1YQJA

Crystal structure of p38 alpha in complex with a selective pyridazine inhibitor
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
356
structure length
356
Chain Sequence
HMLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of potent pyridazine inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 356
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1yqjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1yqjA01
4YBKA 2GQSA 4BHZA 2QNJA 4FIJA 4UZDA 4BZDA 2GS2A 3DOGA 4R3RA 2A19B 4HPTE 5C8MA 3QQFA 1BMKA 4YMJA 5CXZA 4ACGA 2HZ0A 2CGUA 2BZIB 3I79A 1H4LA 4F9WA 2CSNA 4L46A 4XP2A 4YJOA 3FL4A 3CQUA 3THBA 1Q61A 3IQ7A 4QYGA 4WBOA 3T8OA 3WF7A 4Y72A 1FGIA 5EFQA 4O7YA 3DKGA 3FC2A 4LG4A 1H0WA 4G5PA 3G9LX 3FLNC 4CFXA 4J99A 4RVTA 2PE2A 4ZMFA 1IG1A 1E9HA 2WMBA 4N70A 2PHKA 4FV6A 4O2PA 2VTPA 3ZZWA 5DNRA 3ZYAA 1NW1A 4F9BA 1W98A 5EW9A 5JEBA 1PXOA 2BFXA 1CKJA 1PF8A 3Q4CA 4RX9A 1JSUA 2BDFA 4PMMA 3UYTA 2B9JA 3BGQA 4NTTA 4ALVA 4Y83A 3ZRKA 5M08A 3ZOSA 1MUOA 3F3TA 3IKAA 2EB2A 4Z7HA 4MKCA 3Q6UA 4N0SA 3HEGA 2Z7SA 4NM0A 5F4NA 2V7AA 1YXXA 2OJIA 4D1SA 4BWXA 2FVDA 4FT5A 5J9ZA 2ONLA 1PW2A 5C8KA 2W4JA 5EYMA 2BZKB 4OTDA 4IVCA 4ZJIA 5FXRA 4G1WA 4MBLA 5CSHA 3JY9A 3QTIA 3COIA 4BDHA 2YJSA 4FV1A 5CQUA 3BCEA 3GU6A 3TUDA 3G90X 3CKXA 3UC3A 5HLPA 2G01A 4D5HA 2X81A 5J87A 5TF9A 3T9IA 3R1QA 2RFEA 5EM8A 3WZUA 4AZEA 4ZEGA 3EKKA 3Q9ZA 3V01A 3ID6C 3MN3A 4MWIA 5DT4A 2R3FA 1UU3A 3Q60A 3S1HA 4IB0A 4L45A 1DI9A 2FUMA 4DH5A 4M68A 5HCYA 5HVKA 1F3MC 3UO6A 1OL5A 2R3NA 4RIXB 4YHTA 1Q5KA 2C3IB 3H0ZA 4FSZA 4FSYA 2YISA 5E8VA 3W2QA 3UOLA 4EWQA 3I6UA 2XKFA 3GQIA 2CNUA 2XNOA 2W06A 3CKWA 3DJ5A 2CKOA 4ZAUA 3PJCA 3N4VA 3TIYA 2P2IA 3UOKA 1OBGA 5B2KA 3SW4A 3RWPA 3FI8A 3AMAA 1U5RA 4QMZA 5FEEA 4ZJVA 5EYDA 4H1MA 5HIDA 4PMTA 1XBBA 5HGIA 2XK3A 2WTWA 1V0PA 4AT3A 3PZHA 4KKHA 5BQ0A 3QZIA 1FINA 4V0GB 5T6KA 3D2IA 3CY2A 4HVHA 4O1OA 5A9UA 4I20A 2UZLA 3NIZA 4AUAA 2QHNA 4GG7A 4IWQA 4K0YA 4Q2AA 5BVDA 2WMWA 2CPKE 2WD1A 4TYHA 3VHKA 4TWNA 4APPA 5A46A 3DFAA 3NVKI 3D5WA 5JFSA 3LFCA 3ZFMA 4EBVA 4WSQA 4UX9A 2YLFA 2B9HA 4NCTC 2IO6A 4L43A 2YABA 3QTQA 4RT7A 5HBEA 2V7OA 4HVIA 3MB7A 4X2JA 3FC1X 4JS8A 2Z60A 3IGGA 2XK4A 5EOBA 1Q97A 1ZOHA 2WTJA 2PUUA 2VO0A 4QQ5A 5EYCA 3LXNA 3RPVA 3RVGA 3ULIA 4BDEA 4TWCA 1BL7A 4DHFA 3TNWA 3W8LA 4DGNA 4O6LA 2YAAA 4D28A 4C4EA 3ATTA 4UEUA 4KRCA 4ZLZA 3LCTA 2OIQA 3EFLA 3GI3A 5AV4A 3P0MA 2WKMA 3C5UA 5E1SA 4C4IA 3QU0A 3I1AA 5AP7A 3FQSA 4YJTA 4LL5A 1URCA 4ZTHA 4EOQA 1W0XC 2YCRA 4CEGA 4E6DA 4J95A 3TV6A 1YXUA 3OOGA 4RVKA 1K3AA 2C0TA 3KC3A 4QMPA 1PRYA 5CZIA 2Y4PA 4D2RA 1JAMA 1BX6A 1OUYA 1V0BA 3RI1A 4RIWB 3RCJA 4YZ9A 3R63A 1YI6A 1O6KA 3UTOA 3HX4A 3Q4UA 3SA0A 1YQJA 1YW2A 1H00A 4FKLA 5HG9A 1G8SA 2O63A 5H2UA 4ZTQA 1FGKA 3E8NA 4FKVA 4GYGA 4AE6A 4W9XA 3QXPA 4S33A 3A4PA 3RPYA 2IW9A 4YNEA 4CVAA 3OROA 3QQUA 2BIKB 2FGIA 4IC7A 3R1SA 4AS0A 4JAJA 4BBMA 3ZTXA 3OBJA 4FV7A 3BEGA 5HE3A 2IN6A 3DB6A 4UALA 3BPRA 3FMHA 4G3GA 4NFMA 4BN1A 4ZZNA 4JNWA 4O7WA 1G3NA 3DK3A 2OXXA 3RK5A 3VUTA 3FQHA 4A06A 3OXIA 2H6DA 5CWZA 4FEUA 4KSPA 2BRNA 3QCSA 1OIQA 2PZIA 2XKEA 3AC1A 3LOKA 5HESA 4EYJA 2B7AA 2W1DA 4CSVA 4DGGA 2Y8OA 2CNVA 3D7TA 3FLYA 5JK3A 4MNFA 4FIHA 1H1RA 4I22A 5AA8A 4QTAA 4HGLA 2UUEA 2JDRA 3C9WA 4FIEA 4ZTRA 3VVHA 1LP4A 3NUAA 3HZTA 2R3QA 4NKSA 1H1WA 4RA5A 4P5ZA 4ZIMA 3SG9A 3LQ8A 4FV4A 4RWKA 1OL1A 3F61A 3V8WA 5CZHA 4WBBB 4I4FA 4M69B 5J5SA 4YPSA 5AV1A 2XEYA 2VTNA 3EYGA 4RMZA 4YJNA 1NY3A 3A7IA 5EM7A 5M09A 4EZ7A 2Z02A 2JKMA 3TZ7A 4Y5HA 5TKDA 4A7CA 3EL8A 4QP6A 3UVQA 5FM2A 1YOJA 1XR1A 1FBNA 1Y6BA 4QOXA 4NM3A 3I7BA 3R0TA 4Y95A 4U8ZA 5CU6A 3CGFA 3RPOA 4H3BA 3ENMA 4RRVA 4I0RA 4KAOA 1BL6A 4JDKA 3ORLA 3P7AA 1LEZA 4X7QA 4L67A 4E5WA 2OJJA 4CRLA 1XHAA 3RZBA 2W1ZA 4CFMA 4ANNA 3VAPA 3TZ9A 5IDPA 4QP1A 1F5QA 4O7SA 4ITHA 5M4UA 2W1EA 3PE1A 1FPUA 1CKIA 2JBOA 5LVMA 4F9YA 3DNEA 3G0EA 3D5UA 4TYJA 3MH1A 2BUJA 4I5MA 1OKYA 4DEIA 4DYMA 3Q9WA 1YXTA 5IQAA 2WAJA 2WTIA 3IS5A 5D7VA 1KWPA 4PPAA 3I0OA 4J52A 4S2ZA 4F64A 2J2IB 1SYKA 3ZLXA 3MVJA 2CMWA 3NAYA 3FJQE 3PY3A 4D0WA 5EI2A 4QQJA 2H9VA 4FUXA 3PJ1A 3FDNA 5J95A 2QOBA 2VWYA 3HMNA 3TV7A 3TWJA 4ANSA 4NCTA 4ZTLA 2XK6A 3ZM9A 2BAQA 3JYAA 3UG1A 5EQPA 1W7HA 1ZYSA 2FB8A 1NT2A 5AX9A 3W32A 4XV3A 5LVLA 3BU6A 2BAJA 4X0MA 3FMLA 5KZ0A 2W9FB 4OLIA 4NTSA 4CQEA 3OD6X 4QMTA 2FSTX 5IPJA 3U6HA 5JRSA 5J1VA 4MF1A 3PY0A 2A1AB 5J7BA 3OBGA 3S0OA 2EVAA 3NS9A 4KB8A 1ZAOA 4KBCA 4AE9A 2ITXA 3UGCA 2X39A 1GZKA 2Y9QA 3FMNA 4PDSA 4DGLC 4PY1A 3SDJA 3S3IA 4HGSA 4LGDA 3CD8A 5BX0A 3AT2A 4YZDA 3E63A 3O50A 4BTFA 3TKIA 4A9SA 2X2MA 3BE9A 2E9PA 5DT3A 2YM6A 2YFXA 3DBCA 5FRIA 5IA3A 4YZNA 3U9NA 4YJRA 3IG7A 5AUVA 1PXNA 2BPMA 3EN6A 1QPCA 4G3DA 4GK3A 2QODA 5HX8A 4K11A 5FQDC 4APCA 1GZNA 3EOCA 3G33A 1XH7A 4DEBA 1Z9XA 2P0CA 4HNIA 3BYUA 2NO3A 4TWPA 1YHWA 3NYOA 3AMYA 2JIVA 4KIPA 2VRXA 4O6EA 3UQFA 3OW3A 4D2TA 3TUBA 2CLQA 4FIFA 3GCSA 4FKGA 5FDXA 2C1BA 3ZFYA 3F2AA 2WPAA 5DWRA 2XM8A 2JAVA 2WHBA 4I24A 1QL6A 4EC8A 1XJDA 2J5FA 1SVGA 2JIIA 1CKPA 5L2IA 1P4OA 4C61A 3P79A 3ZDUA 4L44A 5E4HA 3PA5A 4HYHA 1FVTA 2IZUA 2JDOA 1ZY4A 2XP2A 3Q32A 2ITPA 3QYWA 2YIXA 3IW8A 4FVRA 5EKNA 5CEKA 1XQZA 2XCKA 1J3HA 2ITWA 3ORMA 1W84A 4AW2A 4EOOA 3VBXA 4JRNA 5DOSA 3PP0A 4C4GA 1UWHA 1BKXA 2X4ZA 4F6SA 3MTLA 3A7GA 3KQ7A 5C03A 4BCQA 2W99B 1O9UA 4O81A 4BF2A 3MYGA 3SV0A 2J6MA 2RG6A 1SNUA 2OZAB 3POZA 4RVMA 3OUNB 2JDSA 5G6VA 2G9XA 3VS5A 3FLZA 2Y4IB 3VS3A 2GSFA 4O82A 2QOCA 2XJ0A 4FKOA 4QMVA 4BC6A 3AGMA 4UWCA 3C51A 1ZZLA 3NYNA 2I7QA 4MX9A 4OAUC 3AC4A 2XS0A 2OXDA 4QQTA 1R0EA 3QUPA 4KIKB 3QUEA 3CJGA 2OZOA 3GT8A 4L68A 5C01A 3OG7A 4AZVA 4PMPA 5FDPA 3UOHA 3LLAA 4BWPA 2I1MA 2W1GA 1F0QA 1Q41A 4M15A 4I5HA 5FXQA 3WZJA 2RF9A 4AW5A 5IF1A 4B7TA 1OIUA 1KOBA 5JZNA 2YAKA 3NWWA 4GT5A 4FEVA 3E3PA 4M3QA 1U59A 4EEVA 4E4MA 4BI1A 2VWUA 5GIPE 4FV2A 5HHWA 4IAFA 4FSWA 5T68A 3PZEA 2UZUE 3AD4A 3GC9A 4FK6A 4QYEA 3UYSA 3RALA 2X1NA 2YIYA 3WF5A 3MVMA 1R1WA 4O0RA 2YITA 3LMGA 3GQLA 1WBNA 5EG3A 2BILB 3QZFA 3Q52A 4J8NA 1W83A 3KULA 4MWHA 4UMTA 4AOTA 2QOQA 2PPQA 4S32A 3A7HA 3EQFA 3I81A 3FL5A 4JRVA 5IUHA 4C34A 2WU6A 5CU4A 2VWWA 4FICA 4QMLA 4L6QA 3LIJA 3VUDA 3ZXZA 4XOYA 2OJFE 3IK3A 2XF0A 3OMVA 1BI7A 5D9HA 5IDNA 2BIYA 3FZOA 3NNVA 3EB0A 4XG3A 4QMOA 5I4NA 3MY0A 4KINA 4DF3A 2LGCA 2IVUA 2BZJA 3AGLA 3HV3A 4G34A 3DBQA 4AT5A 5HNIX 3BLHA 4RFMA 4XV9A 4JL9A 3V5WA 4FKRA 4PPBA 2XJ1A 2V62A 3II5A 5E8TA 3OCTA 4F4PA 3PXQA 4L3JA 1M52A 3U6IA 4O7NA 4BCJA 4NT4A 3BZ3A 3IO7A 2CN8A 2X8EA 3MFRA 2VTQA 3ZO2A 4DEHA 1YDSE 3NLBA 4FTTA 1H8FA 3ZO4A 4RC3A 1ZXEA 5M55A 2BRMA 2IW6A 1E1XA 1UU9A 3OCGA 5H8EA 4H3QA 2F7ZE 3EFJA 5HI2A 4RX8A 4GW8A 4HVSA 5AX3A 1PYXA 4QMQA 2ZV7A 3FUPA 1GNGA 2CLXA 2Z8CA 4IMYA 4C4FA 3R83A 2F9GA 2YCSA 3KMUA 1UU7A 2PE1A 4G6LA 3EQHA 4I5PA 4ID7A 4K1BA 4L7FA 4JOAA 4DCAA 3F2RA 2QOFA 2VV9A 1WBTA 1M2RA 3OS3A 3EN5A 3R1YA 5FEDA 1IA9A 4BI0A 1PMNA 4CKJA 2RG5A 2Y6OA 3U4UA 5KBQA 3OCSA 4M97A 1L8TA 4IX4A 4ZS0A 2W0JA 3OXZA 3D83A 1JVPP 3LM5A 3OT3A 2IJMA 3D7ZA 5AAEA 5HU3A 5ACBC 3HL7A 3PJ3A 4OTIA 3IPHA 2XNGA 2ZV2A 5A6NA 3NNUA 5K9IA 2WMAA 4RGJA 2Y6MA 4U40A 5ETFA 2JC6A 4ACHA 4CT2A 4RWIA 2VTIA 5K0XA 5JFWA 4ONAA 3FAAA 3EQIA 3RCDA 5M06A 3PG1A 2ITNA 3FKOA 2R3RA 2OIBA 3NPCA 4I92A 4DH7A 2HZ4A 4FKQA 5CSPA 4FNZA 1CSNA 4IJ9A 3EQPA 2I6LA 4CG9A 2HY0A 1UVRA 4EOLA 4W8DA 5I9VA 2QOLA 3G0FA 1JKTA 4NIFA 4WD5A 5CAPA 4JBOA 3QQKA 4TT7A 4YC6A 3MA3A 2YM7A 3WF8A 4RPVA 4FX3A 4R7BA 3ZEWA 3DKFA 3PSCA 1ERKA 2AYPA 2YM3A 5FBNC 3TL8A 3LLTA 3JS2A 1EH4A 3ZONA 1IRKA 2QOHA 2ZJWA 3BHYA 3CTJA 4G31A 2I0EA 4W4VA 5AP1A 3VW8A 4DEGA 4EUUA 4RC2A 3LXKA 4NJDA 5CALA 3DV3A 2YHVA 3H30A 5BNJA 4C3RA 2O64A 3GCQA 4UXQA 3CIKA 3R01A 4GMYA 4FT0A 4YSMA 3QC4A 3OUKA 4ALWA 2VZ6A 3RAWA 3R7OA 4PUZA 2IG7A 4F1MA 3TM0A 3FPQA 2WMXA 2H96A 3K5UA 2VO7A 4YJPA 3VC4A 3VS2A 4HOKA 4HVDA 4JQEA 3KN5A 1T46A 5A6OA 3CEKA 2GTNA 3AQVA 5B2LA 4BTJA 3DTCA 3SHEA 4RLKA 3WE4A 5IQBA 3ZHPC 3F2NA 4QMWA 4D4YA 4LOOA 2GFSA 1PXKA 4LQMA 5ANDA 3A8XA 3KXGA 3QGWA 3JPVA 3HA8A 2GNLA 4BL1A 4CGAA 4BTKA 4XBRA 2JFLA 3KK9A 2J7TA 2XNNA 3FZSA 3PJ2A 3MSSA 3KF4A 4OGRA 5DR2A 1H1QA 2ETKA 4J96A 1Q4LA 3ORNA 4R1VA 3FKNA 3G51A 5FG8A 5FM3A 5KZIA 3ZRLA 3LFNA 3E3BX 4C4JA 1IAJA 3VS0A 5CSVA 2REIA 3MFUA 2OF2A 5JKGA 5M53A 2Y0AA 2R3LA 3IONA 3C0GA 3VS1A 4EOJA 5LWNA 4EK8A 4RWLA 4FSRA 3TKHA 4BI2A 3DXNA 4CLIA 5EHYA 4HYSA 4K9YA 3KXZA 3O7LD 3QHWA 2R3JA 4Q9ZA 4FEXA 3Q4TA 5BVKA 2A4LA 3F5PA 3LHJA 4U43A 4XP3A 2QO2A 3QCQA 2W1HA 4QP7A 2BR1A 3MY5A 4FKIA 5CI7A 5CF4A 2J0IA 3QRJA 2R3OA 3V6SA 3SVVA 3JVRA 3PWDA 3FXZA 3BHTA 3E8CA 1XKKA 4J98A 4DFZE 3PRIA 1JKLA 1VYZA 2OI4X 3COHA 1JNKA 4AW1A 2XBAA 1B39A 3F6XA 4ZZMA 3F5UA 3KB7A 3N51A 4I93A 1QMZA 3BLRA 2XRUA 4G6OA 3E8EA 4TN6A 2R3MA 4X3FC 3DLZA 4AZTA 3F3UA 2C6KA 3UNKA 3U9CA 3DCVA 3VBQA 5E8WA 4ZTSA 3MFTA 4U42A 3L9PA 3V5LA 5EM5A 1SVEA 4Z16A 1ZOEA 5KMLA 4IDTA 4FZFB 1SMHA 2ETMA 2PVYA 4MVFA 3TEIA 2BDJA 3FMDA 3HRCA 3VF9A 5LJJA 4HGEA 2GNHA 4IWPA 5DR9A 5BVOA 5CTPA 5K4JA 5CF6A 2JFMA 1YHVA 3BU5A 4R77A 1PYEA 1UNLA 3HKOA 4O0VA 4EH7A 3E64A 3GU5A 2VTHA 2BRBA 1XH4A 3OTUA 4LI5A 4CTBA 4EWHA 2AUHA 5A4QA 3Q04A 4YTIA 5ETCA 4M12A 4O7ZA 4FKTA 4UV0A 4TTHB 1MRVA 4G5JA 5M57A 2OJ9A 2RIOA 3MDYA 3QUDA 4FOBA 4I0TA 2UVXA 5AR4A 3M2WA 4FTMA 4S34A 2QO9A 3EQBA 5IZFA 1PMVA 4C02A 5AV3A 3LQ5A 4GSBA 2B9FA 2I0HA 3PXZA 4K33A 3MW1A 4XS2A 3RAHA 2CNQA 4D5KA 5GIOE 3PWYA 1WFCA 2VX0A 3MJ2A 3UVRA 4HPUE 5HO7A 3LAUA 4W4WA 4FGBA 5BPYA 3RK9A 3KMWA 4U81A 1Z57A 3VS6A 3VRZA 5KMKA 2J51A 4C59A 4C36A 4RZVA 3R7EA 3C4EA 5GHVA 1GJOA 2C5VA 4ORKA 2PMIA 4NJ3A 3QRTA 3UP7A 1UV5A 3OTVA 4K2RA 4KKEA 4P5QA 2YIRA 4BB4A 1LR4A 4JX3A 3BBWA 3LM0A 2NRUA 3L8XA 4YJQA 4ASDA 3TI1A 3L8VA 4KWPA 4MHAA 2B52A 3MIAA 3B8RA 2O8YA 4BYJA 3ET7A 5CXHA 3AC5A 4M66A 5IA2A 4FT9A 2HWOA 3UO5A 5ANKA 1M14A 5FD2A 4DFBA 3O71A 4AA0A 4BZNA 2WIPA 2YERA 3BQRA 3R28A 3PYYA 4NEUA 2JBPA 4RJ5A 4UN0C 4PPCA 3ROYA 2HIWA 4F70A 3ZLYA 2WOTA 4IE9A 4BCPA 2WMQA 4GEOA 3MB6A 1Q3DA 1J7IA 4YLLA 3SRVA 5JT2A 2X0GA 4FNYA 4YURA 4G3FA 3PLAE 1T45A 3N9XA 4OTFA 2QKRA 4B0GA 3ZUTA 3NRMA 3PVUA 4NW5A 4RG0A 3LFDA 3QTWA 4X2NA 2C0IA 2YCFA 4Q5HA 3IGOA 3SOAA 3TJDA 4NUSA 1S9IA 3W2PA 4BVUA 4D1XA 5AA9A 5IU2A 2CKQA 3QC9A 5C4LA 4F0FA 5L6WL 2WEIA 3QLFA 2Z7LA 4BDBA 2CCHA 4FUYA 5KO1A 2WQMA 1VR2A 4IM3A 1DM2A 4DBXA 1PJKA 3GCVA 2NRYA 5E8XA 5HLWA 1UNHA 5I9YA 4F1OA 4WRGA 3BEAA 3CGOA 4HNFA 4FKPA 4EHVA 1PKDA 4EK6A 3W1FA 4BRXA 1UKIA 3ORTA 5EDRA 2V5QA 3M11A 2WTCA 5J9LA 2UZVA 2OK1A 3EH9A 3NW6A 4XLVA 3F82A 3QTZA 1KE5A 4D1ZA 2AC5A 3B2TA 3C0IA 4M14A 4YJVA 4RLLA 4O2ZA 5AUZA 5L3AA 4WO5A 4C33A 3VS4A 4CXAA 4FZAB 2XYNA 4UXLA 3FMEA 3V5PA 3FQEA 4U6RA 5FP5A 2ITVA 3D9VA 4PL3A 1M7QA 2ZAZA 4I41A 4JDIA 4QPSA 1H08A 4ZTNA 4FYOA 2FSOX 2EXCX 2ZYBA 4WSYA 5CI6A 4N6YA 2HZIA 1Y8GA 5IQDA 5HE1A 4HCTA 4Q9SA 2PVNA 2CDZA 5AR7A 4FE2A 3MS9A 4CCUA 5C1QB 3WIKA 4M0ZA 2PVKA 4X2FA 4JBQA 3NEWA 5ETAA 3T9TA 2W4OA 2XNPA 5DMZA 1VZOA 2BRGA 5LQFA 4KS7A 3IDPA 3KRJA 4LOQA 2ZB1A 5ANEA 4EH2A 4E8AA 1S9JA 4FV8A 4EH5A 3QGYA 3F5XA 4LV8A 4PTGA 4X3FA 4A9YA 5KMOA 5M07A 2UZNA 1GIHA 2B4SB 4YU2A 1V0OA 1KE6A 3A4OX 2QD9A 4B9DA 3MPAA 3PPJA 5AP5A 3F7WA 4BDKA 4B4LA 3RK7A 3A60A 1BLXA 5B7VA 4C0TA 2HWPA 4WUNA 3ZZEA 2W5BA 5DFPA 3BLQA 3DB8A 3PIZA 1KSWA 4ACMA 2WMVA 4IX3A 4X2GA 2XH5A 2JDTA 5KBRA 1GIJA 4ANOA 3QA8A 4GU6A 4YHJA 3R8LA 1WBPA 3RAKA 2YZAA 3O7LB 4FG8A 2R3IA 5HO6A 1ZARA 4IM0A 5L8JA 1OITA 4O0SA 4M8TA 3QL8A 2VX3A 4CFFA 2PZ5A 3W33A 3OZ6A 2PVHA 5KMMA 3O23A 3BGPA 3GCPA 1H07A 3DJ7A 3C4ZA 4RBLA 4B8LA 4MXZA 4MNEB 5EDPA 4FV9A 5IH5A 3F3WA 4KRDA 5F95A 5DR6A 3UQGA 3ZS5A 4O0XA 4H36A 3RHXA 1OECA 1STCE 4V05A 3P86A 4QPAA 1OBDA 2BHEA 2QOOA 4LRMA 1U54B 2X2KA 3HRFA 4GS6A 2WTVA 2PZYA 4BIEA 1XWSA 2Q0NA 4O7VA 1K2PA 1WZYA 1JPAA 2HYYA 5HTBA 3ORZA 3D14A 3E7OA 5EW8A 4DLIA 5E90A 2R7BA 3RWQA 1IR3A 3OVVA 2FSMX 4PL4A 1XH6A 4WRSA 2W1FA 4MD9E 3ZM4A 1RJBA 4TYHB 5E8UA 2YN8A 3T3VA 4BDIA 1MQBA 4CLJA 5CEMA 5AFVA 4ZTMA 3DQWA 4A07A 4QTBA 4CYJA 2CGXA 4CT1A 4BCOA 3VBVA 4ASZA 5LCKA 1J1CA 2I0VA 4BIDA 1X8BA 4O86A 3VIDA 2HW7A 4ZSGA 5F9EA 2QQ7A 2QLQA 3TG1A 5JSMA 4C2WA 4FT3A 3MY1A 4CRSA 4I3ZA 2G1TA 3KFAA 5I9XA 4WKQA 3HA6A 4KA3A 1YOLA 2XK7A 5AAGA 3DA6A 3H9FA 4QO9A 4WUAA 3SX9A 4EONA 5C8NA 1YOMA 2HAKA 5HU9A 4FK3A 4GJ3A 2EXEA 4HZRA 3TNIA 3DTWA 4BZOA 4EOSA 2EWAA 4C3FA 4FOCA 1U46A 3M42A 4F08A 4IB1A 2J4ZA 2QHMA 2OKRA 3QBNA 2EB3A 2R0UA 2F2CB 4WT6A 4X6QC 4YZCA 3E93A 1OPKA 3GFEA 4FTQA 4L53A 5D11A 1ZLTA 5TOZA 4R7HA 3BHVA 5CAUA 1HCKA 2C5XA 3QKLA 2UZEA 4FMQA 3TKUA 5IQEA 4DFLA 2I40A 4ZSAA 4BDAA 3G15A 2ZMCA 5CSXA 3I4BA 4ERKA 3UIUA 2YJRA 3QTSA 5D12A 5F1ZA 2YDKA 5HORA 4W4XA 4GKIA 3R8PA 4AZWA 1WBSA 4P4CA 4DITA 5AUYA 3NNXA 3BIZA 4IB5A 3TXOA 4IZYA 4RIYA 3ELJA 4CZYB 4L42A 4FSQA 1OB3A 3R7VA 1Y6AA 3S4QA 4QYFA 4DT8A 3TT0A 3P7BA 4LMNA 3V3VA 3NUNA 2J90A 5CAOA 4CKRA 5LWMA 4FC0A 3O8TA 4NSTA 3NVMB 3CCNA 4QP8A 5CVFA 3WYYA 4EKLA 2GQGA 1H1PA 4YBJA 5CEOA 2J0LA 3PFQA 4O0WA 3R9DA 3CPBA 3ZSGA 3BRBA 3EIDA 3HUCA 2JITA 5CLPA 5AV0A 4CYIA 5FTQA 5ICPA 4AGWA 2C6MA 3QKKA 5J5TA 2Q83A 5AP6A 3QRKA 4I0SA 4I94A 3E92A 2GMXA 3T3UA 4DCEA 4E1ZA 5CANA 3I7CA 5JRQA 2IVVA 1OGUA 4GVAA 4R78A 3R9OA 2ITUA 2JEDA 3DKCA 3R8ZA 3ZC6A 3ZO3A 5AM6A 4G17A 3R71A 3EQRA 4AT4A 1YKRA 4HW7A 3BX5A 5A4EA 2F4JA 2VGPA 2V22A 2QC6A 3SQQA 2PVLA 2QU6A 5BVEA 2CKPA 2IWIA 4FV0A 3H4JA 4O0TA 4ASXA 3P5KA 2UVYA 4BYIA 2VTTA 1OIYA 4U3ZA 2WTKB 3SD0A 4AACA 4AOJA 4FNWA 1JWHA 4PL5A 4BR3A 4F7LA 2PVFA 2C68A 5KKRB 3ZC5A 1UA2A 3P23A 3PA3A 2E9NA 3DBFA 4TZRA 4FTRA 2XRWA 3SLSA 3WYXA 4AAAA 3VBTA 4EK5A 4QTDA 3QTUA 5KNJA 2R2PA 2RL5A 3QTXA 1FVVA 3RZFA 5FWKK 3DFCB 4XG8A 5IUIA 1QPJA 4V01A 4WHZA 5AUXA 2IZTA 3K2LA 4P90A 4U79A 3VJOA 1ZWSA 4R6VA 3LFFA 5IMEA 2XIKA 2PVRA 2WQEA 3VULA 3PPZA 4QMXA 4EQMA 4XG4A 2JLDA 5DEWA 2YEXA 5DBXA 2PSQA 3DDPA 4QNYA 1ZRZA 5DT0A 4CKIA 4BCHA 4HVGA 4WNMA 3UE4A 5EK7A 3A99A 2BDWA 4ZSJA 4ERWA 3U6JA 1NVRA 3VS7A 4EL9A 1ATPE 4BGGA 3BELA 4YSJA 4FBXA 3BWFA 4WNPA 2ZV8A 3BHHA 3CJFA 3VW6A 4AOIA 1OKWA 3KXHA 4HCUA 1XBAA 2W1CA 2X6DA 3C4CA 4G6NA 4UBAA 4L00A 4IHPA 2GNJA 4KNBA 5LARA 3RM6A 4KIOA 5BVWA 3Q2MA 4BGQA 3EJ1A 4FSUA 3FBVA 3GFWA 4IB3A 5D7AA 5ITAA 2EUFB 4FVPA 2XYUA 1MQ4A 4C35A 2PL0A 4EOKA 3BBTB 4FEQA 5C4KA 4L9IA 4L3PA 2VU3A 5DLSA 5B0XA 2QR7A 4IXPA 1JQHA 1KE8A 4J97A 4QP3A 5IKWA 2V55A 3DQXA 3GP0A 1ZYDA 2IVSA 2C6TA 4L8MA 4R1YA 5G1XA 4IZ5A 3VQUA 5IQGA 2GNIA 2GFCA 3C4FA 3QKMA 3TZMA 4BY9E 3MV5A 3CD3A 4I6QA 5L2SA 2ERKA 3CY3A 4XG6A 4PRJA 5GZ8A 3D4QA 2VTMA 3UBDA 1XO2B 3MA6A 3HYHA 3UZPA 4DTKA 1GIIA 4WG5A 3IW4A 4D2SA 2GHLA 1Z5MA 4IAZA 4J7BA 3Q9XA 3TTIA 3VUHA 2PMNX 4IFCA 5L4QA 3OOMA 3EYHA 5K3YA 2PZPA 5L2WA 3GBZA 3O8PA 4CQGA 3DKOA 2X7GA 4NWMA 2W7XA 2YWVA 1WVWA 4KSQA 2O2UA 5T3QA 4F9CA 1UKHA 3TNPC 1OPLA 3FZ1A 3L1SA 4X21A 3GOKA 3TIZA 4GYIA 4YPDA 3LFSA 3PVGA 1OMWA 2OWBA 2IZSA 3D7TB 3KCFA 2OF4A 4PV0A 3TCPA 3LW0A 4XYFA 3R2BA 4KS8A 5ANGA 3CSVA 5L2QA 3DNDA 2VWVA 3SW7A 5AIRA 3UQCA 2GHMA 5BMMA 4OTGA 5HG8A 3R00A 1SNXA 4QMYA 2G2HA 2QURA 2VO6A 2VTSA 1UWJA 2VNWA 2BVAA 4IZAA 5TR6A 4A4LA 1GAGA 2PMOX 4GCJA 3COMA 5GZAA 1TQMA 1KE7A 4FG9A 2BALA 5KCVA 2WELA 1M17A 3P08A 4QMSA 4ZZOA 1O6LA 3I5NA 3QXOA 2JIUA 3A61A 4JG8A 4NW6A 5E8SA 2FH9A 1E1VA 3DK6A 3KY2A 4OAVB 4FKSA 3U4WA 3ENHA 3VHEA 3UOJA 1YDTE 1JOWB 2WZJA 3ODYX 5IUGA 5LVOA 2J5EA 4S30A 1YI4A 5HTIA 4FKJA 1OM1A 3EQCA 4A4OA 5JQ5A 1UU8A 5L6OA 3W2SA 2JKQA 4BBFA 5C26A 5IA0A 3KK8A 5DVRA 2R3KA 4FL1A 4AFEA 4DTBA 3VJNA 5M4IA 1LPUA 4D58A 3NMUF 2HCKA 3WILA 3FHRA 3R02A 4U7ZA 3HV4A 3D5XA 4QQCA 3EHAA 3P78A 4FTUA 1P2AA 4L01A 4DN5A 1OL7A 1ZMVA 3LJ2A 3CC6A 3HMIA 2JGZA 2WEVA 5AV2A 4AX8A 1RE8A 5FEQA 4EI4A 5FP6A 4O38A 5LCJA 3RMFA 4CD0A 4R5YA 1I09A 5HIEA 4JR7A 1YXVA 2BKZA 3KKVA 4EK3A 2C1AA 4FZ6A 4KIQA 3OY1A 4GV1A 3GGFA 4GVJA 1P5EA 2ACXA 5EOLA 2GTMA 4F7JA 5EI6A 2PUPA 4O84A 5FTGA 2W96B 3A7FA 4I5CA 4FGRA 4JDHA 3AT4A 5AUUA 3H0YA 3C0HA 5JGDA 4JQ8A 2QO7A 1J7UA 2P4IA 4NZWB 3Q5ZA 4UZHA 5IH4A 1JBPE 3PJ8A 4GU9A 4KBAA 5CEQA 1H26A 4C3PA 2V0DA 3QD3A 4FTJA 2RKUA 2PK9A 3PVWA 5GJGA 3WE8A 4E3CA 4L52A 3LJ1A 5JZJA 2QR8A 2BROA 4JT3A 4F9AA 4MXYA 4M7IA 2UW8A 3TNHA 4UWYA 3GB2A 4RQVA 2GCDA 3WBLA 2BMCA 3ZU7A 2X7FA 4TL0A 4ITJA 2XK9A 4PP9A 2VTLA 4FTOA 5DGZA 5CEIA 2E9UA 3MBLA 3A7JA 4HYUA 5AADA 3NR9A 3AC8A 5HE0A 3ATSA 1YVJA 5ANOA 4CFNA 2DQ7X 3KRXA 3L9NA 3R30A 4U0IA 4AGUA 4HZSA 4C4HA 5IA5A 5CVHA 4Z7GA 4QD6A 4F99A 3Q96A 4M13A 2BAKA 2W9ZB 4F1TA 3ACKA 3RTPA 4FT7A 5EQEA 1BUHA 3KU2A 4FL2A 4UY9A 2UW3A 5CAVA 4OTWA 4YC3A 4DAWA 1NXKA 3NDMA 4DC2A 4OBQA 5AUTA 3GC8A 1B6CB 2VWBA 4I23A 3FMJA 1TQIA 3POOA 4J1RA 2Y7JA 3GVUA 4QT1A 2QONA 5D41A 5E7RA 5K5NA 2KTYA 2XKCA 3P1AA 4I21A 4WIHA 4XH6A 5LVNA 2OFVA 4EHZA 4AN3A 3HLLA 3BGZA 3TN8A 3VNTA 4G3EA 4CG8A 4DFNA 4V0GA 4ZLYA 5J8IA 4IAAA 4F6UA 3PXRA 4JQ7A 4XRJA 4Z3VA 4FSNA 5BUJA 4AGCA 4A9TA 4YP8A 4EOMA 3M1SA 3D15A 4TPTA 2BZHB 2F7XE 2QI8A 3AMBA 5AEPA 5IQCA 2JKKA 3QALE 4GRBA 4LM5A 3MPMA 4FVQA 2FYSA 3B2WA 3NYXA 3FSFA 1TKIA 4H05A 4OR5A 4GUBA 4U41A 3S2PA 3L9LA 4USFA 4EJ7A 5ANJA 2B1PA 5EI8A 4F0GA 4H1JA 3Q53A 3RNIA 3A62A 5FBOA 2HW6A 4X6RA 3KN6A 5HO8A 4Y85A 1ZZ2A 3RKBA 3V8SA 3MVLA 2A2AA 1JSTA 2NPQA 2YIQA 5HE2A 4PP7A 3QD4A 3AC2A 3IDBA 3LFEA 5EHLA 4AN2A 4LGGA 3I6WA 3ANQA 3AD6A 3FMKA 4I6BA 5CENA 3V04A 5HLNA 2WTKC 4MBIA 4RJ8A 3LMIA 4XEYA 2ZMDA 1FQ1B 2UZOA 3ALOA 2HOGA 4RVLA 4DEDA 4O0UA 5EYKA 3ZXTA 3EMGA 3F5GA 3ORPA 3S95A 4MQ2A 4MCVA 5CYIA 3PDTA 2YZLA 3DZOA 1IASA 3NIEA 2OW3A 4O96A 4ACCA 4ZS4A 4D9TA 4DH8A 4F7SA 3ZBXA 5DN3A 4KD1A 3FKLA 4RIWA 4YUQA 2ZM1A 2PY3A 3R7IA 5HD4A 5LMKC 3O17A 3FYJX 2OFUA 5EHOA 3NUPA 3ORIA 4YC8A 4U5JA 3TV4A 2F57A 3LFQA 4EH4A 5M56A 1AQ1A 5HBHA 2ZOQA 4RJ6A 2PE0A 4G9RA 1IAHA 5I9ZA 4A4XA 4EK4A 3FI3A 3KULB 2XIZA 3BU3A 3CPCA 1IA8A 4WG4A 3ZSIA 1Q24A 4II5A 5BVNA 3NCGA 3VBYA 1R3CA 1PMUA 4EH6A 5I3RA 3WIGA 1CMKE 4IADA 5BMSA 3PY1A 4JLCA 2FA2A 3LE6A 2UW5A 3CQEA 3BV3A 3FZTA 5ANIA 2A27A 4ACDA 4GFGA 2B0QA 1WBVA 4ARKA 3QF9A 5AJQA 4XRLA 3DY7A 4GIIA 5CT0A 2BRHA 4UMPA 4FODA 1SM2A 3CS9A 4ITIA 2VTRA 1PKGA 1R39A 2XA4A 2OGVA 2WTDA 4KKGA 3LCSA 3RPRA 2A0CX 3ULZA 5AP4A 2UVZA 1AD5A 3MH0A 2WQNA 2FO0A 3NUUA 4AF3A 2X9FA 4D0XA 3V5JA 1XH5A 4AW0A 4AA4A 3LCOA 3EZRA 5I5ZA 3U8WA 2J0JA 2AC3A 2Q0BA 3BYOA 4OBOA 5H8BA 4DTAA 4FV5A 1FOTA 4OTHA 3LXLA 3WI6A 1KUTA 3U55A 1G8AA 2Y4IC 2XUUA 4O7LA 4HJOA 5E8YA 4C7TA 1P14A 3OXTA 3PVBA 2CHLA 3MPTA 2PVMA 4BCIA 4D4VA 3NAXA 4WNKA 3DAKA 4Q5EA 4ENYA 2WNTA 4C38A 4CNHA 1DAYA 1GOLA 1NA7A 3PSDA 4GT4A 5DIAA 3QX2A 2O0UA 4M69A 2WMUA 3BV2A 2YM4A 3ORKA 3P4KA 4ZY5A 3EWHA 2W17A 4YLKA 5A54A 1H1SA 4OTQA 3ZFXA 3DXPA 2Z7QA 3LZBA 3KL8A 3W8QA 4I6HA 4XP0A 1L3RE 2C47A 2XNMA 3OC1A 5HCZA 3VQHA 4FYNA 3R8UA 4G9CA 5GJDA 4BKYA 4OBPA 5EW3A 2J50A 4PX6A 1CDKA 3VWAA 3HMMA 3EN7A 4TW9A 3UIBA 4BTMA 4CMUA 3V8TA 1VYWA 2WOUA 3H10A 3EKNA 3F88A 3QFVA 4YO6A 3HECA 3SOCA 4DFUA 3QQJA 2C30A 4CV8A 3IDCA 4DFYA 1REKA 1APME 2VWZA 4O91A 3OEZA 4CMOA 5FTOA 1ZYLA 5FXSA 1PXIA 4XOZA 3ERKA 2UW0A 3UG2A 3PP1A 4WNOA 3RAIA 2CJMA 3FI4A 5GNKA 1YI3A 4MQ1A 3QYZA 2YIWA 4DEAA 3UPXA 4NM7A 5A3XA 2WXVA 4FR4A 4Z9LA 5TE0A 3JR1A 3R9HA 4R5SA 2O5KA 4TYEA 4HYIA 2B54A 1I44A 4XG9A 1CTPE 4NIFB 5IQIA 5IISA 2VNYA 4JXFA 5AWMA 4EOPA 5KMIA 5L8LA 3BYVA 3C13A 3K3IA 3FMMA 4PQNA 3OCBA 3QZGA 2HENA 3NZ0A 2XNBA 4DGOA 4FEWA 4YR8A 4IBMA 3QTRA 1Q8WA 3SXSA 2QKWB 3OEFX 2UW4A 2ZVAA 4BDDA 3EFKA 3PXKA 4FZDB 1V1KA 4K8AA 3TACA 4G2FA 1WAKA 4E7WA 5IQFA 1YHSA 3FYKX 2JAMA 5H3QA 4D4RA 3R9RA 3OWLA 5CQWA 1Y57A 4JDJA 4UMUA 3DS6A 4LYNA 2PVJA 4XJ0A 5I9WA 3R73A 2OU7A 4AGDA 2PZRA 3QA0A 1KE9A 4V04A 4GT3A 3GEQA 3MH3A 4F65A 5E9EA 1R0PA 3LFBA 4FTLA 4OT5A 4GFMA 5CY3A 3RINA 4FKUA 3OY3A 2RFNA 3F7ZA 4PMSA 5D10A 5JGAA 4MK0A 2CGVA 2PMLX 2GPHA 2HZNA 1FMKA 1MRUA 2XIRA 3EQGA 4TY1A 4YGAA 1W8CA 4ANMA 5J1WA 4EZ5A 3IW7A 2OLCA 5GINE 4FTCA 4IZ7A 4OW8A 4R3PA 3QWKA 4MXCA 2HK5A 3R8VA 1OKVA 2X4FA 3GU7A 1OUKA 2IW8A 3LCKA 4BDGA 1VEBA 5AP3A 3JVSA 4MF0A 3LJ0A 4YTFA 5H8GA 2QCSA 3OWJA 2R5TA 4O27B 2VX1A 4U45A 5E92A 5LMKA 3SXFA 4W4YA 5CU2A 1G5SA 4XX9A 3OP5A 4R3CA 3Q3BA 4ANQA 5CF8A 3MFSA 4QMMA 3W10A 3PLSA 2B53A 3COKA 3R04A 4FTNA 3HDMA 3BHUA 2XK8A 4DG2E 5M4FA 3G2FA 4L7SA 5HX6A 4QPMA 3IOKA 2GHGA 2QLUA 3H3CA 1QCFA 5AIKA 4M84A 1PXMA 5CASA 2P3GX 3C50A 3MTFA 4I6FA 4EC9A 5D1JA 4NFNA 3DU8A 2H34A 3NNWA 4FF8A 3CTHA 3OWKA 4FL3A 3HV7A 3K3JA 3O96A 2HXLA 2VGOA 5BYLA 1MP8A 4AN9A 4U80A 5EDQA 5HD7A 3I5ZA 5CU3A 3RP9A 4E5AX 5KX8A 4IX6A 3E62A 2YLEA 3TNQB 1RQQA 3FSKA 1M7NA 2XNEA 3G9NA 3HRBA 1H27A 1J7LA 2PU8A 3LPBA 3Q2JA 2X8IA 4DE4A 2ZDUA 3VUMA 4LMUA 4O7RA 2W5AA 4E5BA 4PDPA 2CCIA 3DT1A 4N6ZA 4DH1A 5BUIA 2WMRA 2OZAA 1U4DA 3HV5A 4RQKA 3CE3A 3KXNA 4CCBA 4NYEA 5H9BA 4YO4A 4IH8A 3RGFA 3TTJA 3U54A 2ZV9A 4E4LA 2QU5A 3BKBA 3IOPA 4ZP5A 3PG3A 4LUDA 4DT9A 3REPA 1UNGA 4UWBA 5HEZA 4ZMEA 4C2VA 4F09A 2OJGA 3E88A 4O7TA 3MGYA 1Y8YA 4NKAA 3AD5A 2B55A 3DAEA 2PYWA 4G3CA 4KIKA 1DI8A 5AR3A 4TNBA 5HICA 4IDVA 1J1BA 3D0EA 2C3KA 4BCNA 3S00A 1H0VA 3KVWA 2XEZA 4Z55A 2WO6A 3QHRA 4DLJA 1WVXA 4R7IA 4CZTA 1VJYA 3D5VA 4F7NA 4BDCA 1PXLA 4IX5A 4TNDA 4CV9A 2NP8A 3DK7A 2VAGA 5HOAA 3WZDA 5IG1A 5EM6A 5KMJA 4IM2A 4RJ7A 2UV2A 5M44A 2C5NA 2HY81 3CLYA 3NYVA 2VN9A 4FIGA 1HOWA 4W8EA 2XVDA 4RIOA 4UMRA 4AQCA 4MYGA 2VTAA 2X9EA 2WMTA 1NVSA 3PA4A 4N4SA 3OW4A 4Y5QA 3V51A 4IVDA 3NX8A 3PIXA 1YWRA 3D2KA 5HG7A 4LL0A 2OICA 3V5QA 2OIDA 4PNIA 3N4UA 1WBWA 2IVTA 4FTKA 1YWVA 4I1ZA 4IFGA 5HG5A 3UIMA 4DG3E 3MVHA 4FKWA 5L2TA 3QRIA 4KUJA 5LMAA 3HP5A 2UZDA 3UPZA 3OFMA 3GUBA 2Z2WA 4CFWA 5K4IA 3QCXA 3U87A 3ZRMA 4UB7A 3G5DA 4LGHA 4H39A 1K9AA 4AFJA 4C62A 4CZUA 3W2RA 1JKKA 2VWIA 2OH4A 1FMOE 3MIYA 5C9CA 4EJNA 4IW0A 2J0MB 3ZUUA 5KHXA 2JDVA 4BKJA 2BHHA 3LCDA 4IC8A 1A06A 3LQ3A 2RGPA 5K5XA 4ALUA 4F0IA 3RNYA 4IVBA 3BQCA 5CNNA 4I4EA 3Q6WA 3UNZA 5DHJA 4XHKB 1KV1A 4EKKA 3QZHA 3SRVB 4DH3A 4P7EA 3GCUA 5HNGA 4KBKA 4A9UA 3JUHA 3ZSHA 4BCGA 2R0IA 1Q8YA 4USEA 3PTGA 3IW5A 4AXAA 3KMMA 4BCKA 5I3OA 4PF4A 3AXWA 2OG8A 3G6HA 4PWNA 3DPKA 4DG0E 3FE3A 2EXMA 4UYNA 3KREA 1A9UA 5CEPA 4L3LA 5IQHA 2W4KA 4JBPA 2RSVA 2XM9A 3Q4ZA 3SKCA 2G2IA 2ERZE 4J53A 4A9RA 4X3JA 3FLWA 1TVOA 1Q62A 4AP7A 4JI9A 3NGAA 3PXFA 4QYYA 4D2WA 3MH2A 4NL0A 4TRLA 4QNAA 4ENXA 3L8SA 2QOIA 4O1PA 5AR5A 1H24A 3O2MA 4XUFA 4M67A 4K18A 3TDWA 5KUPA 1B38A 2XMYA 5B2MA 2P33A 1J91A 1QPEA 3QX4A 5AAFA 2VTOA 5HIBA 4GFOA 4EYMA 3L8PA 4P2KA 4GL9A 4EBWA 1ND4A 2X2LA 3HNGA 5AP2A 4PDOA 3LKMA 3DJ6A 2PULA 1PHKA 1XH9A 3ALNA 3FV8A 2C6DA 2ITOA 4B99A 3KVXA 5CNOA 1ZMUA 3NCZA 2XKDA 3LXPA 3QAME 4MD7E 4WG3A 2E9OA 3ACJA 4F6WA 4OUCA 5ACKA 3FLQA 3C4XA 3DLSA 2JKOA 3KF7A 4RA4A 2ZDTA 5DE2A 1KV2A 3W16A 1XH8A 4PTEA 2ESMA 4BBEA 4MBJA 1Q8UA 2OO8X 3ZO1A 4PTCA 3OT8A 4YLJA 2KULA 3GC7A 2NNWB 4U3YA 2UW9A 4YTHA 3EN9A 2CN5A 3ETAA 3Q9YA 4C8BA 4XNEA 4EH8A 2ITZA 3ROCA 5DYJA 3ZLSA 2E9VA 2ZB0A 4FSMA 4FV3A 4O0YA 1XBCA 2ETRA 3DBEA 4FNXA 4MEDA 4X3FB 3RM7A 3DXQA 5K0KA 3B8QA 3GC0A 3OWPA 1JKSA 4QTEA 4QP4A 3H9OA 4RSSA 3ZBFA 4QMUA 3NUYA 4XV1A 3R7YA 3VUGA 4E6AA 4EORA 1LEWA 5DRBA 4JX7A 3W2OA 4RZWA 2XIXA 3K54A 2BTSA 2C5YA 2W5HA 3Q5IA 5BUEA 4JIKA 2ITTA 2VUWA 3QLGA 4MH7A 5IA4A 4PDYA 4MTAA 2ITQA 3KRRA 3P7CA 4XCUA 1R78A 2YWPA 3C5IA 1SVHA 2HXQA 3F3VA 5A4LA 2DS1A 4CMTA 4PNKA 4JG6A 3HAVA 3SGCA 1YWNA 4FTAA 1U5QA 4U44A 3UZRA 1CM8A 2ITYA 3UVPA 3UC4A 4ASEA 5E1EA 4ZLOA 4TXCA 5BYYA 3FXXA 4GJ2A 4IAIA 4E6CA 4IACA 2X6EA 2XZSA 4BFMA 4CTCA 3R21A 4RX7A 4CFVA 3IW6A 4EUTA 3TDVA 3C1XA 5KMNA 1YRPA 1Q8ZA 3NW7A 4FIIA 2C5OA 2G2FA 3GU8A 3WF9A 5IEXA 2GS6A 3O0GA 4BGHA 2PUNA 4ZSEA 1PXJA 5AP0A 3HAMA 2UZBA 4NK9A 5CS6A 2XIYA 4TYIA 4JIAA 4ZY6A 3EFWA 4WA9A 5AM7A 4LV5A 3D94A 2YM8A 3TJCA 3WARA 5J79A 3P9JA 1ZOGA 3FXWA 4RJ4A 3KEXA 3FY0A 3FHIA 4K6ZA 3WZEA 4IIRA 3VN9A 5FUTA 3E87A 4AU8A 1OI9A 3AG9A 3RBWA 2IPXA 1OL2A 3FWQA 5A4CA 3TUCA 4IAKA 5C27A 3ZUVA 2R3HA 2UW7A 1QPDA 4JG7A 3KRLA 4E20A 5JH6A 4OTRA 2C4GA 2C3JA 3MWUA 4IAYA 5AR2A 4YHFA 5JMSA 2XCHA 4ZSLA 3DAJA 4D9UA 2GS7A 4WOVA 1M2PA 3AC3A 1Q8TA 4FG7A 3W2CA 4FZ7A 3FY2A 2F49A 5CVGA 3ITZA 4C57A 2UZTA 2F7EE 2VD5A 3QQLA 4QP2A 4QYHA 3PUPA 4GK4A 3C7QA 4NM5A 5HCXA 4ZXTA 3ZH8A 2DYLA 3E5AA 4QRCA 3OF0A 1NVQA 2EU9A 4ZK5A 3SXRA 3QQHA 3UJGA 4LRJA 4BCFA 3KXXA 5HQ0A 5J7HA 2QG7A 4MXXA 2F2UA 3W55A 5KHWA 4IANA 5IEVA 2R9SA 3FEGA 1WVYA 2VTJA 4EQUA 5A4TA 1FVRA 5DG5A 3GXLA 4M0YA 5M4CA 2H8HA 4XV2A 3R7UA 5IA1A 4O22A 4MXOA 4R8QA 2OBJA 5CT7A 4QTCA 5DPVA 2DUVA 3WOWA 4B6LA 1WBOA 2R7IA 4J71A 5LMBA 5TT7A 5A14A 1OZ1A 5LVPA 3ORXA 3PSBA 2OXYA 1GZOA 1ZY5A 4X2KA 5HZNA 1H01A 2ZM3A 2P2HA 2X8DA 4B8MA 2BKKA 4EZ3A 5DEYA 5L6PA 2DWBA 4GH2A 4RJ3A 4D4SA 4KABA 4RIYB 3WF6A 2C69A 3FZRA 2Z7RA 4BIBA 3HMPA 3R2YA 3R7GA 4ZOGA 4ZJJA 3UP2A 2J9MA 2PTKA 4RFYA 2J0KA 4F63A 4JVGA 3PRFA 4W9WA 1BI8A 5DRDA 4D2PA 4TYGA 4IWOA 4AA5A 3FLSA 3FI2A 1O6YA 3KCKA 3KRWA 3UMXA 1JSVA 4GIHA 5HVJA 1GZ8A 1REJA 3MJ1A 1ZYCA 4GG5A 3CBLA 2C3LA 2CKEA 3C4WA 4FI1A 5HKMA 4FTIA 4YJSA 3SC1A 3G6GA 4ANLA 1MRYA 3H9RA 5AMNA 4HCVA 3MI9A 3ODZX 4TKSA 3I0QA 4IVAA 1A48A 4DA5A 4O83A 2G15A 2YDJA 3QWJA 5IMXA 4D2VA 2SRCA 3ANRA 2R4BA 4JAIA 4BICA 1YXSA 5L8KA 5CAQA 1KOAA 1TQPA 4LFIA 3V6RA 5HTCA 5EQYA 4YNOA 3GENA 3VBWA 3W18A 4LUEA 1YDRE 3I60A 1WMKA 3R1NA 3RPSA 1PY5A 3F66A 4NU1A 1P4FA 5IH6A 4GKHA 4OT6A 4JR3A 1PXPA 2XJ2A 4RIXA 4EH9A 3BYSA 4E93A 3LVPA 5DH3A 4IWDA 3GU4A 4LOPA 2C6OA 3CTQA 5DA3A 2YM5A 1RW8A 2X7OA 4YJUA 4G16A 3N4TA 2ONLC 3O51A 2WB8A 1PMEA 2RFSA 3DZQA 3KA0A 4IEBA 5E91A 4U9AA 5I9UA 3HDNA 4E4XA 5KE0A 4JJRA 4RX5A 1SZMA 2OSCA 3QCYA 3R8MA 2HELA 3HVCA 4XG2A 3NW5A 3ZDIA 4QP9A 4N57A 5DI1A 5FLFA 3R6XA 1Q3WA 1M2QA 2QVSE 2ZM4A 1LUFA 4EHGA 4EQCA 3HGKA 5JGBA 5LXMA 1URWA 4OTPA 3VF8A 4BDFA 5CU0A 3BWJA 5ETIA 5HBJA 3UMWA 5J9YA 1DAWA 5EKOA 3EL7A 4AZSA 2O65A 4D55A 3F9NA 5HVYA 3BYMA 1OVEA 2LAVA 3UIXA 4MXAA 2WGJA 1OIRA 2P55A 4USDA 4UYAA 5BYZA 4DBNA 4K77A 1AGWA 2GU8A 3TZ8A 5TO8A 4MD8E 4RWJA 3BI6A 1GY3A 2R3GA 2UW6A 3CQWA 3VUIA 3HV6A 5CSWA 1JLUE 2GNGA 1WCCA 5EH0A 2YDIA 3E8DA 2QOKA 5CF5A 3CP9A 1BYGA 3UDBA 4Y73A 3UZTA 4QMNA 3F3ZA 4ZY4A 4BCMA 4E73A 4DEEA 3NUXA 4YZBA 4BDJA 1DS5A 3U51A 4AZFA 2R3PA 3ZCLA 3QD0A 3SAYA 4GUEA 3UNJA 3ZLWA 1ZMWA 2WIHA 5GZ9A 3E7VA 3V5TA 5JFVA 3LMHA 3FPMA 5F20A 2GNFA 2BFYA 2WQOA 5AUWA 1H28A 3QQGA 2GDOA 4HGTA 3LFAA 2OH0E 4FSTA 3DBDA 3L9MA 4H3PA 4J8MA 3VO3A 2PUIA 3DDQA 5JFXA 3CR0A 3UO4A 5KKRC 2BCJA 2CGWA 1ZYJA 1IEPA 4BHNA 2VO3A 5BVFA 1Y91A 4MAOA 1W82A 3EQDA 1RDQE 4GK2A 1Q99A 3NSZA 5GJFA 2I0YA 3PIYA 2W1IA 2C6LA 2WMSA 3ZEPA 4E6QA 2B9IA 5FGKA 3WZKA 4DGMA 3KXMA 5I0BA 3PPKA 2YACA 4EOIA 3GNIB 4EH3A 4RFZA 4E26A 5LOHA 4E4NA 2E2BA 2GQRA 1HCLA 2BTRA 3R22A 3AT3A 3AOXA 3NUSA 5CX9A 2UZWE 3FZPA 1OPJA 4JBVA 2XBJA 3QRUA 2WQBA 3A8WA 4AG8A 4U97A 3K5VA 3RHKA 2RFDA 1OKZA 4AWIA 4C58A 2R64A 3A2CA 4Y46A 4UMQA 3JY0A 5JQ8A 1OL6A 3HP2A 3JXWA 3PXYA 3BE2A 4MNEA 4XG7A 1H25A 2WU7A 5HNBA 2IZRA 5AR8A 4YZMA 3MESA 3EN4A 2VWXA 2YA9A 3GOPA 5F94A 3R9NA 3PE2A 2XB7A 4DFXE 2C0OA 5IEYA 3IECA 4ANBA 5M51A 1U54A 2PWLA 4BKZA 3KGAA 3CXWA 4BWKA 4O21A 4XLIA 5E8ZA 3HMOA 3UODA 3VUKA 2YCQA 3DGKA 4DINA 2O3PA 3HUBA 4Y8DA 3VRYA 2FSLX 4NH1A 4XMOA 4EHEA 3EZVA 4IQ6A 3F69A 3ZMMA 2C6EA 2WFYA 4FA2A 4H58A 3OHTA 4RC4A 3RJCA 2JD5A 3SG8A 2W05A 4LRKA 4IJPA 2C6IA 4YTCA 2QG5A 3QD2B 4C37A 4CFUA 5JN2A 4XBUA 4S31A 4TWOA 3O8UA
chains in the Genus database with same CATH superfamily
4YBKA 2GQSA 4BHZA 2QNJA 4FIJA 4UZDA 4BZDA 4AXCA 2GS2A 3DOGA 4R3RA 2A19B 4HPTE 5C8MA 3QQFA 1BMKA 4YMJA 5CXZA 4ACGA 2HZ0A 2CGUA 2BZIB 3I79A 1H4LA 4F9WA 2CSNA 4L46A 4XP2A 4YJOA 1XMLA 3FL4A 3CQUA 3THBA 1Q61A 3IQ7A 4QYGA 4WBOA 3T8OA 3WF7A 4Y72A 1FGIA 5EFQA 4O7YA 3DKGA 3FC2A 4LG4A 1H0WA 4G5PA 3G9LX 3FLNC 4CFXA 4J99A 4RVTA 2PE2A 4ZMFA 1IG1A 1E9HA 2WMBA 4N70A 2PHKA 4FV6A 4O2PA 2VTPA 3ZZWA 5DNRA 3ZYAA 1NW1A 4F9BA 1W98A 5EW9A 5JEBA 1PXOA 2BFXA 4AXFA 1CKJA 1W2DA 1PF8A 3Q4CA 4RX9A 1JSUA 2IEWA 2BDFA 4PMMA 3UYTA 2B9JA 3BGQA 4NTTA 4ALVA 4Y83A 3ZRKA 5M08A 3ZOSA 1MUOA 3F3TA 3IKAA 2EB2A 4Z7HA 4MKCA 3Q6UA 4N0SA 3HEGA 2Z7SA 4NM0A 5F4NA 2V7AA 1YXXA 2OJIA 4D1SA 4BWXA 2FVDA 4FT5A 5J9ZA 2ONLA 1PW2A 5C8KA 2W4JA 5EYMA 2BZKB 4OTDA 4IVCA 4ZJIA 5FXRA 2XARA 4G1WA 4MBLA 5CSHA 3JY9A 3QTIA 3COIA 4BDHA 2YJSA 4FV1A 5CQUA 3BCEA 3GU6A 3TUDA 3G90X 3CKXA 3UC3A 5HLPA 2G01A 4D5HA 2X81A 5J87A 5TF9A 3T9IA 3R1QA 2RFEA 5EM8A 3WZUA 4AZEA 4ZEGA 3EKKA 3Q9ZA 3V01A 3ID6C 3MN3A 4MWIA 5DT4A 3W0PA 2R3FA 1UU3A 3Q60A 3S1HA 4IB0A 4L45A 1DI9A 2FUMA 4DH5A 4M68A 5HCYA 5HVKA 1F3MC 3UO6A 1OL5A 2R3NA 4RIXB 4YHTA 1Q5KA 2C3IB 3H0ZA 4FSZA 4FSYA 2YISA 5E8VA 3W2QA 3UOLA 4EWQA 3I6UA 2XKFA 3GQIA 2CNUA 2XNOA 2W06A 3CKWA 3DJ5A 2CKOA 4ZAUA 3PJCA 3N4VA 3TIYA 2P2IA 3UOKA 1OBGA 5B2KA 3SW4A 3RWPA 3FI8A 3AMAA 1U5RA 4QMZA 5FEEA 4ZJVA 5EYDA 4H1MA 5HIDA 4PMTA 1XBBA 5HGIA 2XK3A 2WTWA 1V0PA 4AT3A 3PZHA 4KKHA 5BQ0A 3QZIA 1FINA 4V0GB 5T6KA 3D2IA 3CY2A 4HVHA 4O1OA 5A9UA 4I20A 2UZLA 3NIZA 4AUAA 2QHNA 4GG7A 4IWQA 4K0YA 4Q2AA 5BVDA 2WMWA 2CPKE 2WD1A 4TYHA 3VHKA 4TWNA 4APPA 5A46A 3DFAA 3NVKI 3D5WA 5JFSA 3LFCA 3ZFMA 4EBVA 4WSQA 4UX9A 2YLFA 2B9HA 4NCTC 2IO6A 4L43A 2YABA 3QTQA 4RT7A 5HBEA 2V7OA 4HVIA 3MB7A 4X2JA 3FC1X 4JS8A 2Z60A 3IGGA 2XK4A 5EOBA 1Q97A 1ZOHA 2WTJA 2PUUA 2VO0A 4QQ5A 5EYCA 3LXNA 3RPVA 3RVGA 3ULIA 4BDEA 4TWCA 1BL7A 4DHFA 3TNWA 3W8LA 4DGNA 4O6LA 3AKJA 2YAAA 4D28A 4C4EA 3ATTA 4UEUA 4KRCA 4ZLZA 3LCTA 2OIQA 4O4DA 4QDEA 3EFLA 3GI3A 5AV4A 3P0MA 2WKMA 3C5UA 5E1SA 4C4IA 3QU0A 3I1AA 5AP7A 3FQSA 4YJTA 4LL5A 1URCA 4ZTHA 4EOQA 1W0XC 2YCRA 4CEGA 4E6DA 4J95A 3TV6A 1YXUA 3OOGA 4RVKA 1K3AA 2C0TA 3KC3A 4QMPA 1PRYA 5CZIA 2Y4PA 4D2RA 1JAMA 1BX6A 1OUYA 1V0BA 3RI1A 4RIWB 3RCJA 4YZ9A 3R63A 1YI6A 1O6KA 3UTOA 4AAYA 3HX4A 3Q4UA 3SA0A 1YQJA 1YW2A 1H00A 4FKLA 5HG9A 1G8SA 2O63A 5H2UA 4ZTQA 1FGKA 3E8NA 4FKVA 4GYGA 4AE6A 4W9XA 3QXPA 4S33A 3A4PA 3RPYA 2IW9A 4YNEA 4CVAA 3OROA 3QQUA 2BIKB 2FGIA 4IC7A 3R1SA 4AS0A 4JAJA 4BBMA 3ZTXA 3ML1A 3OBJA 4FV7A 3BEGA 5HE3A 2IN6A 3DB6A 4UALA 3BPRA 3FMHA 4G3GA 4NFMA 4BN1A 4ZZNA 4JNWA 4O7WA 1G3NA 3DK3A 2OXXA 3RK5A 3VUTA 3FQHA 4A06A 3OXIA 2H6DA 5CWZA 4FEUA 4KSPA 2BRNA 3QCSA 1OIQA 2PZIA 2XKEA 3AC1A 3LOKA 5HESA 4EYJA 2B7AA 2W1DA 4CSVA 4DGGA 2Y8OA 2CNVA 3W0RA 3D7TA 3FLYA 5JK3A 4MNFA 4FIHA 1H1RA 4I22A 5AA8A 4QTAA 4HGLA 2UUEA 2JDRA 3C9WA 4FIEA 4ZTRA 3VVHA 1LP4A 3NUAA 3HZTA 2R3QA 4NKSA 1H1WA 4RA5A 4P5ZA 4ZIMA 3SG9A 3LQ8A 4FV4A 4RWKA 1OL1A 3F61A 3V8WA 5CZHA 4WBBB 4I4FA 4M69B 5J5SA 4YPSA 5AV1A 2XEYA 2VTNA 3EYGA 4RMZA 4YJNA 1NY3A 3A7IA 5EM7A 5M09A 4EZ7A 2Z02A 2JKMA 3TZ7A 4Y5HA 5TKDA 4A7CA 3EL8A 4QP6A 3UVQA 5FM2A 1YOJA 1XR1A 1FBNA 1Y6BA 4QOXA 4NM3A 3I7BA 2AQXA 3R0TA 4Y95A 4U8ZA 5CU6A 3CGFA 3RPOA 4H3BA 3ENMA 4RRVA 4I0RA 4KAOA 1BL6A 4JDKA 3ORLA 3P7AA 1LEZA 4X7QA 4L67A 4E5WA 2OJJA 4CRLA 1XHAA 3RZBA 2W1ZA 4CFMA 4ANNA 3VAPA 3TZ9A 5IDPA 4QP1A 1F5QA 4O7SA 4ITHA 5M4UA 2W1EA 3PE1A 3TYKA 1FPUA 1CKIA 2JBOA 5LVMA 4F9YA 3DNEA 3G0EA 3D5UA 4TYJA 3MH1A 2BUJA 4I5MA 1OKYA 4DEIA 4DYMA 3Q9WA 1YXTA 5IQAA 2WAJA 2WTIA 3IS5A 5D7VA 1KWPA 4PPAA 3I0OA 2X0OA 4J52A 4S2ZA 4F64A 2J2IB 1SYKA 3ZLXA 3MVJA 2CMWA 3NAYA 3FJQE 3PY3A 4D0WA 2XALA 5EI2A 4QQJA 2H9VA 4FUXA 3PJ1A 3FDNA 5J95A 2QOBA 2VWYA 3HMNA 3TV7A 3TWJA 4ANSA 3NFGB 4NCTA 4ZTLA 2XK6A 3ZM9A 1OGYA 2BAQA 3JYAA 3UG1A 5EQPA 1W7HA 1ZYSA 2FB8A 1NT2A 5AX9A 3W32A 4XV3A 5LVLA 3BU6A 2BAJA 4X0MA 3FMLA 5KZ0A 2W9FB 4OLIA 4NTSA 4CQEA 3OD6X 4QMTA 2FSTX 5IPJA 3U6HA 5JRSA 5J1VA 4MF1A 3PY0A 2A1AB 5J7BA 3OBGA 3S0OA 2EVAA 3NS9A 4KB8A 1ZAOA 4KBCA 4AE9A 2ITXA 3UGCA 2X39A 1GZKA 2Y9QA 3FMNA 4PDSA 4DGLC 4PY1A 3SDJA 3S3IA 4HGSA 4LGDA 3CD8A 5BX0A 3AT2A 4YZDA 3E63A 3O50A 4BTFA 3TKIA 4A9SA 2X2MA 3BE9A 2E9PA 5DT3A 2YM6A 2YFXA 3DBCA 5FRIA 5IA3A 4YZNA 3U9NA 4YJRA 3IG7A 5AUVA 1PXNA 2BPMA 3EN6A 1QPCA 4G3DA 4GK3A 2QODA 5HX8A 4K11A 5FQDC 4APCA 1GZNA 3EOCA 3G33A 1XH7A 4DEBA 1Z9XA 2P0CA 4HNIA 3BYUA 2NO3A 4TWPA 1YHWA 3NYOA 3AMYA 2JIVA 4KIPA 2VRXA 4O6EA 3UQFA 3OW3A 4D2TA 3TUBA 2CLQA 4FIFA 3GCSA 4FKGA 5FDXA 2C1BA 3ZFYA 3F2AA 3UDSA 2WPAA 5DWRA 2XM8A 3BLAA 2JAVA 2WHBA 4I24A 1QL6A 4EC8A 1XJDA 2J5FA 1SVGA 2JIIA 1CKPA 5L2IA 1P4OA 4C61A 4DDIA 3P79A 3ZDUA 4L44A 5E4HA 3PA5A 4HYHA 1FVTA 2IZUA 2JDOA 1ZY4A 2XP2A 3Q32A 2ITPA 3QYWA 2YIXA 3IW8A 4FVRA 5EKNA 5CEKA 1XQZA 2XCKA 1J3HA 2ITWA 3ORMA 1W84A 4AW2A 4EOOA 3VBXA 4JRNA 5DOSA 3PP0A 4C4GA 1UWHA 1BKXA 2X4ZA 4F6SA 3MTLA 3A7GA 3KQ7A 5C03A 4BCQA 2W99B 1O9UA 4O81A 4BF2A 3MYGA 3SV0A 2J6MA 2RG6A 1SNUA 2OZAB 3POZA 4RVMA 3OUNB 2JDSA 5G6VA 2G9XA 3VS5A 3FLZA 2Y4IB 3VS3A 2GSFA 4O82A 2QOCA 2XJ0A 4FKOA 4QMVA 4BC6A 3AGMA 4UWCA 3C51A 1ZZLA 3NYNA 2I7QA 4MX9A 4OAUC 3AC4A 2XS0A 2OXDA 4QQTA 1R0EA 3QUPA 4KIKB 3QUEA 3CJGA 2OZOA 3GT8A 4L68A 5C01A 3OG7A 4AZVA 4PMPA 5FDPA 3UOHA 3LLAA 4BWPA 2I1MA 2W1GA 1F0QA 1Q41A 4M15A 4I5HA 5FXQA 3WZJA 2RF9A 4AW5A 5IF1A 4B7TA 1OIUA 1KOBA 5JZNA 2YAKA 3NWWA 4GT5A 4FEVA 3E3PA 4M3QA 1U59A 4EEVA 4E4MA 4BI1A 2VWUA 5GIPE 4FV2A 5HHWA 4IAFA 4FSWA 5T68A 3PZEA 2UZUE 3AD4A 3GC9A 4FK6A 4QYEA 3UYSA 3RALA 2X1NA 2YIYA 3WF5A 3MVMA 1R1WA 4O0RA 2YITA 3LMGA 3GQLA 1WBNA 4DDGA 4FJVA 5EG3A 2BILB 3QZFA 3Q52A 4J8NA 1W83A 3KULA 4MWHA 4UMTA 4AOTA 2QOQA 2PPQA 4S32A 3A7HA 3EQFA 3I81A 4QEBA 3FL5A 4JRVA 5IUHA 4C34A 2WU6A 5CU4A 2VWWA 4FICA 4QMLA 4L6QA 3LIJA 3VUDA 3ZXZA 4XOYA 2OJFE 3IK3A 2XF0A 3OMVA 1BI7A 5D9HA 5IDNA 2BIYA 3FZOA 3NNVA 3EB0A 4XG3A 4QMOA 5I4NA 3MY0A 4KINA 4DF3A 2LGCA 3BL7A 2IVUA 2BZJA 3AGLA 3HV3A 4G34A 3DBQA 4AT5A 5HNIX 3BLHA 4RFMA 4XV9A 4JL9A 3V5WA 4FKRA 4PPBA 2XJ1A 2V62A 3II5A 5E8TA 3OCTA 4F4PA 3PXQA 4L3JA 1M52A 3U6IA 4O7NA 4BCJA 4NT4A 3BZ3A 3IO7A 2CN8A 2X8EA 3MFRA 2VTQA 3ZO2A 4DEHA 1YDSE 3NLBA 4FTTA 1H8FA 3ZO4A 4RC3A 1ZXEA 5M55A 2BRMA 2IW6A 1E1XA 1UU9A 3OCGA 5H8EA 4H3QA 2F7ZE 3EFJA 5HI2A 4RX8A 4GW8A 4HVSA 5AX3A 1PYXA 4QMQA 2ZV7A 3FUPA 1GNGA 2CLXA 2Z8CA 4IMYA 4C4FA 3R83A 2F9GA 2YCSA 3KMUA 1UU7A 2PE1A 4G6LA 3EQHA 4I5PA 4ID7A 4K1BA 4L7FA 4JOAA 4DCAA 3F2RA 2QOFA 2VV9A 1WBTA 1M2RA 3OS3A 3EN5A 3R1YA 5FEDA 1IA9A 4BI0A 1PMNA 4CKJA 2RG5A 2Y6OA 3U4UA 5KBQA 3OCSA 4M97A 1L8TA 4IX4A 4ZS0A 2W0JA 3OXZA 3D83A 1JVPP 3LM5A 1ST4A 3OT3A 2IJMA 3D7ZA 5AAEA 5HU3A 5ACBC 3HL7A 3PJ3A 4OTIA 3IPHA 2XNGA 2ZV2A 5A6NA 3NNUA 5K9IA 2WMAA 4RGJA 2Y6MA 4U40A 5ETFA 2JC6A 4ACHA 4CT2A 4RWIA 2VTIA 5K0XA 5JFWA 4ONAA 3FAAA 3EQIA 3RCDA 5M06A 3PG1A 2ITNA 3FKOA 2R3RA 2OIBA 3NPCA 4I92A 4DH7A 2HZ4A 4FKQA 5CSPA 4FNZA 1CSNA 4IJ9A 3EQPA 2I6LA 4CG9A 2HY0A 1UVRA 4EOLA 4W8DA 5I9VA 2QOLA 3G0FA 1JKTA 4NIFA 4WD5A 5CAPA 4JBOA 3QQKA 4TT7A 4YC6A 3MA3A 2YM7A 3WF8A 4RPVA 4FX3A 4R7BA 3ZEWA 3DKFA 3PSCA 1ERKA 2AYPA 2YM3A 5FBNC 3TL8A 3LLTA 3JS2A 1EH4A 3ZONA 1IRKA 2QOHA 2ZJWA 3BHYA 3CTJA 4G31A 2I0EA 4W4VA 5AP1A 3VW8A 4DEGA 4EUUA 4RC2A 3LXKA 4NJDA 5CALA 3DV3A 2YHVA 3H30A 5BNJA 4C3RA 2O64A 3GCQA 4UXQA 3CIKA 3R01A 4GMYA 4FT0A 4YSMA 3QC4A 3OUKA 4ALWA 2VZ6A 3RAWA 3R7OA 4PUZA 2IG7A 4F1MA 3TM0A 3FPQA 2WMXA 2A98A 2H96A 3K5UA 2VO7A 4YJPA 3VC4A 3VS2A 4HOKA 4HVDA 4JQEA 3KN5A 1T46A 5A6OA 3CEKA 2GTNA 3AQVA 5B2LA 4BTJA 3DTCA 3SHEA 4RLKA 3WE4A 5IQBA 3ZHPC 3F2NA 4QMWA 4D4YA 4LOOA 2GFSA 1PXKA 4LQMA 5ANDA 3A8XA 3KXGA 3QGWA 3JPVA 3HA8A 2GNLA 4BL1A 4CGAA 4BTKA 4XBRA 2JFLA 3KK9A 2J7TA 2XNNA 3FZSA 3PJ2A 3MSSA 3KF4A 4OGRA 5DR2A 1H1QA 2ETKA 4J96A 1Q4LA 3ORNA 4R1VA 3FKNA 3G51A 5FG8A 5FM3A 5KZIA 3ZRLA 3LFNA 3E3BX 4C4JA 1IAJA 3VS0A 5CSVA 2REIA 3MFUA 2OF2A 5JKGA 5M53A 2Y0AA 2R3LA 3IONA 3C0GA 3VS1A 4EOJA 5LWNA 4EK8A 4RWLA 4FSRA 3TKHA 4BI2A 3DXNA 4CLIA 5EHYA 4HYSA 4K9YA 3KXZA 3O7LD 3QHWA 2R3JA 4Q9ZA 2ZFYA 4FEXA 3Q4TA 5BVKA 1W2FA 2A4LA 3F5PA 3LHJA 4U43A 4XP3A 2QO2A 3QCQA 2W1HA 4QP7A 2BR1A 3MY5A 4FKIA 5CI7A 5CF4A 2J0IA 3QRJA 2R3OA 3V6SA 3SVVA 3JVRA 3PWDA 3FXZA 3BHTA 3E8CA 1XKKA 4J98A 4DFZE 3PRIA 1JKLA 1VYZA 2OI4X 3COHA 4O4FA 1JNKA 4AW1A 2XBAA 3VONA 1B39A 3F6XA 4ZZMA 3F5UA 3KB7A 3N51A 4I93A 1QMZA 3BLRA 2XRUA 4G6OA 3E8EA 4TN6A 2R3MA 4X3FC 3DLZA 4DHJA 4AZTA 3F3UA 2C6KA 3UNKA 3U9CA 3DCVA 3VBQA 5E8WA 4ZTSA 3MFTA 4U42A 3L9PA 3V5LA 5EM5A 1SVEA 4Z16A 1ZOEA 5KMLA 4IDTA 4FZFB 1SMHA 2ETMA 2PVYA 4MVFA 3TEIA 2BDJA 3FMDA 3HRCA 3VF9A 5LJJA 4HGEA 2GNHA 4IWPA 5DR9A 5BVOA 5CTPA 5K4JA 5CF6A 2JFMA 1YHVA 3BU5A 4R77A 1PYEA 1UNLA 3HKOA 4O0VA 4EH7A 3E64A 3GU5A 2VTHA 2BRBA 1XH4A 3OTUA 4LI5A 4CTBA 4EWHA 2AUHA 5A4QA 3Q04A 4YTIA 5ETCA 4M12A 4O7ZA 4FKTA 4UV0A 4TTHB 1MRVA 4G5JA 5M57A 2OJ9A 2RIOA 3MDYA 3QUDA 4FOBA 4I0TA 2UVXA 5AR4A 3M2WA 4FTMA 4S34A 2QO9A 3EQBA 5IZFA 1PMVA 4C02A 5AV3A 3LQ5A 4GSBA 2B9FA 2I0HA 3PXZA 4K33A 3MW1A 4XS2A 3RAHA 2CNQA 4D5KA 5GIOE 3PWYA 1WFCA 2VX0A 3MJ2A 3UVRA 4HPUE 5HO7A 3LAUA 4W4WA 4FGBA 5BPYA 3RK9A 3KMWA 4U81A 1Z57A 3VS6A 3VRZA 5KMKA 2J51A 4C59A 4C36A 4RZVA 3R7EA 3C4EA 5GHVA 1GJOA 2C5VA 4ORKA 2PMIA 4NJ3A 3QRTA 3UP7A 1UV5A 3OTVA 4K2RA 4KKEA 4P5QA 2YIRA 4BB4A 1LR4A 4JX3A 3BBWA 3LM0A 2NRUA 3L8XA 4YJQA 4ASDA 3TI1A 3L8VA 4KWPA 4MHAA 3AKKA 2B52A 3MIAA 4AQKA 3B8RA 2O8YA 4BYJA 3ET7A 5CXHA 3AC5A 4M66A 5IA2A 4FT9A 2HWOA 3UO5A 5ANKA 1M14A 5FD2A 4DFBA 3O71A 4AA0A 4BZNA 2WIPA 2YERA 3BQRA 3R28A 3PYYA 4NEUA 2JBPA 4RJ5A 4UN0C 4PPCA 3ROYA 2HIWA 4F70A 3ZLYA 2WOTA 4IE9A 4BCPA 2WMQA 4GEOA 3MB6A 1Q3DA 1J7IA 4YLLA 3SRVA 5JT2A 2X0GA 4FNYA 4YURA 4G3FA 3PLAE 1T45A 3N9XA 4OTFA 2QKRA 4B0GA 3TMOA 3ZUTA 3NRMA 3PVUA 4NW5A 4RG0A 3LFDA 3QTWA 4X2NA 2C0IA 4BJJA 2YCFA 4Q5HA 3IGOA 3SOAA 3TJDA 4NUSA 1S9IA 3W2PA 4BVUA 4D1XA 5AA9A 5IU2A 2CKQA 3QC9A 5C4LA 4F0FA 5L6WL 2WEIA 3QLFA 2Z7LA 4BDBA 2CCHA 4FUYA 5KO1A 2WQMA 1VR2A 4IM3A 1DM2A 4DBXA 1PJKA 3GCVA 2NRYA 5E8XA 5HLWA 1UNHA 5I9YA 4F1OA 4WRGA 3BEAA 3CGOA 4HNFA 4FKPA 4EHVA 1PKDA 4EK6A 3W1FA 4BRXA 1UKIA 3ORTA 5EDRA 2V5QA 3M11A 2WTCA 5J9LA 2UZVA 2OK1A 3EH9A 3NW6A 4XLVA 3W0SA 3F82A 3QTZA 1KE5A 4D1ZA 2AC5A 3B2TA 3C0IA 4M14A 4YJVA 4RLLA 4O2ZA 5AUZA 5L3AA 4WO5A 3W0OA 4C33A 3VS4A 4CXAA 4FZAB 2XYNA 4UXLA 3FMEA 3V5PA 3FQEA 4U6RA 5FP5A 2ITVA 3D9VA 4PL3A 1M7QA 2ZAZA 4I41A 4JDIA 4QPSA 1H08A 4ZTNA 4FYOA 2FSOX 2EXCX 2ZYBA 4WSYA 5CI6A 4N6YA 2HZIA 1Y8GA 5IQDA 5HE1A 4HCTA 4Q9SA 2PVNA 2CDZA 5AR7A 4FE2A 3MS9A 4CCUA 5C1QB 3WIKA 4M0ZA 2PVKA 4X2FA 4JBQA 3NEWA 5ETAA 3T9TA 2W4OA 2XNPA 5DMZA 1VZOA 2BRGA 5LQFA 4KS7A 3IDPA 3KRJA 4LOQA 2ZB1A 5ANEA 4EH2A 4E8AA 1S9JA 4FV8A 4EH5A 3QGYA 3F5XA 4LV8A 4PTGA 4X3FA 4A9YA 5KMOA 5M07A 2UZNA 1GIHA 2B4SB 4YU2A 1V0OA 1KE6A 3A4OX 2QD9A 4B9DA 3MPAA 3PPJA 5AP5A 3F7WA 4BDKA 4B4LA 3RK7A 3A60A 1BLXA 5B7VA 4C0TA 2HWPA 4WUNA 3ZZEA 2W5BA 5DFPA 3BLQA 3DB8A 3PIZA 1KSWA 1W2CA 4ACMA 2WMVA 4IX3A 4X2GA 2XH5A 2JDTA 5KBRA 1GIJA 4ANOA 3QA8A 4GU6A 4YHJA 3R8LA 1WBPA 3RAKA 2YZAA 3O7LB 4FG8A 2R3IA 5HO6A 1ZARA 4IM0A 5L8JA 1OITA 4O0SA 4M8TA 3QL8A 2VX3A 4CFFA 2PZ5A 3W33A 3OZ6A 2PVHA 5KMMA 3O23A 3BGPA 3GCPA 1H07A 3DJ7A 3C4ZA 4RBLA 4B8LA 4MXZA 4MNEB 5EDPA 1XMMA 4FV9A 5IH5A 3F3WA 4KRDA 5F95A 5DR6A 3UQGA 3ZS5A 4O0XA 4H36A 3RHXA 1OECA 1STCE 4V05A 3P86A 4QPAA 1OBDA 2BHEA 2QOOA 4LRMA 1U54B 2X2KA 3HRFA 4GS6A 2WTVA 2PZYA 2NYAA 4BIEA 1XWSA 2Q0NA 4O7VA 1K2PA 1WZYA 1JPAA 2HYYA 5HTBA 3ORZA 3D14A 3E7OA 5EW8A 4DLIA 5E90A 2R7BA 3RWQA 1IR3A 3OVVA 2FSMX 4PL4A 1XH6A 4WRSA 2W1FA 4MD9E 3ZM4A 1RJBA 4TYHB 5E8UA 2YN8A 3T3VA 4BDIA 1MQBA 4CLJA 5CEMA 5AFVA 4ZTMA 3DQWA 4A07A 4QTBA 4CYJA 2CGXA 4CT1A 4BCOA 3VBVA 4ASZA 5LCKA 1J1CA 2I0VA 4BIDA 1X8BA 4O86A 1G8KA 3VIDA 2HW7A 4ZSGA 5F9EA 2QQ7A 2QLQA 3TG1A 5JSMA 4C2WA 4FT3A 3MY1A 4CRSA 4I3ZA 2G1TA 3KFAA 5I9XA 4WKQA 3HA6A 4KA3A 1YOLA 2XK7A 5AAGA 3DA6A 3H9FA 4QO9A 4WUAA 3SX9A 4EONA 5C8NA 1YOMA 2HAKA 5HU9A 4FK3A 4GJ3A 2EXEA 4HZRA 3TNIA 3DTWA 4BZOA 4EOSA 2EWAA 4C3FA 4FOCA 1U46A 3M42A 4F08A 4IB1A 2J4ZA 2QHMA 2OKRA 3QBNA 2EB3A 2R0UA 2F2CB 4WT6A 4X6QC 3P5JC 4YZCA 3E93A 1OPKA 3GFEA 4FTQA 4L53A 5D11A 1ZLTA 5TOZA 4R7HA 3BHVA 5CAUA 1HCKA 2C5XA 3QKLA 2UZEA 4FMQA 3TKUA 5IQEA 4DFLA 2I40A 4ZSAA 4BDAA 3G15A 2ZMCA 5CSXA 3I4BA 4ERKA 3UIUA 2YJRA 3QTSA 5D12A 5F1ZA 2YDKA 5HORA 4W4XA 4GKIA 3R8PA 4AZWA 1WBSA 4P4CA 4DITA 5AUYA 3NNXA 3BIZA 4IB5A 3TXOA 4IZYA 4RIYA 3ELJA 4CZYB 4L42A 4FSQA 1OB3A 3R7VA 1Y6AA 3S4QA 4QYFA 4DT8A 3TT0A 3P7BA 4LMNA 3V3VA 3NUNA 2J90A 5CAOA 4CKRA 5LWMA 4FC0A 3O8TA 4NSTA 3NVMB 3CCNA 4QP8A 5CVFA 3WYYA 4EKLA 2GQGA 1H1PA 4YBJA 5CEOA 2J0LA 3PFQA 4O0WA 3R9DA 3CPBA 3ZSGA 3BRBA 3EIDA 3HUCA 2JITA 5CLPA 5AV0A 4CYIA 5FTQA 5ICPA 4AGWA 2C6MA 3QKKA 5J5TA 2Q83A 5AP6A 3QRKA 4I0SA 4I94A 3E92A 2GMXA 3T3UA 4DCEA 4E1ZA 5CANA 3I7CA 5JRQA 2IVVA 1OGUA 4GVAA 4R78A 3R9OA 2ITUA 2JEDA 3DKCA 3R8ZA 3ZC6A 3ZO3A 5AM6A 4G17A 3R71A 3EQRA 4AT4A 1YKRA 4HW7A 3BX5A 5A4EA 2F4JA 2VGPA 4DHZA 2V22A 2QC6A 3SQQA 2PVLA 2QU6A 5BVEA 2CKPA 2IWIA 4FV0A 3H4JA 4O0TA 4ASXA 3P5KA 4MUQA 2UVYA 4BYIA 2VTTA 1OIYA 4U3ZA 2WTKB 3SD0A 4AACA 4AOJA 4FNWA 1JWHA 4PL5A 4BR3A 4F7LA 2PVFA 2C68A 5KKRB 3ZC5A 1UA2A 3P23A 3PA3A 2E9NA 3DBFA 4TZRA 4FTRA 2XRWA 3SLSA 3WYXA 4AAAA 3VBTA 4EK5A 4QTDA 3QTUA 5KNJA 2R2PA 2RL5A 3QTXA 1FVVA 3RZFA 5FWKK 3DFCB 4XG8A 5IUIA 1QPJA 4V01A 4WHZA 5AUXA 2IZTA 3K2LA 4P90A 4U79A 3VJOA 1ZWSA 4R6VA 4DHIB 3LFFA 5IMEA 2XIKA 2PVRA 2WQEA 3VULA 3PPZA 4QMXA 4EQMA 4XG4A 2JLDA 5DEWA 2YEXA 5DBXA 2PSQA 3DDPA 4QNYA 1ZRZA 5DT0A 4CKIA 4BCHA 4HVGA 4WNMA 3UE4A 5EK7A 3A99A 2BDWA 4ZSJA 4ERWA 3U6JA 1NVRA 3VS7A 4EL9A 1ATPE 4BGGA 3BELA 4YSJA 4FBXA 3BWFA 4WNPA 2ZV8A 3BHHA 3CJFA 3VW6A 4AOIA 1OKWA 3KXHA 4HCUA 1XBAA 2W1CA 2X6DA 3C4CA 4G6NA