D4QA 4B8LA 3GQLA 2ZAZA 3K5VA 4J8NA 1Y6BA 2OJIA 1SVEA 1ZAOA 2IJMA 3R28A 4IAAA 3FLNC 3PJ2A 5E8TA 4CG9A 4PPCA 3UYSA 2VAGA 2REIA 3FLSA 4JNWA 2C3JA 5D11A 2W1FA 4IZ7A 3BYMA 1XBAA 3ZLSA 5CEPA 2ZYBA 4CTCA 2XIYA 4OTIA 4AG8A 3KK9A 5HBHA 3ZU7A 1XKKA 4NKAA 3QUDA 2YM6A 5D9HA 2EXCX 3ERKA 4XG4A 4I4EA 2GMXA 4QP6A 4JIKA 2VTIA 3IPHA 2UZOA 4AOJA 2W1ZA 4BICA 4IZAA 2R3HA 3NW5A 3W2QA 4NK9A 4IX5A 4HPUE 4LGDA 1ZZLA 1PKDA 4X2NA 4BTKA 4BTMA 1W98A 3DFCB 3GNIB 5IKWA 3R8LA 2X8EA 3UQCA 3ZSGA 3VHKA 2WMAA 4JI9A 2QC6A 4XG2A 2QVSE 2C47A 3MB6A 4NM5A 2OXDA 3DQXA 3POOA 4XNEA 3BPRA 3FI3A 3G9NA 3QQGA 3KMWA 3PFQA 2QOKA 3KRXA 4WD5A 3VULA 3TUDA 3ZOSA 3W55A 2JITA 2BRBA 2WD1A 4XS2A 3OWKA 2GHLA 2JKKA 4E4XA 5L2QA 2WAJA 3BU6A 3KCKA 1BKXA 2FUMA 4D9UA 4F9WA 2JKOA 5K3YA 2WMSA 4L01A 3HDMA 4ZS4A 4KABA 1YWVA 2ERKA 5C9CA 3BWJA 1WBNA 1UNLA 2FSTX 3OOMA 3ORMA 3QQFA 4IANA 2WQNA 4IHPA 3Q04A 1Z57A 4JDKA 1P5EA 1BLXA 3EQFA 4DH1A 2HY0A 3PVUA 4KA3A 2C6IA 2IVVA 4YPDA 2JFMA 2JIIA 3NCZA 1YI6A 3CBLA 1FGKA 3ANRA 2BZIB 4S2ZA 3VJNA 3MESA 4LRMA 3MGYA 2BPMA 3SX9A 3DJ6A 4F0IA 4LG4A 1UNGA 2VGOA 5DT0A 1YHSA 3A61A 3PIZA 1QPCA 2ITPA 3UPXA 3RNYA 3EB0A 1H28A 5FUTA 3PY1A 4FG8A 4ZSLA 2YCQA 3NMUF 3AGLA 4LUDA 3MH3A 2OJFE 2F2UA 1WMKA 2WMWA 4L46A 3FLQA 3GC0A 2OJJA 2VUWA 3I0OA 4V04A 3TIZA 4J98A 4FGRA 1VR2A 4R77A 4UEUA 4NCTC 5AAEA 5FBNC 3VRYA 3C9WA 3DBFA 5IA1A 5JRQA 3R7VA 4NIFA 4PL5A 5CNOA 4J7BA 4O0WA 5AV3A 3BIZA 1ZOGA 4J99A 3IDPA 2XB7A 5AEPA 5CAUA 4O21A 3SAYA 3ZCLA 3UJGA 2YABA 3LXKA 4FIEA 5IEVA 5DYJA 3BZ3A 2F7EE 3A4PA 3IW4A 3LM5A 4PNKA 1WBTA 3OVVA 3MH1A 4NJDA 2XBAA 3E87A 4LV8A 3GCQA 4XP3A 3SV0A 2PUPA 4QMXA 4IVAA 4L00A 3D5VA 3MY1A 4ACMA 3E63A 3QCYA 5ANJA 5H8GA 4PMPA 4QP2A 5AAFA 1U54A 3R0TA 3LVPA 3V04A 4XV9A 4AGCA 4HNIA 2XCHA 4ITHA 1JLUE 4NUSA 5LVLA 2UZNA 2XF0A 4JG6A 4D5HA 2YM8A 3E88A 3MPTA 3PXYA 3MVMA 4QMYA 4JBOA 3Q60A 5JQ8A 2JDVA 4DA5A 2NRUA 3EOCA 4FT7A 3JPVA 3PJ8A 4PTGA 4EH4A 5C1QB 1IASA 2Z7SA 2GNLA 5HLWA 3BEAA 3FKLA 5T68A 4L9IA 4IM0A 1CTPE 1FQ1B 4F7JA 2R5TA 3CY2A 3MN3A 4AZVA 4EOQA 2HW7A 4UZDA 4GJ3A 2QOFA 4H1JA 5DI1A 3HMMA 1TQPA 3R8VA 3T8OA 5I9UA 1XH7A 2HXQA 4LQMA 3W2OA 1YDTE 2XYNA 3MJ1A 4MHAA 1GZOA 3R9NA 3RPVA 3EQBA 3DK3A 3VRZA 4BF2A 3IG7A 5TR6A 4BDHA 2J0KA 4CSVA 3AGMA 4U7ZA 1Y6AA 2O8YA 3ITZA 5HCZA 2UVYA 2B54A 4LOPA 4GSBA 2BRHA 1Q8YA 2Z60A 3T3VA 1Q8ZA 4ZTNA 4YMJA 5GIOE 4JX3A 4I94A 1SVGA 3FWQA 4M8TA 2CCHA 5GHVA 1KOAA 4IC8A 1R0EA 4DG0E 4FEVA 1XH8A 4KINA 4RX5A 5M07A 3ZONA 3BHHA 4D2VA 2QD9A 2C0IA 2I0YA 2PZ5A 3W2SA 3F7ZA 3RHXA 4AFEA 3ZZWA 3PVBA 5IF1A 4AQCA 3ZRMA 4P4CA 4YHTA 3U9NA 1JKLA 3L9NA 2PVHA 2QR7A 3ZFYA 5CU2A 5GZAA 2C5VA 4I5PA 4FVRA 4I6QA 5CTPA 3TZMA 4Y46A 3H3CA 5E4HA 2YAKA 2ZV8A 3S1HA 2UZLA 4EWQA 4QTEA 2ZB1A 4W8DA 5DGZA 3C4CA 4O7YA 4IH8A 3D2KA 3ZYAA 4E7WA 3MS9A 2W1HA 3H9FA 2OXXA 3ULZA 1KE9A 3OWJA 4NTSA 5J1WA 1YDSE 3GQIA 3P79A 5JGBA 3F3TA 3JVRA 2W1GA 3TN8A 2CN8A 3ZXZA 4FTCA 4DINA 5J9LA 5EHOA 1V0PA 4YC8A 5JMSA 4FNWA 5JQ5A 4FICA 2PMIA 4E6QA 1Q8WA 3FXXA 3O96A 2VGPA 3TEIA 3ZLYA 3VAPA 3I0QA 2GCDA 3THBA 2P2IA 4ZTLA 3AC1A 3NS9A 4W4VA 5HZNA 5DBXA 1HCKA 4XOZA 5IQBA 4EJ7A 2VN9A 3G0FA 3AC8A 1OM1A 4RZWA 1H4LA 1L8TA 4GIHA 1MQ4A 3OT3A 4O2PA 1FGIA 1H1WA 4WBBB 2GQSA 2R0UA 3F3ZA 4X2JA 5HG7A 2HWPA 4J71A 5HI2A 4PTCA 5J8IA 4NKSA 2DQ7X 2WEVA 1ZMVA 3C0HA 3FXWA 5AIKA 4GT4A 3T3UA 3IS5A 4H3BA 3E93A 3SXSA 5IEYA 3HUCA 1JVPP 1W82A 3EKNA 3MW1A 4TYHA 2OWBA 3QWJA 2VX0A 3LXLA 4JG7A 4DH5A 4RVKA 2CNVA 2OLCA 4IX6A 2C6DA 2Z7RA 4YJQA 2BKZA 3KFAA 4DTAA 4FIIA 4Z9LA 4D4RA 5C27A 3HA8A 3LCOA 4GT3A 3R8UA 5BX0A 4FSNA 3FMMA 4M15A 4WKQA 4FVPA 2PMNX 4RC3A 3SXRA 4FKIA 3NEWA 2W05A 3KEXA 4TWCA 5DNRA 4ZTMA 3EWHA 4J95A 4ALUA 3BEGA 5JSMA 2WIPA 2XKFA 3MWUA 4TL0A 3OCGA 2XNNA 3K2LA 3LQ8A 5CEIA 3CSVA 1H8FA 3C51A 1U4DA 4D9TA 2PSQA 5AM7A 5LMBA 4L68A 3CGOA 3U6JA 3EJ1A 3N4VA 2JD5A 5IQEA 2OZOA 2XNPA 1OMWA 4BI1A 2YCRA 4V0GA 2OXYA 3KF7A 1MRYA 5FG8A 4DCEA 3QLGA 2JC6A 3LFCA 4TRLA 4A07A 2FSMX 5LWNA 5C4KA 4MQ1A 4GU6A 4XG9A 4ZSAA 2YIQA 5EH0A 4ZSJA 1GIIA 4WA9A 5CWZA 1TQIA 4BDGA 5HU3A 3QD3A 3SVVA 4UWBA 3UC4A 3GCPA 1PXIA 4ALVA 2DS1A 4RRVA 3SKCA 4C0TA 3OXZA 1YWNA 1VJYA 2PVFA 3BHYA 3GXLA 1E1VA 3DAKA 3SRVA 3OCBA 4HVSA 4BTFA 4L53A 4K1BA 4TZRA 4ENXA 2VZ6A 2WEIA 2C6KA 4CXAA 3GOPA 4OUCA 3S4QA 3OMVA 1U59A 2X7GA 5CNNA 1H08A 3KU2A 4MNEB 4FG7A 3VUMA 5IZFA 2YDIA 3GVUA 2QG5A 3QLFA 4ERKA 1NVRA 3HX4A 5KMLA 2JKMA 4ZIMA 1KOBA 1P4FA 2E9UA 4JX7A 3RM7A 5JEBA 4M69B 4PMMA 5HKMA 5AJQA 4DTBA 2O5KA 4QP8A 5AP4A 4IQ6A 3VQUA 3ZMMA 4BL1A 3C5UA 4YPSA 2J9MA 3RK9A 5CI7A 2XIKA 4BC6A 4M97A 3H0ZA 3B2WA 3OXTA 3QTXA 3EQRA 4KS7A 3VNTA 1PYEA 4ZJVA 3FPMA 3R22A 4UXQA 3ZBFA 3TV7A 3ZO4A 2GFCA 4FUXA 3Q52A 3Q2MA 2VX3A 4RIYA 4WIHA 3R8MA 2Z02A 4XG3A 3OUKA 4Y8DA 4MXYA 3KXHA 3VUTA 5K4JA 2W5HA 2DWBA 2IPXA 1Q5KA 2C5XA 4KSPA 3SQQA 1SYKA 3VJOA 5IQCA 4EHZA 1FMOE 2ITXA 5LQFA 4JOAA 5AUVA 4FIHA 3EH9A 4GFOA 5D10A 3VS5A 3O7LD 4FSQA 3Q4UA 2HOGA 4KNBA 2QHNA 5JFSA 2XS0A 3DKGA 1E9HA 3BU5A 2R3FA 2WTCA 5IPJA 4V05A 3P7AA 2VTJA 3CPCA 1MQBA 3DCVA 4S30A 5AIRA 3II5A 3ZO2A 2G15A 3DQWA 3GENA 1MUOA 3VWAA 3LCSA 3I7CA 5B2MA 3Q9YA 3D15A 3K54A 4QMZA 4AZFA 4FSYA 1U5QA 4FV7A 1XQZA 2J0IA 3FHRA 3PVWA 4BDBA 2GNFA 4ITJA 4OTHA 5DN3A 4D5KA 4NM7A 3TT0A 4KB8A 5CZIA 1M17A 3I81A 5ICPA 4APPA 2Z8CA 3PE1A 4HZRA 1ZYSA 4OTPA 4RFZA 3RWQA 3UE4A 4CLJA 3SD0A 2CNQA 2NRYA 5A46A 2C0TA 5IH4A 5HU9A 4O7TA 2QLUA 4HJOA 4O1OA 5AR2A 3QRUA 4UBAA 3PDTA 1R78A 4OT5A 1HOWA 3SG9A 1KE7A 2RL5A 4Y73A 3BELA 2OH0E 4O6LA 3IGOA 2PVKA 3WYXA 2PVRA 3V51A 2JIVA 3MTLA 4DLJA 2GQRA 3G15A 2WU6A 4P90A 1EH4A 4NEUA 4CFMA 4CQEA 5CF4A 4YJOA 4JT3A 4ASZA 4GK4A 5IA3A 5BUEA 1JPAA 1OL7A 4WNMA 2PE0A 4XUFA 5CENA 2OZAA 5I9WA 4UWCA 5GJDA 3V5JA 5M4CA 3DFAA 4H3PA 4YGAA 2CKQA 2E2BA 1IAJA 4IDVA 2PVNA 2E9NA 5HTIA 4BWPA 2WQMA 3HP5A 4OTFA 1RE8A 3QZGA 5DEYA 3B8QA 2FO0A 3CXWA 2G01A 4IMYA 4KSQA 4AA4A 5J79A 3IGGA 2ITOA 3EN9A 5I0BA 5ANIA 5K4IA 4AGUA 5E92A 4F7NA 3E62A 3VUIA 1K3AA 3PPJA 3MB7A 4G3CA 4CEGA 2GTNA 4U81A 5FXRA 3GCVA 4X2GA 5EM7A 2W5BA 1KE8A 3DB8A 4K9YA 3LFFA 2XJ2A 4ZMEA 2VTHA 3CKWA 2I40A 4OBQA 2BDWA 3UDBA 5HO6A 4YU2A 5ITAA 4MD8E 5G1XA 4YTCA 1GNGA 3KXZA 2O63A 4G5PA 5TOZA 1MRUA 4F63A 4L43A 3IW7A 4IJ9A 3TV4A 4X6RA 4AX8A 5M53A 2V62A 5HLPA 4UYAA 3U4WA 3R7EA 1YXTA 3FZSA 4I6FA 4C8BA 3WZEA 1CMKE 3LJ0A 3OF0A 2KULA 3PXKA 1P4OA 2LGCA 4PMSA 5CLPA 4ACGA 5HTBA 3R9DA 4G31A 4EJNA 2W4JA 5KMNA 4E4NA 2BALA 5HG5A 1H1SA 1XH9A 2XBJA 4FSWA 4PL3A 3CCNA 5IQAA 4XRJA 5A4EA 3O8TA 1IR3A 3Q6UA 1GAGA 3VUHA 3BHVA 2OGVA 3AG9A 5IQDA 3FHIA 5M06A 4NZWB 2WZJA 1FBNA 4BDDA 3NNXA 2Q0BA 4KBCA 5FGKA 4FTAA 2Y9QA 3QD2B 3D83A 4BWXA 4GS6A 5AP1A 1PKGA 3R21A 5M55A 4G6LA 2UW4A 3RK7A 3ATSA 2WOTA 4D2RA 3FE3A 3VS7A 4C36A 5CAOA 3VF8A 1QPJA 1GY3A 4PWNA 4IB3A 3GUBA 5JFVA 5CZHA 1ZYLA 5L4QA 1M52A 4AN9A 3MA3A 4QRCA 4AE9A 3LFBA 4S34A 4BCFA 4BDCA 4FBXA 5LOHA 4XOYA 2VO7A 1IG1A 2VTMA 3ALOA 3W2RA 3PG3A 4FV0A 4QYHA 1Y57A 4QTDA 2X8DA 3R1SA 3NAXA 3E8DA 4JR7A 4DG3E 1GOLA 4FSRA 3UOHA 5K5NA 4PNIA 2QOLA 3BLRA 4OLIA 4H36A 1PHKA 3TKUA 4O7LA 4DN5A 4Q5EA 4C4GA 3KGAA 3KMUA 4ZLYA 2GU8A 4AU8A 3OWPA 3REPA 2CKPA 2JDRA 5AP6A 4MK0A 4FKOA 2ZM3A 3LKMA 4ZP5A 5CVGA 1REKA 3MYGA 4OGRA 3F66A 3R71A 4YHFA 5LXMA 4K77A 4CFFA 3CR0A 5IUHA 4ANBA 2VWIA 3IECA 3ZM4A 2Z7QA 5M08A 4EHVA 4EKLA 2RG6A 2XM9A 4GW8A 1W0XC 2RFSA 3PZHA 2WFYA 2ZM4A 1PXJA 5EI2A 4MNFA 5FP5A 4K33A 4PX6A 2ITVA 4DE4A 2JAMA 4AT4A 4AS0A 3AMBA 3RAKA 1XR1A 2C69A 5TKDA 1RQQA 4FV5A 4RQVA 4XX9A 3ENHA 4D2SA 3QKMA 4TPTA 4F7LA 4EORA 3QKKA 3HKOA 3VBXA 3RCJA 5I9YA 1MP8A 4AW2A 3CJGA 1YWRA 3D94A 4N6ZA 4MD7E 5AR5A 3NSZA 3QALE 3ULIA 3U9CA 3DTCA 2ONLA 3DBEA 4CKRA 4PRJA 4BYIA 2YACA 3AC2A 4L52A 1ZARA 4IVDA 5JZJA 2OH4A 4QQJA 1FVRA 4KKEA 3NUXA 5HBJA 3FSFA 4Z7HA 3A8WA 3EL8A 1JOWB 2FB8A 2J90A 3SA0A 4HYSA 4QYEA 3FJQE 2W99B 4JRVA 4Q9SA 5E8ZA 3S00A 4EH7A 3JS2A 1DI9A 1WAKA 3CC6A 3PWDA 5IA4A 3GEQA 1ZRZA 4KD1A 1UU9A 3FZOA 4OBOA 3HNGA 3OBGA 4MBIA 4HPTE 3DDQA 1MRVA 1Q99A 3D7TB 4I6HA 3ZFMA 5C8MA 2A1AB 3HECA 4U8ZA 5CEMA 2RGPA 3EN7A 3I1AA 4XBUA 1J1CA 3R8ZA 4RIOA 2PE2A 3I60A 3PJCA 4U44A 1VYZA 3EFWA 4GMYA 3NLBA 5AUYA 4H05A 1OECA 3DXNA 1OUKA 3EKKA 4F9CA 2O64A 4KKGA 4ACDA 2VTSA 3EFKA 1KE6A 1V1KA 3BLQA 5H9BA 4IB0A 5B2LA 3KRJA 4QMNA 3GCUA 3GU6A 5CANA 4YO6A 4EYJA 2GS7A 2A2AA 2PZIA 2YIXA 3CIKA 4HGLA 5CALA 1IA9A 3EYHA 4UALA 2OK1A 4BBFA 3RJCA 4CFNA 4FZDB 2GNGA 3GC9A 4CVAA 3UQFA 5CVFA 4MBJA 3WIGA 4C02A 1P14A 3KVWA 5A4QA 3DNDA 4ZK5A 3D0EA 2QG7A 3OW4A 4ARKA 4YHJA 2H9VA 4FTMA 2W9ZB 2GSFA 4U79A 4DCAA 4GFGA 4JAJA 4C38A 4JBQA 3CD3A 2VWYA 4HGEA 4QO9A 3A7GA 5AUTA 3HMOA 3QYWA 4O22A 1JWHA 3NW6A 4P7EA 2XIZA 1V0BA 5LARA 3W33A 1YRPA 4DEAA 5HCXA 5A6OA 3TJCA 2XIXA 4QQTA 2IG7A 3TDVA 4JBVA 4I20A 3PLAE 3IONA 2WKMA 4NW5A 4EUUA 5BMSA 1ZY5A 1ZYJA 3VUKA 3H9RA 4IE9A 5DLSA 3F2AA 3SOAA 2P2HA 2XIRA 3H30A 2OW3A 4MCVA 4PMTA 4WHZA 3FPQA 3U8WA 3V8SA 4AW5A 1UNHA 3L8VA 2Y7JA 5EG3A 3DV3A 4UZHA 4RIXB 3QQUA 4G9RA 5DOSA 3BHTA 5I3OA 5EKOA 4NH1A 4OTGA 5I3RA 3TIYA 3Q9XA 3EIDA 3AMAA 4DT8A 2F2CB 5EW9A 1W7HA 3PE2A 3NRMA 4LRKA 4TYGA 3KMMA 4LRJA 1KSWA 4WNOA 3UMXA 4F6SA 4FOBA 4F1TA 5C26A 2GNJA 3V6RA 3NNWA 2ITWA 3AC5A 5FM3A 2R3LA 2BIKB 5HHWA 2BTRA 2XKDA 2CDZA 4P5QA 3VIDA 2HYYA 3E8EA 3ZH8A 4DGLC 4TXCA 1W8CA 4E4LA 3BWFA 5J7BA 5CSVA 3EQHA 3MPMA 3UO6A 3VQHA 3EN4A 5JK3A 4MYGA 5AV4A 3D7ZA 4M66A 4HVDA 3BYSA 1DAWA 5L2WA 5HE3A 4XG8A 3B2TA 4LUEA 2J5EA 3O8PA 4DAWA 4N70A 3N51A 4LL5A 3QU0A 4USDA 1UKIA 2V5QA 1YXUA 2WGJA 3QTRA 4FYOA 1YXXA 3ACJA 3AC3A 4M7IA 5E8XA 3EN6A 3BQRA 2O0UA 1ZXEA 3MVHA 3ZO1A 2CNUA 4IZYA 4IWQA 4GVJA 4L67A 4QYYA 3PA3A 4CYJA 2XRWA 4E5AX 5I9ZA 5EM8A 4YTIA 1H27A 2ITTA 3HGKA 4MWHA 4YBKA 2J51A 3RGFA 2BVAA 5JGDA 1H0WA 2PULA 2C3KA 2VNWA 4XG6A 4KS8A 2J2IB 2X6EA 3MTFA 5CYIA 4ZZNA 2IVTA 2BILB 3NUUA 3WILA 5GJFA 3BGZA 5CY3A 5CEKA 5ANGA 4AWIA 3KXGA 4ZTRA 4FK3A 3E5AA 3D14A 5AR3A 4L6QA 3V5PA 4FV9A 4EYMA 1AQ1A 1UKHA 3ALNA 4LI5A 5L8JA 3M1SA 1M7QA 5EI6A 1B6CB 2J5FA 2W0JA 5HO8A 2NPQA 3UNJA 4U3YA 4WSQA 5BUIA 4CD0A 4C3FA 1Y8YA 3Q96A 3WZUA 1JSUA 3KCFA 4FKSA 1H01A 4FKUA 4D0XA 3QRJA 4F9AA 4KRDA 3L1SA 5BVDA 2RFEA 4HYIA 4APCA 5C8NA 1SNUA 3GI3A 4YZBA 3OTUA 3QFVA 3C0GA 3QTWA 4FTIA 5L6WL 4MVFA 3M42A 2G2HA 1H0VA 2P55A 4RFYA 4XP0A 3QXPA 1JSVA 5HORA 3KKVA 2I0EA 4QP4A 4O1PA 4I22A 3QUPA 3FXZA 5HVJA 4M0YA 4GL9A 3O0GA 4FTOA 4FT9A 5LMAA 2HZNA 4O84A 1T46A 3LFSA 1XJDA 4RJ8A 4F99A 3QRKA 3A2CA 2EXMA 3NCGA 4TW9A 3WF6A 5DRDA 1XBBA 2UVZA 3R7OA 3MVJA 5AM6A 3R1QA 2I7QA 2ZDTA 3OS3A 4BIEA 5IA5A 3LPBA 3COHA 3HVCA 5ANKA 4EOPA 3JXWA 3FMJA 4H3QA 4A9YA 4WUAA 1PMUA 3QRTA 2UUEA 2WQEA 4FSZA 3KXXA 4FTUA 4FVQA 1A9UA 4DH7A 4O86A 3AD4A 3F88A 2WQOA 3MFSA 5AUZA 5HX6A 3MIAA 3MV5A 4KAOA 3TXOA 3R2YA 3QZFA 1G3NA 1FINA 4NM0A 3SOCA 4C4EA 3KN5A 5D41A 4E73A 4ZXTA 2G2FA 1OBGA 2QONA 4O0TA 4RSSA 1TKIA 3L8SA 4RA5A 4AACA 4IVBA 4BCKA 3VO3A 4C4IA 3CPBA 4EKKA 3O2MA 4K18A 4YUQA 1J7LA 3R1NA 4WBOA 3EQCA 4DHFA 4BGGA 4G9CA 2HWOA 4G3GA 4K8AA 2C3IB 3PXZA 3U4UA 4C4JA 2YIWA 2HZ0A 3ROCA 3IKAA 5C4LA 2GS6A 4Y85A 4PTEA 1OGUA 3H4JA 4EH5A 2BAJA 3F5UA 5CU0A 2HENA 5IU2A 3SGCA 3TNIA 4UY9A 3FZRA 1Y8GA 1GZNA 5M51A 2OG8A 3GU4A 4RJ6A 4C3PA 2J0JA 3BKBA 4RJ5A 3U54A 4G17A 3QL8A 3MJ2A 2ITUA 4FODA 4EBWA 3QX2A 1O6LA 1FPUA 1URWA 2XMYA 3ELJA 4Q2AA 4TWNA 4EEVA 3FEGA 4QD6A 4O0UA 2ETKA 1PF8A 2ZB0A 3VS1A 3VC4A 2WMQA 3C4EA 3LJ1A 3P0MA 3UVQA 1XH5A 5CAQA 5J87A 3I5ZA 3A62A 2QOQA 3A99A 4M68A 2XK7A 2BRMA 4XYFA 3RZBA 4GVAA 4GKHA 3FY0A 3C1XA 4C58A 5M4UA 4O7VA 4HYUA 3QGWA 4A9TA 3TZ7A 1LR4A 3LXNA 2QU6A 2XM8A 4NWMA 4OBPA 4RMZA 4KUJA 4GKIA 5F20A 4F6UA 4KKHA 4JXFA 3KVXA 3WI6A 2WELA 3KRWA 3AXWA 1T45A 4GUBA 5A54A 4I0RA 2FSLX 2X9FA 2XEYA 4KIKB 5EYKA 4UMRA 1XO2B 5BYLA 4XP2A 1GJOA 4IWOA 2R3MA 3AT2A 4RT7A 4PP7A 2ZOQA 2FA2A 2C0OA 4S33A 1YHWA 4WT6A 4MNEA 3Q53A 4ANQA 1ND4A 2A19B 4J8MA 4CT2A 4IB1A 4QQCA 2CSNA 3FL5A 4DEEA 3W8QA 1Q97A 4YR8A 4D0WA 3TUCA 1J7IA 3PG1A 4JBPA 1OITA 3PA4A 4M69A 3IQ7A 4RJ4A 2J7TA 2CLXA 3PIXA 4FV8A 3UNKA 4O27B 1M14A 4QMWA 3UG2A 4IX3A 3OW3A 4H1MA 2WU7A 5HE1A 2HIWA 5CU3A 5DA3A 3GU8A 2Z2WA 4RJ7A 3T9IA 4CTBA 2QOIA 2C4GA 1A06A 2CGXA 3SDJA 5CF8A 2O2UA 3U6IA 2X2MA 4FKJA 3F2RA 3MFTA 4GG5A 4LFIA 2VTOA 2UZVA 4TT7A 1RDQE 4OTQA 3RBWA 1UA2A 3ZC5A 4HGTA 3EFJA 4FI1A 2BFXA 3MI9A 4NT4A 3ZDUA 3HV5A 4PL4A 3P7BA 2GFSA 4W8EA 4CV8A 5HX8A 4AOTA 1Q3DA 3HRCA 2I6LA 3UP2A 4AE6A 4PPBA 2XKEA 4USEA 5GZ8A 3OTVA 4WRSA 5D7AA 3UYTA 2EVAA 3C4XA 2OFUA 4F7SA 1J7UA 2QQ7A 1PMVA 2BAQA 3KQ7A 5M4FA 3KN6A 4FK6A 3LE6A 3IW8A 4GK3A 3V8TA 5HIEA 3LCKA 4TYEA 2ZVAA 2BDJA 5L2TA 5AP0A 4TY1A 5A14A 4H58A 2HAKA 4JL9A 4M3QA 3FQHA 4RIWB 4RFMA 5BMMA 3VBVA 4TNDA 5EM6A 1J3HA 2HK5A 3ET7A 3FMNA 3UOLA 4Q9ZA 5AA9A 3VS2A 4ZTSA 4OAVB 3QA0A 3CY3A 4JAIA 4KIQA 4K11A 2R7IA 4A4OA 4BZDA 3MY0A 4D1XA 4EHGA 4RVLA 4GU9A 4F64A 3BU3A 5CU6A 4F70A 3O50A 3BYUA 2VV9A 2LAVA 1XH4A 1OIQA 3DT1A 4QT1A 3SG8A 5L6PA 3QQLA 4PUZA 4UN0C 2KTYA 2YFXA 4FV3A 5TO8A 4DF3A 4AA5A 2CMWA 4C57A 3TKHA 1OIYA 3BBWA 3TNHA 5E8UA 4ANNA 4XMOA 5AR7A 4DFXE 3CE3A 4QMQA 2RF9A 4LMUA 3R1YA 4AN3A 3OT8A 4ASEA 3QRIA 3VW6A 1O6KA 3JY9A 4HOKA 5E1EA 3F69A 5CSWA 4R1YA 4I5CA 3R00A 4FKWA 1WZYA 3AD5A 5FRIA 5HE0A 3QTIA 3RVGA 5DR6A 3VN9A 5EDQA 4R5YA 4D55A 2UZEA 4EQCA 2W1IA 5KBRA 3C13A 5EHYA 4UMTA 3DBQA 2OF2A 4RBLA 3OROA 3ZRLA 3ZUTA 4ZAUA 4WG3A 3VF9A 4E20A 4DEGA 4YLJA 5JN2A 2UW6A 3JUHA 1PMEA 2BDFA 3QHRA 3FZ1A 4JDHA 3VUDA 2A27A 4GV1A 3V5WA 4ACCA 2VTRA 2EUFB 3EFLA 3FZPA 5KHWA 4EH6A 2B4SB 1YQJA 3LZBA 2YM3A 3AT3A 3ZS5A 4FL3A 2JBOA 2ITQA 4FMQA 3Q5ZA 2CGUA 3G33A 4MWIA 4AOIA 4W9XA 2HY81 2CPKE 2PHKA 4FEWA 4O7WA 3LM0A 3L9PA 3ZLXA 3VW8A 5FEDA 4F9BA 2X0GA 2PVLA 3CEKA 1ZOEA 5EDPA 5HCYA 5HIBA 3R9OA 4BBMA 3FLYA 4FIFA 4MD9E 2UW8A 4MXCA 5EOBA 4W4YA 4N6YA 3HLLA 1XHAA 2FVDA 5HVYA 3WF8A 1SNXA 2YCSA 3RAWA 3L9MA 4AN2A 4XH6A 5HEZA 3TCPA 4FEUA 4BGQA 1REJA 2YJRA 1M7NA 3AOXA 4FIJA 5FWKK 5J7HA 3RAHA 2F7ZE 4BHZA 4NFMA 3R30A 1KWPA 2WMBA 5BUJA 1PMNA 5DG5A 3H9OA 3GCSA 2W1DA 5AX3A 4G3FA 2PUIA 1KV1A 2XH5A 4DC2A 2J0MB 1NW1A 2R0IA 2I0HA 4FV6A 3FKNA 2QOHA 1PXKA 3ZC6A 4BI2A 4X3JA 4FTLA 2JEDA 4R3RA 2WMVA 4TTHB 3CJFA 3R7UA 4R6VA 5BVNA 2PUNA 4FA2A 4BI0A 5IQHA 1F5QA 1O6YA 5BYZA 4DGNA 3KL8A 2C68A 5BPYA 2ACXA 4QQ5A 5I9VA 2Y4PA 1YKRA 3PY3A 4A9SA 5DFPA 1ZZ2A 4AFJA 1KV2A 1M2PA 1URCA 4CMUA 1GZKA 1ZMWA 3LCDA 2X4ZA 4HYHA 4X3FA 5A4CA 4H39A 3C4ZA 4C4FA 4GFMA 3NUNA 1G5SA 2IWIA 2Z7LA 3ZLWA 3GBZA 3OD6X 4EI4A 4BZNA 5DMZA 2YWVA 3N4TA 1OIUA 4O7NA 4FTQA 3AT4A 3WZKA 2CHLA 1ERKA 4DH3A 4QMVA 5DH3A 3K3IA 3QHWA 1SVHA 4RWJA 5E1SA 1YOMA 4FNXA 1DI8A 4W4WA 4X2FA 2PVYA 3PXFA 4XV1A 4C3RA 1JAMA 3IK3A 3PUPA 4D4VA 4EL9A 4CYIA 2QR8A 5A4LA 2EWAA 3RALA 1X8BA 5CEQA 3RMFA 1Z9XA 3DOGA 5H8BA 4QPMA 4EQMA 5KMKA 5EYMA 2EU9A 3GFEA 5EDRA 1Q62A 1WVWA 4AZSA 3CD8A 1WVYA 2W4OA 2QO9A 3FLZA 4QTCA 2FYSA 4QOXA 4HVGA 5CXHA 4MH7A 4HCTA 5EQPA 5AP7A 4AZTA 4NTTA 2GHMA 3QCQA 2W4KA 2GS2A 4EC8A 5TT7A 3HMNA 3UIBA 1YXSA 5FDPA 1NXKA 2IO6A 5ANDA 5BVEA 4FKQA 5EKNA 1F0QA 4DFNA 3BX5A 3P78A 3MFRA 2R3RA 3P23A 3G51A 5FEQA 4ZOGA 4Y5HA 4N57A 2WHBA 4QMUA 2X2KA 3FY2A 2IZSA 4DH8A 4YJPA 4DEBA 4E3CA 4C62A 1SZMA 4QP9A 4XV2A 3WZDA 4C33A 2BRNA 3NNVA 2WQBA 3Q2JA 2AUHA 2OFVA 2YM4A 4FZAB 3FI2A 4LYNA 4R3CA 2XNMA 3QZIA 3VS4A 3TKIA 3B8RA 4D4SA 3AQVA 1XWSA 3HMPA 4K2RA 3I7BA 4OW8A 4EC9A 2XYUA 3JY0A 4QMPA 4MKCA 1JQHA 4HVHA 3TACA 2OKRA 4F6WA 4I6BA 3FMDA 2C6TA 2JLDA 3HYHA 4IIRA 5K9IA 2VD5A 2WPAA 4C7TA 3R63A 3DLSA 1OKWA 3PXQA 4L7SA 3LJ2A 1FVVA 4CG8A 5IDPA 4QTBA 2YM5A 4UMQA 1YOLA 3D7TA 3BV2A 5E8SA 5E8WA 5L8KA 4Z7GA 1FVTA 4I93A 4MBLA 4FIGA 1WBOA 2C6MA 1NVQA 4QYGA 3ENMA 1XBCA 5KX8A 4CMOA 1WCCA 4QP3A 3R7IA 1P2AA 2VTPA 2WMXA 2X8IA 4PPAA 1U46A 2A4LA 4FZ6A 4MXXA 4YSMA 4YJNA 4IVCA 4ZY6A 5HESA 1PXPA 5BVWA 3KULB 3UO5A 4FSMA 4TNBA 1R1WA 2X81A 5KHXA 3MH2A 1LPUA 3RAIA 1FOTA 4YTHA 3NYNA 5M4IA 5AR8A 2YEXA 4CFWA 4E93A 3D5UA 5BYYA 3BLHA 1WBWA 5KCVA 1BMKA 2XEZA 3GU7A 3WF7A 4EONA 2XNEA 3F3UA 3NYOA 5HNIX 5M57A 3I6WA 3WF5A 4USFA 3HEGA 5J9YA 1OPJA 2W17A 5LJJA 1GZ8A 5FLFA 4UV0A 2R3KA 3GT8A 3OY1A 4PV0A 4FF8A 1NVSA 3CTHA 5KMMA 5K0XA 3HAMA 4ZY4A 3OUNB 2C1AA 2YISA 4DFUA 4C35A 3NNUA 5DT4A 4BHNA 3C4FA 4CZTA 4I4FA 5KMIA 4FV4A 4GEOA 1UU3A 3W2CA 4EQUA 1BUHA 2ZJWA 4OTDA 4CV9A 2OICA 3ZO3A 5CF5A 3LFEA 4BWKA 1F3MC 4R78A 4ZMFA 2ITZA 2XK8A 4IAFA 3UO4A 4BIDA 2W7XA 3Q4TA 1B38A 2JFLA 3TZ9A 3WARA 4AZWA 4ORKA 1SMHA 4U97A 3I4BA 1H00A 2VU3A 3FMLA 4PDSA 4O0VA 2BRGA 4L3LA 3TTIA 3ORZA 3P08A 1BL6A 2JDSA 3QTQA 4MAOA 4U5JA 5ANEA 5K0KA 4AW0A 4B99A 3NIZA 4BCJA 4BN1A 4CRLA 4G3DA 5LVMA 3MH0A 3PZEA 1IA8A 2XNBA 5KUPA 3ZEPA 3DBDA 4XBRA 5GJGA 4BZOA 2R9SA 3BHUA 3ORXA 4OT6A 5T6KA 5AX9A 2VTAA 2A0CX 5ANOA 3LFQA 3SXFA 4EOIA 3IO7A 2UZWE 4BYJA 1W84A 4ZJJA 3V5QA 3P5KA 4KBKA 4X7QA 4FG9A 3E8NA 5DRBA 4F0GA 1YI3A 1OKZA 3C4WA 3U6HA 5A4TA 5J95A 4L8MA 5EW3A 4RLKA 2XNOA 3VVHA 4FX3A 1PRYA 1H25A 3ZM9A 4M67A 2R3OA 4ASXA 2R3JA 4RC2A 1XH6A 3S0OA 4J96A 5LVNA 2HCKA 3DJ7A 5IH6A 3PWYA 4D1ZA 2X7OA 4FNYA 4WRGA 4FSUA 5E8YA 4P2KA 3LIJA 5AV0A 5HQ0A 4FZFB 4EBVA 2YAAA 4TWOA 3W10A 2CKEA 4M13A 1PXNA 2XKCA 1OL2A 2CGWA 4FKGA 4ID7A 3NR9A 5JH6A 2C5YA 4S32A 5M56A 2Y0AA 5L2IA 4L42A 3UIUA 4PDPA 3NX8A 4KIOA 3NW7A 2YM7A 4B4LA 1ATPE 2ZV9A 4V01A 4MQ2A 5M09A 3G2FA 4FKTA 4MXOA 2UZBA 1QPDA 2CLQA 4EOKA 2R3PA 2XJ1A 4UWYA 4KBAA 2GDOA 2VNYA 2HW6A 4NCTA 5IH5A 4GCJA 2PVJA 3FI4A 4AZEA 5AMNA 2XK6A 4QMLA 3V8WA 3L8PA 4B6LA 2B9IA 3ZFXA 2HZIA 1L3RE 5AP2A 2B52A 2QKWB 4DG2E 3QKLA 4YZCA 2Q0NA 3PPKA 3QYZA 3UMWA 3HL7A 3U87A 3MDYA 3LMHA 4O6EA 2J50A 4YZNA 5LMKC 1S9IA 3NGAA 3ZUUA 5A6NA 2NO3A 1OPLA 3OG7A 1CKIA 3TL8A 3FQSA 3GC8A 5F1ZA 3TDWA 3OEZA 5JFXA 4YBJA 3Q6WA 3KK8A 4TN6A 5HTCA 2ZDUA 2RFNA 3PRIA 3UIXA 2BTSA 5AA8A 4O7SA 4L7FA 4S31A 2B7AA 2ETMA 3I79A 4LL0A 1SM2A 5A9UA 5F9EA 2YERA 3QQJA 1IRKA 4MX9A 2EB2A 4O81A 3FZTA 3MBLA 3IDBA 4GJ2A 3LQ3A 4U9AA 2CN5A 3QTSA 4CZYB 4HCVA 4E1ZA 4Z3VA 5GIPE 4IM2A 3DB6A 5HO7A 1NY3A 4WO5A 3D2IA 3FBVA 4WG4A 1K9AA 3Q9ZA 4CNHA 2VWVA 4OAUC 2PYWA 3K3JA 4IXPA 2BAKA 4JDIA 4DFBA 1DM2A 1LEZA 1PXLA 1WFCA 3UZTA 1UU7A 3HUBA 2BMCA 2WIHA 3WE8A 3EN5A 3LFDA 2W1EA 3PIYA 2AC5A 5D12A 3KRRA 4JQ7A 4NFNA 4UYNA 4EOLA 5AFVA 4OR5A 4EZ5A 3QTUA 3PA5A 4GYIA 3DA6A 4BKZA 3GP0A 5DEWA 2ZMDA 2BZKB 4LOOA 3O17A 1OL1A 1Q61A 1VYWA 4TWPA 3NYVA 3G5DA 3PY0A 4X0MA 2OIBA 2B9FA 5CT7A 5CAPA 4IM3A 1Q4LA 3PVGA 3FDNA 5DT3A 1H24A 2ONLC 2R7BA 3G9LX 4BDJA 4QP7A 4G3EA 1FMKA 3QQHA 1W83A 2BROA 3V5TA 3D9VA 2VWXA 4NM3A 2PZYA 4JVGA 3D5WA 3CLYA 2YIYA 3PXRA 3QA8A 4FL1A 4QMMA 4AT3A 3IOKA 2QU5A 2QODA 2F4JA 4R7HA 4E6DA 3QX4A 3RP9A 3AMYA 3HP2A 4IEBA 4Q5HA 3DKFA 4LM5A 5M44A 3COIA 3K5UA 2X1NA 5D7VA 3VBWA 2WNTA 3R7GA 2UV2A 3VBQA 4WNPA 3RCDA 2QLQA 3MIYA 4XHKB 5IQGA 5EK7A 3P4KA 5EYDA 2YHVA 3LAUA 3OC1A 4FYNA 2AC3A 3L8XA 4ANLA 2YZLA 3F7WA 1Z5MA 3LMGA 3NPCA 3M2WA 3UNZA 3FAAA 3V01A 4DEDA 3EZVA 1ZOHA 3DU8A 3OCTA 4NL0A 4FEQA 2ZMCA 3BGQA 3PSBA 4DGMA 4WOVA 3PJ3A 5HG8A 2SRCA 3PPZA 3IOPA 4YNEA 3HV3A 4EH3A 4EOSA 1QL6A 2Q83A 4IFCA 4KIKA 4FEXA 4BKJA 2WTDA 1K2PA 4QPSA 4R1VA 3DXQA 5FQDC 4CQGA 4KRCA 5B7VA 4XLVA 3VS0A 2V0DA 4BDEA 2VWWA 3MA6A 3H10A 4Y5QA 5KBQA 4O7RA 4ALWA 4DFLA 3V5LA 2WTKB 4RX7A 3FC1X 3IDCA 3QXOA 4U40A 4DLIA 3UOKA 5LVPA 1H26A 4XCUA 4U0IA 3QWKA 3ROYA 4D2WA 3ZZEA 3FMKA 2R3IA 3Q4ZA 5HD4A 2PL0A 2OBJA 4ZEGA 2HZ4A 4DT9A 1OUYA 1S9JA 5EM5A 5I5ZA 4DFYA 4I41A 4IX4A 2E9PA 3E7OA 3ORPA 5IUIA 4C2VA 2VO0A 5KO1A 3KREA 3BE9A 3BV3A 2IW8A 4FKLA 4O0XA 4GG7A 4I3ZA 2WTKC 3ANQA 2BHHA 3HV6A 3LOKA 5JRSA 3PSCA 4LMNA 2CGVA 3W2PA 3DXPA 5F95A 4U3ZA 4G5JA 3U55A 4TYJA 4RVMA 2UZDA 5ACKA 3G6HA 4RG0A 5EQYA 5FTOA 2C30A 4FT0A 5B0XA 2I0VA 5IQIA 3EQDA 3M11A 4YJTA 4C37A 5F94A 3UPZA 3ORNA 4OTWA 4QMTA 4EK6A 4ZLZA 3GGFA 4XLIA 4R3PA 3UGCA 4D2TA 1PYXA 4U45A 2FGIA 1Q8TA 2YITA 4FC0A 2AYPA 4G2FA 1G8SA 4IAYA 3FLWA 3TNWA 4MEDA 2OSCA 2O3PA 2R3NA 3E7VA 3I6UA 1WBPA 2H96A 3UVRA 4WG5A 4QMSA 4RWKA 4Y72A 5DIAA 4A9RA 4BDIA 5EOLA 4FKRA 4E4MA 5JT2A 3UZRA 4D4YA 3TZ8A 4F09A 2JIUA 2WTJA 2XK9A 1LP4A 3E92A 1JSTA 3NUYA 1ZLTA 4IFGA 3TNQB 3UIMA 2BKKA 1GIJA 3V3VA 4RIWA 2OI4X 5LCKA 4E5BA 2UW9A 2Y6MA 4HNFA 5JZNA 5ACBC 3RZFA 2WTWA 2B9HA 4BCHA 4II5A 4AP7A 1VEBA 3G0EA 5CU4A 5DHJA 4JDJA 2R4BA 2C5NA 2GNHA 4I1ZA 4YZDA 4C61A 3CQWA 3F5XA 2IVSA 5HBEA 3VS3A 4RX8A 3ID6C 3C0IA 5FP6A 5CXZA 4BR3A 4XJ0A 3F5PA 3ODZX 5CAVA 3QQKA 4L45A 2VWZA 2IN6A 2UZUE 3F3VA 1OPKA 4DGOA 5BVFA 2XJ0A 4EWHA 3BBTB 5JKGA 2X6DA 3NVMB 3AC4A 2DYLA 3BQCA 3OWLA 4ONAA 4A06A 4PP9A 4NIFB 3TUBA 5B2KA 3KXMA 5AR4A 2J6MA 4FGBA 1CKPA 3CGFA 4FKVA 4W4XA 3KY2A 4IAKA 3EQGA 4I21A 3RK5A 3TJDA 4U41A 3TWJA 1G8AA 5GZ9A 2F7XE 2IZUA 1NT2A 3HV7A 4EK4A 4ACHA 1QPEA 5T3QA 2X9EA 1I44A 3UODA 5DWRA 4D1SA 2QO2A 4D58A 2YLFA 4GT5A 3F2NA 3Q32A 4EH8A 3C5IA 3KXNA 1YHVA 1BX6A 2R2PA 4EOOA 1RW8A 2F57A 1OBDA 2QOBA 4RWLA 3LW0A 5HD7A 1YOJA 4I5MA 4IACA 1U54B 3PLSA 3ZEWA 4BDKA 5AP3A 4BKYA 3MVLA 5AADA 2QURA 2UW5A 3W8LA 5IEXA 3CTJA 3ZRKA 3ACKA 5FEEA 4E6CA 3FKOA 4CZUA 5AV1A 4LGHA 4UX9A 4A4LA 3DNEA 3WZJA 4ZZOA 5L6OA 2OIDA 1V0OA 3COKA 4YURA 1TQMA 3IW6A 3E8CA 5HICA 4A7CA 2WTIA 2WXVA 3UOJA 3OBJA 4O82A 4GRBA 3POZA 4L3JA 2I1MA 5CS6A 4RGJA 3VBTA 3DZOA 5CEOA 5KE0A 2RIOA 3RINA 2OIQA 2IVUA 1M2QA 3QC9A 4U43A 1OVEA 4N0SA 2QOCA 2YCFA 3NZ0A 4TKSA 3WF9A 4EH2A 4YLLA 5IA0A 2BCJA 4BY9E 4NYEA 5CSPA 4YZMA 5H2UA 4DBXA 3S3IA 2VWBA 4NJ3A 5JFWA 4F9YA 4R8QA 4W9WA 2P3GX 3LHJA 1JKSA 3QD0A 3HV4A 4BBEA 4J52A 2H8HA 2GPHA 3JYAA 1CDKA 3KC3A 3E64A 4HCUA 5IUGA 2C1BA 5FD2A 4F4PA 4HZSA 2C5OA 2W96B 4NSTA 2PK9A 2WO6A 4ZJIA 5BNJA 2BUJA 1OL5A 4E26A 5BVKA 5DR9A 4MTAA 4JQ8A 2UW0A 4EUTA 3CKXA 3P9JA 4ERWA 4IBMA 5DR2A 3FMHA 5HE2A 3GFWA 4G16A 3ZUVA 2BIYA 4JS8A 4IC7A 4K0YA 1STCE 4FTJA 3HMIA 4Z16A 3DY7A 3DAJA 3E3PA 3W16A 3RPOA 2RG5A 3LMIA 5AUXA 4R7BA 2NNWB 3ZHPC 3TTJA 3GOKA 4O0YA 4IJPA 4HW7A 3TM0A 3COMA 3A7HA 2UVXA 5L3AA 3SW7A 3LLAA 4BCMA 3LQ5A 3BYOA 3ORIA 4DTKA 4GIIA 3NAYA 3BI6A 4MXAA 5KZIA 1O9UA 1AGWA 1JKTA 4AW1A 3TV6A 3UBDA 2V7OA 3BGPA 3A7FA 1NA7A 4RX9A 2RSVA 3MSSA 2PZPA 3OHTA 4CGAA 3DLZA 5E90A 5LCJA 4TYIA 3ORTA 2XA4A 4C34A 3DTWA 4FUYA 3EMGA 2W9FB 2ZV2A 4ANOA 3CS9A 2GQGA 4D2PA 5CF6A 4FE2A 4CFUA 4ZS0A 4BCGA 4FKPA 3UZPA 3N4UA 1OKVA 4FTKA 4KIPA 3R83A 4X21A 4E8AA 2PVMA 2IW9A 3RHKA 2QOOA 4CCBA 2F49A 1KUTA 3OP5A 4TYHB 2QI8A 3DAEA 3F82A 1YVJA 4M12A 3R02A 2XK4A 4QYFA 5GNKA 2YIRA 1LUFA 4CLIA 2PZRA 4O7ZA 2H34A 2XP2A 2E9VA 2YA9A 2Y6OA 4EK5A 2P0CA 4G6NA 3HA6A 4X2KA 4F1MA 5K5XA 4B9DA 4BIBA 3HAVA 4BCIA 5L2SA 3DK7A 4IWPA 2ITNA 5CI6A 3T9TA 4R5SA 3ZBXA 3I5NA 3IW5A 3LFNA 5DPVA 3DBCA 3GU5A 1IEPA 2C6LA 4JQEA 2WOUA 3FV8A 2JDOA 4FR4A 1PXMA 5H3QA 5CVHA 5IA2A 5L8LA 3U51A 3DPKA 3FUPA 3O23A 4DFZE 5C8KA 2X7FA 5G6VA 2YLEA 5I4NA 2CCIA 3JVSA 4PY1A 3UTOA 4O0SA 2XCKA 4LGGA 1WVXA 3R9HA 4V0GB 4I5HA 4YJVA 3OEFX 4YSJA 2ETRA 1H1QA 3HRFA 2VTNA 4EZ7A 3D5XA 3UVPA 3MPAA 3NUPA 4QP1A 2BZJA 4CMTA 4JRNA 3R9RA 4AGWA 2XZSA 1OL6A 3DZQA 2W5AA 3KRLA 4M84A 3TG1A 2VTQA 3UC3A 4EH9A 1ZMUA 3FL4A 5H8EA 1UWJA 3OOGA 5CSHA 5HNGA 4L3PA 2JBPA 3P1AA 3WIKA 5HLNA 3UP7A 4BB4A 4JJRA 3GB2A 2C6OA 3R04A 4FV2A 5CASA 3KULA 2V22A 3NWWA 3SRVB 4YJSA 3FMEA 2J4ZA 5HNBA 4BCPA 5DVRA 5C03A 4ZLOA 4ZTQA 3LLTA 4ASDA 5CSXA 1PW2A 3ZDIA 2GTMA 2PMOX 3BE2A 2YJSA 2BZHB 4A9UA 1WBSA 3FYKX 2CKOA 3DKOA 1Y91A 4J97A 1BL7A 2G9XA 2YDKA 2DUVA 4BCNA 4BDAA 3RPSA 5KKRB 2JKQA 2Y4IB 3R73A 2WTVA 2UZTA 4RJ3A 4Y83A 5EW8A 4AUAA 4ENYA 3PRFA 1KE5A 2ITYA 4WSYA 4FTRA 2VRXA 3RPYA 5AUWA 1UV5A 3FYJX 3F6XA 4AT5A 1ZYCA 3FC2A 3P86A 4GK2A 5FDXA 3Q9WA 3UG1A 3A7JA 2X4FA 2ZV7A 4AF3A 4UMPA 5F4NA 3RM6A 4QTAA 1OIRA 4Z55A 1UWHA 1PXOA 1JBPE 5AUUA 1OKYA 5CQUA 3DJ5A 4RIYB 5ETFA 3RPRA 4AGDA 5IG1A 2FSOX 1UVRA 2WB8A 4BTJA 5LWMA 3ZTXA 3DK6A 1A48A 4FOCA 5FTQA 5KKRC 3VUGA 3UQGA 2Y4IC 3A60A 4G6OA 1H07A 3PP1A 4G1WA 2RFDA 4CFVA 5FM2A 4JR3A 4F0FA 1TVOA 5IQFA 4O0RA 4EOMA 4RA4A 3QGYA 3KA0A 4IAIA 4PDYA 1Q41A 4EZ3A 3DDPA 4J1RA 4NU1A 3O8UA 4CKIA 5EYCA 5A3XA 2QCSA 2B53A 5HVKA 3KB7A 2PY3A 2YN8A 5KZ0A 4FTNA 3KF4A 4RLLA 4QMOA 3SC1A 1Q8UA 2R64A 1BYGA 3QZHA 2PTKA 4XG7A 4BDFA 2P33A 4IB5A 3LFAA 4PQNA 1BI8A 5J9ZA 3R6XA 4KWPA 5BQ0A 4F1OA 3VS6A 4HGSA 3ZSHA 5EHLA 5HIDA 2VTLA 4DBNA 3EQPA 5IMXA 3G6GA 4AXAA 5KMJA 2QO7A 5E7RA 2ZM1A 2YDJA 3CP9A 3O7LB 4I24A 5AP5A 1I09A 2IW6A
chains in the Genus database with same CATH superfamily
2QNJA 3QF9A 3NUSA 3RKBA 4YC3A 3P5JC 3DS6A 1GIHA 3MY5A 3EQIA 4FV1A 5JGAA 3QC4A 4RPVA 4U6RA 4BVUA 2UW3A 3QD4A 5LMKA 2X39A 2PE1A 1Q3WA 4GUEA 3W18A 3EYGA 2OO8X 4C4HA 2NP8A 2XUUA 1R0PA 3ETAA 3LXPA 3ZSIA 4CT1A 1AD5A 3A7IA 4ZY5A 4F65A 2ESMA 2OZAB 4MF1A 5CT0A 1JKKA 1OB3A 2XNGA 4O38A 1CM8A 4X3FB 4DGGA 4EK8A 1VZOA 1CSNA 2IZRA 4FNZA 2F9GA 5FTGA 3S2PA 1R39A 1QCFA 4GYGA 3RI1A 3G90X 1QMZA 2WMTA 2YWPA 3P7CA 2RKUA 3RWPA 1BI7A 2CJMA 4K6ZA 4YJRA 5E8VA 3V6SA 4EK3A 4YO4A 4I92A 3BRBA 2C3LA 4FT5A 2B55A 4UB7A 3R7YA 3OCSA 5GINE 4CCUA 1R3CA 2V7AA 3NIEA 3OZ6A 2BR1A 2VTTA 2WMUA 4UXLA 4UMUA 2BFYA 5I9XA 4FSTA 1J1BA 2HELA 4OTRA 5ETIA 3Q5IA 2GNIA 2IZTA 5ETCA 2ERZE 2B1PA 2XRUA 3N9XA 3PYYA 1OI9A 2QKRA 1H1PA 4WNKA 4IADA 3Q4CA 1APME 2OJGA 2W06A 2EB3A 3H0YA 2E9OA 4X3FC 3SW4A 3TNPC 4DYMA 4CRSA 2VX1A 2OU7A 4U80A 4QPAA 4ZZMA 5AAGA 2XK3A 5TE0A 4RIXA 3QAME 4B7TA 4F08A 1YI4A 3OFMA 3FI8A 3R01A 3RTPA 4CFXA 4FTTA 3CQUA 4XEYA 3ATTA 3BCEA 4I0SA 3DKCA 3ODYX 4X6QC 3F9NA 2QHMA 2OJ9A 1Q24A 3OY3A 1DAYA 4O91A 3SHEA 5BVOA 4YZ9A 4ZSEA 3F3WA 4FT3A 3WE4A 4E5WA 4XRLA 2H6DA 1DS5A 5C01A 1PY5A 4O96A 4ZSGA 2VO3A 4FL2A 4O2ZA 4ANMA 3KIOC 3QCSA 2GHGA 4NW6A 2VO6A 5CX9A 4CKJA 4LV5A 2YZAA 4QNYA 5IISA 4G34A 2X2LA 4I23A 4U42A 5J1VA 5DE2A 3OXIA 3Q3BA 2HXLA 4YC6A 2C6EA 3RNIA 4N4SA 3TI1A 3A4OX 5FXQA 2W1CA 5KNJA 2B0QA 5ETAA 4BRXA 3C7QA 1YXVA 5J5TA 3NDMA 4DEIA 3WBLA 4R7IA 3F61A 3ORKA 4P5ZA 5HG9A 2J0LA 5CQWA 4HVIA 3SLSA 3QCXA 3EL7A 3S95A 5J5SA 4A4XA 4BFMA 5KMOA 4MF0A 2OF4A 3PSDA 2P4IA 3C50A 3R2BA 4GH2A 5EFQA 3ZXTA 2AEGA 1PJKA 3HRBA 1B39A 3NVKI 4JG8A 2UW7A 3A8XA 2VWUA 4XV3A 3VBYA 3BYVA 4YTFA 4RC4A 3DGKA 4ANSA 1WBVA 2JAVA 3GC7A 1ZY4A 3LCTA 4IWDA 4WUNA 4B8MA 3O51A 5EQEA 4YLKA 1OZ1A 4YNOA 4AA0A 3EHAA 3E3BX 4IZ5A 3WOWA 4M0ZA 4DEHA 3L9LA 4Y95A 4ZTHA 4C2WA 2PU8A 4IDTA 4RZVA 3R8PA 2PMLX 3QUEA 4MXZA 2BHEA 3W32A 1RJBA 1ZYDA 3PJ1A 4QNAA 1J91A 4O83A 4DITA 2B9JA 3FQEA 2EXEA 2WMRA 5FXSA 4PF4A 4YJUA 3F5GA 3QBNA 5FBOA 5IDNA 4J53A 2JDTA 3W1FA 5AWMA 3EZRA 3CTQA 4BGHA 4C59A 2G1TA 1UU8A 1JNKA 3CQEA 2JGZA 4RVTA 1CKJA 3NUAA 3AD6A 4RQKA 4LOQA 4E6AA 5HOAA 4L44A 2FH9A 1E1XA 1LEWA 3HDNA 4JIAA 3VHEA 3JR1A 2R3QA 1ZWSA 3NYXA 5AV2A 3WYYA 4AAAA 1IAHA 4D28A 4DDGA 4FZ7A 5IMEA 4PDOA 1H1RA 3PP0A 4EHEA 1M2RA 3FSKA 4ITIA 3PTGA 4B0GA 1HCLA 2XVDA 4IW0A 4I0TA 4DDIA 4IAZA 2Y8OA 3MFUA 5TF9A 2PUUA 5E9EA 1U5RA 1YW2A 3HZTA 4JLCA 5D1JA 5E91A 3O71A 4BCOA 2PPQA 5EI8A 4YP8A 3ORLA 2O65A 2G2IA 4BCQA 5HGIA 1YDRE 3QTZA 2V55A 4RWIA 2PWLA 4M14A 2R3GA 5LVOA 4EOJA 3D4QA 4B8LA 3GQLA 2ZAZA 3K5VA 4J8NA 1Y6BA 2OJIA 1SVEA 1ZAOA 2IJMA 3R28A 4IAAA 3FLNC 3PJ2A 5E8TA 4CG9A 4PPCA 3UYSA 2VAGA 2REIA 3FLSA 4JNWA 2C3JA 4AQKA 5D11A 2W1FA 4IZ7A 3BYMA 1XBAA 3ZLSA 5CEPA 2ZYBA 4CTCA 2XIYA 4OTIA 4AG8A 3KK9A 5HBHA 3ZU7A 1XKKA 4NKAA 3QUDA 2YM6A 5D9HA 2EXCX 3ERKA 4XG4A 4I4EA 2GMXA 4QP6A 4JIKA 2VTIA 3IPHA 2UZOA 4AOJA 2W1ZA 4BICA 4IZAA 2R3HA 3NW5A 3W2QA 4NK9A 4IX5A 4HPUE 4LGDA 1ZZLA 1PKDA 4X2NA 4BTKA 4BTMA 1W98A 3DFCB 3GNIB 5IKWA 3R8LA 2X8EA 3UQCA 3ZSGA 3VHKA 2WMAA 4JI9A 2QC6A 4XG2A 2QVSE 2C47A 3MB6A 4NM5A 2OXDA 3DQXA 3POOA 4XNEA 4AXDA 3BPRA 3FI3A 3G9NA 3QQGA 3KMWA 3PFQA 2QOKA 3KRXA 4WD5A 3VULA 3TUDA 3ZOSA 3W55A 2JITA 2BRBA 2WD1A 4XS2A 3OWKA 2GHLA 2JKKA 4E4XA 5L2QA 2WAJA 3BU6A 3KCKA 1BKXA 2FUMA 4D9UA 4F9WA 2JKOA 5K3YA 2WMSA 4L01A 3HDMA 4ZS4A 4KABA 1YWVA 2ERKA 5C9CA 3UDZA 3BWJA 4MUQA 1WBNA 1UNLA 2FSTX 3OOMA 3ORMA 3QQFA 4IANA 2WQNA 4IHPA 3Q04A 1Z57A 4JDKA 1P5EA 1BLXA 3EQFA 4DH1A 2HY0A 2X0QA 3PVUA 4KA3A 2C6IA 2IVVA 4YPDA 2JFMA 2JIIA 3NCZA 1YI6A 3CBLA 1FGKA 3ANRA 2BZIB 4S2ZA 3VJNA 3MESA 4LRMA 3MGYA 2BPMA 3SX9A 3DJ6A 4F0IA 4LG4A 1UNGA 2VGOA 5DT0A 1YHSA 3A61A 3PIZA 1QPCA 2ITPA 3UPXA 3RNYA 3EB0A 1H28A 5FUTA 3PY1A 4FG8A 4ZSLA 2YCQA 3NMUF 3AGLA 4LUDA 3MH3A 2OJFE 2F2UA 1XMMA 1WMKA 2WMWA 4L46A 3FLQA 3GC0A 2OJJA 2VUWA 3I0OA 4V04A 3TIZA 4J98A 4FGRA 1VR2A 4R77A 2IEWA 4UEUA 4NCTC 5AAEA 5FBNC 3VRYA 3C9WA 3DBFA 5IA1A 5JRQA 3R7VA 4NIFA 4PL5A 5CNOA 4J7BA 4O0WA 5AV3A 3BIZA 1ZOGA 4J99A 3IDPA 2XB7A 5AEPA 5CAUA 4O21A 3SAYA 3ZCLA 3UJGA 2YABA 3LXKA 4FIEA 5IEVA 5DYJA 3BZ3A 2F7EE 3A4PA 3IW4A 3LM5A 4PNKA 1WBTA 3OVVA 3MH1A 4NJDA 2XBAA 3E87A 4LV8A 2X0PA 3GCQA 4XP3A 3SV0A 2PUPA 4QMXA 4IVAA 4L00A 3D5VA 3MY1A 4ACMA 3E63A 3QCYA 5ANJA 5H8GA 4PMPA 4QP2A 5AAFA 1U54A 3R0TA 3LVPA 3V04A 4XV9A 4AGCA 4HNIA 2XCHA 4ITHA 1JLUE 4NUSA 5LVLA 2UZNA 2XF0A 4JG6A 4D5HA 2YM8A 3E88A 3MPTA 3PXYA 3MVMA 4QMYA 4JBOA 3Q60A 5JQ8A 2JDVA 4DA5A 2NRUA 3EOCA 4FT7A 3JPVA 3PJ8A 4PTGA 4EH4A 5C1QB 1IASA 2Z7SA 2GNLA 5HLWA 3BEAA 3FKLA 5T68A 4L9IA 4IM0A 1CTPE 1FQ1B 4F7JA 2R5TA 3CY2A 3MN3A 4AZVA 4EOQA 2HW7A 4UZDA 4GJ3A 2QOFA 4H1JA 5DI1A 1W2FA 3HMMA 1TQPA 3R8VA 3T8OA 5I9UA 1XH7A 2HXQA 4LQMA 3W2OA 1YDTE 2XYNA 3MJ1A 4MHAA 1GZOA 3R9NA 3RPVA 3EQBA 3DK3A 3VRZA 4BF2A 3IG7A 5TR6A 4BDHA 2J0KA 4CSVA 3AGMA 4U7ZA 1Y6AA 2O8YA 3ITZA 5HCZA 2UVYA 2B54A 4LOPA 4GSBA 2BRHA 1Q8YA 2Z60A 3T3VA 1Q8ZA 4ZTNA 4YMJA 5GIOE 4JX3A 4I94A 1SVGA 3FWQA 4M8TA 2CCHA 5GHVA 1KOAA 4IC8A 1R0EA 4DG0E 4FEVA 1XH8A 4KINA 4RX5A 5M07A 3ZONA 3BHHA 4D2VA 2QD9A 2C0IA 2I0YA 2PZ5A 3W2SA 3F7ZA 3RHXA 4AFEA 3ZZWA 3PVBA 5IF1A 4AQCA 3ZRMA 4P4CA 4YHTA 3U9NA 1JKLA 3L9NA 2PVHA 2QR7A 3ZFYA 5CU2A 5GZAA 2C5VA 4I5PA 4FVRA 4I6QA 5CTPA 3TZMA 4Y46A 3H3CA 3NFFB 5E4HA 2YAKA 2ZV8A 3S1HA 2UZLA 4EWQA 4QTEA 2ZB1A 4W8DA 5DGZA 3C4CA 4O7YA 4IH8A 3D2KA 3ZYAA 4E7WA 3MS9A 1TFFA 2W1HA 3H9FA 2OXXA 3ULZA 1KE9A 3OWJA 4NTSA 5J1WA 1YDSE 3GQIA 3P79A 5JGBA 3F3TA 3JVRA 2W1GA 3TN8A 2CN8A 3ZXZA 4FTCA 4DINA 5J9LA 5EHOA 1V0PA 4YC8A 5JMSA 4FNWA 5JQ5A 4FICA 2PMIA 4E6QA 1Q8WA 3FXXA 3O96A 2VGPA 3TEIA 3ZLYA 3VAPA 3I0QA 2GCDA 3THBA 2P2IA 4ZTLA 3AC1A 3NS9A 4W4VA 5HZNA 5DBXA 1HCKA 4XOZA 5IQBA 4EJ7A 2VN9A 3G0FA 3AC8A 1OM1A 4RZWA 1H4LA 1L8TA 4GIHA 1MQ4A 3OT3A 4O2PA 3W0SA 1FGIA 1H1WA 4WBBB 2GQSA 2R0UA 3F3ZA 4X2JA 5HG7A 2HWPA 4J71A 5HI2A 4PTCA 5J8IA 4NKSA 2DQ7X 2WEVA 1ZMVA 3C0HA 3FXWA 5AIKA 4GT4A 3T3UA 3IS5A 4H3BA 3E93A 3SXSA 5IEYA 3HUCA 1JVPP 1W82A 3EKNA 4BJJB 3MW1A 4TYHA 2OWBA 3QWJA 2VX0A 3LXLA 4JG7A 4DH5A 4RVKA 2CNVA 2OLCA 4IX6A 2C6DA 2Z7RA 4YJQA 2BKZA 3KFAA 4DTAA 4FIIA 4Z9LA 4D4RA 5C27A 3HA8A 3LCOA 4GT3A 3R8UA 5BX0A 4FSNA 3FMMA 4M15A 4WKQA 4FVPA 2PMNX 4RC3A 3SXRA 4FKIA 3NEWA 2W05A 3KEXA 4TWCA 5DNRA 4ZTMA 3EWHA 4J95A 4ALUA 3BEGA 5JSMA 2X0OA 2WIPA 2XKFA 3MWUA 4TL0A 3OCGA 2XNNA 3K2LA 3LQ8A 5CEIA 3CSVA 1H8FA 3C51A 1U4DA 4D9TA 2PSQA 5AM7A 5LMBA 4L68A 3CGOA 4O4BB 3U6JA 3EJ1A 3N4VA 2JD5A 5IQEA 2OZOA 2XNPA 1OMWA 4BI1A 2YCRA 4V0GA 2OXYA 2AQXA 3KF7A 1MRYA 5FG8A 4DCEA 3QLGA 2JC6A 3LFCA 4TRLA 4A07A 2FSMX 5LWNA 5C4KA 4MQ1A 4GU6A 4XG9A 4ZSAA 2YIQA 5EH0A 4ZSJA 1GIIA 4WA9A 5CWZA 1TQIA 4BDGA 5HU3A 3QD3A 3SVVA 4UWBA 3UC4A 3GCPA 1PXIA 4ALVA 2DS1A 4RRVA 3SKCA 4C0TA 3OXZA 1YWNA 1VJYA 2PVFA 3BHYA 3GXLA 1E1VA 3DAKA 3SRVA 3OCBA 4HVSA 4BTFA 4L53A 4K1BA 4TZRA 4ENXA 2VZ6A 2WEIA 2C6KA 4CXAA 3GOPA 4OUCA 3S4QA 3OMVA 1U59A 2X7GA 5CNNA 1H08A 3KU2A 4MNEB 4FG7A 3VUMA 5IZFA 2YDIA 3GVUA 2QG5A 3QLFA 4ERKA 1NVRA 3HX4A 5KMLA 2JKMA 4ZIMA 1KOBA 1P4FA 2E9UA 4JX7A 3RM7A 5JEBA 4M69B 4PMMA 5HKMA 5AJQA 4DTBA 2O5KA 4QP8A 5AP4A 4IQ6A 3VQUA 3ZMMA 4BL1A 3C5UA 4YPSA 2J9MA 3RK9A 5CI7A 2XIKA 4BC6A 4M97A 3H0ZA 3B2WA 3OXTA 3QTXA 3EQRA 4KS7A 4AXFA 3VNTA 1PYEA 4ZJVA 3FPMA 3R22A 4UXQA 3ZBFA 3TV7A 3ZO4A 2GFCA 4FUXA 3Q52A 3Q2MA 2VX3A 4RIYA 4WIHA 3R8MA 2Z02A 4XG3A 3OUKA 4Y8DA 4MXYA 3KXHA 3VUTA 5K4JA 2W5HA 2DWBA 2IPXA 1Q5KA 2C5XA 4KSPA 3SQQA 1SYKA 3VJOA 5IQCA 4EHZA 1FMOE 2ITXA 5LQFA 4JOAA 5AUVA 4FIHA 3EH9A 4GFOA 5D10A 3VS5A 3O7LD 4FSQA 3Q4UA 2HOGA 4KNBA 2QHNA 5JFSA 2XS0A 3DKGA 1E9HA 3BU5A 2R3FA 2WTCA 5IPJA 4V05A 3P7AA 3PUFC 2VTJA 3CPCA 1MQBA 3DCVA 4S30A 5AIRA 3II5A 3ZO2A 2G15A 3DQWA 3GENA 1MUOA 3VWAA 3W0PA 3LCSA 3I7CA 5B2MA 3Q9YA 3D15A 3K54A 4QMZA 4AZFA 4FSYA 1U5QA 4FV7A 1XQZA 2J0IA 3FHRA 3PVWA 4BDBA 2GNFA 4ITJA 4OTHA 5DN3A 4D5KA 4NM7A 3TT0A 4KB8A 5CZIA 1M17A 3I81A 5ICPA 4APPA 2Z8CA 3PE1A 4HZRA 1ZYSA 4OTPA 4RFZA 3RWQA 4AAYA 3UE4A 4CLJA 3SD0A 2CNQA 2NRYA 5A46A 2C0TA 5IH4A 5HU9A 4O7TA 2QLUA 4HJOA 4O1OA 5AR2A 3QRUA 4UBAA 3PDTA 1R78A 4OT5A 1HOWA 3SG9A 1KE7A 2RL5A 4Y73A 3BELA 2OH0E 4O6LA 3IGOA 2PVKA 3WYXA 2PVRA 3V51A 2JIVA 3MTLA 4DLJA 2GQRA 3G15A 2WU6A 4P90A 1EH4A 4NEUA 4CFMA 4CQEA 5CF4A 4YJOA 4JT3A 4ASZA 4GK4A 5IA3A 5BUEA 1JPAA 1OL7A 4WNMA 2PE0A 4XUFA 5CENA 2OZAA 5I9WA 4UWCA 5GJDA 3V5JA 5M4CA 3DFAA 4H3PA 4YGAA 2CKQA 2E2BA 1IAJA 4IDVA 2PVNA 2E9NA 5HTIA 4BWPA 2WQMA 3HP5A 4OTFA 1RE8A 3QZGA 5DEYA 3B8QA 2FO0A 3CXWA 2G01A 4IMYA 4KSQA 4AA4A 5J79A 3IGGA 2ITOA 3EN9A 5I0BA 5ANIA 5K4IA 4AGUA 5E92A 4F7NA 3E62A 3VUIA 1K3AA 3PPJA 3MB7A 4G3CA 4CEGA 2GTNA 4U81A 5FXRA 3GCVA 4X2GA 5EM7A 2W5BA 1KE8A 3DB8A 4K9YA 3LFFA 2XJ2A 4ZMEA 2VTHA 3CKWA 2I40A 4OBQA 2BDWA 3UDBA 5HO6A 4YU2A 1VLRA 5ITAA 4MD8E 5G1XA 4YTCA 1GNGA 3KXZA 2O63A 4G5PA 5TOZA 1MRUA 3BL7A 4F63A 4L43A 3IW7A 4IJ9A 3TV4A 4X6RA 4AX8A 5M53A 2V62A 5HLPA 4UYAA 3U4WA 3R7EA 1YXTA 3FZSA 4I6FA 4C8BA 3WZEA 1CMKE 3LJ0A 3OF0A 2KULA 3PXKA 1P4OA 2LGCA 4PMSA 5CLPA 4ACGA 5HTBA 3R9DA 4G31A 4EJNA 2W4JA 5KMNA 4E4NA 2BALA 5HG5A 1H1SA 1XH9A 2XBJA 4FSWA 4O4DA 3CCNA 4PL3A 4DHIB 5IQAA 4XRJA 5A4EA 3O8TA 1IR3A 3Q6UA 1GAGA 3VUHA 3BHVA 2OGVA 3AG9A 5IQDA 3FHIA 5M06A 4NZWB 2WZJA 1FBNA 4BDDA 3NNXA 2Q0BA 4KBCA 5FGKA 4FTAA 2Y9QA 3QD2B 3D83A 4BWXA 4GS6A 5AP1A 1PKGA 3R21A 5M55A 4G6LA 2UW4A 3RK7A 3ATSA 2WOTA 4D2RA 3FE3A 3VS7A 4C36A 5CAOA 3VF8A 1QPJA 1GY3A 4PWNA 4IB3A 3GUBA 5JFVA 5CZHA 1ZYLA 5L4QA 1M52A 4AN9A 3MA3A 4QRCA 4AE9A 3LFBA 4S34A 4BCFA 4BDCA 4FBXA 5LOHA 4XOYA 2VO7A 1IG1A 2VTMA 3ALOA 3W2RA 3PG3A 4FV0A 4QYHA 1Y57A 4QTDA 2X8DA 3R1SA 3NAXA 3E8DA 4JR7A 4DG3E 1GOLA 4FSRA 3UOHA 5K5NA 4PNIA 2QOLA 3BLRA 1G8KA 4OLIA 4H36A 1PHKA 3TKUA 4O7LA 4DN5A 4Q5EA 4C4GA 3KGAA 3KMUA 4ZLYA 2GU8A 4AU8A 3OWPA 3REPA 2CKPA 2JDRA 5AP6A 4MK0A 4FKOA 2ZM3A 3LKMA 4ZP5A 5CVGA 1REKA 3MYGA 4OGRA 3F66A 3R71A 4YHFA 5LXMA 4K77A 4CFFA 3CR0A 5IUHA 4ANBA 2VWIA 3IECA 3ZM4A 2Z7QA 5M08A 4EHVA 4EKLA 2RG6A 2XM9A 4GW8A 1W0XC 2RFSA 3PZHA 2WFYA 2ZM4A 1PXJA 5EI2A 4MNFA 5FP5A 4K33A 4PX6A 2ITVA 4DE4A 2JAMA 4AT4A 4AS0A 3AMBA 3RAKA 1XR1A 2C69A 5TKDA 1RQQA 4FV5A 4RQVA 4XX9A 3ENHA 4D2SA 3QKMA 4TPTA 4F7LA 4EORA 3QKKA 3HKOA 3VBXA 3RCJA 5I9YA 1MP8A 4AW2A 3CJGA 1YWRA 3D94A 4N6ZA 4MD7E 5AR5A 3NSZA 3QALE 3ULIA 3U9CA 3DTCA 2ONLA 3DBEA 4CKRA 4PRJA 4BYIA 2YACA 3AC2A 4L52A 3W0OA 1ZARA 4IVDA 5JZJA 2OH4A 4QQJA 1FVRA 4KKEA 3NUXA 5HBJA 3FSFA 4Z7HA 3A8WA 3EL8A 1JOWB 2FB8A 2J90A 3SA0A 4HYSA 4QYEA 3FJQE 2W99B 4JRVA 4Q9SA 5E8ZA 3S00A 4EH7A 3JS2A 1DI9A 1WAKA 3CC6A 3PWDA 5IA4A 3GEQA 1ZRZA 4KD1A 1UU9A 3FZOA 4OBOA 3HNGA 3OBGA 4MBIA 4HPTE 3DDQA 1MRVA 1Q99A 3D7TB 4I6HA 3ZFMA 5C8MA 2A1AB 3HECA 4U8ZA 5CEMA 2RGPA 3EN7A 3I1AA 4XBUA 1J1CA 3R8ZA 4RIOA 2PE2A 3I60A 3PJCA 4U44A 1VYZA 3EFWA 4GMYA 3NLBA 5AUYA 4H05A 1OECA 3DXNA 1OUKA 3EKKA 4F9CA 2O64A 4KKGA 4ACDA 2VTSA 3EFKA 1KE6A 1V1KA 3BLQA 5H9BA 4IB0A 5B2LA 3KRJA 4QMNA 3GCUA 3GU6A 5CANA 4YO6A 4EYJA 2GS7A 2A2AA 2PZIA 2YIXA 3CIKA 4HGLA 5CALA 1IA9A 3EYHA 4UALA 2OK1A 4BBFA 3RJCA 4CFNA 4FZDB 2GNGA 3GC9A 4CVAA 3UQFA 5CVFA 4MBJA 3WIGA 4C02A 1P14A 3KVWA 5A4QA 3DNDA 4ZK5A 3D0EA 2QG7A 3OW4A 4ARKA 4YHJA 2H9VA 4FTMA 2W9ZB 2GSFA 4U79A 4DCAA 4GFGA 4JAJA 4C38A 4JBQA 3CD3A 2VWYA 4HGEA 4QO9A 3A7GA 5AUTA 3HMOA 3QYWA 4O22A 1JWHA 3NW6A 4P7EA 2XIZA 1V0BA 5LARA 3W33A 1YRPA 4DEAA 5HCXA 5A6OA 3TJCA 2XIXA 4QQTA 2IG7A 3TDVA 4JBVA 4I20A 3PLAE 3IONA 2WKMA 4NW5A 4EUUA 5BMSA 1ZY5A 1ZYJA 3VUKA 4QDEA 3H9RA 4IE9A 5DLSA 3F2AA 3SOAA 2P2HA 2XIRA 3H30A 2OW3A 4MCVA 4PMTA 4WHZA 3FPQA 3U8WA 3V8SA 4AW5A 1UNHA 3L8VA 2Y7JA 5EG3A 3DV3A 4UZHA 3W0MA 4RIXB 3QQUA 4G9RA 5DOSA 3BHTA 5I3OA 5EKOA 4NH1A 4OTGA 5I3RA 3TIYA 3Q9XA 2ZFYA 3EIDA 3AMAA 4DT8A 2F2CB 5EW9A 1W7HA 3PE2A 3W0QA 3NRMA 4LRKA 4TYGA 3KMMA 4LRJA 1KSWA 4WNOA 3UMXA 4F6SA 4FOBA 4F1TA 5C26A 2GNJA 3V6RA 3NNWA 2ITWA 3AC5A 5FM3A 2R3LA 2BIKB 5HHWA 2BTRA 2XKDA 2CDZA 4P5QA 3VIDA 2HYYA 3E8EA 3ZH8A 4DGLC 4TXCA 1W8CA 4E4LA 3BWFA 5J7BA 5CSVA 3EQHA 3MPMA 3UO6A 3VQHA 3EN4A 5JK3A 4MYGA 5AV4A 3D7ZA 4M66A 4HVDA 3BYSA 1DAWA 5L2WA 5HE3A 4XG8A 3B2TA 4LUEA 2J5EA 3O8PA 4DAWA 4N70A 3N51A 4LL5A 3QU0A 4USDA 1UKIA 2V5QA 1YXUA 2WGJA 3QTRA 4FYOA 1YXXA 3ACJA 3AC3A 4M7IA 4AXEA 5E8XA 3EN6A 3BQRA 2O0UA 1ZXEA 3MVHA 3ZO1A 2CNUA 4IZYA 4IWQA 4GVJA 4L67A 4QYYA 3PA3A 4CYJA 2XRWA 4E5AX 5I9ZA 5EM8A 4YTIA 1H27A 2ITTA 3HGKA 4MWHA 4YBKA 2J51A 3RGFA 2BVAA 5JGDA 1H0WA 2PULA 2C3KA 2VNWA 4XG6A 4KS8A 2J2IB 2X6EA 3MTFA 5CYIA 4ZZNA 2IVTA 2BILB 3NUUA 3WILA 5GJFA 3BGZA 5CY3A 5CEKA 5ANGA 4AWIA 3KXGA 4ZTRA 4FK3A 3E5AA 3D14A 5AR3A 3W0RA 4L6QA 3V5PA 4FV9A 4EYMA 1AQ1A 1UKHA 3ALNA 4LI5A 5L8JA 3M1SA 1M7QA 5EI6A 1B6CB 2J5FA 2W0JA 5HO8A 2NPQA 3UNJA 4U3YA 4WSQA 5BUIA 4CD0A 4C3FA 1Y8YA 3Q96A 3WZUA 1JSUA 3KCFA 4FKSA 1H01A 4FKUA 4D0XA 3QRJA 4F9AA 4KRDA 3L1SA 5BVDA 2RFEA 4HYIA 4APCA 5C8NA 1SNUA 3GI3A 4YZBA 3OTUA 3NFGB 3QFVA 3C0GA 3QTWA 4FTIA 5L6WL 4MVFA 3M42A 2G2HA 1H0VA 2P55A 4RFYA 4XP0A 3QXPA 1JSVA 5HORA 3KKVA 2I0EA 4QP4A 4O1PA 4I22A 3QUPA 3FXZA 5HVJA 4M0YA 4GL9A 3O0GA 4FTOA 4FT9A 5LMAA 2HZNA 4O84A 1T46A 3LFSA 1XJDA 4RJ8A 4F99A 3QRKA 3A2CA 2EXMA 3NCGA 4TW9A 3WF6A 5DRDA 1XBBA 2UVZA 3R7OA 3MVJA 5AM6A 3R1QA 2I7QA 2ZDTA 3OS3A 4BIEA 5IA5A 3LPBA 3COHA 3TYKA 3HVCA 5ANKA 4EOPA 3JXWA 3FMJA 4H3QA 4A9YA 4WUAA 1PMUA 3QRTA 2UUEA 2WQEA 4FSZA 3KXXA 4FTUA 4FVQA 1A9UA 4DH7A 4O86A 3AD4A 3F88A 2WQOA 3MFSA 5AUZA 5HX6A 3MIAA 3MV5A 4KAOA 3TXOA 3R2YA 3QZFA 1G3NA 1FINA 4NM0A 3SOCA 4C4EA 3KN5A 5D41A 4E73A 4ZXTA 2G2FA 1OBGA 2QONA 4O0TA 4RSSA 1TKIA 3L8SA 4RA5A 4AACA 4IVBA 4BCKA 3VO3A 4C4IA 4BJJA 3CPBA 4EKKA 3O2MA 4K18A 4YUQA 1J7LA 3R1NA 4WBOA 3EQCA 4DHFA 4BGGA 4G9CA 2HWOA 4G3GA 4K8AA 2C3IB 3PXZA 3U4UA 4C4JA 2YIWA 2HZ0A 3ROCA 3IKAA 5C4LA 2GS6A 4Y85A 4QEBA 4PTEA 1OGUA 3H4JA 4EH5A 2BAJA 3F5UA 5CU0A 2HENA 5IU2A 3SGCA 2XALA 3TNIA 4UY9A 3FZRA 1Y8GA 1GZNA 5M51A 2OG8A 3GU4A 4RJ6A 4C3PA