4HVDA

Jak3 kinase domain in complex with 2-cyclopropyl-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid ((s)-1,2,2-trimethyl-propyl)-amide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
276
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK3
publication title 3-Amido Pyrrolopyrazine JAK Kinase Inhibitors: Development of a JAK3 vs JAK1 Selective Inhibitor and Evaluation in Cellular and in Vivo Models.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 276
sequence length 287
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hvdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hvdA01
4FKUA 1E1VA 2GNJA 5TF9A 4D2TA 5C1QB 3BLQA 4NYEA 1YXTA 2CDZA 4QMQA 3PDTA 3HLLA 4YLKA 4MWIA 2VRXA 3CQWA 4D1XA 5IUGA 2R0IA 3ORXA 5T6KA 2HCKA 4FL3A 1JSUA 3ZO3A 4EKKA 4IJ9A 3BZ3A 5L6OA 2WPAA 5BMMA 4JDHA 4AGWA 5HLNA 1G3NA 3B2WA 3PXQA 3UYSA 1BX6A 3HMNA 4IHPA 2Q83A 5CI7A 5HI2A 5IA5A 4EZ3A 3U6IA 3KF4A 2FUMA 3O8UA 5DOSA 5F1ZA 3V04A 1ND4A 2W17A 4GG7A 5CSXA 2YWPA 4UALA 2YZAA 3BLRA 4LRJA 5J95A 5E9EA 3MIAA 3ORTA 5AWMA 4BDCA 1ZYLA 4IM2A 4XUFA 2WAJA 3IQ7A 4OAVB 5FD2A 2PZ5A 5BVOA 3NSZA 4I93A 1M2QA 5GJGA 1OL7A 1OL2A 2BZHB 3DNEA 5CALA 2GDOA 5KBQA 5DRDA 2FYSA 4G3EA 4ZTLA 3RM7A 4D28A 2NO3A 2UW4A 4EK5A 3R30A 2XEYA 4CLJA 3VUMA 1JSTA 4UX9A 2IVUA 5FRIA 3QKMA 2JKKA 4PY1A 4JXFA 5A54A 3N51A 3QTUA 4B9DA 3NAYA 5AUWA 4FGBA 4ACDA 4QQ5A 4RX5A 4CFNA 4O7RA 4RA4A 3UZPA 3W10A 1OL5A 3ZRMA 2QU5A 2XKCA 2YEXA 1RJBA 2EXCX 4GJ3A 4FF8A 5CT7A 4UB7A 4D4RA 4EH9A 5I3RA 3EJ1A 3EL7A 3VJNA 3R1QA 2GPHA 5CT0A 3QCXA 2C3LA 4HCVA 3ZC5A 3Q9XA 3K5UA 2EXEA 3EQHA 5IF1A 3MY1A 5M51A 2W4KA 4QP7A 2ZV9A 1Z9XA 3CIKA 3D4QA 4C58A 1SNUA 2GNFA 3ALNA 3S2PA 4EK4A 5BVFA 5AUXA 5D9HA 4BN1A 3S1HA 3TZMA 4BRXA 3O8PA 1UU9A 2OF2A 3BLHA 3FMJA 4M67A 5JFVA 3PUPA 3ZUVA 2E9NA 4FT0A 4UWYA 4FVRA 5CAVA 3GOPA 3E7VA 4MAOA 4YZ9A 3ORPA 4AE6A 2X1NA 4Y72A 4AE9A 3I5ZA 5M4UA 2FH9A 4K6ZA 2GS6A 3DS6A 3R7VA 5J1VA 3PLAE 3FHRA 4QNAA 4F7JA 1JKLA 1VYZA 3OY1A 1ZZ2A 3FWQA 3KXMA 3D7TB 2YM3A 4CT2A 3EN9A 3FYJX 5KZIA 4ENXA 3FI4A 4L43A 4F70A 3UIXA 4ZLOA 4DFBA 1J1BA 4ZP5A 4FTCA 3E8CA 2E2BA 2Z7RA 4HCTA 3ZO4A 1H8FA 1NY3A 4XEYA 5CANA 4H3QA 3COHA 3Q5IA 5BVWA 5HOAA 3P7AA 3QGWA 3R6XA 3R7IA 2UW5A 2JEDA 3VW6A 4BDEA 5ANGA 2GTMA 1DI8A 1U4DA 2WTVA 2X4ZA 3A7GA 4HGSA 3COIA 2P2HA 5IA4A 4DLJA 3HP5A 4JAJA 4XBUA 3ROYA 3BV3A 5BUJA 2ONLC 3VS5A 3ZSHA 2WMRA 1O6LA 4HPUE 1Y91A 3FI3A 1WBOA 2WTCA 4DEEA 4D4SA 2W0JA 1KV2A 3VF8A 3W2QA 4BYJA 5A4CA 4W8DA 1OKWA 3O23A 4PMTA 4ZK5A 5E8XA 2XZSA 2Y0AA 3CEKA 2W1FA 3HYHA 3IO7A 3NS9A 3Q04A 4FIIA 4OW8A 4U40A 3P0MA 3AD4A 5CVHA 5HVYA 3G33A 1VR2A 4LGHA 2PVNA 4PDSA 4LV8A 3NVMB 2EWAA 4HYUA 5IDNA 3FC2A 1KUTA 4FT3A 3BQCA 2R3HA 5C8MA 4QQCA 1H28A 2B9HA 2EB3A 2X0GA 3LXLA 3AD5A 4I21A 3WF5A 4EC8A 3FL5A 4DEIA 4J8NA 3CTHA 3VVHA 3KA0A 3D5XA 3W1FA 3NUNA 1PXJA 4IWQA 5HE0A 4BKYA 2PK9A 4OTPA 3DKFA 4JNWA 4O38A 2C0IA 2IW8A 4FZ6A 5IA1A 2QVSE 3EOCA 3LPBA 3MVLA 4FG7A 4ZY5A 2P55A 4TTHB 3W2RA 4U0IA 5IEXA 3EWHA 2XKEA 3C4EA 4G6OA 4IM0A 3KRJA 1ATPE 4IM3A 5CQWA 3RPYA 1QL6A 2I7QA 4GMYA 3RBWA 3FZTA 3VHEA 4XV2A 4N0SA 3TM0A 4EJ7A 2OBJA 5HIEA 4PP9A 2CNUA 3KK9A 4ZZNA 3MYGA 5BPYA 4K33A 4RG0A 4C33A 3VBTA 4TYHA 4C35A 1Y6AA 2VGOA 4O7LA 4JJRA 4DEBA 4FSUA 4IMYA 4I22A 2PUIA 3WF8A 4XCUA 2VTQA 3PP1A 3SD0A 4PMPA 2A27A 4AW0A 4E4LA 3IDBA 4RVKA 4UY9A 4WUNA 2QG5A 1XBCA 3DY7A 4C4JA 4XG3A 2WU7A 3NX8A 4W4WA 2O8YA 1Q3WA 4ZSGA 4AT3A 3GC8A 4LRMA 4BWXA 3P78A 4A4XA 1PF8A 1IR3A 3BHUA 2XA4A 2CGVA 2OZOA 4RJ3A 1UKIA 2YIRA 3W8LA 4FEWA 1LEZA 4UBAA 5FEDA 3E8EA 2JGZA 3EQFA 3PVUA 4DGLC 4CQGA 4GKIA 2ITVA 3I4BA 4FKIA 4RWIA 2ZDUA 4YTIA 3TACA 2V7AA 2W1DA 4RIXB 5I9UA 2RF9A 1KOAA 3FQHA 4E20A 3FMMA 1SZMA 3AMAA 4C3RA 3FMHA 3AC2A 2P0CA 4ASEA 3DNDA 1J1CA 3PVWA 5HO6A 1GOLA 3PPZA 2UUEA 1R78A 3NIZA 1DM2A 2QONA 4DYMA 3IS5A 4U9AA 3G51A 4YC6A 3DKCA 3PFQA 2ACXA 5KO1A 3R9OA 4FYNA 1OITA 1J7LA 5HG9A 4FSNA 2AC3A 2PU8A 4BCKA 2ETRA 3V5WA 4YC3A 2PVYA 3BWJA 4C62A 1Q62A 3S4QA 5IQHA 5ANDA 4A06A 5FLFA 4C3PA 4YNEA 2BRHA 4BCNA 1BL6A 4RZVA 3QCYA 3A8WA 3F88A 3OD6X 3POZA 2LAVA 3WARA 3IKAA 3CKXA 4EK6A 4YUQA 4Z9LA 4TRLA 2ITOA 4XG6A 4DFLA 2QCSA 3C13A 3NCGA 4M0ZA 2E9OA 3HMMA 2IW6A 3DQXA 3SA0A 4LQMA 4W4XA 3TKHA 4ERKA 3K3JA 5AR2A 4IX5A 3LIJA 4LMNA 1MQ4A 3AC1A 4JR7A 4L3JA 2VO7A 5FEQA 4XHKB 3QGYA 1JNKA 4GL9A 3OC1A 2CPKE 5JH6A 4KBCA 5LVOA 1IA8A 4NWMA 2XBAA 4FICA 4UMTA 1Q8UA 4JS8A 3ELJA 1M2RA 4E6AA 4EOQA 4I4EA 2QU6A 5C8KA 3NAXA 3K3IA 4FV2A 5JQ8A 3O7LD 2CLQA 2WFYA 4LOOA 2R3MA 5IQEA 2X8EA 2IN6A 2J5EA 4R3PA 4XP3A 5K0XA 4L68A 3TXOA 3QF9A 2WTDA 4YNOA 3VS2A 4DFYA 3LCOA 3PRIA 1Q61A 4IBMA 3L8XA 3A99A 4QMSA 2VZ6A 4MVFA 4U7ZA 1M7NA 4IX3A 2RG5A 4O21A 4FV6A 5CSWA 1Y57A 4GYGA 3RPVA 5C4LA 2YM5A 4HCUA 4U43A 2XK9A 4CFMA 3BRBA 2OK1A 3C7QA 3QZGA 5EHLA 3ORZA 3LFCA 3ORNA 4FUXA 4BHNA 3HX4A 3C1XA 4U45A 2HWOA 5LCJA 3GCUA 3R7UA 1FMKA 3I7CA 1GIIA 2C69A 3BYVA 2QNJA 5IH6A 2G01A 5LMKC 4E6DA 4MX9A 4FZDB 5AAGA 4N6ZA 1MRUA 4EQCA 2H34A 2J4ZA 3EZVA 4GU6A 4CRSA 2E9UA 4AF3A 3R2YA 3CE3A 2R3PA 3DJ5A 5JKGA 5LVNA 1OB3A 4FK3A 1YDTE 3ANRA 3RK9A 4QNYA 4A7CA 2JBPA 3P4KA 4E4NA 5D7AA 3UP7A 3R0TA 5HU9A 3QWJA 4RZWA 2YCFA 4I0RA 5DH3A 3OOMA 4HW7A 5AR3A 3PSCA 3MPTA 3MSSA 4X3FB 4BTFA 3GCQA 3OUKA 3BBWA 4FMQA 4X6RA 4S32A 3RKBA 3FZSA 2ITQA 2HY0A 3I6UA 2OJIA 3LLTA 3ZC6A 4IAKA 4FNYA 4G9RA 4OBQA 4YJRA 5AV1A 4QRCA 4RWJA 3G15A 3VRZA 4JIKA 4O1PA 3LFFA 4HNFA 2FB8A 3P1AA 4I6QA 4LM5A 5BX0A 2YAKA 1DAYA 5J7BA 2CJMA 5DA3A 3UE4A 4GRBA 4KKHA 5HD7A 5HLWA 3NYOA 3QTIA 3VO3A 4EC9A 4IVAA 2WIPA 2XP2A 4FTQA 2A1AB 4IADA 4WUAA 2GQGA 4YBKA 4IAZA 4FTOA 4S31A 2IO6A 4RFYA 3ZCLA 4F9BA 3KMWA 4DTBA 3F3ZA 4TNBA 4M14A 3UO4A 4NW5A 2PULA 4ZTRA 1LPUA 2Z7QA 1IRKA 4X0MA 4BICA 3UQFA 2XNNA 4AZVA 1NVRA 5LXMA 3A4OX 4DCEA 4FUYA 4KBAA 5GNKA 3G9NA 4DBNA 1J7IA 1TQIA 3L8VA 4MXXA 3RINA 4QQTA 2XF0A 1PXKA 3TV7A 5EKOA 4FV7A 4D2RA 2CGWA 2Z2WA 3QCSA 5AIRA 3DLZA 1TKIA 2R3NA 4ZMFA 3P86A 1JBPE 3LFNA 3H10A 3ZDUA 5IUIA 2OJGA 3PWYA 3VUIA 4EHEA 4EKLA 4RIWB 1RW8A 3T3UA 4BC6A 2VWIA 3PE2A 3AC8A 2WTJA 1W8CA 4FODA 4QTAA 5E8YA 1TVOA 1H08A 4DGNA 5L6PA 4O84A 3BU6A 5CEOA 2BAKA 5E1EA 3QD0A 2CKOA 4YJQA 1PMEA 2IVTA 4AT4A 4BDHA 4KIPA 4L01A 4FX3A 3KCKA 4EOSA 3EQRA 4JAIA 1Z57A 4KKGA 3U6HA 4RT7A 3C5UA 4M8TA 4AFJA 1O6YA 4F65A 3Q6UA 2UZUE 4UMUA 2HIWA 4J95A 4BB4A 4RRVA 4GK2A 3VHKA 2RG6A 3KU2A 2JKOA 4O83A 4EUUA 3UVPA 1OKZA 3THBA 3RZFA 2QR7A 3WZUA 1KOBA 4G5PA 3W2CA 3I0QA 4BYIA 5F94A 3W2SA 4JLCA 3Q4ZA 3UBDA 3IW7A 3UOLA 4YC8A 3ZXTA 3BE9A 3SC1A 4RJ7A 4JG8A 3R7YA 5EDPA 3RMFA 4OTQA 4C2VA 4CMTA 3A7HA 3IGGA 3NNWA 4G3FA 5EDRA 3JVRA 4EH5A 3DK7A 2CN5A 4IZAA 2F4JA 2OW3A 2WMWA 4BDBA 1YW2A 1ZZLA 1O9UA 4J97A 4RIYA 4XLIA 4UWBA 1H01A 5AX3A 2JD5A 5EHOA 4YLLA 2PMNX 1ZYJA 3F82A 3JYAA 3PWDA 4NK9A 1XBAA 1JOWB 2BZKB 2PUUA 2QKRA 3VJOA 1PXIA 3TJCA 2A19B 3LFBA 4FSWA 4FSYA 3DZOA 4M7IA 2FSLX 4O22A 4Y5HA 2YERA 4E4MA 4O81A 3FYKX 5L6WL 5D1JA 4PTCA 4IVBA 2BAQA 4NT4A 4U42A 1QPDA 2JIUA 2Y4PA 2ZVAA 2NRUA 3U54A 4LYNA 4ANNA 3Q2MA 5HG8A 4APCA 2OZAA 4BCQA 3RCJA 3ET7A 5E4HA 4KABA 3HZTA 5CF5A 2BHHA 4WSQA 3T3VA 4RSSA 2XM8A 3VBVA 3DQWA 2XK3A 2W99B 5L3AA 5ACBC 2PPQA 5CYIA 2RFDA 4FL1A 3V8SA 1KE6A 4V0GA 5C27A 1IG1A 3MW1A 4A9UA 4IX4A 5D7VA 2C47A 3R8ZA 4CSVA 2DYLA 4CTCA 5KUPA 2F7ZE 1PXLA 5ETIA 3C0IA 4R3RA 3CY3A 2CN8A 3GVUA 2UW3A 5CU6A 4I0SA 4BBFA 3U8WA 3R9NA 3PLSA 3Q52A 4WOVA 4CTBA 1SYKA 2BVAA 2JBOA 4QTEA 2C1BA 3MIYA 3LFQA 4PTEA 4FTAA 3VUTA 4EBVA 3KXHA 3P5KA 3TV6A 2GMXA 2BIKB 1DAWA 3O8TA 4RVLA 5A6OA 4QO9A 3BBTB 3QX2A 3UOKA 4ASZA 2OFUA 1AQ1A 2HK5A 5JEBA 4FEXA 4MXYA 3V5TA 4LG4A 4G2FA 2JDTA 4R1YA 4S2ZA 4R5SA 5CSPA 1ERKA 5DGZA 1YKRA 4IZYA 4W4VA 4AS0A 4FTRA 4USEA 2C6EA 1WBVA 3UNZA 4RVTA 4H1MA 5AM7A 4FTUA 2O0UA 5EKNA 4S33A 3NZ0A 4BDFA 3H9FA 3UG2A 5CSHA 1SVHA 2R3FA 2ZV7A 4F0IA 2CGXA 1YXXA 5AP0A 4C36A 2WMAA 5KE0A 3HUBA 1OVEA 4D9TA 2B55A 4P7EA 4NUSA 5CZHA 5FDXA 3NYVA 5AV4A 3CY2A 2J0LA 5FWKK 1NVSA 2QI8A 3CPBA 4AQCA 2C6OA 1OI9A 5EK7A 2UW0A 2WOTA 3RJCA 5IQAA 3VS3A 4MBLA 2VTIA 4QMOA 3LE6A 4PDOA 4ZLYA 4G9CA 3UOHA 4LRKA 3OT8A 1XH9A 3F7WA 3MPAA 4QTCA 4FKOA 2ITTA 3W2OA 3CKWA 5GINE 4E7WA 2VNWA 3KRWA 3JVSA 3AXWA 3QYWA 4X2NA 4CGAA 2FSOX 1YQJA 2FO0A 5FQDC 3DDQA 3PY0A 4QPAA 4BWPA 3Q32A 1TQMA 2QOFA 3IECA 3EN5A 4C34A 4B8MA 3N9XA 4ANBA 3BX5A 3DK6A 3BEAA 4PL4A 4XG4A 4YO6A 2YM4A 2XRUA 4JDKA 3DXNA 2R3KA 4I23A 1XKKA 3LJ2A 2VTRA 4QMWA 4WHZA 5L2SA 3QFVA 3R73A 5E92A 4FKWA 4B99A 5E8SA 2R9SA 3NUPA 5EI8A 2G9XA 3PSBA 3UP2A 1P4FA 4YJNA 4PL5A 4G3DA 3PZHA 3OWJA 3UMXA 2F7XE 3F5UA 4ZTMA 3GB2A 4G34A 4H39A 4A9TA 1YOLA 1RQQA 5M55A 2OXYA 5A4EA 5A6NA 4E5WA 3Q6WA 2X2MA 1ZLTA 2QO2A 5AP3A 2EB2A 4FKJA 1DS5A 4FGRA 5CSVA 3MB6A 4F09A 3MH1A 3NNXA 4GG5A 4RX7A 3AT2A 4FKGA 3SOCA 2CNVA 4BTMA 2EXMA 3OVVA 3S95A 3UNJA 4ANMA 3CQEA 4MXZA 1FPUA 1Y6BA 2OIQA 2XYNA 4IC7A 4MXOA 4TWCA 3UIUA 1SM2A 3KY2A 3MBLA 2O3PA 4YURA 2X9FA 3A7JA 3SRVB 4I0TA 2VNYA 4JX3A 4O96A 2X7OA 4IQ6A 3RNIA 2XNGA 3POOA 1WVYA 4EH6A 1ZRZA 3A60A 2G2IA 4G6LA 4I6HA 4AOJA 3LM0A 4GVJA 5AMNA 3PXYA 4IAAA 3OEFX 2BIYA 3F6XA 1K9AA 4C37A 3DOGA 3LXKA 3CLYA 3AMBA 1PRYA 5HCYA 4X6QC 1Q8YA 3AC3A 3Q4UA 3EFJA 2WMTA 3IDCA 5C03A 5TO8A 4EH2A 4W4YA 3MFRA 3ZXZA 3DBDA 2PSQA 5FP6A 5L2TA 2ZB1A 5FM2A 4EQMA 3HAVA 2VGPA 3WBLA 4ZZOA 2UV2A 3E8DA 2I1MA 4PNIA 1ZOEA 3GU5A 3K5VA 3ZBFA 3OCSA 2VWXA 3BGPA 4UWCA 4NIFB 5I9WA 2F7EE 3NLBA 4AN3A 1BKXA 3JS2A 1S9IA 2JDOA 2J90A 4NCTC 2WELA 4MHAA 3N4TA 3A8XA 3L9NA 3ZEPA 2OXDA 2LGCA 1MP8A 1YXSA 4FVPA 4K77A 4A07A 3DT1A 3WYYA 3WIGA 2R3LA 3QRIA 4J71A 4Y8DA 2ZDTA 5HO8A 2JLDA 4PMSA 4CV8A 4F0FA 4JBQA 4M97A 5IA2A 2VN9A 2C0OA 4X2KA 1P14A 4A4LA 3LOKA 3G0FA 3PJ1A 4QMNA 5CENA 5HIDA 3FMLA 3P79A 3KEXA 3QRKA 4ZXTA 2W05A 5I4NA 2B7AA 3OTVA 3RK5A 4EH7A 5K5XA 2I0YA 3KRLA 4OBOA 4BTJA 3Q4CA 3DAEA 4WG3A 4RC4A 4IDTA 3PA3A 5A4LA 4DINA 5CLPA 3MVJA 3QYZA 4NL0A 3O0GA 4O91A 3ZFYA 4GFGA 4AT5A 2ZM3A 2OH4A 4FA2A 3BPRA 1NW1A 1OUKA 5E8WA 2PZPA 2YITA 3BHYA 4ANSA 2YM6A 4BGQA 2WU6A 4NM7A 5M44A 2IG7A 4X7QA 3PY1A 4BY9E 4KSPA 2J0KA 3RAWA 3E92A 4JG7A 4IJPA 5CAUA 1PKDA 2XNOA 4C57A 4PRJA 4WNOA 2FSMX 4PF4A 5KKRB 2XNEA 4NZWB 3PE1A 5LARA 5AFVA 4HVHA 3L1SA 1UWJA 4YPSA 2O65A 4AFEA 1H26A 1UNGA 3FLZA 3IG7A 4BI2A 2BTRA 1J91A 4YGAA 2X2KA 3SQQA 2OO8X 3AGMA 5JFWA 2HZ4A 3FZPA 4RPVA 4R78A 2XIRA 4A9RA 4Z55A 5FGKA 1JAMA 4DGMA 4GIHA 1U54A 2O2UA 5CEMA 5J5SA 3HRBA 2BRMA 5DFPA 5L2WA 3ORIA 4DC2A 3JY9A 3G5DA 3WZJA 3OF0A 4DF3A 4CCBA 4RIOA 2YIQA 2PVFA 4CMOA 4EK8A 1YRPA 3FKNA 3MY5A 3ZYAA 4ACMA 4X3FC 3P23A 2V55A 2CHLA 5HX6A 2I0VA 3BCEA 4DG3E 3OWKA 4RX8A 4TN6A 2PMOX 3R00A 3SXSA 3TTJA 3KC3A 4G31A 3LMHA 4CG8A 3TI1A 4I5HA 4RBLA 2B52A 4FG8A 4U3YA 2P2IA 2XB7A 4ZSJA 4CFVA 2YM8A 4XV1A 5DWRA 2PVKA 3QKKA 4YU2A 3R2BA 3L9MA 3JPVA 3EKKA 3MPMA 3VRYA 5HQ0A 4DFUA 1ZYDA 1Q8TA 4B0GA 4F7NA 3HVCA 4L6QA 3QA8A 2IZSA 2UZVA 5LMAA 3ZLXA 4ZTHA 4MEDA 2B1PA 3F69A 4JI9A 4IB1A 3GFEA 4KS8A 3REPA 4UXLA 4P5ZA 3R8PA 3FPMA 3G90X 4R7BA 4C61A 4CQEA 5HTBA 4HOKA 2WTIA 1J3HA 3AT3A 1BL7A 2GQRA 4OTDA 1Y8YA 3NNVA 3FHIA 2OG8A 3JY0A 2UW7A 4MQ2A 4TY1A 3VS0A 5KMNA 4O7WA 5E91A 4IB3A 2C6TA 4R5YA 1YI6A 3SG8A 2GNLA 4TKSA 2VAGA 2YISA 3DAKA 3D2IA 4BCFA 5AP7A 3DFAA 5FBNC 2GU8A 3C51A 5IQDA 5FTOA 3FBVA 3GT8A 4W9WA 3I79A 1VJYA 1E1XA 5TR6A 4DEGA 1OIQA 3SXRA 4M3QA 1SVGA 2C5VA 3QHWA 4TPTA 5CXHA 4DAWA 5AR8A 4II5A 3RWPA 2XS0A 3KXXA 5I9XA 5J5TA 2XJ0A 5HG7A 4ZLZA 3IW4A 3QUDA 3AMYA 3HUCA 4MCVA 3ENHA 2YIXA 4E1ZA 5HNIX 2WIHA 3KCFA 4I1ZA 4P90A 4FYOA 3BEGA 3F9NA 4GVAA 2JIVA 4FV1A 5HKMA 2GS2A 5DYJA 2AYPA 3HEGA 2UZOA 3BHHA 3QC9A 3GP0A 4O0XA 3CPCA 2ITWA 3UC3A 3NVKI 3OP5A 3GENA 3LFEA 2F2UA 2VTNA 4S30A 5EG3A 2UZNA 3CGOA 4M0YA 4C7TA 3DKOA 1FQ1B 3HMOA 3LFSA 4FSQA 4D1SA 4D55A 3FKOA 5M53A 1H0WA 3KXNA 2XJ1A 4H3BA 4E26A 4EK3A 2CKEA 4BF2A 4CYIA 2A0CX 2YACA 2UVYA 3PIZA 5AP5A 4F64A 3NGAA 4ASXA 3R21A 4IZ5A 3DCVA 3OCBA 1U54B 1STCE 2NNWB 2H6DA 3D5UA 2X8IA 4K9YA 3SGCA 4TYJA 1NXKA 1UVRA 2HWPA 3O17A 5KNJA 4IB0A 4RJ8A 5GZ9A 3VC4A 3HA8A 1ZMWA 3BGQA 1W84A 4O27B 2JC6A 4U5JA 3QD2B 3QXOA 5H8GA 3D7ZA 4FIGA 5DEWA 3LKMA 4DH1A 1WBTA 3BGZA 3TZ8A 3DZQA 4L8MA 4XG7A 2PVMA 3BU3A 1FVRA 3OBGA 4FV8A 5IKWA 4UMQA 4F9YA 4G17A 4H36A 4NTTA 2RL5A 3BU5A 5AJQA 4F1MA 1EH4A 3AOXA 3NDMA 4Y46A 2V62A 4DGOA 5E7RA 4U81A 5AR5A 3FJQE 3NWWA 3T9IA 4YJPA 4EH4A 2BR1A 2JITA 5IQIA 3FLNC 4UMRA 1U46A 3DU8A 3UJGA 3FXXA 3NRMA 3VIDA 4GCJA 2J2IB 2UW6A 4LUDA 4V05A 4H3PA 4XH6A 5IQCA 2HZIA 4IFGA 4ZTQA 4WA9A 5DT4A 4IAFA 4C3FA 4FSMA 2PHKA 2OLCA 3RZBA 4IWOA 3VS7A 5IMEA 3PVBA 4AGCA 3DGKA 3HRFA 2XIXA 4I20A 4JBVA 5DT0A 4RC3A 4AZFA 4PV0A 4IFCA 2XIKA 3Q4TA 3TNHA 4JQ8A 4ZEGA 3ROCA 1QCFA 4DG2E 5AP6A 3SHEA 3VULA 2CNQA 5E8ZA 3ZSIA 3UZRA 1H27A 3L8SA 4CV9A 1OPJA 3RTPA 1RE8A 5ANJA 4G16A 5LWMA 5FM3A 3ZHPC 3D0EA 4DH8A 3AT4A 2W1IA 4ZTNA 1FOTA 1CM8A 1ZY5A 1KE7A 4GFMA 4FZAB 3TUDA 1B6CB 4G3CA 5IH4A 3RAHA 3FI2A 3ODZX 5C01A 1BLXA 2OJ9A 2XUUA 3F5PA 1W82A 4YZBA 4AA0A 2C30A 4HPTE 3RM6A 5CEKA 3QQFA 5LWNA 3R8VA 4EUTA 4O86A 2JIIA 2IPXA 3H9RA 4BIBA 5IUHA 5A46A 3QRUA 2VTOA 3VAPA 5BYLA 3DBQA 4AZTA 3V8TA 4AP7A 2JDRA 5IG1A 3VNTA 3MI9A 4ANQA 4YJTA 2ZM4A 3O50A 4NKAA 4F0GA 3UG1A 4WT6A 2QOIA 5TT7A 3F3UA 4YZDA 4BDAA 1FINA 3LFDA 3VN9A 2QLQA 4IDVA 1G8AA 4NTSA 3FE3A 4FOBA 1V1KA 2CKQA 4AW1A 4TYHB 2CKPA 3MH0A 4HVIA 4Z16A 4IVDA 2Z60A 4JOAA 3ZONA 3MESA 5HLPA 3Q2JA 2QKWB 3I7BA 1XO2B 4R7IA 4WNKA 4FL2A 1OPKA 1MRYA 4FIFA 1LUFA 3HECA 3WE8A 4Y85A 5AV3A 4WBBB 5H9BA 2ITZA 4AGUA 4J8MA 2BDWA 3ULZA 2BFYA 3D15A 5L8JA 3UIBA 4BCPA 5J7HA 2QOHA 4L00A 4ORKA 3KULA 4PQNA 3V01A 3CC6A 4M69A 4IAYA 3C4WA 3TCPA 4QTDA 4XX9A 5L2IA 2C3JA 2YCQA 3E62A 5C26A 3Q60A 3WZDA 2VTMA 4WIHA 1T46A 2C5OA 3BYOA 3DPKA 5HVKA 5M56A 3UOJA 4GK4A 3F66A 1GZ8A 3D83A 2J9MA 4JRVA 4QPSA 5LQFA 1IASA 3FY2A 3MN3A 1G8SA 3EZRA 3OW3A 1GJOA 4TYIA 1UKHA 1YXVA 3GU7A 5JK3A 5HE2A 4RLKA 1GIJA 4KWPA 4EEVA 4GH2A 2BAJA 2UVZA 4DEHA 3QC4A 5CXZA 2WMQA 3VW8A 3BQRA 3EFLA 4ZJJA 3UODA 4F9CA 4LGDA 3ZLSA 4BDGA 2R3JA 4QP8A 5B2MA 2VWWA 2BRNA 5DIAA 4GV1A 4R8QA 4MH7A 1TQPA 5KCVA 3KFAA 4OTHA 5M09A 2C3IB 1OKYA 2CLXA 3FMDA 4O82A 1CSNA 4QMYA 3WILA 3TUBA 1JVPP 3NIEA 3H0ZA 3QZIA 4G6NA 1GZKA 1XQZA 5HE1A 3LMGA 1JKKA 2W7XA 3RP9A 4F4PA 4FTIA 4ZJVA 1OL6A 4RC2A 2HXLA 2Y6MA 3R1SA 4I5PA 1XH4A 1UU3A 2ZV2A 4O2ZA 5B0XA 5FXRA 3VBXA 3OUNB 3UVQA 3F3WA 2Q0BA 3E63A 3MS9A 5BVDA 2OFVA 4WG4A 4OLIA 4XJ0A 2C5NA 4KIKA 5K0KA 4E6QA 4E3CA 5AX9A 3HKOA 3KB7A 5DT3A 5EYDA 3EN6A 3MV5A 2HZ0A 4GT4A 4KRCA 5K5NA 2RFSA 3G2FA 5DRBA 3SAYA 3QUEA 3HGKA 4UV0A 5HHWA 4C38A 1M52A 2BMCA 2X7GA 4DCAA 4DFNA 2X7FA 3BIZA 3HNGA 3I60A 4EZ7A 3TKIA 5DPVA 1GZOA 3LCKA 5LCKA 4RWLA 2OJFE 4FC0A 5DVRA 3WI6A 1WCCA 3ORMA 5AIKA 2X6EA 4YHFA 1ZOHA 4DITA 2PVHA 5GZAA 1PW2A 5EM8A 5IEVA 2W9FB 2XCKA 3HP2A 2J0MB 4IWPA 5AADA 5CWZA 5JMSA 3UNKA 3DB8A 2PMIA 2FVDA 3ATSA 4XS2A 2G2FA 1G5SA 3G6GA 3PG1A 3QQGA 4H05A 1FGIA 4C4GA 2XCHA 1L3RE 3ACKA 3IK3A 4TWNA 3V5QA 4CRLA 1H25A 3DV3A 4PTGA 5JQ5A 3OTUA 1U5RA 1WZYA 3FMKA 3GU6A 5AR4A 2RFEA 1GY3A 1Q3DA 3PA4A 3RPRA 3EFKA 3NUAA 4O7SA 1O6KA 1HCKA 3H3CA 4U6RA 3PJ3A 2W4JA 3UDBA 4HYSA 4I3ZA 4PUZA 3OXIA 5CF8A 3CGFA 3QD3A 4ITHA 4KS7A 4QP9A 4IEBA 5E8VA 3VQHA 4EYMA 4CKJA 4CMUA 3TT0A 5I0BA 4BCOA 5DN3A 4L53A 3F3TA 4PX6A 3FLSA 4DHFA 3VUKA 1YI4A 5EHYA 1PYEA 4FV4A 1T45A 4J96A 3SV0A 5TKDA 2V0DA 3ZM4A 3NUXA 3QX4A 2W1GA 2Z7LA 4Q5HA 1F0QA 4U3ZA 5HX8A 4YZNA 4TNDA 5T3QA 5EQYA 1YDRE 3GCPA 2B9FA 3C0GA 3EN7A 3ZU7A 2YLEA 2QLUA 5E90A 3KN6A 5KKRC 3PZEA 1OECA 3KK8A 3D5VA 5CI6A 4DFZE 2R64A 1ZAOA 5ETCA 3VUDA 5IU2A 3PPJA 3R71A 4AZWA 3U9NA 3BHTA 2REIA 5JFXA 3PXFA 2C6DA 1YHWA 3BE2A 1JLUE 4YLJA 3LJ1A 3PTGA 3GI3A 4AG8A 4J7BA 3C4FA 2GNHA 3KQ7A 5IH5A 5LMKA 2JAMA 3D14A 1YWVA 2X39A 5T68A 4O0RA 2HY81 4MF1A 5HNGA 3NW6A 4DEAA 1XBBA 3DK3A 3EB0A 2H8HA 3F2NA 3QRJA 2BKZA 2XYUA 2YM7A 3HV6A 4M15A 4QPMA 4BBMA 5JRQA 3ORKA 2YAAA 1IAJA 3EKNA 2OF4A 2V7OA 2ZV8A 4XOYA 4A9YA 3EH9A 2HAKA 1XHAA 3ODYX 3R63A 4FV0A 1H00A 4BCGA 4BZOA 5CF4A 1FVVA 4OTFA 4FBXA 1PJKA 2B53A 3S0OA 4QOXA 3MGYA 3U51A 3VS4A 4G3GA 3OXZA 4U80A 2XRWA 3LCSA 4AW2A 1Q41A 4F08A 4IIRA 2C68A 3EQBA 3Q9WA 5JZNA 5JGDA 3UZTA 4GSBA 1GAGA 3HMIA 3R9HA 5IA3A 1ZARA 3RPSA 2ZMDA 5EI6A 3OT3A 2YIWA 1Q5KA 4O0TA 5CS6A 5ITAA 1WVXA 2HYYA 4ONAA 1A06A 3A7FA 3MFTA 2ETMA 5A4QA 4O7VA 4QMUA 2WZJA 3PSDA 4GEOA 4U97A 4DTKA 4JRNA 5TOZA 4CCUA 3S3IA 3BELA 2WQBA 2DQ7X 1GIHA 1BYGA 2ZYBA 3EFWA 2J6MA 4ZS0A 3UIMA 3IGOA 4UN0C 5ICPA 4FV5A 4RA5A 3ETAA 1E9HA 3MA6A 4DT8A 3BV2A 3T8OA 3PRFA 2YLFA 4RGJA 4Y95A 2QHMA 5LOHA 2R3RA 4OTRA 2ERZE 3AG9A 2BZIB 4UZDA 5M07A 3W55A 4LV5A 4I94A 4LL0A 5E1SA 3SDJA 4WNPA 4J52A 3VQUA 3A61A 4AA5A 4L7FA 3KRXA 3CD8A 4GW8A 4C8BA 3JR1A 3W33A 4F6WA 3CJFA 2P4IA 3DJ7A 1NA7A 2PVJA 2WTKB 4LOQA 2J50A 4NJDA 1UWHA 4D4YA 3KREA 1MRVA 3A62A 1VEBA 2IJMA 5LVMA 3LMIA 2KTYA 4OTIA 4RIYB 3RGFA 2A2AA 4BGHA 4WNMA 3ID6C 5H8EA 5CU3A 4KIOA 4C2WA 4YHTA 1KWPA 4QP6A 3UVRA 5LVPA 3LAUA 4EWQA 4ANLA 1Q4LA 2C1AA 1JSVA 3HAMA 2XKFA 3UPXA 5J9LA 1KE5A 1AGWA 4IACA 4TYGA 4EI4A 4AN2A 4G1WA 5AUTA 3EYGA 4N70A 3CXWA 4CD0A 3FY0A 4ZZMA 2GCDA 2H96A 4RJ5A 4BZNA 3O96A 4O7ZA 3CBLA 4FKPA 2QOBA 3PIXA 4O0VA 1V0OA 3CS9A 4O1OA 2C4GA 1XR1A 2W5AA 4M66A 4XNEA 5HESA 5GIPE 5KMJA 3KN5A 3GGFA 5IDPA 2C6KA 3IDPA 5KMIA 4XG8A 2B54A 2OZAB 4OT6A 1MQBA 5CEIA 3QQJA 2YCRA 5K9IA 4KA3A 5H2UA 3HRCA 3TN8A 1APME 2ITNA 4C4HA 2YDIA 4EH3A 1UU8A 4FTMA 3F5XA 4V0GB 2WD1A 3KMUA 4AWIA 5A4TA 4U44A 5IZFA 3FLQA 1CDKA 4QYEA 1YWRA 4E8AA 3ACJA 4NU1A 4WRGA 3FZRA 3I5NA 1CKPA 2XJ2A 3OXTA 3SOAA 1H4LA 3IW6A 5F9EA 4K2RA 5I3OA 3V5JA 2R0UA 4XRLA 3DJ6A 3MH3A 2UW8A 2XKDA 3FV8A 3PXRA 5BVEA 4ACGA 4KIQA 1Q97A 3PJ8A 4ACCA 4C59A 3DXQA 3O2MA 2JFMA 2PVLA 5L4QA 3IOPA 2WQMA 3M2WA 5I9YA 1XWSA 4GT5A 1I09A 4LUEA 2BDJA 2IVVA 4X2FA 3NYNA 3V5PA 4WBOA 2OKRA 3ZZWA 4EH8A 5HU3A 5I5ZA 5FUTA 4USFA 5BUEA 3BKBA 4JIAA 3ZMMA 1AD5A 2Y7JA 5M4IA 2W1ZA 4CZUA 5AP1A 3TZ7A 2B9JA 2WXVA 3VS1A 4KD1A 2BRGA 3ITZA 1Q99A 4YJVA 3WIKA 4FZ7A 2V5QA 3LQ5A 1QPEA 3ZTXA 4BVUA 2PZIA 4L7SA 3FQSA 2FGIA 4DH7A 3EQDA 3PG3A 4QP4A 4XG9A 5HCXA 3FSKA 5EW3A 5HBHA 3OW4A 4DH3A 1DI9A 3SLSA 1PY5A 2VX1A 1W83A 3G0EA 3GXLA 4RFMA 2C5YA 2HOGA 4ZMEA 3WE4A 2CSNA 4TWOA 4I6BA 3D7TA 1SNXA 2OIDA 3MA3A 1JQHA 2CMWA 5HVJA 4O7TA 3SW7A 2X6DA 2YDJA 3C0HA 4OBPA 5HIBA 4P2KA 4FOCA 5EQEA 2W96B 3D5WA 3F3VA 1R3CA 4P4CA 1QPJA 3ZUUA 4DA5A 5ANIA 2PWLA 3RALA 3G9LX 4CG9A 2PY3A 4O7YA 3CR0A 4GS6A 1I44A 3QTXA 3H4JA 2FSTX 1OMWA 3IOKA 1F5QA 4L3LA 4ZAUA 1H0VA 5AUVA 3E87A 3O51A 4YPDA 1W7HA 4JBOA 4NEUA 1QPCA 3PXZA 4BKJA 3V5LA 4EHZA 4CVAA 4H58A 5E8TA 3E8NA 5ANKA 2RKUA 3GC0A 5A14A 3LLAA 5CZIA 2WMVA 3NPCA 3BYSA 3R22A 3RCDA 4NFMA 2OSCA 2H9VA 2JDSA 2PZYA 3LXPA 4HYHA 5ETAA 3UTOA 5BYZA 2B9IA 3CSVA 5CY3A 5BYYA 4FE2A 2GHGA 3P7BA 4FTLA 4EHGA 1WVWA 4CNHA 3ZO2A 1H1QA 5AUZA 2VO3A 4R3CA 5CAPA 3MVHA 4F9WA 4BHZA 3GQIA 4YSJA 4V01A 5EH0A 2PVRA 2XNPA 2BALA 1A48A 5AV2A 4BFMA 3EN4A 5DI1A 3U87A 2UZWE 3FPQA 3ZH8A 4F6UA 4DH5A 1FVTA 4YSMA 4AGDA 5GJFA 3D9VA 3IONA 2WQEA 4GUEA 4QT1A 4F1OA 3S00A 4RMZA 4TWPA 4MXAA 3MFUA 4GYIA 3C9WA 3SX9A 1OGUA 5JFSA 3QD4A 4AOIA 4MF0A 3QU0A 3IW5A 2PTKA 2YABA 3PXKA 4XOZA 4B7TA 2F2CB 3QTQA 4AU8A 2PUNA 5FEEA 2QHNA 5DMZA 1PYXA 4LGGA 3FEGA 3E7OA 4JQ7A 5FXSA 5JN2A 3V6SA 1P2AA 1FBNA 3A7IA 3OZ6A 4M84A 5CU4A 4BZDA 1ZMVA 4ERWA 3H0YA 3MY0A 1FGKA 1M2PA 4J98A 2J51A 5HCZA 3WYXA 4GJ2A 4L46A 1REKA 1ZWSA 4D0WA 2NRYA 4AXAA 4AAAA 4ZY4A 4DE4A 2O5KA 4BDIA 4LOPA 4OGRA 2XIYA 2FA2A 1B38A 2R3OA 2WMSA 5M06A 4WRSA 1H24A 4R77A 4FNXA 5K4JA 3N4UA 4EWHA 3ZUTA 4R7HA 3GCVA 4O0YA 4J99A 4XBRA 5D10A 4QTBA 2IZRA 3ALOA 3H9OA 3CJGA 3FKLA 4MXCA 4FKSA 3ENMA 4A9SA 3HV5A 4RIXA 3WZEA 2ZOQA 4XLVA 4QMLA 3DBEA 1XH6A 3I81A 2I0EA 3KF7A 4YBJA 2BTSA 3B2TA 4JR3A 4U41A 2RFNA 3ANQA 3QALE 4UEUA 4FV3A 2XEZA 5TE0A 5HGIA 3DAJA 1VZOA 3TNPC 4JT3A 1PMVA 3BWFA 2W5BA 3K54A 5JT2A 4ALWA 4D0XA 2NPQA 4CZYB 5HZNA 4CLIA 2QC6A 4EOLA 3LJ0A 4YR8A 4K11A 2GFSA 3P08A 5I9ZA 4ASDA 2ZAZA 3KKVA 3U55A 1YOMA 4GK3A 3ATTA 3EQIA 4BKZA 1U59A 2UW9A 5G6VA 3GUBA 5KMOA 3R02A 1M7QA 1YVJA 3MTLA 1OIYA 5C8NA 4N57A 3AC5A 3MJ1A 3VBYA 4AOTA 4DGGA 3TNIA 4F1TA 3KVXA 2YCSA 4F9AA 3NUUA 4DN5A 5FXQA 4EYJA 4FR4A 5JGBA 1KSWA 3LZBA 4AUAA 4JVGA 5D41A 3VF9A 1HOWA 4O7NA 4IWDA 1PXNA 1U5QA 1VYWA 3MWUA 1UNLA 4IANA 5K4IA 5IISA 4RFZA 5CVGA 3CQUA 3KMMA 3GCSA 4NCTA 4QD6A 1UU7A 3GQLA 4WO5A 3QQHA 4ZSAA 3NCZA 4NKSA 3C5IA 4EORA 2PE2A 3HA6A 4WKQA 2PUPA 4IC8A 4DG0E 1H1PA 4FTTA 3QA0A 4ID7A 4KSQA 3FLYA 4JG6A 1YXUA 2QOCA 4C0TA 1K2PA 3TG1A 4FZFB 4I5MA 1P5EA 2HW7A 4JDJA 4F6SA 4FVQA 5LMBA 3AGLA 3UPZA 3GNIB 3EHAA 3H30A 3DTWA 2VTAA 2XK4A 2QOLA 3MJ2A 3LQ8A 2RGPA 4FV9A 2R5TA 4P5QA 4MKCA 3HDNA 4XYFA 4Z3VA 2WQOA 2X2LA 1FMOE 1LR4A 2Y8OA 4YMJA 4D2PA 3QQUA 3RAKA 5E8UA 4L45A 3F61A 4FEQA 2I0HA 4G5JA 4LI5A 4UYNA 4AW5A 3E93A 4HVDA 5AA9A 5L8KA 2BZJA 4HNIA 4E5AX 5J1WA 3U4UA 4RQVA 2GS7A 3R9DA 5M4FA 3FL4A 3OCGA 1JWHA 4YTHA 2C6IA 3VUHA 4XV9A 1UV5A 5I9VA 4MD7E 2G1TA 2HXQA 4BGGA 3TUCA 2PE0A 4UYAA 2VTPA 4N4SA 4FKRA 3A2CA 5A3XA 2WOUA 1JPAA 4FNWA 4EOOA 4OUCA 3RWQA 4BI1A 3GEQA 4M12A 4UZHA 5GJDA 3NEWA 2UVXA 1KE9A 3OY3A 3R9RA 5JSMA 3QCQA 4B6LA 4XMOA 3KXZA 5IQGA 1PMUA 4L42A 3N4VA 1SMHA 2SRCA 4ACHA 4QMTA 4BWKA 3LQ3A 5HTCA 4KKEA 2F57A 4GT3A 4X3JA 3ZRKA 4TT7A 2JDVA 3JXWA 4RQKA 2RIOA 3ZEWA 5M4CA 5CNNA 5AUUA 2Y4IB 4EBWA 1HCLA 4C4EA 2VWZA 2VTHA 3NYXA 3QHRA 4NFNA 5J9YA 1BMKA 1OIRA 4QMXA 1OPLA 1OBDA 2W9ZB 2UZDA 4HZRA 3QL8A 2JFLA 4NJ3A 4BCJA 4R6VA 4ZSLA 2E9VA 1PXOA 4X3FA 4X2GA 3D2KA 4D9UA 4HVSA 4HGEA 4EZ5A 4B4LA 5M08A 3F5GA 5HEZA 4EL9A 2I40A 2EVAA 3ZS5A 4EOJA 3TV4A 4TW9A 3RHXA 2W1EA 4MTAA 2IW9A 1PXPA 2W1HA 5KHWA 2B0QA 4H1JA 2AC5A 2ZM1A 4M13A 1OIUA 3ZLWA 4ZS4A 1R39A 2VTTA 3PJCA 2GNGA 2XBJA 2XMYA 5ANOA 2BRBA 3CTQA 3SXFA 2J7TA 3RI1A 4TXCA 2JAVA 4NSTA 4MK0A 2VX3A 4LL5A 3WZKA 4K0YA 4W8EA 4W9XA 4JDIA 3COKA 4QP3A 3KXGA 5CQUA 3WOWA 2VWUA 4BCHA 5HORA 2Z7SA 3RNYA 3CD3A 4MYGA 3D94A 5B2KA 2R7BA 2YHVA 4EOIA 2C3KA 3AQVA 4I6FA 4QYFA 5JRSA 1RDQE 4CFFA 2WO6A 4DTAA 2W1CA 2VO0A 4ITIA 5AP4A 3FI8A 1P4OA 2ONLA 4DLIA 2OJJA 1GZNA 2G15A 4X2JA 5DNRA 3W2PA 2CCIA 4GU9A 2PYWA 3ORLA 5CU2A 5EOBA 5AR7A 3R7OA 5IEYA 2QG7A 2OH0E 1F3MC 4J1RA 3UQGA 2WTKC 3TIYA 3M11A 2XK6A 5DG5A 3B8RA 1WBSA 2A4LA 3QLGA 4MBJA 5EYMA 2JKMA 2BDFA 2WEIA 4PWNA 2GHMA 4YJOA 4ENYA 4L3PA 1Q24A 4QP1A 4EHVA 5KHXA 3DB6A 4NM0A 5CEPA 5HBEA 4QMZA 3DDPA 1JKTA 4PPAA 4RIWA 3OMVA 5IA0A 5FBOA 5KMLA 3HDMA 3ZRLA 2VD5A 2W4OA 2C0TA 3PPKA 1OZ1A 4IZ7A 4CZTA 3K2LA 4D2WA 3TDVA 3CP9A 1ZYCA 3F2RA 3RHKA 4E6CA 2X9EA 4PL3A 1WBNA 1BUHA 2XNBA 1YHSA 5K3YA 3QTRA 2WQNA 3TDWA 2R2PA 3FZ1A 4IXPA 4D2VA 4D2SA 3DA6A 2VU3A 1M17A 2Q0NA 3Q96A 2OI4X 3OWLA 2VWBA 4X21A 5CEQA 3OHTA 2GQSA 3R28A 5FDPA 3LHJA 2UZLA 4KAOA 4CYJA 4KRDA 2X4FA 5AM6A 3LCDA 1OKVA 1ZMUA 4LMUA 3UMWA 3ZFXA 3ZFMA 4BTKA 4L9IA 3BYMA 4TZRA 5EDQA 4FTNA 3NUYA 5AUYA 4CXAA 2YWVA 3R7GA 4O6LA 2CCHA 5KMKA 2O64A 1W0XC 1URWA 4R1VA 5EI2A 4Q2AA 4E5BA 5JZJA 3OBJA 2E9PA 4OTGA 3TIZA 4E93A 3HL7A 3PJ2A 1MUOA 2PZRA 3DXPA 4CFWA 2V22A 2R4BA 4FSTA 4C4IA 4M68A 2WNTA 4BCMA 4FTKA 4IAIA 1H1RA 4RLLA 4HGTA 5BQ0A 2XVDA 2YJSA 3T9TA 2OICA 2QOQA 4IVCA 4OT5A 4YO4A 3C4ZA 3DLSA 3OG7A 4B8LA 5L8LA 3NUSA 3WF6A 3W18A 3TWJA 4IH8A 4FK6A 3TNWA 4RWKA 4L52A 4BIEA 5HNBA 4FEUA 2WGJA 3Q9YA 4L44A 1BI8A 2W06A 5KZ0A 4BBEA 4D58A 4JQEA 4DBXA 3R83A 3KGAA 1PKGA 3TZ9A 5F4NA 5FTQA 2YIYA 4BDDA 5BNJA 3CTJA 4O0SA 3FAAA 5J87A 3TNQB 4K18A 3FDNA 3NNUA 4APPA 3FC1X 3SG9A 2OU7A 2GSFA 3C4XA 2YA9A 5IPJA 4MD8E 2DWBA 4XP0A 4I24A 2QR8A 4FKLA 3BI6A 1ZYSA 3PVGA 5FTGA 4V04A 3P9JA 4I4FA 2UZTA 2ETKA 5B2LA 2BPMA 2XM9A 4EONA 3KL8A 4FKVA 3ZZEA 3OCTA 3MFSA 2VTLA 2ERKA 5KBRA 3F7ZA 4YP8A 2PE1A 4D4VA 4IB5A 2BKKA 4HGLA 3MVMA 3AC4A 4ZSEA 4L67A 2R3IA 3MTFA 3EQGA 3PYYA 1WFCA 5F95A 4U79A 4O2PA 4CEGA 2IZUA 3ERKA 3IPHA 2R3QA 1PHKA 2I6LA 4FSRA 5CASA 3Q3BA 3ZDIA 4O0UA 1M14A 3ZM9A 4FIEA 1IAHA 3R8MA 1IEPA 2WEVA 3OFMA 3R8UA 1XJDA 2WTWA 3ZLYA 1Y8GA 5AEPA 2ITPA 1CKIA 3B8QA 4PDPA 4K1BA 4RJ6A 3NW5A 4ZTSA 4Y73A 4MQ1A 4CKIA 5CNOA 3ZOSA 1Q8ZA 3QQLA 3DBFA 3JUHA 5L2QA 3KRRA 5BVNA 4JL9A 2Z8CA 3KULB 3EL8A 2PMLX 3Q9ZA 4AX8A 4M69B 2EU9A 3MB7A 3U6JA 1R1WA 4DT9A 4MBIA 1ZXEA 4AA4A 4EOKA 1OM1A 3Q5ZA 2XNMA 1NVQA 4UXQA 3OS3A 2QO7A 1XH7A 3UO6A 1SVEA 4OTWA 4MWHA 4ZOGA 3I0OA 2WB8A 2X8DA 4EOMA 3PY3A 3V6RA 2WHBA 2BCJA 4HZSA 2C5XA 3W32A 3MDYA 4BCIA 3BYUA 5DBXA 2AUHA 2R3GA 2VWVA 3FMEA 3QAME 5EM7A 3PP0A 4Y5QA 3R7EA 3DTCA 3BHVA 4MD9E 3KVWA 1IA9A 4KBKA 2HENA 3DKGA 2WMXA 3V3VA 3R1NA 4YJSA 4ZY6A 3SW4A 3SKCA 2F9GA 1YHVA 4KINA 4XV3A 4TYEA 5EW9A 5D11A 4OAUC 4OR5A 3I1AA 3W8QA 4QYHA 3VWAA 3QKLA 2O63A 2DUVA 4BDKA 1YDSE 2Y9QA 3V8WA 4RVMA 3EQPA 4IX6A 4XRJA 3QLFA 3R8LA 2ITUA 2OXXA 4ARKA 5KX8A 4USDA 2J0IA 2YDKA 3QZFA 4BR3A 1CMKE 1YI3A 4U8ZA 3TTIA 2IVSA 4YTCA 1XH5A 4YZCA 1ZY4A 2QODA 4XG2A 2VTJA 4C02A 3OEZA 4KB8A 3L8PA 3P7CA 3EIDA 3MH2A 4HJOA 2GFCA 5CVFA 4F63A 4PPBA 2P3GX 2ITYA 3I6WA 3E64A 5EYKA 4YJUA 1UNHA 2RSVA 4KIKB 5HG5A 4F7LA 5GHVA 3WF9A 1V0BA 1WMKA 4ITJA 4MNEA 4RJ4A 3GBZA 5ANEA 3ZO1A 4NH1A 2B4SB 5LVLA 2KULA 3FSFA 1KV1A 2XIZA 3HV4A 4FT9A 5DR2A 5EM6A 3V51A 4BI0A 2ESMA 2XK7A 2QO9A 2VTSA 3NW7A 3TL8A 4QMMA 5C4KA 5CAOA 3LFAA 5EM5A 5ACKA 3ULIA 1S9JA 1OUYA 3HMPA 3IW8A 3QUPA 3QBNA 3HV7A 1YWNA 1R0EA 4CT1A 5C9CA 1CTPE 2W5HA 1LEWA 4QYGA 4AZSA 3UO5A 4HVGA 4MNFA 4PMMA 1B39A 4CFUA 4WD5A 5FG8A 3GFWA 1LP4A 3M1SA 4GUBA 3FZOA 1K3AA 3SRVA 2IWIA 4BIDA 2YN8A 3LVPA 4UMPA 4Y83A 2F49A 5EYCA 4FI1A 5AA8A 4FKQA 3ZBXA 5AAEA 4YHJA 4KUJA 5CF6A 3Q53A 4LFIA 1H1WA 2GNIA 4ALVA 3R01A 1NT2A 4PNKA 4D1ZA 4C4FA 1JKSA 3GC7A 4FKTA 1OL1A 4DFXE 2BHEA 2C6MA 2QD9A 4WG5A 4GKHA 3FMNA 4AN9A 3R04A 3RK7A 3E3PA 5EOLA 5HE3A 4ZIMA 1URCA 4YZMA 2VV9A 1L8TA 4D5KA 3F2AA 3VS6A 5DHJA 4YTFA 3NMUF 4IW0A 3HV3A 3TEIA 3GU8A 1PMNA 2P33A 3FXWA 5F20A 2PL0A 3L9PA 5HICA 5J8IA 3SVVA 2UZEA 5CX9A 2OWBA 1J7UA 2XK8A 3E3BX 4NIFA 4Q5EA 4GFOA 3LM5A 5CTPA 4A4OA 5A9UA 4JBPA 1CKJA 1WBPA 4PPCA 3LXNA 4EQUA 4CFXA 5HTIA 4PP7A 5DE2A 4O6EA 3W16A 2ZJWA 3OWPA 2WKMA 5CAQA 3O7LB 3LW0A 3NR9A 3QTWA 2NP8A 3II5A 4Q9ZA 5H3QA 2YZLA 3QTZA 3UYTA 5J79A 3EMGA 4J53A 4S34A 4XP2A 1X8BA 2ZB0A 3WF7A 2VWYA 1H07A 4N6YA 4ZJIA 5LJJA 4NW6A 5EW8A 2QURA 5DLSA 4QQJA 4EJNA 5HBJA 3U4WA 5JGAA 1UA2A 4QMPA 2Y6OA 3QRTA 4E73A 5H8BA 4JX7A 3TJDA 4ALUA 4NM5A 1BI7A 1QMZA 2HELA 3GOKA 1REJA 4I41A 3ZSGA 2ZMCA 5EFQA 3OOGA 3FXZA 3L9LA 4FSZA 4AACA 3U9CA 3COMA 3PIYA 4TL0A 2BUJA 5BMSA 3DFCB 3DBCA 3E5AA 1Q8WA 5B7VA 5GIOE 3QZHA 3O71A 2OGVA 4KNBA 5IQBA 1R0PA 5FP5A 4ANOA 4MNEB 5AP2A 5HO7A 2BROA 2UZBA 4RX9A 3VBWA 2Z02A 2QQ7A 2VO6A 1W98A 1WAKA 4Z7GA 4FEVA 3UC4A 4O0WA 5DR6A 4FNZA 5G1XA 4BDJA 4FG9A 4F7SA 3FQEA 1PXMA 3VUGA 2CGUA 5J9ZA 4FT7A 4FT5A 5M57A 5EQPA 5IMXA 4FIJA 3RPOA 4AZEA 1OBGA 2G2HA 2BFXA 3LCTA 5DEYA 4F99A 3C4CA 5HD4A 2EUFB 2BILB 2X81A 3FLWA 4QMVA 4CKRA 2OIBA 2GTNA 1V0PA 1XH8A 5AAFA 2VUWA 3FUPA 4DEDA 2YFXA 1GNGA 2Y4IC 1ZOGA 3AD6A 2WMBA 3M42A 4FIHA 4GIIA 3RVGA 1H1SA 1KE8A 4D5HA 3E88A 5ETFA 4BL1A 4Q9SA 3UQCA 5BUIA 2GHLA 3A4PA 4NM3A 5KMMA 2IZTA 2ITXA 3TKUA 5AV0A 2C6LA 2DS1A 5DR9A 5IQFA 3R1YA 2JKQA 2R7IA 4QP2A 2HW6A 3GU4A 2YJRA 3PA5A 3QWKA 4HYIA 4I92A 4K8AA 1Z5MA 2J0JA 3UGCA 2VX0A 2XH5A 3C50A 3QQKA 4Z7HA 2J5FA 2QOKA 3CCNA 4I5CA 3GC9A 3OROA 3QXPA 1WBWA 4E4XA 2QOOA 3EYHA 1YOJA 3G6HA 3EQCA 3RAIA 5BVKA 4QYYA 1A9UA 2WMUA 5D12A 3VBQA 5CU0A 2HZNA 4EOPA 4FTJA 3QTSA 4IE9A 4PDYA 4WSYA 5GZ8A
chains in the Genus database with same CATH superfamily
4FKUA 1E1VA 2GNJA 5TF9A 4D2TA 5C1QB 3BLQA 4NYEA 1YXTA 2CDZA 4QMQA 3PDTA 3HLLA 4YLKA 4MWIA 2VRXA 3CQWA 4D1XA 5IUGA 2R0IA 3ORXA 5T6KA 2HCKA 4FL3A 1JSUA 3ZO3A 4EKKA 4IJ9A 3BZ3A 5L6OA 2WPAA 5BMMA 4JDHA 4AGWA 5HLNA 1G3NA 3B2WA 3PXQA 3UYSA 1BX6A 3HMNA 4IHPA 2Q83A 5CI7A 5HI2A 5IA5A 4EZ3A 3U6IA 3KF4A 2FUMA 3O8UA 5DOSA 5F1ZA 3V04A 1ND4A 2W17A 4GG7A 5CSXA 2YWPA 4UALA 2YZAA 3BLRA 4LRJA 5J95A 5E9EA 3MIAA 3ORTA 5AWMA 4BDCA 1ZYLA 4IM2A 4XUFA 2WAJA 3IQ7A 4OAVB 5FD2A 2PZ5A 5BVOA 3NSZA 4I93A 1M2QA 5GJGA 1OL7A 1OL2A 2BZHB 3DNEA 5CALA 2GDOA 5KBQA 5DRDA 2FYSA 2AQXA 4G3EA 4ZTLA 3RM7A 4D28A 2NO3A 2UW4A 4EK5A 3R30A 2XEYA 4CLJA 3VUMA 1JSTA 4UX9A 2IVUA 5FRIA 3QKMA 2JKKA 4PY1A 4JXFA 5A54A 3N51A 3QTUA 4B9DA 3NAYA 5AUWA 4FGBA 4ACDA 4QQ5A 4RX5A 4CFNA 4O7RA 4RA4A 3UZPA 3W10A 1OL5A 3ZRMA 2QU5A 2XKCA 2YEXA 1RJBA 2EXCX 4GJ3A 4FF8A 5CT7A 4UB7A 4D4RA 4EH9A 5I3RA 3EJ1A 3EL7A 3VJNA 3R1QA 2GPHA 5CT0A 3QCXA 2C3LA 4HCVA 3ZC5A 3Q9XA 3KIOC 3K5UA 2EXEA 3EQHA 5IF1A 3MY1A 5M51A 2W4KA 4QP7A 2ZV9A 1Z9XA 3CIKA 3D4QA 4C58A 1SNUA 2GNFA 3ALNA 3S2PA 4EK4A 5BVFA 5AUXA 5D9HA 4BN1A 3S1HA 3TZMA 4BRXA 3O8PA 1UU9A 2OF2A 3BLHA 3FMJA 4M67A 5JFVA 3PUPA 3ZUVA 2X0OA 2E9NA 4FT0A 4UWYA 4FVRA 5CAVA 3GOPA 3E7VA 4MAOA 4YZ9A 4DHIB 3ORPA 4AE6A 2X1NA 4Y72A 4AE9A 3I5ZA 5M4UA 2FH9A 4K6ZA 2GS6A 3DS6A 3R7VA 5J1VA 3PLAE 3FHRA 4QNAA 4F7JA 1JKLA 1VYZA 3OY1A 4JMQA 1ZZ2A 2X0PA 3FWQA 3KXMA 3D7TB 2YM3A 4CT2A 3EN9A 3FYJX 5KZIA 4ENXA 3FI4A 4L43A 4F70A 3UIXA 4ZLOA 4DFBA 1J1BA 4ZP5A 4FTCA 3E8CA 2E2BA 2Z7RA 4HCTA 3ZO4A 1H8FA 1NY3A 4XEYA 5CANA 4H3QA 3COHA 3Q5IA 5BVWA 5HOAA 3P7AA 3QGWA 3R6XA 3R7IA 2UW5A 2JEDA 3VW6A 4BDEA 5ANGA 2GTMA 1DI8A 1U4DA 2WTVA 2X4ZA 3A7GA 4HGSA 3COIA 2P2HA 5IA4A 4DLJA 3HP5A 2XANA 4JAJA 4XBUA 3ROYA 3BV3A 5BUJA 2ONLC 3VS5A 3ZSHA 2WMRA 4LV7A 1O6LA 4HPUE 1Y91A 3FI3A 1WBOA 2WTCA 4DEEA 4D4SA 2W0JA 1KV2A 3VF8A 3W2QA 4BYJA 5A4CA 4W8DA 1OKWA 3O23A 4PMTA 4ZK5A 5E8XA 2XZSA 2Y0AA 3CEKA 2W1FA 3HYHA 3IO7A 3NS9A 3Q04A 4FIIA 4OW8A 4U40A 3P0MA 3AD4A 5CVHA 5HVYA 3G33A 1VR2A 4LGHA 2NYAA 2PVNA 4PDSA 4LV8A 3NVMB 2EWAA 4HYUA 5IDNA 3FC2A 1KUTA 4FT3A 3BQCA 2R3HA 5C8MA 4QQCA 1H28A 2B9HA 2EB3A 2X0GA 3LXLA 3AD5A 4I21A 3WF5A 4EC8A 3FL5A 4DEIA 4J8NA 3CTHA 3VVHA 3KA0A 3D5XA 3W1FA 3NUNA 1PXJA 4IWQA 5HE0A 3W0RA 4BKYA 2PK9A 4OTPA 3DKFA 4JNWA 4O38A 2C0IA 2IW8A 4FZ6A 5IA1A 2QVSE 3EOCA 3LPBA 3MVLA 4DHJA 4FG7A 4ZY5A 2P55A 4TTHB 3W2RA 4U0IA 5IEXA 3EWHA 2XKEA 3C4EA 4G6OA 4IM0A 3KRJA 1ATPE 4AXCA 4IM3A 5CQWA 3RPYA 1QL6A 2I7QA 4GMYA 3RBWA 3FZTA 3VHEA 4XV2A 4N0SA 3TM0A 4EJ7A 2OBJA 5HIEA 4PP9A 2CNUA 3KK9A 4ZZNA 3MYGA 5BPYA 4K33A 4RG0A 4C33A 3VBTA 4TYHA 4C35A 1Y6AA 2VGOA 4O7LA 4JJRA 4DEBA 4DDIA 4FSUA 4IMYA 4I22A 2PUIA 3WF8A 4XCUA 2VTQA 3PP1A 3SD0A 4PMPA 2A27A 4AW0A 4E4LA 3IDBA 4RVKA 4UY9A 4WUNA 2QG5A 1XBCA 3DY7A 4C4JA 4XG3A 2WU7A 3NX8A 4W4WA 2O8YA 1Q3WA 4ZSGA 4AT3A 3GC8A 4LRMA 4BWXA 3P78A 4A4XA 1PF8A 1IR3A 3BHUA 2XA4A 2CGVA 2OZOA 4RJ3A 1UKIA 2YIRA 3W8LA 4FEWA 1LEZA 4UBAA 5FEDA 3E8EA 2JGZA 3EQFA 3PVUA 4DGLC 4CQGA 4GKIA 2ITVA 3I4BA 4FKIA 4RWIA 2ZDUA 4YTIA 3TACA 2V7AA 2W1DA 4RIXB 5I9UA 2RF9A 1KOAA 3FQHA 4E20A 3FMMA 1SZMA 3AMAA 4C3RA 3FMHA 3AC2A 2P0CA 4ASEA 3DNDA 1J1CA 3PVWA 5HO6A 1GOLA 3PPZA 2UUEA 1R78A 3NIZA 1DM2A 2QONA 4DYMA 3IS5A 4U9AA 3G51A 4YC6A 3DKCA 3PFQA 2ACXA 5KO1A 3R9OA 4FYNA 1OITA 1J7LA 5HG9A 4FSNA 2AC3A 2PU8A 4BCKA 2ETRA 3V5WA 4YC3A 2PVYA 3BWJA 4C62A 1Q62A 1W2FA 3S4QA 5IQHA 5ANDA 4A06A 5FLFA 4C3PA 2ZFYA 4YNEA 2BRHA 4BCNA 1BL6A 4RZVA 3QCYA 3A8WA 3F88A 3OD6X 3POZA 2LAVA 3WARA 3IKAA 3CKXA 4EK6A 4YUQA 4Z9LA 4TRLA 2ITOA 4XG6A 4DFLA 2QCSA 3C13A 3NCGA 4M0ZA 2E9OA 3HMMA 2IW6A 3DQXA 3SA0A 4LQMA 4W4XA 3TKHA 4ERKA 3K3JA 5AR2A 4IX5A 3LIJA 4LMNA 1MQ4A 3AC1A 4JR7A 4L3JA 2VO7A 5FEQA 4XHKB 3QGYA 1JNKA 4GL9A 3OC1A 3W0OA 2CPKE 5JH6A 4KBCA 5LVOA 1IA8A 4NWMA 2XBAA 4FICA 4UMTA 1Q8UA 4JS8A 3ELJA 1M2RA 4E6AA 4EOQA 4I4EA 2QU6A 5C8KA 3NAXA 3K3IA 4FV2A 5JQ8A 3O7LD 2CLQA 2WFYA 4LOOA 2R3MA 5IQEA 2X8EA 2IN6A 2J5EA 4R3PA 4XP3A 5K0XA 4L68A 3TXOA 3QF9A 2WTDA 4YNOA 3VS2A 4DFYA 3LCOA 3PRIA 1Q61A 4IBMA 3L8XA 3A99A 4QMSA 2VZ6A 4MVFA 4U7ZA 1M7NA 4IX3A 2RG5A 4O21A 4FV6A 1TFFA 5CSWA 1Y57A 4GYGA 3RPVA 5C4LA 2YM5A 4HCUA 4U43A 2XK9A 4CFMA 3BRBA 2OK1A 3C7QA 3QZGA 5EHLA 3ORZA 3LFCA 3ORNA 4FUXA 4BHNA 3HX4A 3C1XA 4U45A 2HWOA 5LCJA 3GCUA 3R7UA 1FMKA 3I7CA 1GIIA 2C69A 3BYVA 2QNJA 5IH6A 2G01A 5LMKC 4E6DA 4MX9A 4FZDB 5AAGA 4N6ZA 1MRUA 4EQCA 2H34A 2J4ZA 3EZVA 4GU6A 4CRSA 2E9UA 4AF3A 3R2YA 3CE3A 2R3PA 3DJ5A 5JKGA 5LVNA 1OB3A 4FK3A 1YDTE 3ANRA 3RK9A 4QNYA 4A7CA 2JBPA 3P4KA 4E4NA 5D7AA 3UP7A 3R0TA 5HU9A 4MUQA 3QWJA 4RZWA 2YCFA 4I0RA 5DH3A 3OOMA 4HW7A 5AR3A 3PSCA 3MPTA 3MSSA 4X3FB 4BTFA 3GCQA 3OUKA 3BBWA 4FMQA 4X6RA 4S32A 3RKBA 3FZSA 2ITQA 2HY0A 3I6UA 2OJIA 3LLTA 3ZC6A 4IAKA 4FNYA 4G9RA 4OBQA 4YJRA 5AV1A 4QRCA 4RWJA 3G15A 3VRZA 4JIKA 4O1PA 3LFFA 4HNFA 2FB8A 3P1AA 4I6QA 4LM5A 5BX0A 2YAKA 1DAYA 5J7BA 2CJMA 5DA3A 3UE4A 4GRBA 4KKHA 5HD7A 5HLWA 3NYOA 3QTIA 3VO3A 4EC9A 4IVAA 2WIPA 2XP2A 4FTQA 2A1AB 4IADA 4WUAA 2GQGA 4YBKA 4IAZA 4FTOA 4S31A 2IO6A 4RFYA 3ZCLA 4F9BA 3KMWA 4DTBA 3F3ZA 4TNBA 4M14A 3UO4A 4NW5A 2PULA 4ZTRA 1LPUA 2Z7QA 1IRKA 4X0MA 4BICA 3UQFA 2XNNA 4AZVA 1NVRA 5LXMA 3A4OX 4DCEA 4FUYA 4KBAA 5GNKA 3G9NA 4DBNA 1J7IA 1TQIA 3L8VA 4MXXA 3RINA 4QQTA 2XF0A 1PXKA 3TV7A 5EKOA 4FV7A 4D2RA 2CGWA 2Z2WA 3QCSA 5AIRA 3DLZA 1TKIA 2R3NA 4ZMFA 3P86A 1JBPE 3LFNA 3H10A 3ZDUA 5IUIA 2OJGA 3PWYA 3VUIA 4EHEA 4EKLA 4RIWB 1RW8A 3T3UA 4BC6A 2VWIA 3PE2A 3AC8A 2WTJA 1W8CA 4FODA 4QTAA 5E8YA 1TVOA 1H08A 4DGNA 5L6PA 4O84A 3BU6A 5CEOA 2BAKA 5E1EA 3QD0A 2CKOA 4YJQA 1PMEA 2IVTA 4AT4A 4BDHA 4KIPA 4L01A 4FX3A 3KCKA 4EOSA 3EQRA 4JAIA 1Z57A 4KKGA 3U6HA 4RT7A 3C5UA 4M8TA 4AFJA 1O6YA 4F65A 3Q6UA 2UZUE 4UMUA 2HIWA 4J95A 4BB4A 4RRVA 4GK2A 3VHKA 2RG6A 3KU2A 2JKOA 4O83A 4EUUA 3UVPA 1OKZA 3THBA 3RZFA 2QR7A 3WZUA 1KOBA 4G5PA 3W2CA 3I0QA 4BYIA 5F94A 3W2SA 4JLCA 3Q4ZA 3UBDA 3IW7A 3UOLA 4YC8A 3ZXTA 3BE9A 3SC1A 4RJ7A 4JG8A 3R7YA 5EDPA 3RMFA 4OTQA 4C2VA 4CMTA 3A7HA 3IGGA 3NNWA 4G3FA 5EDRA 3JVRA 4EH5A 3DK7A 2CN5A 4IZAA 2F4JA 2OW3A 2WMWA 4BDBA 1YW2A 1ZZLA 1O9UA 4J97A 4RIYA 2XAOA 4XLIA 4UWBA 1H01A 5AX3A 2JD5A 5EHOA 4YLLA 2PMNX 1ZYJA 3F82A 3JYAA 3PWDA 4NK9A 1XBAA 1JOWB 2BZKB 2PUUA 2QKRA 3VJOA 1PXIA 3TJCA 2A19B 3LFBA 4FSWA 4FSYA 3DZOA 4M7IA 2FSLX 4O22A 4Y5HA 2YERA 4E4MA 4O81A 3FYKX 5L6WL 5D1JA 4PTCA 4IVBA 2BAQA 4NT4A 4U42A 1QPDA 2JIUA 2Y4PA 2ZVAA 2NRUA 3U54A 4LYNA 4ANNA 3Q2MA 5HG8A 4APCA 2OZAA 4BCQA 3RCJA 3ET7A 5E4HA 4KABA 3HZTA 5CF5A 2BHHA 4WSQA 3T3VA 4RSSA 2XM8A 3VBVA 3DQWA 2XK3A 2W99B 5L3AA 5ACBC 2PPQA 5CYIA 2RFDA 4FL1A 3V8SA 1KE6A 4V0GA 5C27A 1IG1A 3MW1A 4A9UA 4IX4A 5D7VA 2C47A 3R8ZA 4CSVA 2DYLA 4CTCA 5KUPA 2F7ZE 1PXLA 5ETIA 3C0IA 4R3RA 3CY3A 2CN8A 3GVUA 2UW3A 5CU6A 4I0SA 4BBFA 3U8WA 3R9NA 3PLSA 3Q52A 4WOVA 4CTBA 1SYKA 2BVAA 2JBOA 4QTEA 2C1BA 3MIYA 3LFQA 4PTEA 4FTAA 3VUTA 4EBVA 3KXHA 4AXFA 3P5KA 3TV6A 2GMXA 2BIKB 1DAWA 3O8TA 4RVLA 5A6OA 4QO9A 3BBTB 3QX2A 3UOKA 4ASZA 2OFUA 1AQ1A 2HK5A 5JEBA 4FEXA 3UDSA 4MXYA 3V5TA 4LG4A 4G2FA 2JDTA 4R1YA 4S2ZA 4R5SA 5CSPA 1ERKA 5DGZA 1YKRA 4IZYA 4W4VA 4AS0A 4FTRA 4USEA 2C6EA 1WBVA 3UNZA 4RVTA 4H1MA 5AM7A 4FTUA 2O0UA 5EKNA 4S33A 3NZ0A 4BDFA 3H9FA 1ST4A 3UG2A 5CSHA 1SVHA 2R3FA 2ZV7A 4F0IA 2CGXA 1YXXA 5AP0A 4C36A 2WMAA 5KE0A 3HUBA 1OVEA 4D9TA 2B55A 4P7EA 4NUSA 5CZHA 5FDXA 3NYVA 5AV4A 3CY2A 2J0LA 5FWKK 1NVSA 2QI8A 3CPBA 4AQCA 2C6OA 1OI9A 5EK7A 2UW0A 2WOTA 3RJCA 5IQAA 3VS3A 4MBLA 2VTIA 4QMOA 3LE6A 4PDOA 4ZLYA 4G9CA 3UOHA 4LRKA 3OT8A 1XH9A 3F7WA 3MPAA 4QTCA 4FKOA 2ITTA 3W2OA 3CKWA 5GINE 4E7WA 2VNWA 3KRWA 3JVSA 3AXWA 3QYWA 4X2NA 4CGAA 2FSOX 1YQJA 2FO0A 5FQDC 3DDQA 3PY0A 4QPAA 4BWPA 3Q32A 1TQMA 2QOFA 3IECA 3EN5A 4C34A 4B8MA 3N9XA 4ANBA 3BX5A 3DK6A 3BEAA 4PL4A 4XG4A 4YO6A 2YM4A 2XRUA 4JDKA 3DXNA 2R3KA 4I23A 1XKKA 3LJ2A 2VTRA 4QMWA 4WHZA 5L2SA 3QFVA 3R73A 5E92A 4FKWA 4B99A 5E8SA 2R9SA 4AXEA 3NUPA 5EI8A 2G9XA 3PSBA 3UP2A 1P4FA 4YJNA 4PL5A 4G3DA 3PZHA 3OWJA 3UMXA 2F7XE 3F5UA 4ZTMA 3GB2A 4G34A 4H39A 2AEGA 4A9TA 1YOLA 1RQQA 5M55A 2OXYA 1TZDA 5A4EA 5A6NA 4E5WA 3Q6WA 2X2MA 1ZLTA 2QO2A 5AP3A 2EB2A 4FKJA 1DS5A 2XAMA 4FGRA 5CSVA 3MB6A 4F09A 3MH1A 3NNXA 4GG5A 4RX7A 3AT2A 4FKGA 3SOCA 2CNVA 4BTMA 2EXMA 3OVVA 3S95A 3UNJA 4ANMA 3CQEA 4MXZA 1FPUA 1Y6BA 2OIQA 2XYNA 4IC7A 4MXOA 4TWCA 3UIUA 1SM2A 3KY2A 3MBLA 2O3PA 4YURA 2X9FA 3A7JA 3SRVB 4I0TA 2VNYA 4JX3A 4O96A 2X7OA 4IQ6A 3RNIA 2XNGA 3POOA 1WVYA 2XALA 4EH6A 1ZRZA 3A60A 2G2IA 4G6LA 4I6HA 4AOJA 3LM0A 4GVJA 5AMNA 3P5JC 3PXYA 4IAAA 3OEFX 2BIYA 3F6XA 1K9AA 4C37A 3DOGA 3LXKA 3CLYA 3AMBA 1PRYA 5HCYA 4X6QC 3AKLA 1Q8YA 3AC3A 3Q4UA 3EFJA 2WMTA 3IDCA 5C03A 5TO8A 4EH2A 4W4YA 3MFRA 3ZXZA 3DBDA 2PSQA 5FP6A 5L2TA 2ZB1A 5FM2A 4EQMA 3HAVA 2VGPA 3WBLA 4ZZOA 2UV2A 3E8DA 2I1MA 4PNIA 1ZOEA 3GU5A 3K5VA 3ZBFA 3OCSA 2VWXA 3BGPA 4UWCA 4NIFB 5I9WA 2F7EE 3NLBA 4AN3A 1BKXA 3JS2A 1S9IA 2JDOA 2J90A 4NCTC 2WELA 4MHAA 3N4TA 3A8XA 3L9NA 3ZEPA 2OXDA 4BJJB 2LGCA 1MP8A 1YXSA 4FVPA 4K77A 4A07A 3DT1A 3WYYA 3WIGA 2R3LA 3QRIA 4J71A 4Y8DA 2ZDTA 5HO8A 2JLDA 4PMSA 4CV8A 4F0FA 4JBQA 4M97A 5IA2A 2VN9A 2C0OA 4X2KA 1P14A 4A4LA 3LOKA 3G0FA 3PJ1A 3VONA 4QMNA 5CENA 5HIDA 3FMLA 3P79A 3KEXA 3QRKA 4ZXTA 2W05A 5I4NA 2B7AA 3OTVA 3RK5A 4EH7A 5K5XA 2I0YA 3KRLA 4QDEA 4OBOA 4BTJA 3Q4CA 3DAEA 4WG3A 4RC4A 4IDTA 3PA3A 5A4LA 4DINA 5CLPA 3MVJA 3QYZA 4NL0A 1G8JA 3O0GA 4O91A 3ZFYA 4GFGA 4AT5A 2ZM3A 2OH4A 4FA2A 3BPRA 1NW1A 1OUKA 5E8WA 2PZPA 2YITA 3BHYA 4ANSA 2YM6A 4BGQA 2WU6A 4NM7A 5M44A 2IG7A 4X7QA 3PY1A 4BY9E 4KSPA 4AAYA 2J0KA 3RAWA 3E92A 4JG7A 4IJPA 5CAUA 1PKDA 2XNOA 4C57A 4PRJA 4WNOA 2FSMX 4PF4A 5KKRB 2XNEA 4NZWB 3PE1A 5LARA 5AFVA 4HVHA 3L1SA 1UWJA 4YPSA 2O65A 4AFEA 3AKJA 1H26A 1UNGA 3FLZA 3IG7A 4BI2A 2BTRA 1J91A 4YGAA 2X2KA 3SQQA 2OO8X 3AGMA 5JFWA 2HZ4A 3W0NA 3FZPA 4RPVA 4R78A 2XIRA 4A9RA 4Z55A 5FGKA 1JAMA 4DGMA 3PFYA 4GIHA 1U54A 2O2UA 5CEMA 5J5SA 1XMLA 3HRBA 2BRMA 5DFPA 5L2WA 3ORIA 4DC2A 3JY9A 3G5DA 3WZJA 3OF0A 4DF3A 4CCBA 4RIOA 2YIQA 2PVFA 4CMOA 4EK8A 1YRPA 3FKNA 3MY5A 3ZYAA 4ACMA 4O4BB 4X3FC 3P23A 2V55A 2CHLA 5HX6A 2I0VA 3BCEA 4DG3E 3OWKA 4RX8A 4TN6A 2PMOX 3R00A 3SXSA 3TTJA 3KC3A 4G31A 3LMHA 4CG8A 3TI1A 4I5HA 4RBLA 2B52A 3BLAA 4FG8A 4U3YA 2P2IA 2XB7A 4ZSJA 4CFVA 2YM8A 4XV1A 5DWRA 2PVKA 3QKKA 4YU2A 3R2BA 3BL7A 3L9MA 3JPVA 3EKKA 3MPMA 3VRYA 5HQ0A 4DFUA 1ZYDA 1Q8TA 4B0GA 4F7NA 3HVCA 4L6QA 3QA8A 2IZSA 2UZVA 5LMAA 3ZLXA 4ZTHA 4MEDA 2B1PA 3F69A 4JI9A 4IB1A 3GFEA 4KS8A 3REPA 4UXLA 4P5ZA 3R8PA 3FPMA 3G90X 4R7BA 4C61A 4CQEA 5HTBA 4HOKA 2WTIA 1J3HA 3AT3A 1BL7A 2GQRA 4OTDA 1Y8YA 1W2DA 3NNVA 3FHIA 2OG8A 3JY0A 2UW7A 4MQ2A 4TY1A 3VS0A 5KMNA 4O7WA 5E91A 4IB3A 2C6TA 4R5YA 1YI6A 3SG8A 2GNLA 4TKSA 3W0SA 2VAGA 2YISA 3DAKA 3D2IA 4BCFA 5AP7A 3DFAA 5FBNC 2GU8A 3C51A 5IQDA 5FTOA 3FBVA 3GT8A 4W9WA 3I79A 1VJYA 1E1XA 5TR6A 4DEGA 1OIQA 3SXRA 4M3QA 1SVGA 2C5VA 3QHWA 4TPTA 5CXHA 4DAWA 5AR8A 4II5A 3RWPA 2XS0A 3KXXA 5I9XA 5J5TA 2XJ0A 5HG7A 4ZLZA 3IW4A 3QUDA 3AMYA 3HUCA 4MCVA 3ENHA 2YIXA 4E1ZA 5HNIX 2WIHA 3KCFA 4I1ZA 4P90A 4FYOA 3BEGA 3F9NA 4GVAA 2JIVA 4FV1A 5HKMA 2GS2A 5DYJA 2AYPA 3HEGA 2UZOA 3BHHA 3QC9A 3GP0A 4O0XA 3CPCA 2ITWA 3UC3A 3NVKI 3OP5A 4LDTA 3GENA 3LFEA 2F2UA 2VTNA 4S30A 5EG3A 1OGYA 2UZNA 3CGOA 4M0YA 4C7TA 3DKOA 1FQ1B 3HMOA 3LFSA 4FSQA 4D1SA 4D55A 3FKOA 5M53A 1H0WA 3KXNA 2XJ1A 4H3BA 4E26A 4EK3A 2CKEA 3W0PA 4BF2A 4CYIA 2A0CX 2YACA 2UVYA 3PIZA 5AP5A 4F64A 3NGAA 4ASXA 3R21A 4IZ5A 3DCVA 3OCBA 1U54B 1STCE 2NNWB 2H6DA 3D5UA 2X8IA 4K9YA 3SGCA 4TYJA 1NXKA 1UVRA 2HWPA 3O17A 5KNJA 4IB0A 4RJ8A 5GZ9A 3VC4A 3HA8A 1ZMWA 3BGQA 1W84A 4O27B 2JC6A 4U5JA 3QD2B 3QXOA 5H8GA 3D7ZA 4FIGA 5DEWA 3LKMA 4DH1A 1WBTA 3BGZA 4O4EA 3TZ8A 3DZQA 4L8MA 4XG7A 2PVMA 4O4DA 3BU3A 1FVRA 3OBGA 4FV8A 5IKWA 4UMQA 4F9YA 4G17A 4H36A 4NTTA 2RL5A 3BU5A 5AJQA 4F1MA 1EH4A 3AOXA 3NDMA 4Y46A 2V62A 4DGOA 5E7RA 4U81A 5AR5A 3FJQE 2IEWA 3NWWA 4YJPA 3T9IA 2BR1A 4EH4A 2JITA 5IQIA 3FLNC 4UMRA 1U46A 3DU8A 3UJGA 3FXXA 3NRMA 3VIDA 4GCJA 2J2IB 2UW6A 4LUDA 4V05A 4H3PA 4XH6A 5IQCA 2HZIA 4IFGA 4ZTQA 4WA9A 5DT4A 4IAFA 4C3FA 4FSMA 2PHKA 2OLCA 3RZBA 4IWOA 3VS7A 5IMEA 3PVBA 4AGCA 3DGKA 3HRFA 2XIXA 4I20A 4JBVA 5DT0A 4RC3A 4AZFA 4PV0A 4IFCA 2XIKA 3Q4TA 1G8KA 3TNHA 4JQ8A 4ZEGA 3ROCA 1QCFA 4DG2E 5AP6A 3SHEA 3VULA 2CNQA 5E8ZA 3ZSIA 3UZRA 1H27A 3L8SA 4CV9A 1OPJA 2X0QA 3RTPA 1RE8A 5ANJA 4G16A 5LWMA 5FM3A 3ZHPC 3D0EA 4DH8A 3AT4A 2W1IA 4ZTNA 1FOTA 1CM8A 1ZY5A 1KE7A 4GFMA 4FZAB 3TUDA 1B6CB 4G3CA 5IH4A 3RAHA 3FI2A 3ODZX 5C01A 1BLXA 2OJ9A 2XUUA 3F5PA 1W82A 4YZBA 4AA0A 2C30A 4HPTE 3RM6A 5CEKA 3QQFA 5LWNA 3R8VA 4EUTA 4O86A 2JIIA 2IPXA 3H9RA 4BIBA 5IUHA 5A46A 3QRUA 2VTOA 3VAPA 5BYLA 3DBQA 4AZTA 3V8TA 4AP7A 2JDRA 5IG1A 3VNTA 3MI9A 4ANQA 4YJTA 2ZM4A 3O50A 4NKAA 4F0GA 3UG1A 4WT6A 2QOIA 5TT7A 3F3UA 4YZDA 4BDAA 1FINA 3LFDA 3VN9A 2QLQA 4IDVA 1G8AA 4NTSA 3FE3A 4FOBA 1V1KA 2CKQA 4AW1A 4TYHB 2CKPA 3MH0A 4HVIA 4Z16A 4IVDA 1W2CA 2Z60A 4JOAA 3ZONA 3BL9A 3MESA 5HLPA 3Q2JA 2QKWB 3I7BA 1XO2B 4R7IA 4WNKA 4FL2A 1OPKA 1MRYA 4FIFA 1LUFA 3HECA 3WE8A 4Y85A 5AV3A 4WBBB 5H9BA 2ITZA 4AGUA 4J8MA 2BDWA 3ULZA 2BFYA 3D15A 5L8JA 3UIBA 4BCPA 5J7HA 2QOHA 4L00A 4ORKA 3KULA 4PQNA 3V01A 3CC6A 4M69A 4IAYA 3C4WA 3TCPA 4QTDA 4XX9A 5L2IA 2C3JA 2YCQA 3E62A 5C26A 3Q60A 3WZDA 2VTMA 4WIHA 1T46A 2C5OA 3BYOA 3DPKA 5HVKA 5M56A 3UOJA 4GK4A 3F66A 1GZ8A 3D83A 2J9MA 4JRVA 4QPSA 5LQFA 1IASA 3FY2A 3MN3A 1G8SA 3EZRA 3OW3A 1GJOA 4TYIA 1UKHA 1YXVA 3GU7A 5JK3A 5HE2A 4RLKA 1GIJA 4KWPA 4EEVA 4GH2A 2BAJA 2UVZA 4DEHA 3QC4A 5CXZA 2WMQA 3VW8A 3BQRA 3EFLA 4ZJJA 3UODA 4F9CA 4LGDA 3ZLSA 4BDGA 2R3JA 4QP8A 5B2MA 2VWWA 2BRNA 5DIAA 4GV1A 4R8QA 4MH7A 1TQPA 5KCVA 3KFAA 4OTHA 5M09A 2C3IB 1OKYA 2CLXA 3FMDA 4O82A 1CSNA 4QMYA 3WILA 3TUBA 1JVPP 3NIEA 3H0ZA 3QZIA 4G6NA 1GZKA 1XQZA 5HE1A 3LMGA 1JKKA 2W7XA 3RP9A 4F4PA 4FTIA 4ZJVA 1OL6A 4RC2A 2HXLA 2Y6MA 3R1SA 4I5PA