1YQJA

Crystal structure of p38 alpha in complex with a selective pyridazine inhibitor
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
356
structure length
356
Chain Sequence
HMLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of potent pyridazine inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 356
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1yqjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1yqjA01
4C57A 3QQKA 3C0GA 2ITPA 3QUEA 3RHKA 1R1WA 5D7VA 3O23A 5E1SA 4C4HA 4MQ1A 4ASZA 4EC8A 3EIDA 2XKCA 3ZEWA 3CQUA 4WNPA 3VW6A 5AR4A 2YLFA 4FTTA 4TPTA 2BRMA 1UU8A 4A4LA 4OAUC 3Q4CA 3UG2A 5I9ZA 4CLJA 3AT3A 4I24A 4UXQA 4KSPA 1UV5A 5GIOE 3A62A 2BZJA 2C6KA 3DNEA 5ANDA 2VTNA 5DMZA 4JDKA 4ERKA 5L6WL 2P0CA 4DF3A 3LLTA 4M69A 4XP0A 4KB8A 1SVHA 2BPMA 5ANKA 4IAFA 1YDSE 5AP7A 5BYLA 2YM6A 3ZFYA 4C3RA 3KGAA 5HIDA 4L8MA 1FPUA 3C9WA 5CQWA 3HECA 4M15A 3MESA 1QPEA 3DFCB 3NYXA 4YBKA 5HBJA 5GZ9A 3ALOA 4MXZA 3OXIA 3FC1X 3GCPA 3TG1A 3WE4A 4GU6A 4L45A 2RGPA 3BEGA 1RW8A 4U45A 3SRVA 2HY81 1Q4LA 5KHXA 4UYNA 4ZTRA 2OO8X 4ZZOA 3PJ3A 4QMWA 2QLUA 4HCUA 4OTHA 5E1EA 5IQAA 2PE2A 4GJ3A 2BIYA 4DITA 3LAUA 1P4OA 3OZ6A 4D2RA 1H1PA 5IQEA 2HZ4A 3D7TA 3PPZA 4MH7A 2J6MA 2XK9A 2FSMX 2UW4A 4BRXA 3UMWA 2FVDA 5EI6A 2J51A 5D7AA 5EG3A 3R7EA 4DG0E 2UZDA 3PA5A 1ZZLA 3VHEA 5IA1A 1PMVA 1Z57A 1YXVA 4KKGA 3JPVA 4RA4A 3LKMA 4JQ7A 5CSXA 3KVXA 1U5RA 3GU5A 3JS2A 3TTJA 5AA9A 3F2AA 2QKWB 3QAME 4ZK5A 4EOIA 5BYYA 2B55A 4RIXB 4J98A 3ERKA 3GB2A 5TF9A 4R78A 2XIZA 4FSUA 4RLKA 5BUEA 3GC7A 2F49A 4R8QA 5AV1A 2GNFA 3HV6A 4ANMA 3E88A 2YZLA 2XIYA 4N70A 3NLBA 5E8SA 5GJFA 1KE6A 2HZNA 3ORLA 3QQLA 4FVRA 4YLKA 2W4JA 5HE0A 4DCAA 5C01A 4FEXA 3KFAA 2WMXA 3I0QA 4JAIA 5HIBA 5IEXA 1DS5A 3FLQA 5BVFA 2JC6A 4U44A 1OPKA 4NIFA 5BPYA 3UIMA 4S34A 3FL5A 4NK9A 2WQMA 2C3LA 3MFUA 1J3HA 3QCYA 4E6QA 3R30A 3NUPA 4UBAA 3PG1A 1OUYA 4GK3A 5AAGA 4KBKA 5AP3A 4ZIMA 3R1YA 4ERWA 2PHKA 5L2WA 2YACA 3PXYA 3U51A 4E4NA 5AR3A 5KMKA 4FKJA 3R83A 4FKLA 1FMOE 3DLZA 4QP9A 3SKCA 3MVJA 3D5WA 3IW8A 3W2CA 4BIEA 3FHIA 4DT9A 3HRCA 3ORMA 3LIJA 5B2KA 2W7XA 1GIIA 1UU7A 4XH6A 2WMBA 4IDTA 2EUFB 3ZC5A 3ZDIA 5AP6A 5HX8A 1H1QA 2VTIA 4J8NA 4IX5A 3D2IA 2OIBA 3PSBA 4DEEA 5L2IA 1PYEA 3GU6A 1OIUA 1BI7A 4XBUA 3PZEA 4KUJA 4S32A 3BU6A 3EWHA 3UIXA 4FTOA 3V8WA 3UZRA 4LMUA 4TNBA 4I5HA 5CQUA 5L2SA 4AT4A 2VD5A 3M11A 2EB2A 1Q5KA 3AC2A 4FKPA 2JKOA 4IMYA 4PL3A 3OHTA 4PQNA 5LJJA 2EXMA 4GH2A 4HZSA 3FMHA 5C4LA 1Z9XA 4YJSA 1OMWA 2R7IA 3HP2A 4G3GA 2E9OA 3D9VA 4FYNA 3ZZEA 3K5VA 4O0TA 4D55A 5F95A 1OKWA 2C68A 4K18A 4RIYB 5EI8A 3V5WA 3V6SA 1FVRA 4TZRA 5HLWA 4IZYA 3NW7A 1U54A 5E90A 2OH0E 4C34A 1DAWA 3OS3A 5E7RA 2XVDA 3BX5A 3VS4A 3FL4A 1NXKA 4MHAA 3VWAA 1GZ8A 4MYGA 4QMPA 5I9XA 3UYSA 5A6NA 3I1AA 3EQGA 3QA0A 4FEUA 3UNKA 1T45A 4RVMA 4KAOA 4ACCA 5LWMA 2H9VA 2XJ2A 4I4FA 5CASA 4TYJA 2C1AA 4E4XA 3I6UA 3QCSA 1XH4A 1NVSA 3CQEA 4OUCA 3ZUVA 4ANLA 2AYPA 3BU3A 5BNJA 5G6VA 2OKRA 4TT7A 3OG7A 4O7RA 5IQBA 4TWCA 5I9WA 2WELA 4XJ0A 4FKRA 5CF6A 1JVPP 1BLXA 1KV1A 1S9IA 2GNLA 2UZTA 5AMNA 4RC2A 4RWKA 5E8YA 4XLVA 4AN2A 3V5LA 3MPTA 3P0MA 4Y5HA 3PLSA 2E9PA 3WZJA 1PXPA 4TXCA 3JY9A 4MK0A 4P90A 3RHXA 2YITA 5M44A 2YCRA 2OG8A 4ZTLA 1ZARA 2QHMA 4NJDA 4Z7GA 4ZTMA 1YQJA 3ZLSA 2IG7A 5F1ZA 4EK6A 4CCUA 3AG9A 1PXLA 5GJDA 3O51A 4PF4A 4NM5A 4U5JA 1Q41A 5CTPA 4EJ7A 3FXZA 2X6EA 1PMEA 4M84A 2PMLX 3JR1A 3AT4A 4N0SA 3E3PA 4I0SA 1JQHA 3QD0A 1KE9A 1KE7A 2PY3A 3OWPA 4WOVA 4ZZNA 3HRBA 2P33A 4NM0A 4BY9E 3CTHA 5JMSA 3NNVA 3VRYA 2I1MA 1JLUE 1M7NA 1RQQA 1H01A 3JXWA 4M14A 3UPZA 3V3VA 3UQGA 5KMLA 4R6VA 2OWBA 3PVWA 4FG7A 4ITIA 3SXSA 2YIRA 2XRUA 4G6LA 3ET7A 4FSMA 3CIKA 2VTMA 3Q60A 4AZTA 1H27A 1W82A 3KN6A 4JVGA 3BELA 4J71A 2C30A 3ZYAA 4E6DA 3CY2A 4IFCA 3VIDA 3R2YA 4PRJA 3E87A 4BCGA 5JN2A 3C50A 4RFMA 3QKMA 4DEBA 4PPCA 2JBOA 2GSFA 3MYGA 4BCQA 3TKIA 1WAKA 2GPHA 3DB8A 2FB8A 4EUUA 4KIOA 4EYMA 3FDNA 4FKQA 4HOKA 2YIYA 3AD4A 4FGBA 4WG5A 4FT7A 4PTEA 3AC5A 5J5SA 1LR4A 1PJKA 5CI7A 4L3JA 4LV8A 1OKYA 2G15A 3CTJA 4F64A 1JKKA 5EI2A 2OFUA 4C4GA 4ITJA 2A1AB 3FI3A 2RKUA 4QP4A 4UMRA 5E8WA 1UWHA 2JDOA 4JBPA 2WMTA 3PSDA 4XBRA 5AV2A 4A4OA 4LRJA 2CKPA 3NVKI 3GOPA 4DAWA 3Q32A 3ODZX 3QRIA 1REJA 3PDTA 5DT4A 5HVJA 5L2TA 3UYTA 1MRUA 3LQ5A 3NUAA 4GKHA 5C27A 2WQOA 2QOKA 4IC8A 1X8BA 2PZPA 3P9JA 2W1HA 3BGQA 4E6CA 2XK8A 4GVJA 5CEOA 5KMJA 4K9YA 5TE0A 4EEVA 4F9AA 4G34A 3RAIA 1OKVA 4BWKA 1OL2A 3GXLA 3I81A 3C4EA 3NAXA 4CMUA 5BQ0A 3RWPA 2UZVA 3PZHA 4RIOA 4U97A 4PTCA 2ZYBA 2WB8A 5DT3A 3RZBA 3TZMA 4BTKA 4F6UA 1RJBA 3NR9A 3GGFA 3LCDA 5JRSA 1NVRA 2YIWA 3LM0A 4NUSA 4GUBA 2GNIA 2E9NA 4EOOA 4ZSJA 4ARKA 4RVTA 2DS1A 2F7XE 4AG8A 2WMAA 2HWOA 4QMLA 5EM8A 1W8CA 2BZIB 5E8ZA 2EWAA 5CSWA 4YPDA 3C0IA 3OMVA 4S31A 5ANGA 4K6ZA 4DTBA 3F3TA 2VO3A 3EQBA 4PPBA 3WBLA 4G3FA 3EL8A 2CSNA 3FZ1A 3E62A 4L42A 3UDBA 2R9SA 4KIPA 1BL7A 4DGMA 3F88A 4H39A 2DWBA 3KULA 4CVAA 2VTSA 4FV3A 4M7IA 4AW5A 4DEGA 2RFDA 3CKWA 4BTMA 3ORZA 4NJ3A 5IQFA 3G0EA 2OI4X 5FTGA 1KOBA 2V7OA 2A27A 3BYMA 5FBOA 4DFBA 4GT3A 3UPXA 3BYUA 3W55A 1Q62A 4M97A 4NH1A 3CJGA 3FMJA 3OT3A 3PLAE 2ZB1A 3TKHA 3PRFA 2XM9A 5M56A 4O22A 5B2LA 3OCBA 3W18A 4J53A 2VV9A 5A4TA 4AGDA 4MQ2A 4O0XA 3M2WA 1V0PA 1PXKA 3BWFA 2XBJA 2FSOX 4TYIA 2OJIA 3QHRA 3RKBA 5K5NA 5C8KA 4NW5A 4CCBA 2JAMA 2PZIA 3E5AA 3NNWA 4Y83A 3G33A 2VO0A 4GUEA 5HCYA 5HESA 3E7VA 3OY3A 3BWJA 4EK8A 3GOKA 4Z16A 2UVZA 4NEUA 4QP8A 2XIRA 4LL0A 4IHPA 5I9VA 4D4SA 1DI9A 5EK7A 4BCNA 1MP8A 4CZYB 4FIFA 2UZLA 4GMYA 4AA4A 4DT8A 3EHAA 3ORKA 4BYJA 3D94A 2RFNA 4O0RA 4PY1A 3QZHA 3T9IA 1M17A 3LCKA 5FM2A 3D83A 4XUFA 3UG1A 3R7OA 4RX7A 1DM2A 3BRBA 4ZXTA 4TW9A 5DRDA 2G2IA 4UALA 5H8BA 3AMBA 3JVRA 4K2RA 3GENA 3LJ1A 5F4NA 5BX0A 5CAPA 4XV1A 2ZAZA 4USFA 4FKSA 3UTOA 4Z55A 3D7ZA 5AWMA 5HU3A 4X3JA 3RI1A 4C0TA 4R7IA 5L4QA 4USDA 3QTIA 4AF3A 4E3CA 5KKRC 3PUPA 5HE2A 3ZDUA 2E2BA 4C4JA 5M53A 4OTFA 4YHFA 3F7ZA 1B38A 4CFUA 3I5NA 3Q9ZA 4ACDA 5KUPA 2GFCA 2RL5A 3MSSA 4ENXA 5M09A 4ZS0A 4FC0A 3BYOA 3EMGA 3PJ8A 3RJCA 4CZUA 2OF2A 4C02A 4AACA 3UQCA 4PP9A 4O86A 1E1XA 2UVYA 3GFEA 4Q9ZA 3CP9A 3DFAA 4I92A 1WBOA 3MJ2A 1WMKA 2ZV7A 5EQEA 1PXJA 4CG9A 1BUHA 3BIZA 3QALE 5AP4A 3R7GA 4KSQA 2CGXA 2A19B 3DBQA 3OT8A 4BTJA 3FLWA 3ZRMA 2VU3A 3DBFA 2PVMA 3U87A 4JT3A 5IQDA 2X2KA 3QZFA 2VO6A 3DKGA 4RIWB 3R9NA 5J5TA 3S95A 4XEYA 3F3WA 4DINA 4PDPA 4C4FA 5KKRB 4O83A 3FUPA 1YVJA 3A60A 3VUDA 3FYJX 1OKZA 1W83A 3DTCA 4K0YA 5F94A 3DBCA 4N57A 3E8NA 4PX6A 3HA6A 4ZLOA 2YCQA 4XRJA 4FV6A 3QZGA 4R5SA 2PL0A 1KV2A 3OFMA 1QCFA 4CG8A 1JSUA 4X2GA 4ENYA 5FTQA 5BVKA 2NPQA 1YHVA 1YXSA 4FTJA 5EM7A 3SLSA 3DDPA 1KE5A 3WYXA 5M4FA 2WIPA 1VYWA 4E4LA 2B4SB 4TKSA 4YC3A 4WO5A 3BBWA 3I7CA 4EHVA 3MFTA 4W4YA 4CQGA 4V0GA 4FI1A 3EFWA 3EQCA 2WNTA 3G51A 4YJNA 4M69B 4CGAA 5IQGA 5FP6A 4I5PA 3TDWA 1I09A 4LRKA 3OBJA 4NTTA 5C8NA 2Z7LA 4YGAA 5FXQA 5HLPA 5AP1A 1ZYLA 3AMYA 5HNBA 3W10A 3EFLA 3IW4A 3ANQA 4FTRA 4FUYA 4FZAB 5EDQA 3LLAA 3VQUA 3KRJA 3DXQA 1APME 3FPQA 5CVGA 3R8ZA 1VYZA 1SVEA 2ZV9A 1P14A 3SRVB 3CC6A 4NYEA 2PSQA 3L9NA 2PMOX 1R78A 4YJTA 3MA6A 3O8TA 4FL3A 3GUBA 3WZUA 3TTIA 3G6HA 2C6LA 2BDWA 4HGLA 1QL6A 1XH7A 3PWDA 5DT0A 4QP1A 5HNGA 4L01A 1ZOGA 2W1ZA 3PY0A 2NP8A 2B9FA 4PDOA 4KD1A 2W0JA 5ETIA 2XZSA 3NSZA 1SVGA 3VC4A 5JZJA 1V0BA 4FUXA 4A9RA 4L67A 3PYYA 4QQCA 4YZMA 3Q6UA 4ZMFA 3NWWA 1IR3A 1UKHA 4LI5A 4D4YA 3CSVA 2YFXA 5M4IA 3P1AA 4X2JA 3N4VA 4Y85A 2RFSA 5LMKA 1KE8A 3MBLA 1ZWSA 4FIEA 4II5A 3QU0A 3AC8A 3F66A 2R3RA 4OTQA 4TYHA 4FKWA 4KINA 3RK7A 2A0CX 3ZO1A 4BDHA 4QTEA 3SW7A 2QU6A 3GC8A 3PPJA 3RAHA 3RNYA 2QURA 3HGKA 5DH3A 5IA2A 3WZDA 2J7TA 5IUHA 3ODYX 3H4JA 5HBEA 3IGGA 5BVWA 4D9TA 3TV7A 2ZV2A 4FTAA 4NFNA 4NM7A 1HCKA 2BIKB 4A07A 4BYIA 2H96A 4D9UA 2XEYA 4XG3A 3MH3A 3MI9A 2J50A 5KMOA 5CY3A 3VN9A 3COKA 2WO6A 4O7TA 2R3OA 5DWRA 3A2CA 3QUDA 2WTJA 4XV3A 5EHLA 2OGVA 4QP2A 2O0UA 3HRFA 3CBLA 3R71A 1YKRA 3F5GA 2BDFA 4DBNA 4EHGA 3RGFA 4AZSA 4AE6A 4F7SA 3VVHA 4C4IA 4FMQA 2FUMA 2LGCA 2CKOA 4ALVA 4FV8A 3ZSGA 4OTPA 2W9ZB 3HLLA 1MQ4A 3JY0A 3RPSA 3G0FA 5IEVA 1BKXA 3BV3A 3LFBA 3R8VA 2F7EE 3LCSA 3LXPA 4BCPA 4JQ8A 2IO6A 2OXDA 3DQWA 4JG6A 5I9YA 1CKPA 4IFGA 3LFSA 4WNOA 5J7BA 2P2IA 1H1WA 3KXHA 4BKZA 4D0XA 5HI2A 3ORXA 3RWQA 4O91A 3IG7A 1BX6A 4HGSA 3RPOA 3UIUA 4BC6A 4R1YA 4YHJA 4F1OA 2FA2A 3MY5A 4F0GA 4UN0C 5J9LA 4LL5A 2W06A 3ZRKA 3QYZA 4ASXA 3LFQA 4BBFA 5HNIX 5FBNC 2ITXA 5C26A 3UVPA 3DJ5A 3CD8A 3C7QA 4ZY4A 4IJ9A 5D11A 2VO7A 3ZM4A 3OEFX 3PG3A 4YJVA 4DEIA 4EK4A 5AR2A 4FT3A 2WMWA 3MN3A 5IMXA 3ZFXA 1PRYA 2B54A 3GCQA 4YU2A 5I0BA 4E5BA 5KCVA 4EI4A 4UB7A 3G6GA 3ANRA 4EOKA 1RE8A 1HOWA 2GNGA 2OBJA 2WTIA 4F7JA 5ANJA 3WF5A 3UGCA 1SZMA 4I5CA 3VUGA 3FMLA 3QBNA 3R22A 4O96A 4FV2A 3VRZA 2VTTA 5CU4A 4ZY5A 4YJPA 4O82A 4YC8A 4LOQA 2OZOA 1U54B 5I4NA 5EYMA 1ZYJA 2R3FA 3PFQA 1I44A 1U4DA 2YIQA 3PIYA 4FZFB 4CTCA 2HW7A 3LHJA 3PVGA 4C3FA 3ATSA 4N6YA 4D4RA 5JGAA 2YM8A 4K1BA 4V05A 1MRVA 1LP4A 3R0TA 3R8MA 3RBWA 1STCE 4EL9A 4PPAA 4QMUA 2VAGA 3MVHA 1LUFA 4ASEA 3Q4TA 3QQJA 4L52A 4U43A 3QGYA 4Q9SA 3O71A 3R8LA 1G8AA 5DRBA 3QQHA 4MWHA 5IQHA 4QYFA 3R1SA 3ZH8A 4XG7A 4XHKB 3ACKA 5IUGA 3NGAA 4Z3VA 1AD5A 2WTWA 3VQHA 1XO2B 4TY1A 3WF6A 3NVMB 2WMRA 3DJ6A 3MW1A 2VWBA 3QWJA 1YWVA 1JKTA 5IU2A 2A2AA 4IAIA 2CHLA 4IH8A 4JR7A 4KKHA 3A7FA 4RBLA 3ITZA 4EQUA 4EHEA 3QTUA 3FZPA 1FOTA 4DFNA 4D58A 2J2IB 4TN6A 5CEKA 3SVVA 3FY0A 1WVYA 2PMIA 3IOKA 5ANIA 4NFMA 2Z7SA 3FYKX 4O7LA 3DDQA 4HCTA 3UC4A 1H0VA 4OT6A 3OWKA 3A7JA 4FL1A 4QP3A 1ZRZA 3IONA 5FRIA 3VBQA 5JRQA 2J90A 3UO4A 4W4XA 5H3QA 4QMVA 3OW3A 2PE1A 3FSFA 4HJOA 4FV9A 2V22A 3TNIA 3DB6A 3KN5A 2BKKA 2C6IA 3P08A 3CGOA 3H9OA 1XH8A 4DCEA 5HQ0A 3DZOA 4YZDA 2OIDA 4BI1A 1ZXEA 2BFYA 3NZ0A 4QOXA 2QR8A 2UZWE 4E20A 3GC9A 3LM5A 4PMMA 2PU8A 4FGRA 2F9GA 3NCGA 4D4VA 4HGEA 5CU0A 3MH0A 5JEBA 1IRKA 3E63A 4GFOA 3EQPA 3DA6A 4L68A 5AA8A 4O7SA 3MV5A 4I0TA 5DIAA 4AE9A 3LFAA 4QYEA 2FSLX 1M14A 3DK6A 5FEQA 4RT7A 5LQFA 3GP0A 3RCDA 3OTVA 2IVVA 3FQEA 4CFWA 5HG5A 3F61A 4U6RA 4APPA 4IWOA 3F5XA 3Q2MA 3ID6C 2OH4A 5C03A 4AFEA 3O0GA 4MVFA 3LFDA 3RK9A 3CEKA 1XH5A 3TNPC 3IKAA 3NIEA 4C61A 4DH1A 3UODA 2ONLC 3R7UA 2C6TA 2QO9A 5J1VA 2JKKA 1GJOA 5D12A 3VHKA 5K5XA 1FVTA 5IH4A 4MXAA 4JJRA 3H9FA 4X2FA 4JG7A 5D10A 4CT2A 2PVFA 1UA2A 3R04A 2C5XA 5EKOA 3ZLYA 5J1WA 5HCXA 2X8IA 1FGIA 4FSYA 4ZSLA 3VW8A 3Q5IA 4I94A 4G6NA 3IDPA 1U59A 3K3JA 3ZO2A 3H9RA 4L53A 1AGWA 1DI8A 2XP2A 2UZEA 4IVDA 5D1JA 5C1QB 2F57A 2C6OA 3QWKA 4WKQA 5C9CA 3RZFA 1E1VA 5AM6A 3T3VA 4BCIA 3PXFA 4RA5A 2ETRA 4E6AA 5IISA 3OWLA 2ACXA 2QHNA 2F2CB 3AC3A 1Y6BA 3AOXA 4S33A 4E73A 4DA5A 2JD5A 2Y8OA 4L6QA 1H26A 1VR2A 1Y8YA 3NYNA 5HE3A 3VS2A 4FKVA 4AT3A 1H28A 2ITTA 4XX9A 3EQRA 2JIVA 4O7VA 4RGJA 3QFVA 1XR1A 3TV4A 2PVHA 3SOAA 3NS9A 4YPSA 2X2LA 3PY1A 3Q53A 3IW6A 5BUJA 4BGHA 5JQ5A 4UX9A 4BF2A 2BROA 3QYWA 1J7UA 2XNNA 3KULB 4WUAA 4JG8A 4B7TA 4QNYA 4D28A 2B52A 1KOAA 2ZOQA 3BU5A 3CR0A 5KO1A 4IX4A 4QO9A 5CT7A 2ZV8A 3DT1A 3VAPA 4AXAA 3VS5A 3GNIB 4XG6A 3VBYA 4EBVA 2JDRA 4BDIA 5L8KA 2ITUA 3HMNA 4FV1A 5HICA 2Y7JA 4JX3A 5CEQA 4AQCA 1ND4A 3E8CA 4YJOA 1ZY4A 5KZIA 2R3QA 2XJ1A 2J9MA 3D5XA 4MXOA 4BGQA 2BCJA 2HENA 3KMWA 3FKNA 4CZTA 2PE0A 3LQ8A 5TOZA 4DLIA 5T3QA 1KUTA 4BDBA 3FZRA 2PVRA 3HL7A 3KF7A 1YOMA 2XCKA 4PDSA 5L6PA 5C8MA 3BZ3A 5HG9A 2BAQA 4BWPA 1F3MC 2PVLA 4OT5A 4BR3A 2PULA 3DKFA 4ANNA 4YLJA 3UO5A 3PJ2A 4J99A 2BRGA 5FP5A 3SHEA 4XYFA 1XBBA 1Z5MA 4WG3A 3ZO4A 3ZUUA 2VTPA 4OTDA 2XNMA 1Q99A 4I23A 1PXOA 4MWIA 4RJ4A 4PTGA 5HOAA 3HV4A 4IE9A 4I4EA 3F2RA 2HZIA 2R0IA 3EQIA 3FZTA 5HBHA 3WILA 4M66A 4QMZA 3LFCA 2A4LA 5ITAA 5JGBA 2JDVA 1NY3A 5GHVA 5A9UA 4QP6A 5L3AA 2C4GA 4BKYA 1XH9A 4C8BA 3DV3A 2PUIA 2QR7A 4X3FA 2QU5A 5CNNA 4ZEGA 1WBVA 3HYHA 3MIAA 5BVOA 3SA0A 2XYUA 4MNFA 2UZNA 4KKEA 4IX6A 2PUUA 3QLFA 1T46A 3O17A 1OZ1A 2C0TA 1GZOA 4FZDB 1K2PA 5M4CA 2JKQA 3OXTA 4H58A 4QTAA 5A3XA 5K0XA 2RG5A 3H3CA 2SRCA 4FTQA 3ELJA 2ZMDA 5IA3A 2W5AA 4PL4A 4FIGA 3MY0A 2UW8A 3F3VA 4O0SA 3BHHA 5HG8A 4X7QA 3G15A 2CMWA 4E5AX 4Z7HA 1GZKA 4YJUA 5D9HA 2P3GX 3DAEA 3F82A 2BRNA 4C59A 3KREA 4GKIA 4C37A 4AW0A 2J0IA 4GG7A 4JBVA 2QOHA 4FG8A 2BZKB 5IG1A 5KHWA 2EU9A 4EH9A 4UMTA 4DG2E 4BDGA 4ZSAA 2UW6A 4YZBA 4GU9A 1CDKA 4AOIA 2YHVA 2XNEA 4DH7A 4QRCA 1ZAOA 1ZZ2A 3UZTA 3R9RA 1JNKA 4ORKA 2Z2WA 3FY2A 4LUEA 1ZMVA 5LCKA 4AN9A 2VWZA 2YM3A 4KS7A 2GDOA 1YOJA 5E92A 4C33A 5HVKA 1NA7A 4C2VA 3OCTA 1L8TA 4A9TA 4KNBA 1Y8GA 1OIQA 2HZ0A 2R4BA 3BI6A 3D5VA 5HZNA 4ZLYA 4YLLA 3W2OA 4RSSA 5T68A 2WU6A 5FEDA 3NDMA 4YZ9A 3PPKA 1ZOHA 3BHTA 3GU7A 4RX5A 5CEPA 1ZYDA 3EKKA 4F6SA 5FXSA 2IZSA 4RWJA 4P7EA 4JDHA 4J7BA 2R7BA 5DN3A 4D2SA 3HZTA 5I9UA 3EL7A 3U54A 2PVNA 3W16A 4R7BA 3KB7A 4F6WA 3O8UA 3POZA 4V0GB 2WTDA 4ACHA 2RSVA 2VTLA 5CF4A 3D0EA 4O6LA 3DK3A 3BQRA 3ZO3A 3KF4A 1ZYCA 5LMKC 3HMOA 5ICPA 4ACGA 2WTCA 1R0PA 3U55A 2OFVA 3QD2B 3K2LA 5IA5A 1Y57A 4G3EA 3E8EA 4AU8A 3EQFA 4FTKA 3KY2A 4D5KA 3VS6A 4O0UA 4ZLZA 2HXLA 3QHWA 5I3RA 4JL9A 4WG4A 3RCJA 3TACA 4X0MA 3DTWA 2YZAA 3QKKA 2E9VA 2CLXA 4RJ8A 4X6RA 4PMPA 2GHMA 3GT8A 3HAVA 5EM5A 2G2FA 1Q24A 5HX6A 3UVRA 2BTSA 3KVWA 4FSWA 5H9BA 3PE2A 5TKDA 1Q61A 4JX7A 2OK1A 1EH4A 4GK4A 4U42A 4M68A 1ZMUA 5HE1A 4CXAA 3L1SA 2HY0A 4YJQA 4OAVB 1M2PA 1YDRE 1WBNA 3KCFA 4QMNA 4L7FA 3RAKA 4RC3A 5CF5A 4USEA 2OF4A 4P5ZA 3ORNA 2PZRA 4QQTA 2P2HA 3TT0A 4BL1A 3IOPA 3P4KA 4IAZA 4IADA 4ONAA 5L2QA 4TYHB 4KS8A 1PXMA 3LE6A 3P5KA 5HG7A 4R3PA 3QX2A 3TV6A 1W7HA 2Z7RA 3QCQA 4FYOA 4DGOA 4FL2A 3S2PA 5HGIA 2B9HA 2YM4A 2LAVA 5HD7A 4AZFA 4PDYA 5D41A 2PPQA 4R77A 4IDVA 4EOQA 3TIZA 3C4XA 5ETAA 1P5EA 1XKKA 3IW5A 4HW7A 5EM6A 1LEZA 1Q8TA 2VWVA 5E91A 4ZTQA 4TWPA 5KMIA 1CTPE 4FV0A 4FNYA 5IH6A 5ACBC 4O0VA 4XV9A 3EFJA 4ZSEA 3RALA 4MX9A 2BTRA 4EH2A 2YN8A 1QMZA 4TRLA 2WQNA 5JFWA 2X2MA 3GI3A 3EB0A 4ZJJA 3A7IA 2OXYA 2QD9A 2WEVA 2YLEA 3MH2A 2QG5A 3FI8A 3DZQA 4JDJA 2R3LA 5FQDC 3SD0A 4ANQA 4ZAUA 2CCHA 5AR7A 2CCIA 3A8XA 4JXFA 5CSVA 3UJGA 5J8IA 2Z8CA 5AIKA 4HYSA 5FD2A 4C4EA 5JK3A 1OVEA 3IS5A 4J96A 5AP2A 4AW2A 4FZ7A 2O2UA 4Y73A 3S1HA 1MUOA 4YO4A 2YWVA 3BQCA 4ZTHA 1XJDA 1YHSA 3BHVA 4HNIA 2O3PA 4FEVA 5DE2A 2OZAA 4XS2A 5EH0A 4A9UA 5M08A 5CVFA 5A4EA 3NYOA 3QRJA 2PVYA 4IVBA 4J1RA 4XCUA 4G9CA 3FQSA 2R3IA 1H1RA 2VZ6A 4XP3A 3CGFA 4DGNA 2EXCX 4CFFA 5DOSA 4IVCA 4GIIA 5AAEA 3U9NA 1FQ1B 3EN7A 4WA9A 4DFYA 3FBVA 3FLSA 2OJFE 2GCDA 5CWZA 3DPKA 4YTIA 4EBWA 2Y4PA 1ZOEA 3FXWA 3PE1A 4XRLA 3PVUA 2C1BA 1Q8ZA 3MVMA 4CKIA 5CALA 3UMXA 4TYEA 2NRUA 3FMEA 3RINA 2W1DA 3KRRA 1WBWA 3QLGA 4IB1A 3Q2JA 4OTIA 2ZDTA 3FLYA 4C7TA 4QMYA 3COHA 3ZMMA 3H30A 3OEZA 2PZ5A 4D1SA 4QPAA 4FV7A 4CEGA 3SV0A 2W5BA 4DFLA 5FDPA 1J7LA 1YW2A 2X1NA 3U6JA 3PXKA 4HVSA 4IQ6A 1O6LA 2HWPA 4H3PA 4G17A 5AEPA 2UUEA 1LEWA 1WBTA 4CFXA 4P5QA 4W8DA 2VTJA 4FTUA 2IVSA 4O1PA 3R8PA 2YAAA 4BCJA 4JS8A 3ZLXA 4CKRA 2XK4A 1HCLA 3GU8A 4S2ZA 3FMKA 5IF1A 3CJFA 2R3MA 5HCZA 4EZ5A 4IW0A 1H25A 4RFZA 4GVAA 4FEQA 5JGDA 2VTQA 2R3JA 3DNDA 4WT6A 4CRSA 2YABA 4UWYA 4CQEA 3HMIA 2IW6A 3PVBA 5HO6A 4GL9A 4OBPA 4KBCA 3D15A 4G3CA 3QXPA 2J0LA 4CKJA 2NRYA 4I20A 3R02A 4C36A 2JEDA 3O96A 2J0JA 1L3RE 3LQ3A 4AAAA 3IDCA 2YM5A 4L44A 2X81A 3HX4A 5GZ8A 4NL0A 5E8UA 3QA8A 2PTKA 4E93A 2KULA 4FIIA 4JOAA 5CYIA 3DS6A 2UW3A 1O6KA 2XF0A 3PRIA 3QTXA 3N4UA 4O7NA 2BUJA 3B2TA 4FTLA 2JFMA 4U9AA 4YP8A 5GINE 4W4VA 4WBOA 3SAYA 4HVIA 4LGDA 4WNMA 2OLCA 2CKQA 4QNAA 2R0UA 4HPUE 3MIYA 3F3UA 5LVOA 3QTQA 1Q3WA 4ZJIA 3CS9A 4M13A 2X4FA 1UNHA 4B8LA 1OIRA 4GIHA 4ITHA 4W8EA 5CX9A 2JBPA 2YISA 3F7WA 1B6CB 2CLQA 4X21A 2BFXA 1J91A 3REPA 3RPRA 3PY3A 2PZYA 4X2KA 2C6MA 3O8PA 2YDKA 2J5FA 4B99A 3P7AA 4JRVA 2UV2A 3V5PA 5EQYA 3PJCA 2C3KA 3A7HA 3QX4A 2Q0NA 3DJ7A 4ASDA 3PP1A 4DEHA 5EFQA 5H8GA 2X8DA 4FSQA 3FPMA 4BHNA 2GQRA 4FEWA 2ZM4A 2C5YA 4IM3A 4QMSA 4ANOA 2XIKA 4NCTA 3LFFA 4AZWA 1F5QA 2G9XA 2OJ9A 2Y6OA 1OGUA 1BI8A 2PVJA 2DQ7X 4OW8A 5DR2A 5I5ZA 4O81A 3KMMA 2W96B 3P7BA 2I6LA 5F20A 4QMMA 3KXZA 3LOKA 3QTRA 5AX3A 3ZSHA 4B0GA 4UXLA 2C6DA 5DYJA 4RQKA 4I3ZA 4AGCA 5LVLA 1Q97A 4UYAA 2XBAA 2WFYA 3UOJA 1OBGA 2FSTX 1YXXA 3MPAA 4HVGA 2QOBA 4BN1A 2CNQA 5IA0A 3W2QA 5HU9A 2H34A 3LXKA 4HYUA 3U8WA 3KA0A 3MJ1A 3QKLA 3CE3A 4QTDA 4F1TA 3D7TB 4O2ZA 2ETKA 3IQ7A 1OUKA 4FNWA 2H8HA 4IB0A 4MNEA 4NKAA 2QNJA 5AUWA 3UZPA 2QOIA 4CRLA 1O6YA 4FKGA 5IKWA 4OGRA 5LCJA 5EQPA 5H8EA 1ZY5A 3SC1A 2VTOA 5A4QA 3HMPA 5IZFA 3OWJA 2OSCA 3FLNC 4RC4A 1SNUA 3R63A 3EN4A 5KE0A 5IQIA 3OBGA 4V04A 1QPJA 4C38A 5L8JA 3F3ZA 2GS7A 2XCHA 4FBXA 4RRVA 1FINA 5DI1A 2W1GA 1G8SA 3JUHA 3KKVA 4U3ZA 2PUPA 5L8LA 3ZCLA 2OW3A 5DA3A 3FSKA 3OC1A 2WKMA 4AZVA 2VWIA 1KSWA 5EW3A 5JH6A 3CPCA 3TZ8A 2YDJA 3KXXA 2VTAA 1R39A 1IASA 2ITVA 4G1WA 3RMFA 4AA0A 2GHGA 3TEIA 3QQFA 4FVPA 5JSMA 3NMUF 1CSNA 2RG6A 2W9FB 3CPBA 2R3PA 4FIHA 3JYAA 2BVAA 3FMNA 4NIFB 3QXOA 4BCOA 4BWXA 3K54A 4IBMA 5GNKA 4GW8A 5FTOA 2Y6MA 4AS0A 2REIA 4HGTA 1OI9A 2OJGA 4G2FA 3UC3A 4CMOA 4EWQA 3PP0A 4TL0A 3PWYA 1K9AA 5C4KA 4TWNA 5E8TA 5DLSA 5IPJA 3VJNA 2WAJA 5HTIA 4DFZE 3P78A 2X0GA 3EN5A 1CMKE 3UQFA 3A4PA 4LV5A 2X6DA 3HV5A 4EZ7A 1Q8UA 3KL8A 3LFNA 3M1SA 4D5HA 3FJQE 4ZJVA 1IG1A 4BI2A 4NT4A 1XBAA 4RVKA 5DGZA 1XWSA 3BKBA 4KABA 1OM1A 5KNJA 3BYSA 1V0OA 1V1KA 4QD6A 4ZP5A 3GQIA 3QC9A 2VN9A 4XOZA 3UOHA 4L3LA 5KBQA 1YHWA 3R1NA 4MD8E 1SNXA 3U6HA 5CSHA 3RVGA 2XKFA 2Z60A 3BLHA 4WNKA 4BVUA 3C4ZA 3I5ZA 4RWLA 4ZTNA 4D2VA 3VS3A 4BDEA 2YCFA 3B8QA 5BMSA 3Q3BA 2I0YA 4L43A 4HCVA 4DTKA 3Q6WA 3OROA 4B9DA 4TWOA 5BYZA 3NW5A 5GZAA 2I0HA 5TT7A 4KRCA 3R7YA 3PXQA 1OL1A 4Q5EA 1U5QA 4FE2A 4NU1A 4MD9E 3OW4A 2AC3A 4NWMA 2WOTA 4EH3A 3R8UA 3M42A 4DBXA 4MTAA 5LVNA 1H00A 5CAOA 3BGPA 4I22A 3MB7A 3R28A 1YWRA 3AC4A 5EDPA 3SDJA 3TUDA 3HDMA 5HO8A 5J9ZA 3C4CA 2JFLA 4QT1A 2UZUE 2WIHA 4FNZA 4LRMA 4QYHA 2ITYA 2YERA 1UNLA 2YIXA 3AGLA 2BDJA 4FX3A 4P4CA 4DHFA 5CU3A 3SG9A 5KZ0A 2WHBA 4EORA 4IX3A 4EKLA 3VUKA 3D5UA 3PA3A 4GCJA 4M3QA 4WUNA 2R64A 4KIKA 4XG9A 3VBVA 3EYHA 5CANA 5CZHA 3R9HA 3VF9A 4CTBA 4ZMEA 4OTRA 4QMXA 3R7VA 3VUIA 2QQ7A 3E8DA 2JIUA 3UOLA 4M8TA 5GIPE 1R0EA 4RPVA 4UEUA 3C0HA 3DXPA 1JKSA 2R3GA 4DGLC 4U8ZA 2W4OA 1PKGA 3EYGA 4IAAA 2RFEA 5CLPA 4BGGA 2I7QA 1WCCA 1YXTA 3P7CA 4LOPA 5GJGA 5HVYA 4XLIA 2WQBA 4OLIA 2YJRA 3AMAA 2IJMA 4QYYA 4FNXA 4F08A 1IA8A 4IM0A 4OBOA 2CGVA 3FZSA 5AP0A 3LXLA 4PP7A 3HDNA 3Q52A 4KWPA 4LGGA 1G3NA 4J97A 3ROCA 4L7SA 4H3BA 2XK3A 3THBA 3BEAA 3DAJA 4CV9A 2ITOA 3VS7A 3AD5A 3C51A 4CV8A 3DKCA 2GQGA 3UOKA 2Q83A 3I7BA 4CLIA 2R2PA 2CPKE 3E92A 3MA3A 3F69A 3TKUA 4EK3A 1PMUA 4G5PA 4AFJA 4BBMA 3WI6A 2F2UA 3ORIA 4Y8DA 3TNWA 4BFMA 2HK5A 3KMUA 3Q9XA 2BR1A 5FG8A 4G16A 2XKEA 4BCMA 2X9FA 3QTWA 4JNWA 4RWIA 3RM7A 3N9XA 3TZ7A 2C5VA 4JI9A 2HOGA 3OUNB 4CD0A 3NNUA 4BDJA 4CSVA 1B39A 2UZBA 4FTMA 3U4WA 5LXMA 5HIEA 5EW9A 3U9CA 4I0RA 2C0IA 1ZLTA 3MY1A 3R7IA 1PYXA 1ZMWA 2WMUA 3C5UA 4UY9A 3UE4A 3FQHA 4IEBA 4FODA 4IANA 2VTHA 4XV2A 5G1XA 3V01A 2QONA 5K9IA 2GU8A 2WTKC 4FTIA 2CGWA 2ZM1A 4TTHB 2YM7A 4C58A 3MDYA 3OF0A 2B1PA 4ZSGA 4YUQA 2HXQA 4G3DA 4NM3A 2EVAA 3TDVA 3L8SA 5EYDA 4RJ7A 3K5UA 4FV4A 2ZJWA 4RJ5A 4I5MA 4JBOA 3SQQA 4BCFA 2VNWA 4MBJA 1F0QA 1JAMA 2QVSE 4I6FA 2W99B 4YZCA 5EDRA 4C3PA 3ZUTA 3CKXA 3TWJA 3LXNA 4O6EA 2HW6A 3RPYA 4MCVA 3GU4A 4JQEA 3AC1A 1TQMA 2QG7A 4N4SA 1ERKA 5E8VA 2VWXA 2YWPA 4WHZA 5AV3A 5CENA 2EXEA 3NNXA 2BHHA 4O0WA 5FDXA 4EOJA 1A48A 4O84A 4JDIA 4YNEA 5B7VA 3ZSIA 5AP5A 5IQCA 2UW5A 2IPXA 3UIBA 3OXZA 2X8EA 3ZBFA 4GT5A 2QCSA 3DGKA 2XK7A 4D2WA 3QTSA 4A7CA 2WGJA 4L46A 5IA4A 2WTKB 3R1QA 2EB3A 3NW6A 5FUTA 4LQMA 5DEWA 4PMTA 3L8VA 3EQDA 4GFMA 4BDCA 4KRDA 1FVVA 4GSBA 2XKDA 4YHTA 3EZRA 3Q4UA 2W1IA 3MTLA 2PVKA 3NEWA 3PSCA 4I93A 3TM0A 5AAFA 5HORA 4X6QC 3ULIA 3KK9A 3HVCA 4R7HA 3PIZA 2Q0BA 4WD5A 2WMSA 3GCVA 3ZC6A 2WTVA 3KC3A 4EH8A 3DOGA 3FMDA 4O2PA 4XP2A 4F99A 3EZVA 4BIDA 4RZWA 4EQMA 5JFXA 3LMHA 3SG8A 2JAVA 2HAKA 3HUBA 3CY3A 3G2FA 1YWNA 2BALA 3F5PA 4HVDA 4UMPA 5CAVA 4YZNA 2OIQA 5ANEA 5DBXA 3QRUA 3WF7A 1ATPE 4KIQA 3DKOA 2BHEA 3V8TA 3DQXA 1KWPA 2XK6A 2YA9A 3WYYA 4LUDA 2UZOA 3EN6A 4Q2AA 4LGHA 2JLDA 4U40A 4NTSA 3KEXA 2ESMA 4LYNA 3I4BA 1JKLA 4QMOA 2HELA 2O63A 1CM8A 2IWIA 3P23A 5K0KA 4F9YA 3ZHPC 4AT5A 2B9IA 5AUYA 3QTZA 4O27B 5M06A 1M7QA 1P4FA 3PIXA 2OZAB 2ETMA 2JDTA 3MFRA 3BGZA 4P2KA 5AFVA 1PKDA 4AGUA 5HTBA 3IDBA 5A46A 5IMEA 2VUWA 3ZXTA 1MRYA 3GVUA 2VNYA 5J7HA 1QPCA 3A8WA 1XH6A 4FOCA 5AUTA 2Z02A 3WF8A 2VWWA 3ENHA 2X7OA 1GNGA 4ALWA 5E9EA 1PHKA 3A7GA 3HV7A 5ACKA 4I21A 4D1ZA 5DHJA 4J52A 2QC6A 1URWA 3I60A 4M12A 1H4LA 4FV5A 4QTCA 4UMUA 4LG4A 5EKNA 3SGCA 1WVXA 2WU7A 3AGMA 4EZ3A 3UVQA 4FT0A 3V8SA 2PUNA 3C5IA 3FC2A 4B6LA 4YBJA 5AX9A 4BBEA 3OCGA 4O1OA 3FLZA 3E3BX 2C3JA 3L8PA 2QODA 3HUCA 4XMOA 4YSJA 3FHRA 3OY1A 3SW4A 4YTFA 4IB3A 2B7AA 3T8OA 4AZEA 5BVEA 3WIKA 3ALNA 5B2MA 1SYKA 3KQ7A 5JKGA 3BLQA 3BLRA 5K3YA 2VGPA 5IH5A 1UU3A 2IW9A 3Q96A 4DC2A 4DH5A 2WMQA 3AQVA 3FE3A 2ITWA 4CT1A 1PXNA 3VUMA 1FMKA 4MF0A 3CCNA 1OECA 4MF1A 4AW1A 5A54A 4FSZA 3VJOA 2UW9A 5BMMA 4AGWA 3KU2A 5TR6A 3G9LX 5AUXA 4RX8A 3FEGA 4O0YA 5ETFA 2AUHA 2Y4IC 4FICA 4HZRA 3Q04A 2OJJA 5AR8A 3RAWA 2VGOA 3C4WA 4M0ZA 2XM8A 3P86A 3KXMA 2XH5A 3N4TA 4AOJA 5FEEA 1YXUA 5EOLA 3KRXA 4Z9LA 5CU2A 3C1XA 4IB5A 3BYVA 3EKNA 5M4UA 5EYKA 3GCUA 2CN5A 5KX8A 3TJCA 4A9YA 3IO7A 2XMYA 3E93A 5B0XA 5H2UA 4MXYA 4NCTC 2X39A 5L6OA 3ENMA 3H10A 4CNHA 2BZHB 1H24A 3OCSA 3QD4A 4QTBA 5CAUA 1H1SA 1OIYA 4K77A 4BB4A 2O8YA 4D1XA 2GTNA 2GNJA 2W5HA 2BILB 1WBSA 3V5TA 2Y4IB 3QZIA 5ANOA 3H0ZA 4S30A 1R3CA 3QQUA 4EOSA 3NX8A 4B4LA 1TKIA 4WSQA 1Y91A 5AIRA 4E5WA 2ERKA 3QUPA 2YAKA 2CGUA 5CT0A 3S4QA 2B53A 2WOUA 1XHAA 3AT2A 3Q4ZA 2B0QA 4ANBA 4O21A 1OBDA 1O9UA 4F09A 3PA4A 1H8FA 4Y46A 2J5EA 4DYMA 3ETAA 5T6KA 3R00A 4EK5A 3F9NA 4M0YA 4EONA 2IZUA 5JZNA 3TUCA 2QKRA 4NKSA 5K4JA 5M55A 3BE9A 3NRMA 1TQIA 5HEZA 2V0DA 4IAYA 4L9IA 2O65A 4H1MA 3WIGA 2UVXA 1RDQE 4FKIA 3NUNA 1Y6AA 4ZTSA 2WXVA 1GY3A 4BICA 2V55A 4EH6A 1J1BA 2WD1A 3ZOSA 5AUUA 2C47A 5J95A 3S0OA 4IWDA 4YNOA 4A06A 3MFSA 2CNUA 4GS6A 4RLLA 5IDPA 3EQHA 4A9SA 4DH3A 5IDNA 4UV0A 4EUTA 3IW7A 4JBQA 4B8MA 4GYIA 4EH4A 3T3UA 2XUUA 1J7IA 3ZEPA 1DAYA 4OR5A 1XBCA 4V01A 4BI0A 2QO2A 2XNBA 4FSRA 4MNEB 4G5JA 1YDTE 2XA4A 1CKJA 5JT2A 3LJ2A 4A4XA 5M57A 4MEDA 2I0VA 4CYJA 2BAJA 2GQSA 5E4HA 1YI4A 2W1CA 4ZS4A 3D4QA 3II5A 3R21A 5CEIA 4FR4A 5BUIA 4EWHA 3PXRA 1PF8A 1W84A 1PW2A 2V5QA 4R3CA 3V51A 5CEMA 2Z7QA 5DG5A 4U79A 4J95A 3UNJA 3OUKA 4CMTA 2R3NA 3LJ0A 4AUAA 4BZNA 5CXHA 3MGYA 4BZOA 3TL8A 4NW6A 4RJ3A 1M52A 4CFVA 2DUVA 2R3HA 4RJ6A 3VS0A 1IAHA 2ZMCA 2V7AA 4MXXA 2QOLA 5LMBA 2VWYA 3W33A 1OPJA 3RPVA 3HA8A 4XNEA 3EH9A 2FO0A 3TXOA 3ZONA 4F1MA 5A4CA 3ZU7A 3OOGA 5CZIA 4F65A 4DEDA 3GFWA 1YRPA 4DN5A 3W8LA 1NT2A 4E8AA 2BKZA 2KTYA 3JVSA 5TO8A 4LM5A 4RIXA 2B9JA 5FGKA 1AQ1A 2W17A 3O7LB 4WSYA 2VWUA 2YEXA 1J1CA 1PMNA 4AWIA 4XG8A 3C13A 5DNRA 3TCPA 1PY5A 2ONLA 4O38A 3CXWA 1OPLA 2X4ZA 3FI2A 4FK3A 1UVRA 3D14A 4FKTA 5LVPA 5J79A 3KRWA 3NAYA 3MS9A 3LPBA 2ERZE 3VNTA 4YSMA 3H0YA 4KA3A 2GNHA 5FM3A 4MD7E 3CLYA 1GOLA 3WZEA 3VF8A 3I6WA 3WE8A 4RQVA 3UP7A 1YI3A 2W05A 3L9PA 1Q8YA 2F4JA 4YTCA 3BV2A 1XQZA 4IC7A 4MBLA 4JRNA 2ZB0A 4JAJA 4AA5A 3SX9A 3DAKA 3VUHA 2IN6A 3NUSA 1OB3A 2AC5A 2IW8A 4MAOA 3KK8A 3MB6A 4PL5A 5AR5A 1JSVA 3SXFA 5LWNA 3FKLA 4XG4A 1YOLA 4OBQA 4IWQA 2JIIA 2OICA 3FXXA 3DU8A 4EHZA 4NZWB 4FIJA 3Q9YA 2JGZA 5EHOA 3T9TA 1OL6A 2DYLA 2XIXA 4YURA 1OL5A 1H07A 4UZDA 2W1FA 4GRBA 4IACA 2YCSA 3L9MA 4FVQA 2VRXA 3ATTA 3EFKA 3A99A 3NUXA 3C4FA 3HV3A 4IJPA 1GIHA 4RG0A 3W32A 3LMGA 4U80A 3HP5A 5DVRA 2XJ0A 4HYHA 4K8AA 4Y95A 4RX9A 4RVLA 5K4IA 3VBWA 5DR6A 4R5YA 3Q5ZA 4GEOA 5E8XA 3VBTA 2FH9A 2JKMA 4JLCA 3G9NA 4KIKB 3ZTXA 3W2SA 1GAGA 2GFSA 3O50A 1UU9A 4BDDA 3TNHA 3ORTA 2UW0A 4C62A 3NPCA 3PXZA 3BHUA 4I6BA 4EOPA 4FA2A 5HO7A 3R6XA 4JIKA 4OTGA 3KXNA 5I3OA 3RM6A 1E9HA 3QGWA 4LFIA 4BTFA 4RIYA 2NO3A 2ZDUA 3UNZA 2GS6A 4W9WA 3GEQA 2QOFA 3F5UA 5CAQA 3NUUA 4QMQA 1U46A 2GS2A 4RMZA 3BBTB 3W2RA 4DLJA 3FAAA 3RK5A 4F9WA 4R3RA 3E64A 4JIAA 4EQCA 3AD6A 3IPHA 4BZDA 3R01A 5IEYA 2J0MB 3CTQA 2IZTA 3W8QA 4RZVA 4IZ5A 4DG3E 3KXGA 4ZY6A 4O7WA 4F70A 1JBPE 2G1TA 5BVDA 5FWKK 3O7LD 3LCTA 4AN3A 3ZFMA 4H36A 3ACJA 3B8RA 3GQLA 4K11A 4KBAA 4ACMA 4YR8A 2BMCA 5J87A 2WPAA 3DLSA 3DCVA 4E26A 4F9BA 2PK9A 3HMMA 4EOLA 3BPRA 1PXIA 3DY7A 4YMJA 4F0IA 2GMXA 4WRSA 1GIJA 1URCA 3OVVA 4Y72A 5IUIA 4F63A 3QL8A 1WZYA 3MPMA 4XOYA 3IECA 4HVHA 3DBDA 3QC4A 2ITQA 4EH5A 3EJ1A 4EKKA 4QPMA 1LPUA 3WF9A 5M51A 1WBPA 4E4MA 4O7ZA 3IK3A 4G31A 1BL6A 4EYJA 5CXZA 4FG9A 4I1ZA 2XEZA 4GFGA 1OITA 3IGOA 4M67A 3UO6A 3LFEA 3NUYA 1UNGA 1ZYSA 3GBZA 2ZM3A 3KRLA 3R9OA 3LMIA 2V62A 2VTRA 4L3PA 4IVAA 1G5SA 3VS1A 1JOWB 5DR9A 5CS6A 4D2PA 4BCHA 5LOHA 1IAJA 4ZOGA 5JFSA 2HIWA 4O7YA 1JSTA 2X9EA 3BCEA 5DFPA 4E1ZA 3U4UA 5CSPA 4ALUA 2QLQA 5KMNA 2HYYA 5DEYA 2OU7A 4ID7A 4PNKA 3GCSA 4N6ZA 2R3KA 3PJ1A 3DXNA 2ITZA 1REKA 4FK6A 2ZVAA 3V6RA 3EN9A 1UWJA 1NVQA 2JDSA 2P4IA 4H3QA 3LCOA 3WZKA 4U81A 1FGKA 1WFCA 4TNDA 1VJYA 4GK2A 5EHYA 5FXRA 2IVUA 2CDZA 3VUTA 3L8XA 3ROYA 2UW7A 2F7ZE 2C5OA 2BRHA 4AOTA 4K33A 4TYGA 4I6HA 5HTCA 4DEAA 2C3IB 4PUZA 5AUZA 3TI1A 2W1EA 5AV4A 1OL7A 4C2WA 3POOA 3B2WA 3KCKA 3QQGA 4FT9A 4IAKA 2NNWB 3W2PA 4D2TA 4U41A 4QYGA 5KMMA 3BHYA 1GZNA 2E9UA 3ZRLA 4WRGA 3P79A 3I79A 3QRTA 4W4WA 5J9YA 5A6OA 1VZOA 5JQ8A 3LW0A 5HKMA 4GJ2A 4U0IA 4BDFA 2XNGA 2IZRA 3GC0A 4BHZA 3LZBA 1S9JA 3FZOA 4GV1A 5EYCA 1MQBA 1H08A 4J8MA 4QPSA 1A9UA 4U3YA 5AV0A 2W4KA 1IA9A 4PV0A 3OOMA 5LARA 3F6XA 4BKJA 3N51A 3K3IA 1P2AA 4JR3A 1BYGA 3RTPA 3FKOA 4QP7A 4WIHA 4BDKA 3BE2A 2PWLA 4UWCA 1W0XC 4GYGA 4HNFA 5LVMA 3NIZA 3FI4A 4PMSA 5F9EA 2G2HA 4QQJA 1UKIA 4EH7A 4ZZMA 3OP5A 4IZ7A 4LOOA 3MVLA 4FOBA 2X7FA 2QOCA 1CKIA 3VULA 4C35A 2PYWA 2BAKA 3G5DA 4X3FC 3WARA 4RFYA 5BVNA 3A61A 4G6OA 4CFNA 3DBEA 4DTAA 4D0WA 4IIRA 2WEIA 2XRWA 3TN8A 4I6QA 2O5KA 4FTNA 2RIOA 3MH1A 5KBRA 2FYSA 3MTFA 3R73A 3WOWA 2QOQA 4ANSA 2XB7A 4MXCA 3HEGA 3UP2A 3E7OA 3V04A 3V5JA 4F7LA 4YC6A 3S00A 4PNIA 4G9RA 3TIYA 2VX3A 4L00A 4F4PA 2IVTA 4FF8A 3S3IA 3EOCA 5M07A 5EOBA 4BCKA 2I0EA 4GG5A 4QMTA 2QO7A 3OTUA 5A14A 3FMMA 4H1JA 3NYVA 2FGIA 3F2NA 2XNOA 4R1VA 3QD3A 5CU6A 5JFVA 2GHLA 4UMQA 3ULZA 4X2NA 4BDAA 1TVOA 4FKUA 4HYIA 2GTMA 2Y9QA 4X3FB 5AM7A 3TJDA 4CFMA 2C5NA 3DK7A 5CVHA 4FTCA 4E7WA 4XG2A 5CF8A 4UZHA 3HNGA 5FLFA 3R2BA 4AP7A 4FKOA 4EC9A 5HLNA 3A4OX 3FV8A 3VBXA 2QOOA 2WZJA 1W98A 3TNQB 4QQ5A 2WMVA 4DFUA 4IWPA 2QI8A 3VO3A 4YTHA 1NW1A 3CQWA 4APCA 4F9CA 2C0OA 2CKEA 3COIA 2BRBA 2CJMA 4MKCA 4DFXE 1A06A 4YJRA 5AADA 1H0WA 3ORPA 4I41A 4IZAA 5HHWA 5LMAA 1IEPA 3ZXZA 1TQPA 2VX1A 4FZ6A 3O2MA 2P55A 1JWHA 4U7ZA 2CN8A 4OTWA 4UWBA 1JPAA 2XYNA 1M2RA 2I40A 2HCKA 1YI6A 2J0KA 5AJQA 2JITA 3QCXA 4W9XA 3QF9A 3V5QA 2H6DA 1FBNA 3SOCA 3TZ9A 1K3AA 2CNVA 1Q3DA 3PTGA 5CI6A 2OXXA 4DH8A 2O64A 3HKOA 4NSTA 2Y0AA 5HD4A 4BIBA 3COMA 1QPDA 3G90X 3ZBXA 3ZLWA 3RP9A 4WBBB 1M2QA 2WQEA 1BMKA 2RF9A 3QRKA 3MWUA 4GT4A 5CNOA 5A4LA 4HPTE 4H05A 5ETCA 2VX0A 4F7NA 4EJNA 3SXRA 3CD3A 1SM2A 4Q5HA 3U6IA 3RNIA 3ZS5A 3HAMA 4FT5A 2ITNA 4YO6A 4CYIA 3LVPA 4IXPA 5DPVA 3UBDA 3ZM9A 2G01A 4AX8A 1WVWA 3FWQA 4LMNA 1Q8WA 3AXWA 2C69A 2J4ZA 3L9LA 5EW8A 3W1FA 4EOMA 2YDIA 3TUBA 4RIWA 4FSTA 4PWNA 3ZZWA 4DE4A 2XS0A 3R9DA 4MBIA 1SMHA 4FSNA 2R5TA 5AUVA 1VEBA 2PMNX 4F0FA 4IM2A 2C6EA 4Y5QA 2XNPA 2YJSA 4DGGA 3D2KA 3Q9WA 2X7GA 3I0OA 3NCZA 3OD6X
chains in the Genus database with same CATH superfamily
4C57A 3QQKA 3C0GA 2ITPA 3QUEA 3RHKA 1R1WA 5D7VA 3O23A 5E1SA 4C4HA 4MQ1A 4ASZA 4EC8A 3EIDA 2XKCA 3ZEWA 3CQUA 4WNPA 3VW6A 5AR4A 2YLFA 4FTTA 4TPTA 2BRMA 1UU8A 4A4LA 4OAUC 3Q4CA 3UG2A 5I9ZA 4CLJA 3AT3A 4I24A 4UXQA 4KSPA 1UV5A 5GIOE 3A62A 2BZJA 2C6KA 3DNEA 5ANDA 2VTNA 5DMZA 4JDKA 4ERKA 5L6WL 2P0CA 4DF3A 3LLTA 4M69A 4XP0A 4KB8A 1SVHA 2BPMA 5ANKA 4IAFA 4AQKA 1YDSE 5AP7A 5BYLA 2YM6A 3ZFYA 4C3RA 3KGAA 5HIDA 4L8MA 1FPUA 3C9WA 5CQWA 3HECA 1XMMA 4M15A 3MESA 1QPEA 3DFCB 3NYXA 4YBKA 5HBJA 5GZ9A 3ALOA 4MXZA 3OXIA 3FC1X 3GCPA 3TG1A 3WE4A 4GU6A 4L45A 2RGPA 3BEGA 1RW8A 4U45A 3SRVA 2HY81 1Q4LA 5KHXA 4UYNA 4ZTRA 2OO8X 4ZZOA 3PJ3A 4QMWA 2QLUA 4HCUA 4OTHA 5E1EA 5IQAA 2PE2A 4GJ3A 2BIYA 4DITA 3LAUA 1P4OA 3OZ6A 4D2RA 1H1PA 5IQEA 2HZ4A 3D7TA 3PPZA 4MH7A 2J6MA 2XK9A 2FSMX 2UW4A 4BRXA 3UMWA 2FVDA 5EI6A 2J51A 5D7AA 5EG3A 3R7EA 4DG0E 2UZDA 3PA5A 1ZZLA 3VHEA 5IA1A 1PMVA 1Z57A 1YXVA 4KKGA 3JPVA 4RA4A 3LKMA 4JQ7A 5CSXA 3KVXA 1U5RA 3GU5A 3JS2A 3TTJA 5AA9A 3F2AA 3BLAA 2QKWB 3QAME 4ZK5A 4EOIA 5BYYA 2B55A 4RIXB 4J98A 3ERKA 3GB2A 5TF9A 4R78A 2XIZA 4FSUA 4RLKA 5BUEA 3GC7A 2F49A 4R8QA 5AV1A 2GNFA 3HV6A 4ANMA 3E88A 2YZLA 2XIYA 4N70A 3NLBA 5E8SA 5GJFA 1KE6A 2HZNA 3ORLA 3QQLA 4FVRA 4YLKA 2W4JA 5HE0A 4DCAA 5C01A 4FEXA 3KFAA 2WMXA 3I0QA 4JAIA 5HIBA 5IEXA 1DS5A 3FLQA 1W2CA 5BVFA 2JC6A 4U44A 1OPKA 4NIFA 5BPYA 3UIMA 4S34A 3FL5A 4NK9A 2WQMA 2C3LA 3MFUA 1J3HA 3QCYA 4E6QA 3R30A 3NUPA 4UBAA 3PG1A 1OUYA 4GK3A 5AAGA 4KBKA 5AP3A 4ZIMA 4AXCA 3R1YA 4ERWA 2PHKA 5L2WA 2YACA 3PXYA 3U51A 4E4NA 5AR3A 5KMKA 4FKJA 3R83A 4FKLA 1FMOE 3DLZA 4QP9A 3SKCA 3MVJA 3D5WA 3IW8A 3W2CA 4BIEA 3FHIA 4DT9A 3HRCA 3ORMA 3LIJA 4BJJA 5B2KA 2W7XA 1GIIA 1UU7A 4XH6A 2WMBA 4IDTA 2EUFB 3ZC5A 3ZDIA 5AP6A 5HX8A 1H1QA 2VTIA 4J8NA 4IX5A 3D2IA 2OIBA 3PSBA 4DEEA 5L2IA 1PYEA 3GU6A 1OIUA 1BI7A 4XBUA 3PZEA 4KUJA 4S32A 3BU6A 3EWHA 3UIXA 4FTOA 3V8WA 3UZRA 4LMUA 4TNBA 4I5HA 5CQUA 5L2SA 4AT4A 2VD5A 3M11A 2EB2A 1Q5KA 3AC2A 4FKPA 2JKOA 4IMYA 4PL3A 3OHTA 4PQNA 5LJJA 2EXMA 4GH2A 4HZSA 3FMHA 5C4LA 1Z9XA 4YJSA 1OMWA 2R7IA 3HP2A 4G3GA 2E9OA 3D9VA 4FYNA 3ZZEA 3K5VA 4O0TA 4D55A 5F95A 1OKWA 2C68A 4K18A 4RIYB 5EI8A 3V5WA 3V6SA 1FVRA 4TZRA 5HLWA 4IZYA 3NW7A 1U54A 5E90A 2OH0E 4C34A 1DAWA 3OS3A 5E7RA 2XVDA 3BX5A 3VS4A 3FL4A 1NXKA 4MHAA 3VWAA 1GZ8A 4MYGA 4QMPA 5I9XA 3UYSA 5A6NA 3I1AA 3EQGA 3QA0A 4FEUA 3UNKA 1T45A 4RVMA 4KAOA 4ACCA 5LWMA 2H9VA 2XJ2A 4FJVA 4I4FA 5CASA 4TYJA 2C1AA 4E4XA 3I6UA 3QCSA 1XH4A 1NVSA 3CQEA 4OUCA 3ZUVA 4ANLA 2AYPA 3BU3A 5BNJA 5G6VA 2OKRA 4TT7A 3OG7A 4O7RA 5IQBA 4TWCA 5I9WA 2WELA 4XJ0A 4FKRA 5CF6A 1JVPP 3NFFB 1BLXA 1KV1A 1S9IA 2GNLA 2UZTA 4O4EA 5AMNA 4RC2A 2IF8A 4RWKA 5E8YA 4XLVA 4AN2A 3V5LA 3MPTA 3P0MA 4Y5HA 3PLSA 2E9PA 3WZJA 1PXPA 4TXCA 3JY9A 4MK0A 4P90A 3RHXA 2YITA 5M44A 2YCRA 2OG8A 4ZTLA 1ZARA 2QHMA 4NJDA 4Z7GA 4ZTMA 1YQJA 3ZLSA 2IG7A 5F1ZA 4EK6A 4CCUA 3AG9A 1PXLA 5GJDA 3O51A 4PF4A 4NM5A 4U5JA 1Q41A 5CTPA 4EJ7A 3FXZA 2X6EA 1PMEA 4M84A 2PMLX 3JR1A 3AT4A 4N0SA 3E3PA 4I0SA 1JQHA 3QD0A 1KE9A 1KE7A 2PY3A 3OWPA 4WOVA 4ZZNA 3HRBA 2P33A 4NM0A 4BY9E 3CTHA 5JMSA 3NNVA 3VRYA 2I1MA 1JLUE 1M7NA 1RQQA 1H01A 3JXWA 4M14A 3UPZA 3V3VA 3UQGA 5KMLA 4R6VA 2OWBA 3PVWA 4FG7A 4ITIA 3SXSA 2YIRA 2XRUA 4G6LA 3ET7A 4FSMA 3CIKA 2VTMA 3Q60A 4AZTA 1H27A 1W82A 3KN6A 4JVGA 3BELA 4J71A 2C30A 3ZYAA 4E6DA 3ML1A 3CY2A 4IFCA 3VIDA 3R2YA 4PRJA 3E87A 4BCGA 5JN2A 3C50A 4RFMA 3QKMA 4DEBA 4PPCA 2JBOA 2GSFA 3MYGA 4BCQA 3TKIA 1WAKA 2GPHA 3DB8A 2FB8A 4EUUA 4KIOA 4EYMA 3FDNA 4FKQA 4HOKA 2YIYA 3AD4A 4FGBA 4WG5A 4FT7A 4PTEA 3AC5A 5J5SA 1LR4A 1PJKA 5CI7A 4L3JA 4LV8A 1OKYA 2G15A 3CTJA 4F64A 1JKKA 5EI2A 2OFUA 4C4GA 4ITJA 2A1AB 3FI3A 2RKUA 4QP4A 4UMRA 5E8WA 1UWHA 2JDOA 4JBPA 2WMTA 3PSDA 4XBRA 5AV2A 4A4OA 4LRJA 2CKPA 3NVKI 3GOPA 4DAWA 3Q32A 3ODZX 3QRIA 1REJA 3PDTA 5DT4A 5HVJA 5L2TA 3UYTA 1MRUA 3LQ5A 3NUAA 4GKHA 5C27A 2WQOA 2QOKA 4IC8A 1X8BA 2PZPA 3P9JA 2XANA 2W1HA 3BGQA 4E6CA 2XK8A 4GVJA 5CEOA 5KMJA 4K9YA 5TE0A 4EEVA 4F9AA 4G34A 3RAIA 1OKVA 4BWKA 1OL2A 3GXLA 3I81A 3C4EA 3NAXA 4CMUA 5BQ0A 3RWPA 2UZVA 3PZHA 4RIOA 4U97A 4PTCA 2ZYBA 2WB8A 5DT3A 3RZBA 3TZMA 4BTKA 4F6UA 1RJBA 3NR9A 3GGFA 3LCDA 5JRSA 1NVRA 2YIWA 3LM0A 4NUSA 4GUBA 2GNIA 2E9NA 4EOOA 4ZSJA 4ARKA 1TFFA 4RVTA 2DS1A 2F7XE 4AG8A 2WMAA 2HWOA 4QMLA 5EM8A 1W8CA 2BZIB 5E8ZA 2EWAA 5CSWA 4YPDA 3C0IA 3OMVA 4S31A 5ANGA 4K6ZA 4MUQA 4DTBA 3F3TA 2VO3A 3EQBA 4PPBA 3WBLA 4G3FA 3EL8A 2CSNA 3FZ1A 3E62A 4L42A 3UDBA 2R9SA 4KIPA 1BL7A 4DGMA 3F88A 4H39A 2DWBA 3KULA 4CVAA 2VTSA 4FV3A 4M7IA 4AW5A 4DEGA 2RFDA 3CKWA 4BTMA 3ORZA 4NJ3A 5IQFA 2X0PA 3G0EA 2OI4X 5FTGA 1KOBA 2V7OA 3UDTA 2A27A 3BYMA 5FBOA 4DFBA 4GT3A 3UPXA 3BYUA 3W55A 1Q62A 4M97A 4NH1A 3CJGA 3FMJA 3OT3A 3PLAE 2ZB1A 3TKHA 3PRFA 2XM9A 5M56A 4O22A 5B2LA 3OCBA 3W18A 4J53A 2VV9A 5A4TA 4AGDA 4MQ2A 4O0XA 3M2WA 1V0PA 1PXKA 3BWFA 2XBJA 2FSOX 4TYIA 2OJIA 3QHRA 3RKBA 5K5NA 5C8KA 4NW5A 4CCBA 2JAMA 2PZIA 3E5AA 3NNWA 4Y83A 3G33A 2VO0A 4GUEA 5HCYA 5HESA 3E7VA 3OY3A 3BWJA 4EK8A 3GOKA 4Z16A 2UVZA 4NEUA 4QP8A 2XIRA 4LL0A 4IHPA 5I9VA 4D4SA 1DI9A 5EK7A 4BCNA 1MP8A 4CZYB 4FIFA 2UZLA 4GMYA 4AA4A 4DT8A 3EHAA 3ORKA 4BYJA 3D94A 2RFNA 4O0RA 4PY1A 3QZHA 3T9IA 1M17A 3LCKA 5FM2A 3D83A 4XUFA 3UG1A 3R7OA 4RX7A 1DM2A 3BRBA 4ZXTA 4TW9A 3KIOC 2AQXA 5DRDA 2G2IA 4UALA 5H8BA 3AMBA 3JVRA 4K2RA 3GENA 3LJ1A 5F4NA 5BX0A 5CAPA 4XV1A 2ZAZA 4USFA 4FKSA 3UTOA 4Z55A 3D7ZA 5AWMA 5HU3A 4X3JA 3RI1A 4C0TA 4R7IA 5L4QA 4USDA 3QTIA 4AF3A 4E3CA 5KKRC 3PUPA 5HE2A 3ZDUA 2E2BA 4C4JA 5M53A 4OTFA 4YHFA 3BL9A 3F7ZA 1B38A 4CFUA 3I5NA 3Q9ZA 4ACDA 5KUPA 2GFCA 2RL5A 3MSSA 4ENXA 5M09A 4ZS0A 4FC0A 3BYOA 3EMGA 3PJ8A 3RJCA 4CZUA 2OF2A 4C02A 2NYAA 4AACA 3UQCA 4PP9A 4O86A 1E1XA 2UVYA 3GFEA 4Q9ZA 3CP9A 3DFAA 4I92A 1WBOA 3MJ2A 1WMKA 2ZV7A 5EQEA 1PXJA 4CG9A 1BUHA 3BIZA 3QALE 5AP4A 3R7GA 4KSQA 2CGXA 2A19B 3DBQA 3OT8A 4BTJA 3FLWA 3ZRMA 2VU3A 3DBFA 2PVMA 3U87A 4JT3A 5IQDA 2X2KA 3QZFA 2VO6A 3DKGA 4RIWB 3R9NA 5J5TA 3S95A 4XEYA 3F3WA 4DINA 4PDPA 4C4FA 5KKRB 4O83A 3FUPA 1YVJA 3A60A 3VUDA 3FYJX 1OKZA 1W83A 3DTCA 4K0YA 4O4CA 5F94A 3DBCA 4N57A 3O5AA 3E8NA 4PX6A 3HA6A 4ZLOA 2YCQA 4XRJA 4FV6A 3QZGA 4R5SA 2PL0A 1KV2A 3OFMA 1QCFA 4LV7A 4CG8A 1JSUA 4X2GA 4ENYA 5FTQA 5BVKA 2NPQA 1YHVA 1YXSA 4FTJA 5EM7A 3SLSA 3DDPA 1KE5A 3WYXA 5M4FA 2WIPA 1VYWA 4E4LA 2B4SB 4TKSA 4YC3A 4WO5A 3BBWA 3I7CA 4EHVA 3MFTA 4W4YA 4CQGA 4V0GA 4FI1A 3EFWA 3EQCA 2WNTA 3G51A 4YJNA 4M69B 4CGAA 5IQGA 4DDGA 5FP6A 4I5PA 3TDWA 1I09A 4LRKA 3OBJA 4NTTA 5C8NA 2Z7LA 3UDZA 4YGAA 5FXQA 5HLPA 5AP1A 1ZYLA 3AMYA 5HNBA 3W10A 3EFLA 3IW4A 3ANQA 4FTRA 4FUYA 4FZAB 5EDQA 3LLAA 3VQUA 3KRJA 3DXQA 1APME 3FPQA 5CVGA 3R8ZA 1VYZA 1SVEA 2ZV9A 1P14A 3SRVB 3CC6A 4NYEA 2PSQA 3L9NA 2PMOX 1R78A 4YJTA 3MA6A 3O8TA 4FL3A 3GUBA 3WZUA 3TTIA 3G6HA 2C6LA 2BDWA 4HGLA 1QL6A 1XH7A 3PWDA 5DT0A 4QP1A 5HNGA 4L01A 1ZOGA 2W1ZA 3PY0A 2NP8A 2B9FA 4PDOA 4KD1A 2W0JA 5ETIA 2XZSA 3NSZA 1SVGA 3VC4A 5JZJA 4DDIA 1V0BA 4FUXA 4A9RA 4L67A 3PYYA 4QQCA 4YZMA 3Q6UA 4ZMFA 3NWWA 1IR3A 1UKHA 4LI5A 4D4YA 3CSVA 2YFXA 5M4IA 3P1AA 4X2JA 3N4VA 4Y85A 2RFSA 5LMKA 1KE8A 3MBLA 1ZWSA 4FIEA 4II5A 3QU0A 3AC8A 3F66A 2R3RA 4OTQA 4TYHA 4FKWA 4KINA 3RK7A 2A0CX 3ZO1A 4BDHA 4QTEA 3SW7A 2QU6A 3GC8A 3PPJA 3RAHA 3RNYA 2QURA 2AEGA 3HGKA 5DH3A 5IA2A 3WZDA 2J7TA 5IUHA 3ODYX 3H4JA 5HBEA 3IGGA 5BVWA 4D9TA 3TV7A 2ZV2A 4FTAA 4NFNA 4NM7A 1HCKA 2BIKB 4A07A 4BYIA 2H96A 4D9UA 2XEYA 4XG3A 3MH3A 3MI9A 2J50A 5KMOA 5CY3A 3VN9A 4AXDA 3COKA 2WO6A 4O7TA 2R3OA 5DWRA 3A2CA 3QUDA 2WTJA 4XV3A 5EHLA 2OGVA 4QP2A 2O0UA 3HRFA 3CBLA 3R71A 1YKRA 3F5GA 2BDFA 4DBNA 4EHGA 3RGFA 4AZSA 4AE6A 4F7SA 3VVHA 4C4IA 4FMQA 2FUMA 2LGCA 2CKOA 4ALVA 4FV8A 3ZSGA 4OTPA 1ST0A 2W9ZB 3HLLA 1MQ4A 3JY0A 3RPSA 3G0FA 5IEVA 1BKXA 3BV3A 3LFBA 3R8VA 2F7EE 3LCSA 3LXPA 4BCPA 4JQ8A 2IO6A 2OXDA 3DQWA 4JG6A 5I9YA 1CKPA 4IFGA 3LFSA 4WNOA 5J7BA 2P2IA 1H1WA 3KXHA 4BKZA 4D0XA 5HI2A 3ORXA 3RWQA 4O91A 3IG7A 1BX6A 4HGSA 3RPOA 3UIUA 4BC6A 4R1YA 4YHJA 4F1OA 2FA2A 3MY5A 4F0GA 4UN0C 5J9LA 4LL5A 2W06A 3ZRKA 3QYZA 4ASXA 3LFQA 4BBFA 5HNIX 5FBNC 2ITXA 5C26A 3UVPA 3DJ5A 3CD8A 3C7QA 4ZY4A 4IJ9A 5D11A 2VO7A 3ZM4A 3OEFX 3PG3A 4YJVA 4DEIA 4EK4A 5AR2A 4FT3A 2WMWA 3MN3A 5IMXA 3ZFXA 1PRYA 2B54A 3GCQA 4YU2A 5I0BA 4E5BA 5KCVA 4EI4A 4UB7A 3G6GA 3ANRA 4EOKA 1RE8A 1HOWA 2GNGA 2OBJA 2WTIA 4F7JA 5ANJA 3WF5A 3UGCA 1SZMA 4I5CA 3VUGA 3FMLA 3QBNA 4BJJB 3R22A 4O96A 4FV2A 3VRZA 2VTTA 5CU4A 4ZY5A 4YJPA 4O82A 4YC8A 4LOQA 2OZOA 1U54B 5I4NA 5EYMA 1ZYJA 2R3FA 3PFQA 1I44A 1U4DA 2YIQA 3PIYA 4FZFB 4CTCA 2HW7A 3LHJA 3PVGA 4C3FA 3ATSA 4N6YA 4D4RA 5JGAA 2YM8A 4K1BA 4V05A 1MRVA 1LP4A 3R0TA 3R8MA 3RBWA 1STCE 4EL9A 4PPAA 4QMUA 2VAGA 3MVHA 1LUFA 4ASEA 3Q4TA 3QQJA 4L52A 4U43A 3QGYA 4Q9SA 3O71A 3R8LA 1G8AA 5DRBA 3QQHA 4MWHA 5IQHA 4QYFA 3R1SA 3ZH8A 4XG7A 4XHKB 3ACKA 5IUGA 3NGAA 4Z3VA 1AD5A 2WTWA 3VQHA 1XO2B 4TY1A 3WF6A 3NVMB 2WMRA 3DJ6A 3MW1A 2VWBA 3QWJA 1YWVA 1JKTA 5IU2A 2A2AA 4IAIA 2CHLA 4IH8A 4JR7A 4KKHA 3A7FA 4RBLA 3ITZA 4EQUA 4EHEA 3QTUA 3FZPA 1FOTA 4DFNA 4D58A 2J2IB 4TN6A 5CEKA 3SVVA 3FY0A 1WVYA 2PMIA 3IOKA 4I6LA 5ANIA 4NFMA 2Z7SA 3FYKX 4O7LA 3DDQA 4HCTA 3UC4A 1H0VA 4OT6A 3OWKA 3A7JA 4FL1A 4QP3A 1ZRZA 3IONA 5FRIA 3VBQA 5JRQA 2J90A 3UO4A 4W4XA 5H3QA 4QMVA 3OW3A 2PE1A 3FSFA 4HJOA 4FV9A 2V22A 3TNIA 3DB6A 3KN5A 2BKKA 2C6IA 3P08A 3CGOA 3H9OA 1XH8A 4DCEA 5HQ0A 3DZOA 4YZDA 2OIDA 4BI1A 1ZXEA 2BFYA 3NZ0A 4QOXA 2QR8A 2UZWE 4E20A 3GC9A 3LM5A 4PMMA 2PU8A 4FGRA 2F9GA 3NCGA 4D4VA 4HGEA 5CU0A 3MH0A 5JEBA 1IRKA 3E63A 4GFOA 3EQPA 3DA6A 4L68A 5AA8A 4O7SA 3MV5A 4I0TA 5DIAA 4AE9A 3LFAA 4QYEA 2FSLX 1M14A 3DK6A 5FEQA 4RT7A 5LQFA 3GP0A 3RCDA 3OTVA 2IVVA 3FQEA 4CFWA 5HG5A 3F61A 4U6RA 4APPA 4IWOA 3F5XA 3Q2MA 3ID6C 2OH4A 5C03A 4AFEA 3O0GA 4MVFA 3LFDA 3RK9A 3CEKA 1XH5A 3TNPC 3IKAA 3NIEA 4C61A 4DH1A 3UODA 2ONLC 3R7UA 2C6TA 2QO9A 5J1VA 2JKKA 1GJOA 5D12A 3VHKA 5K5XA 1FVTA 5IH4A 4MXAA 4JJRA 3H9FA 4X2FA 4JG7A 5D10A 4CT2A 2PVFA 1UA2A 3R04A 2C5XA 5EKOA 3ZLYA 5J1WA 5HCXA 2X8IA 1FGIA 4FSYA 4ZSLA 3VW8A 4F78A 3Q5IA 4I94A 4G6NA 3IDPA 1U59A 3K3JA 3ZO2A 3H9RA 4L53A 1AGWA 1DI8A 2XP2A 2UZEA 4IVDA 5D1JA 5C1QB 2F57A 2C6OA 3QWKA 4WKQA 5C9CA 3RZFA 1E1VA 5AM6A 3T3VA 4BCIA 3PXFA 4RA5A 2ETRA 4E6AA 5IISA 3OWLA 2ACXA 2QHNA 2F2CB 3AC3A 1Y6BA 3AOXA 4S33A 4E73A 4DA5A 2JD5A 2Y8OA 4L6QA 1H26A 1VR2A 1Y8YA 3NYNA 5HE3A 3VS2A 4FKVA 4AT3A 1H28A 2ITTA 4XX9A 3EQRA 2JIVA 4O7VA 4RGJA 3QFVA 1XR1A 3TV4A 2PVHA 3SOAA 3NS9A 4YPSA 2X2LA 3PY1A 3Q53A 3IW6A 5BUJA 4BGHA 5JQ5A 4UX9A 4BF2A 2BROA 3QYWA 1J7UA 2XNNA 3KULB 4WUAA 4JG8A 4B7TA 4QNYA 4D28A 2B52A 1KOAA 2ZOQA 3BU5A 3CR0A 5KO1A 4IX4A 4QO9A 5CT7A 2ZV8A 3DT1A 3VAPA 4AXAA 3VS5A 3GNIB 4XG6A 3VBYA 4EBVA 2JDRA 4BDIA 5L8KA 2ITUA 3HMNA 4FV1A 2XAMA 4O4BB 5HICA 2Y7JA 4JX3A 5CEQA 4AQCA 1ND4A 3E8CA 4YJOA 1ZY4A 5KZIA 2R3QA 2XJ1A 2J9MA 3D5XA 4MXOA 4BGQA 2BCJA 2HENA 3KMWA 3FKNA 4CZTA 2PE0A 3LQ8A 5TOZA 4DLIA 5T3QA 1KUTA 4BDBA 3FZRA 2PVRA 3HL7A 3KF7A 1YOMA 2XCKA 4PDSA 5L6PA 5C8MA 3BZ3A 5HG9A 2BAQA 4BWPA 1F3MC 2PVLA 4OT5A 4BR3A 2PULA 3DKFA 4ANNA 4YLJA 3UO5A 3PJ2A 4J99A 2BRGA 5FP5A 3SHEA 4XYFA 1XBBA 1Z5MA 4WG3A 3ZO4A 3ZUUA 2VTPA 4OTDA 2XNMA 1Q99A 4I23A 1PXOA 4MWIA 4RJ4A 4PTGA 5HOAA 3HV4A 4IE9A 4I4EA 3F2RA 2HZIA 2R0IA 3EQIA 3FZTA 3W0QA 5HBHA 3WILA 4M66A 4QMZA 3LFCA 2A4LA 5ITAA 5JGBA 2JDVA 1NY3A 5GHVA 5A9UA 4QP6A 5L3AA 2C4GA 4BKYA 1XH9A 4C8BA 3DV3A 2PUIA 2QR7A 4X3FA 2QU5A 5CNNA 4ZEGA 1WBVA 3HYHA 3MIAA 5BVOA 3SA0A 2XYUA 4MNFA 2UZNA 4KKEA 4IX6A 2PUUA 3QLFA 1T46A 3O17A 1OZ1A 2C0TA 1GZOA 4FZDB 1K2PA 5M4CA 2JKQA 3OXTA 4H58A 4QTAA 5A3XA 5K0XA 2RG5A 3H3CA 2SRCA 4FTQA 3ELJA 2ZMDA 5IA3A 2W5AA 4PL4A 4FIGA 3MY0A 2UW8A 3F3VA 4O0SA 3BHHA 5HG8A 4X7QA 3G15A 2CMWA 4E5AX 4Z7HA 1GZKA 4YJUA 5D9HA 2P3GX 3DAEA 3F82A 2BRNA 4C59A 3KREA 4GKIA 4C37A 4AW0A 2J0IA 4GG7A 4JBVA 2QOHA 4FG8A 2BZKB 5IG1A 5KHWA 2EU9A 4EH9A 4UMTA 4DG2E 4BDGA 4ZSAA 2UW6A 4YZBA 4FRFA 4GU9A 1CDKA 4AOIA 2YHVA 2XNEA 4DH7A 4QRCA 1ZAOA 1ZZ2A 3UZTA 3R9RA 1JNKA 4ORKA 2Z2WA 3FY2A 4LUEA 1ZMVA 5LCKA 4AN9A 2VWZA 2YM3A 4KS7A 2GDOA 1YOJA 5E92A 4C33A 5HVKA 1NA7A 4C2VA 3OCTA 1L8TA 4A9TA 4KNBA 1Y8GA 1OIQA 2HZ0A 2R4BA 3BI6A 3D5VA 5HZNA 4ZLYA 4YLLA 3W2OA 4RSSA 5T68A 2WU6A 5FEDA 3NDMA 4YZ9A 3PPKA 1ZOHA 3BHTA 3GU7A 4RX5A 5CEPA 1ZYDA 3EKKA 4F6SA 5FXSA 2IZSA 4RWJA 4P7EA 4JDHA 4J7BA 2R7BA 5DN3A 4D2SA 3HZTA 5I9UA 3EL7A 3U54A 2PVNA 3W16A 4R7BA 3KB7A 4F6WA 3O8UA 3POZA 4V0GB 2WTDA 4ACHA 2RSVA 2VTLA 5CF4A 3D0EA 4O6LA 3DK3A 3BQRA 3ZO3A 3KF4A 1ZYCA 5LMKC 3HMOA 5ICPA 4ACGA 2WTCA 1R0PA 3U55A 2OFVA 3QD2B 3K2LA 5IA5A 1Y57A 4G3EA 3E8EA 4AU8A 3EQFA 4FTKA 3KY2A 4D5KA 3VS6A 4O0UA 4ZLZA 2HXLA 3QHWA 5I3RA 4JL9A 4WG4A 3RCJA 3TACA 4X0MA 3DTWA 2YZAA 3QKKA 2E9VA 4DHIB 2CLXA 4RJ8A 4X6RA 4PMPA 2GHMA 3GT8A 3HAVA 5EM5A 2G2FA 1Q24A 5HX6A 3UVRA 2BTSA 3KVWA 4FSWA 5H9BA 3PE2A 5TKDA 1Q61A 4JX7A 2OK1A 1EH4A 4GK4A 4U42A 4M68A 1ZMUA 5HE1A 4CXAA 3L1SA 2HY0A 4YJQA 4OAVB 1M2PA 1YDRE 1WBNA 3KCFA 4QMNA 4L7FA 3RAKA 4RC3A 5CF5A 4USEA 2OF4A 4P5ZA 3ORNA 2PZRA 4QQTA 2P2HA 3TT0A 4BL1A 3IOPA 3P4KA 4IAZA 4IADA 4ONAA 5L2QA 4TYHB 3TYKA 4KS8A 1PXMA 3LE6A 3P5KA 5HG7A 4R3PA 3QX2A 3TV6A 1W7HA 2Z7RA 3QCQA 4FYOA 4DGOA 4FL2A 3S2PA 5HGIA 2B9HA 2YM4A 2LAVA 5HD7A 4AZFA 4PDYA 5D41A 2PPQA 4R77A 4IDVA 4EOQA 3TIZA 3C4XA 4DHJA 5ETAA 1P5EA 1XKKA 3IW5A 4HW7A 5EM6A 1LEZA 1Q8TA 2VWVA 5E91A 4ZTQA 4TWPA 5KMIA 1CTPE 4FV0A 1ST4A 4FNYA 5IH6A 5ACBC 3P5JC 4O0VA 4XV9A 3EFJA 4ZSEA 3RALA 4MX9A 2BTRA 4EH2A 2YN8A 1QMZA 4TRLA 2WQNA 5JFWA 2X2MA 3GI3A 3EB0A 4ZJJA 3A7IA 2OXYA 2QD9A 2WEVA 2YLEA 2ZFYA 3MH2A 2QG5A 3FI8A 3DZQA 4JDJA 2R3LA 5FQDC 3SD0A 4ANQA 4ZAUA 2CCHA 5AR7A 2CCIA 3A8XA 4JXFA 5CSVA 3UJGA 5J8IA 2Z8CA 5AIKA 4HYSA 5FD2A 4C4EA 5JK3A 1OVEA 3IS5A 4J96A 5AP2A 4AW2A 4FZ7A 2O2UA 4Y73A 3W0PA 4LDTA 3S1HA 1MUOA 4YO4A 1W2FA 2YWVA 3BQCA 4ZTHA 1XJDA 1YHSA 3BHVA 4HNIA