5AR5A

Rip2 kinase catalytic domain (1 - 310) complex with benzimidazole
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
284
Chain Sequence
EAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMEGGTIIYMPPENYEPSIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 284
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar5A00
3FXXA 1URWA 3BX5A 4ZZMA 5IZFA 3NYOA 3UNJA 4BVUA 3PSCA 3N51A 3QRUA 3A4OX 4FV4A 4I22A 2EUFB 3IGGA 3V6RA 4IX6A 4K11A 4O6EA 4EZ7A 3VJOA 5HD7A 1FVTA 2OJJA 4QYGA 4YTCA 5IA3A 3VUDA 5IA4A 2YLEA 3PJ3A 3QGWA 4G3CA 4RIOA 5AR2A 5BVEA 4CT1A 1OKZA 1OI9A 5A4CA 4USFA 4R6VA 4C62A 3PA4A 3KVWA 5A3XA 3IK3A 4DFZE 3OT8A 5JN2A 2VTMA 3QZGA 4ASZA 2XK9A 4D55A 5KMOA 3OG7A 5EH0A 4F1OA 4I6QA 3KXGA 1H24A 3M42A 4FKUA 3UJGA 5E8VA 4FV0A 3IGOA 4LOOA 2ZOQA 4F63A 2XH5A 3NW5A 4QMXA 4E5AX 1R0EA 4M68A 3DXNA 3QQLA 1P2AA 2YCRA 4JRNA 2XKEA 4HCVA 4KRDA 2AUHA 4JX7A 5ANJA 4ZIMA 3ZBXA 4EBVA 2QOBA 3DFAA 3FKLA 4I41A 4RSSA 1ZLTA 4TWPA 3E7VA 1V1KA 3P7CA 3KRXA 3RNYA 3OFMA 5FDPA 1XH7A 5GJDA 2ZV7A 4K0YA 3ZO2A 4NTTA 3TTIA 4B6LA 2J0MB 3KRRA 3WZKA 2GTNA 3MWUA 4H3PA 3SV0A 2UW5A 4D28A 1NVQA 3IOPA 4LI5A 3ZUVA 5J79A 1K9AA 1FOTA 4DH7A 3HRCA 1V0BA 1OL2A 3LZBA 5K4IA 1UKHA 3RPVA 3MBLA 4NSTA 4MNEB 4OTGA 1M2PA 4C38A 3ORZA 4CV9A 3TNQB 2ZYBA 2YCFA 4EH6A 4FVPA 1BL7A 5J95A 5JKGA 4CCBA 3PXKA 4X2GA 4I23A 2XKCA 1J91A 4JXFA 4I0SA 4IWQA 3I79A 4QQ5A 4ZY6A 4IXPA 4NCTC 3EQFA 2R7IA 2UW3A 3BU6A 4AGUA 4QO9A 4K8AA 4U3YA 3LFBA 4FX3A 4BRXA 4BIBA 2BDWA 3L1SA 3ZFMA 3TNPC 3FSKA 1ZRZA 2F4JA 1WVYA 2RFNA 3EQGA 4QP8A 4M66A 3EFKA 2B9JA 4LUEA 4RX8A 4R3CA 3MH2A 4R5SA 4C3FA 4XG2A 2W1FA 3HUCA 4JBOA 3PXYA 4QPSA 3FY2A 2OZAB 4K33A 3F3UA 3R9NA 3ORTA 2QHMA 5DHJA 1ZMVA 5FM2A 4FVRA 5HD4A 3FLZA 4BTKA 4EWHA 1PYEA 4PDSA 1XKKA 4RWKA 5EI2A 5HBEA 3I60A 3R2YA 3COIA 4IAZA 4X2FA 1MQBA 2BVAA 1PXIA 3K3JA 3Q9WA 5I9YA 1M17A 3RK7A 3AMYA 1ZYJA 4YSJA 3KN6A 3ZZWA 2W96B 4O1PA 4O91A 4QT1A 5CZIA 3I1AA 2O63A 4FL3A 2C6IA 3G6HA 2W17A 2VV9A 2CCIA 1W7HA 2XYNA 3LW0A 3C5UA 5AP4A 4ARKA 3HECA 2R64A 4GEOA 5HG9A 4ASXA 3LFSA 5CSPA 2FSTX 5AP3A 3KRJA 4EH7A 5ANOA 5EFQA 3GC9A 4HW7A 2PVRA 3QQHA 3R01A 4IZ7A 5AX9A 1OPLA 4BCIA 3HRBA 5L6OA 5EI6A 3G0FA 5A4LA 2GHLA 3EFJA 2XNEA 5KCVA 4DGLC 3NGAA 3HZTA 3QFVA 2UZEA 4JAJA 4UMQA 4UWCA 1PXOA 3MB6A 2J7TA 3F88A 3H30A 4K77A 4A9UA 2SRCA 1WBNA 4GK3A 3O0GA 4TN6A 3TL8A 3QQGA 3VQUA 5CX9A 2WFYA 4O1OA 1PW2A 2CGXA 3FMHA 4HYHA 4P5ZA 4HVIA 2DWBA 3TIYA 3D5VA 4LL5A 5BUJA 5FGKA 3KA0A 3HL7A 4AA0A 2X8EA 2UW7A 2RG5A 3R2BA 2Z60A 3FLYA 3LM0A 5JGDA 5AV2A 3LMGA 2BAKA 4G3GA 3BYUA 2CKEA 5KHWA 3H4JA 3W2PA 3TKHA 5CEKA 4WT6A 4EH3A 2GPHA 3CR0A 4QMPA 2QVSE 3VC4A 2RG6A 5CEQA 5HIBA 4QRCA 4KNBA 4MKCA 4MXAA 3G33A 4RJ6A 1FMOE 4IAYA 3THBA 4CLJA 3G6GA 3V5WA 3H9OA 4IVDA 4O0YA 1QCFA 4CKIA 2OFUA 4GW8A 2B53A 4KIOA 5CI7A 2JBPA 2B4SB 4XG6A 4EQUA 2G1TA 3ZLYA 3H0YA 2Y9QA 5IMEA 4QP2A 2PK9A 4NU1A 2ZVAA 5I3OA 5ETIA 3GUBA 5HIDA 4RG0A 4F7NA 1JPAA 1RW8A 4RX7A 2ITNA 1LP4A 2GTMA 4RLLA 1PMEA 3DDPA 4BDHA 3JXWA 4JI9A 4ZTNA 3SXFA 2FYSA 5L2TA 3UTOA 5DN3A 2Z7RA 2UZDA 1E9HA 2VUWA 3KY2A 4B4LA 2W4JA 4G6NA 1Q61A 2XNGA 3FQHA 3TCPA 2QC6A 3M2WA 4FV8A 3HVCA 3QUDA 2W1EA 1OVEA 3EN6A 3V8TA 3DV3A 4NUSA 5GZ8A 2ITYA 3LFAA 2X1NA 2YZAA 4G16A 2VWVA 4S31A 3A62A 3KK9A 5DE2A 4I6HA 1OZ1A 3O96A 4KSQA 5AIRA 3ENHA 4ZSGA 5IUIA 1KOBA 3ZSHA 3TTJA 4A4LA 2VTNA 2UW9A 5FTQA 3RBWA 1M2QA 1Z5MA 3CQEA 3A8WA 3DKCA 3AQVA 3VS0A 4AW0A 5A6NA 3NIEA 2ITZA 1OB3A 4JBPA 4KD1A 3RALA 3SD0A 1OGUA 4YLJA 2XNNA 3PA5A 4FT5A 4IM3A 3EIDA 2QR8A 4S32A 3RWPA 4K2RA 3VUKA 2XRWA 5E8ZA 2OW3A 3LFDA 4WIHA 5KBQA 4CFVA 3N9XA 2QD9A 5DWRA 4JDKA 5EDRA 1CMKE 3CTJA 2QODA 4ZY4A 5AV1A 5C8KA 4PQNA 2H6DA 3LFCA 4YU2A 1GZNA 3WF9A 4TWNA 4WNOA 3QBNA 5AV4A 5M51A 1BI8A 4LRKA 4TXCA 2FSLX 2R3HA 3HV5A 2ITWA 3PZEA 5HGIA 3EKKA 5HLPA 2JDRA 5D9HA 4CYIA 2OICA 4EOKA 3P86A 4J53A 4B9DA 5A4TA 1G3NA 3C7QA 3PY0A 4IACA 4RJ3A 3HRFA 4QTCA 1HCKA 1AGWA 3FXWA 3HA8A 3OTVA 2R3LA 3UO5A 1SVEA 3UQGA 5AAEA 3ULZA 1OPKA 4YO4A 2YAAA 5JFSA 5BX0A 4WNMA 2QO7A 3QUEA 1ZY5A 4AGCA 3MVHA 2JEDA 4FKSA 4IC8A 4DCEA 2FVDA 4H3QA 4J98A 3TV6A 4Y72A 4W4XA 1CKJA 3O7LB 5JRSA 5ITAA 5AIKA 2R3FA 5TR6A 1SM2A 4C4GA 3QRKA 4IH8A 4XG3A 3UODA 3VW8A 2B9FA 3Q5IA 5B2KA 4WA9A 4L46A 5ANGA 4BDFA 5IEXA 5LMKA 3QQUA 4IAKA 3JY9A 4AZTA 3BV3A 1NVSA 2W5AA 4G1WA 4EHZA 3LHJA 1IG1A 4EJNA 4QMVA 2YJRA 4W4YA 4RT7A 3ORKA 5ACKA 4EI4A 1PXJA 4I3ZA 5AP0A 2FH9A 2O64A 4MTAA 1K3AA 4QQJA 5JT2A 4ALWA 3G2FA 3ZUTA 3ANQA 4F64A 3CY3A 3PJCA 2XA4A 3HDNA 4V0GB 2VZ6A 4OR5A 4YURA 2JDVA 4QNYA 4RX5A 2QU5A 3HV6A 3DT1A 3LAUA 4CFNA 3FMEA 1FVVA 5LWNA 5FBNC 3IONA 3SW7A 3GU8A 5HCYA 3UMWA 4ACHA 3TUDA 4FTIA 5CF4A 3OUKA 1OMWA 2EVAA 5B7VA 5L6PA 2EB2A 3EJ1A 4FIJA 2ITOA 1JVPP 4TWCA 4WBBB 3ZH8A 5I9UA 4EOOA 4YZBA 4EOJA 1ZOGA 3QTRA 3ORPA 4CMOA 3K5VA 3BHUA 2Q0BA 5CQWA 3ZC5A 3CS9A 3G0EA 3D2KA 4RIYB 4JAIA 3PG1A 4BWKA 4AT5A 3OWPA 2IZTA 4RC3A 5EM7A 3VBTA 4KSPA 4WO5A 4EC8A 4IHPA 5LARA 3FV8A 3EQDA 4RVKA 5CEPA 1PKDA 2OJIA 3R02A 3MY1A 4MNFA 5HNIX 4XV1A 2ETKA 5C26A 4F99A 4RVTA 1WBOA 4KKHA 2J51A 3DCVA 4NJDA 5HTCA 3F5UA 4OTDA 3H9RA 2R3GA 3P9JA 3L9NA 4O0TA 2HWOA 4ACDA 4YBJA 2HY81 4M12A 4EKLA 3MIYA 4UALA 3UQFA 2Y4IB 4IVCA 4U81A 4L8MA 3CKXA 3NNVA 4EOIA 4Z16A 3PVGA 5F20A 5HE2A 3A7IA 2AC5A 2PSQA 3QKMA 3R7OA 3VNTA 4CRSA 4ENYA 4WG4A 3BCEA 3WF5A 3NUYA 5BPYA 4BI1A 3LVPA 3R21A 4TYHA 4BTFA 4EK4A 5CNOA 5I5ZA 3ZO1A 2BRGA 2YABA 3OS3A 3GQIA 4DGOA 1JQHA 2I40A 4I92A 3BWFA 1H07A 2I0EA 4IM2A 3RHXA 2JLDA 3BPRA 4AS0A 4D58A 4C57A 3P78A 3LFQA 4R7HA 4OBOA 3LXKA 4A7CA 2C3JA 3B2WA 4M97A 5LVMA 4MBJA 3ZMMA 5BYZA 1KE5A 5M55A 5KMJA 4KBKA 4YMJA 4F1MA 3C9WA 4TYIA 4BCGA 4EUUA 3Q32A 4B99A 5AA8A 4AGWA 5ETCA 4JR7A 4PPAA 2OF2A 1XBAA 4F1TA 2C5VA 4QQCA 3TEIA 3R8UA 4PMTA 4QMYA 2BCJA 4TNDA 2BZIB 3PTGA 2VNYA 3JS2A 2YJSA 3NUNA 5AUZA 3DAJA 4NFMA 2WTKB 3MFUA 2WQMA 5EYMA 5AUTA 3QHRA 4DH3A 1OECA 4ASEA 3QZIA 4C2WA 3HMIA 2J9MA 4KS8A 1ZYDA 5M56A 2C30A 4MBIA 3PXRA 3QXOA 4IANA 4XMOA 5T3QA 1IASA 4DITA 2WQBA 1WMKA 3PUPA 3I81A 4M3QA 1WBVA 2XIZA 2IVTA 3C0IA 5BVWA 1O6KA 4P2KA 3C13A 5HE3A 2VTIA 3P7BA 2JIVA 3C0GA 4AG8A 5CEMA 3DJ7A 3GVUA 3I7BA 4D1ZA 1GIIA 3MDYA 1Q3WA 4UMUA 3DBEA 3VJNA 4D2VA 1ZMWA 2XJ2A 3BYMA 5J9LA 5DRDA 1Y8YA 4LOPA 4RQVA 5HNBA 2WIPA 3FKNA 3MPTA 2PVFA 5E7RA 4CKJA 5HO8A 4BKYA 3DNDA 4NFNA 2V5QA 5EHOA 4TPTA 2F9GA 3NDMA 4USDA 2GNHA 3U6HA 3IPHA 3C4FA 4PMMA 2O2UA 4U42A 5AADA 3E5AA 5I9ZA 3V01A 5M4UA 3BE9A 2J0LA 4XP3A 4XOYA 4XV9A 1S9JA 2WELA 2R3KA 4FV7A 5CVHA 3QTSA 3QTQA 2WXVA 3PZHA 2EU9A 4CFWA 3GCSA 2XEZA 2QONA 2WGJA 2WPAA 4TT7A 2XNPA 4APCA 3R71A 3G9LX 2CCHA 4JOAA 1JKKA 2HZNA 3BBWA 2X7OA 4E4LA 2PHKA 5L4QA 4MD9E 5CALA 3QKKA 4FKLA 5JZNA 4MEDA 4D4YA 4OT5A 4IQ6A 4UXLA 4C4IA 2BTRA 5ANEA 2Y6MA 4BGGA 3TACA 5T68A 3F69A 4J95A 4LOQA 2R3NA 1AD5A 3DAEA 4K6ZA 4TNBA 4F6SA 2X4ZA 4HYIA 5CSXA 4AA5A 5FXRA 4AW1A 5HVKA 1UVRA 3CE3A 4XLIA 4NKSA 4E73A 3R1SA 2XM8A 3V5LA 2PZ5A 4FA2A 3F61A 3HP5A 2J5EA 4R5YA 5JFXA 2YITA 4MXYA 4FNXA 4FTMA 1E1VA 5CENA 4XLVA 2XJ1A 5EM5A 2A0CX 4G2FA 3L8SA 4MAOA 3FMJA 4WG3A 4F0FA 3KL8A 2A2AA 3B8RA 5E8TA 4EHVA 3FWQA 2UW6A 4F7JA 3PA3A 4EQMA 4QTAA 5E8UA 4NW6A 4JG8A 3RTPA 1YW2A 3IW4A 4QYHA 3GC0A 1OIQA 1YVJA 4OT6A 3F3ZA 4I0RA 4YC3A 2QOFA 3Q5ZA 2C6MA 5HICA 3ERKA 2VTOA 5L6WL 3BWJA 2OJ9A 4HJOA 3NUPA 3RCDA 5J9ZA 4RZWA 5HX8A 3UMXA 4P7EA 4AGDA 3FZTA 2UVZA 5AP2A 4D4SA 2BHHA 3PIYA 5TF9A 1GAGA 3GU4A 3DDQA 4CNHA 5IDNA 4ACCA 2WO6A 3EL7A 5EYCA 5JZJA 2ZMDA 5EKOA 3RVGA 2BR1A 1H08A 2R3OA 3ZDIA 5FRIA 3VWAA 3QUPA 3VUHA 3ZM4A 3S00A 5KZIA 1PKGA 3DLSA 3FLNC 2VTPA 3BRBA 4E7WA 4Z7GA 3LQ5A 5EW9A 5KKRC 4L3JA 4JQ8A 3FMMA 3REPA 2BALA 3ELJA 5EDPA 2OJGA 2HZ4A 3KN5A 3EH9A 2H9VA 2QOCA 3LQ8A 3WILA 1M14A 3OD6X 1GIHA 4LQMA 5AV0A 2J6MA 1OL6A 4PX6A 3WE8A 1CKPA 3ETAA 5ICPA 4N70A 4CSVA 3HKOA 3SRVA 3Q4TA 4A9YA 3G5DA 5G6VA 3MIAA 4U8ZA 1KWPA 2IZUA 5HG5A 3OTUA 4BZOA 2JAVA 3TUCA 3WF8A 1RDQE 1KOAA 4CQGA 4F9CA 2Z7SA 4V0GA 4FIIA 3II5A 1BUHA 3RPSA 1CKIA 2VO0A 2X2MA 4FKQA 4Y5HA 1GIJA 1ZOEA 1W0XC 2I0VA 4QMZA 4CT2A 5KO1A 4KIKB 3TZ7A 5DT4A 5IA5A 4UBAA 3U87A 1ZY4A 3MPAA 4FTKA 4DHFA 3VS6A 4QMTA 4UX9A 3UC3A 5LMKC 3KXZA 4E6QA 4FSWA 4JT3A 3DJ5A 3MV5A 4YZ9A 4XUFA 2EXEA 2QOQA 4FTAA 3LFNA 3MVMA 4FT9A 3NNXA 3OBJA 4LGGA 5FLFA 1T45A 4ZZOA 4UWBA 3A7FA 4IE9A 3WBLA 4J99A 3QQJA 2PVNA 4FF8A 4RIYA 3GGFA 3VBQA 2RL5A 2JKOA 4X3FB 4BZNA 3UVRA 3PPJA 1MRVA 4TL0A 3WZJA 4QMOA 4NH1A 5CNNA 4ZSLA 3SQQA 3DK7A 3DKGA 4HYSA 4Z7HA 4BHZA 2GS7A 3KFAA 3FLWA 2PMOX 4NW5A 5CU0A 2ONLA 2OBJA 4W4WA 2BILB 3PP1A 2AYPA 3FI3A 4I5MA 5AR4A 2V0DA 5IUGA 5AP1A 2ZM4A 3IKAA 3IW7A 4YPSA 3RJCA 3FMKA 4ITHA 4FIFA 1Z57A 5DVRA 2WOUA 4LUDA 5DEWA 3BGPA 4ZSEA 2WMVA 2QO9A 2W4OA 4BN1A 4J8MA 4BZDA 3VS7A 3NS9A 3EN7A 4OW8A 4ZSJA 2ZDTA 2GHGA 4FEQA 5CI6A 5LJJA 3GOPA 4AACA 4QMNA 3DK6A 3WARA 3QTWA 4OTFA 4UYNA 4E1ZA 1PHKA 1M7NA 4M0ZA 3EQBA 4D4RA 3UNKA 3AC5A 3CQUA 4GMYA 4FNYA 2CN5A 3K54A 3E3BX 3MTFA 3GFEA 4OUCA 4ZAUA 4OAUC 1Q5KA 4QP1A 5DFPA 4FSNA 2FSMX 3DA6A 5E92A 3QHWA 3BI6A 4YJUA 3HMMA 4CKRA 4XH6A 2IWIA 4WNKA 4CMUA 4BDAA 4YZCA 3ZDUA 4ENXA 4H1JA 4U0IA 3QRTA 2CLXA 5CSWA 4UEUA 5HTBA 3KXNA 4H1MA 5DOSA 3UDBA 4ZJJA 1H0WA 3CY2A 4EKKA 4M84A 3W32A 2OI4X 4LMUA 1OIRA 3BHYA 5AAGA 5FTOA 4R3PA 3MS9A 2O5KA 4JVGA 5AX3A 2HYYA 5HI2A 5HEZA 4HZRA 1NA7A 2XUUA 3GU5A 4M8TA 2QU6A 5M4FA 4JDIA 3AGMA 2GFSA 5K0XA 4CCUA 2ERKA 2R3IA 2VO7A 1M52A 4KAOA 3QA0A 4KIQA 3TJCA 4AXAA 3HMOA 3KC3A 4X21A 3OOGA 4FYOA 1DAYA 5CANA 3PXFA 3FHIA 4WKQA 4FV5A 3R30A 5IF1A 2PVLA 2VNWA 4NJ3A 5EKNA 1W8CA 3DPKA 5HORA 2BRHA 4OGRA 4D2SA 3OEFX 4R7IA 3CGFA 4YC6A 3EQHA 3EQRA 4V04A 3QXPA 2BZJA 4BICA 4JBQA 2W7XA 1E1XA 1O6YA 3RWQA 3OMVA 4Z3VA 2BFYA 2YISA 2WEVA 3OW3A 4ZTSA 4DGMA 4U43A 2BDFA 3QYZA 3ZU7A 4FSTA 1ZARA 4F7SA 4BI2A 5DMZA 4NZWB 2BIKB 4ONAA 3Q3BA 4YNOA 2HK5A 3Q9ZA 4AX8A 4W9WA 4XG4A 3V51A 4EH9A 3WZUA 1JBPE 4OTHA 5HCZA 4B7TA 3BYVA 2IVSA 3R7YA 1Q62A 5K4JA 4N6ZA 1Q99A 1OKWA 4CD0A 4OAVB 5BVFA 3OWLA 3DBDA 5CLPA 5M4CA 3GP0A 1BYGA 1PXPA 2NPQA 1P14A 2OH4A 2H8HA 3DU8A 4AW2A 1H1PA 4YGAA 2BRBA 4PDPA 2HZ0A 1QPDA 5CEIA 2RF9A 4FV6A 4S34A 4PMSA 2W1IA 1XBCA 2IVUA 3ZRMA 1FVRA 5HNGA 1SYKA 2W06A 3DB8A 4G5PA 4U45A 4QTDA 5LXMA 4C58A 4TYHB 4BB4A 3UG1A 3L8VA 3HV3A 4MQ2A 1DAWA 4GH2A 4RWLA 2VX1A 3V8WA 4WRGA 4AF3A 3KCKA 1YHVA 2HAKA 4S2ZA 4B0GA 4PTGA 2QOKA 2R5TA 3R9DA 4C4JA 3TKUA 2X9EA 2XNOA 2BRMA 3MJ2A 5EOLA 4AZVA 3W10A 1OKVA 2IJMA 2LGCA 3HUBA 1GZ8A 2OIDA 4RIXB 4BTMA 4HGEA 3C50A 3NIZA 4FVQA 1PJKA 3MFSA 3TZ8A 2CDZA 2YIWA 1MQ4A 4CVAA 5A9UA 3BGQA 3F5XA 4EH8A 2B1PA 3ZSIA 3KXHA 3IW8A 4DEBA 1UKIA 2X81A 2B9IA 1JAMA 4CZTA 1H8FA 1MRUA 2HIWA 4ALVA 1WZYA 4IM0A 1Y91A 2FSOX 3JYAA 4I6BA 3QKLA 3NLBA 3EFWA 3R73A 3W2CA 4MF0A 3IS5A 4YPDA 4E26A 1YXSA 3QX4A 5LVPA 1B38A 5HU3A 3BHVA 3W18A 2Y6OA 3NYNA 5GZAA 1YHWA 4G17A 4R8QA 2W05A 4A9RA 2HXLA 1OL1A 4TYJA 3ZZEA 3GC7A 4QMSA 3WIGA 5HQ0A 4JX3A 4J1RA 2XKDA 3VUGA 4BKZA 4IVAA 3VBVA 4A4OA 3SOCA 2BAJA 2ACXA 2BMCA 2C47A 4U80A 3ZLSA 3QQKA 5AR8A 5H2UA 2V62A 4KBCA 2P3GX 3UVQA 5DIAA 4G9RA 4YBKA 3M11A 3PXQA 4HCTA 3L8PA 3O17A 5AA9A 4FKIA 3Q9YA 4QP7A 4FIGA 4PP7A 2BROA 2EXMA 4RJ8A 3W55A 3S1HA 5F1ZA 3V5QA 2YWPA 1PXNA 2G15A 2R0IA 2C1AA 2YIYA 3PYYA 4AN9A 3W2SA 1MUOA 3PWDA 4JL9A 4ANOA 5C8NA 3GEQA 1OM1A 3FZRA 3NAXA 1FQ1B 2J50A 4B8MA 4E6DA 3R00A 4IBMA 5BVOA 5KX8A 5AR3A 3W8LA 5E1EA 4YTIA 2X6DA 3ZCLA 2C3IB 5KHXA 2DUVA 4GV1A 4KA3A 2C0OA 4L7SA 2XBJA 3DB6A 4YJNA 5JH6A 4XP0A 3ODYX 5AAFA 5M4IA 5KZ0A 2JIIA 1XH9A 1Y8GA 3VHKA 5IDPA 2VTSA 1OUYA 3SOAA 4JBVA 3TNHA 2GSFA 2GNJA 4FTUA 4RJ5A 3P1AA 1I44A 2VTLA 2WTWA 3CPCA 3OROA 1STCE 4KIKA 4X0MA 1PXMA 3MY5A 3FI2A 4TY1A 3AMAA 4AT4A 3DKFA 3IDPA 3IW6A 4EK6A 3UPZA 4PDOA 5EHLA 4CTBA 4PL4A 2WMSA 3PRFA 1UV5A 2OXXA 3BU3A 4Q5HA 3DY7A 2XVDA 3LIJA 4L42A 4YJTA 4Y5QA 3NCZA 4Y8DA 3ZLWA 4ZLOA 1P4OA 3TKIA 4X3FA 3IG7A 2AC3A 4CEGA 2VRXA 4RFZA 5CVGA 5DEYA 2VTTA 5TKDA 4AFEA 3R6XA 4GJ2A 3COKA 1YRPA 3JY0A 5CQUA 3LLTA 2X8DA 2YAKA 1H1WA 2BKZA 3BYOA 3HA6A 4XCUA 3NR9A 3GU7A 5I9WA 3W33A 4BWXA 3QTIA 3MSSA 2YA9A 1WAKA 2X7GA 3ORLA 4ZXTA 3NCGA 2XCHA 3UOKA 3LCSA 2W5HA 2R3MA 1GZKA 5FG8A 4BDIA 5EHYA 4RLKA 4Y73A 2PUUA 3F2AA 1TQIA 1HOWA 3RINA 3I0OA 1QPEA 4E93A 3A61A 2WMAA 4OTRA 3COMA 3GFWA 4GFGA 3ZRKA 2XK4A 2OIBA 4D1XA 1KV1A 3DGKA 3NNWA 4UY9A 2XIKA 4XEYA 3I0QA 3FL4A 3KEXA 3VBXA 4IB0A 1WCCA 4QNAA 3PFQA 5DR9A 4FKTA 5DI1A 2J2IB 5HZNA 4YHFA 4GL9A 3TWJA 2ONLC 2WKMA 1I09A 5CWZA 4I5HA 4PPCA 1Q97A 4RC2A 5HU9A 2WTIA 3FUPA 4L9IA 4CZYB 4EWQA 1YDTE 2C6EA 2P2HA 4XRLA 5I3RA 5M44A 2UV2A 4NEUA 4BHNA 3OWKA 3UIMA 3P08A 1JLUE 1WBSA 2HELA 2A27A 3RGFA 4UZHA 2Y4IC 2YERA 1NY3A 4IWOA 4XV2A 3ODZX 3RPOA 5BVNA 3BIZA 2IW8A 2JBOA 4Y46A 4ZZNA 3D7TB 2NRUA 3DJ6A 4FUXA 1SMHA 2E9VA 4X6RA 5HG7A 4AFJA 3IOKA 5IUHA 3SRVB 4HVSA 2O3PA 3VQHA 4XBRA 3UQCA 5HCXA 2CHLA 5JEBA 2P4IA 4HYUA 4FYNA 5AR5A 2XEYA 4QYYA 3UP2A 3VF9A 4CRLA 4F65A 4EOSA 3CGOA 2G01A 3PIZA 4G34A 2G2HA 3NYXA 4AE9A 3SVVA 5IU2A 3KKVA 1H1RA 3FL5A 1BX6A 5I9XA 3E92A 5ACBC 5HVJA 3FYKX 4GYIA 1BMKA 1OIUA 4IB5A 2YM7A 4Z9LA 1PMUA 3VS4A 3PVBA 1VZOA 3EB0A 2CLQA 3FAAA 1F5QA 3SA0A 1CTPE 1XQZA 3PPZA 4GS6A 1Y6BA 5DBXA 5E1SA 2Z2WA 1UWHA 2I1MA 2VX3A 2C6OA 3OXTA 5AP7A 1QL6A 5DA3A 2JKMA 3QZHA 3HV4A 4I6FA 4ZEGA 3AD5A 4O96A 5J9YA 4FKOA 2EB3A 5CT7A 2VO3A 4BCJA 1KE9A 4BCFA 2WTKC 4G31A 2C5NA 2ESMA 3KQ7A 4FZ6A 4LG4A 3DBCA 1DI9A 5AWMA 5LVOA 4QOXA 2GS6A 3BLRA 4EH2A 3UYSA 3QTUA 3QU0A 2OXDA 5J7BA 3MB7A 3TIZA 4F9YA 3D15A 3BKBA 3EYGA 4FTOA 2XK3A 3EKNA 2FUMA 4YJPA 2P33A 3KF7A 2UUEA 3FC2A 3QL8A 1RE8A 4FKGA 5DT3A 1Q8TA 2YM6A 3K3IA 2WTDA 5CT0A 5CF8A 3KU2A 3SKCA 2R3JA 3U51A 3I5NA 2HOGA 5L2QA 4IJ9A 3HEGA 5KE0A 2BUJA 2DS1A 2WEIA 3AMBA 2PE1A 4C7TA 4U41A 4DEEA 4JQEA 2P0CA 3F3VA 2F57A 4APPA 2F7ZE 4FTLA 2OG8A 3ACJA 4GK2A 4XS2A 3AC3A 3ZS5A 1YXVA 4I20A 2WQNA 3F5GA 4JNWA 4GSBA 4QYEA 5K0KA 5K5XA 2JDSA 3Q53A 4E6CA 5CU6A 3FQSA 1OL7A 1V0OA 1VYWA 2IVVA 4M69B 3FKOA 4RIXA 4M67A 2VGOA 1REKA 4KKGA 3A8XA 4EORA 1Q4LA 4YHTA 2YDKA 5C9CA 1ZYSA 2R0UA 3UIXA 3TXOA 5BUEA 4O0VA 2A1AB 1APME 2OF4A 3DAKA 4BFMA 4E4NA 3I5ZA 3D7ZA 2ZM1A 3F7ZA 4DG0E 2OJFE 4F9BA 2XF0A 4NTSA 2PTKA 5GNKA 3V5PA 3OC1A 3F82A 5TOZA 4IAIA 1YI6A 1DI8A 4S30A 3GU6A 4DG3E 2G2IA 4QP9A 3PJ2A 4IZYA 4BL1A 2QO2A 3O2MA 3QD2B 4ID7A 4WD5A 5AUUA 4E4MA 2PZRA 2BIYA 2C4GA 4RBLA 3EQIA 3I4BA 3MH0A 3OF0A 4XV3A 1R1WA 3SXSA 3V04A 5J1WA 4H3BA 4IWDA 3LXLA 5C1QB 3A7JA 4QP3A 4ANQA 4AP7A 2VD5A 3MTLA 4YNEA 3JVSA 5CSHA 1LPUA 5EM6A 2UZOA 4U44A 4ZTRA 5F9EA 1RQQA 2OH0E 4GT4A 1XR1A 5IKWA 3ZXTA 5GJFA 2XK6A 4FR4A 5DNRA 1PY5A 2OWBA 1B39A 3KULB 4IX4A 4TYEA 2HXQA 2X4FA 4AAAA 4EBWA 5LMBA 3OHTA 4MXCA 3GCVA 4MHAA 2Z7LA 4U5JA 4DG2E 4ZTQA 5J5TA 3KB7A 5DRBA 2PL0A 2X8IA 2I6LA 3H0ZA 4I21A 4AA4A 3GNIB 3O71A 1YWNA 1ZYCA 4L00A 3W2OA 4E20A 2YIXA 3PSDA 2XIRA 4R1YA 3GI3A 5HE1A 2B54A 4GG7A 3WF6A 4YZNA 3QRJA 3L9MA 3TT0A 1QPCA 2YLFA 3F7WA 4UV0A 5ANIA 2VWYA 4YLLA 3CIKA 4QMUA 4Q5EA 4BBFA 2FA2A 4ZK5A 4AZFA 3AC2A 3W8QA 4BGHA 3AC1A 3UZTA 3FC1X 2YEXA 5AP6A 3FPQA 4HGTA 3V3VA 5KUPA 4U40A 3HDMA 4FNWA 3VUMA 2ZM3A 4FSMA 3GCQA 4BCNA 3GC8A 3HYHA 5JQ5A 2C6TA 3FMNA 4LL0A 4FTRA 3RZFA 4A06A 4IAFA 2QCSA 4RX9A 2J0KA 4AZEA 3FPMA 2W9FB 3EYHA 2X9FA 4X2KA 1GY3A 2XM9A 4Q9SA 3B2TA 4FIHA 2W1DA 2GFCA 3OBGA 2IW6A 4FGBA 4HNFA 4D1SA 4ZLYA 4YHJA 5JGAA 3E8EA 5KMMA 2IO6A 4QMLA 1QMZA 4D2WA 3P4KA 3R1QA 2WU7A 3SXRA 4CLIA 4GJ3A 4IJPA 3EMGA 4WHZA 3H10A 4DEIA 4EZ3A 1FMKA 2YDJA 4F9AA 5CZHA 3QC9A 3OUNB 4E3CA 5L2IA 3ZYAA 3FI4A 3WF7A 1XO2B 3QGYA 4FV3A 4QPAA 5CAQA 4IWPA 2QOOA 3NAYA 4MWIA 4XP2A 5H8EA 3RAWA 3ENMA 3OWJA 3R7UA 2ZB1A 3S2PA 4AWIA 1U5RA 4LFIA 3TN8A 2UZTA 4PV0A 4J7BA 1VEBA 4FTTA 5D12A 5M53A 4Y95A 2CSNA 4OBQA 4D5KA 4PNKA 2E9UA 3A99A 4GIIA 4LV8A 2VU3A 2WTJA 3AT4A 4XX9A 1QPJA 5DR2A 1WBPA 2XKFA 4G6LA 4L68A 1LR4A 3TV4A 2GNGA 3TZ9A 5B2LA 5DLSA 1L3RE 2REIA 1OKYA 2WMXA 2C0IA 1AQ1A 1GOLA 2I0HA 3BV2A 3TI1A 1BKXA 1Q24A 4E4XA 1YOJA 2P2IA 3AT3A 2UZBA 4L3PA 3ALOA 1BLXA 2EXCX 1W84A 2FO0A 2J0IA 5HIEA 3LXNA 3Q04A 4ZS0A 3L8XA 5K5NA 4FIEA 3BE2A 2WQEA 4AN3A 2B55A 5E8WA 3NX8A 2YFXA 5FWKK 2J4ZA 5BMSA 3EZVA 4L44A 3NEWA 2WHBA 2ZMCA 1H01A 4A07A 5I4NA 3PIXA 1TQMA 3QYWA 5GZ9A 5A54A 1JSTA 4WNPA 4DFXE 4FODA 4H39A 4FSYA 3EQPA 4RA4A 3DZQA 3D7TA 4KABA 3E3PA 1KE8A 4MVFA 3BQRA 4FL2A 4ZP5A 1U5QA 5BYYA 2A4LA 3KRLA 3R04A 1H1SA 3ALNA 5H9BA 4HPTE 1OL5A 4GVJA 3O50A 1UA2A 2PVMA 1FPUA 4EOMA 4XHKB 4UB7A 4J71A 5IH6A 5HESA 4LGHA 2ERZE 3L9PA 3UPXA 3BELA 3KCFA 4QP6A 2WIHA 3F2NA 3CJFA 3VULA 3NUUA 4GFMA 3SHEA 3PE2A 3PP0A 3NZ0A 3MA6A 3C4EA 1V0PA 4F70A 1Q8UA 2JDOA 3ZEPA 4F0GA 3QTZA 3E88A 5KMIA 2VWBA 4II5A 3OCGA 4L67A 4MWHA 3SDJA 4OTIA 1U4DA 4BDBA 2Z7QA 1H25A 5D1JA 4C02A 2W9ZB 4FC0A 5J87A 3SW4A 4UN0C 2VTQA 2YACA 4OTPA 4RIWB 3CCNA 5FEDA 3ET7A 4FTQA 1YXUA 4GU6A 5A4EA 4RMZA 4L7FA 4RRVA 1J1CA 2HY0A 3NRMA 1RJBA 1BL6A 4O38A 4FK6A 4BCMA 4CTCA 4C4FA 3QAME 3ZEWA 4G9CA 2ZB0A 4FT7A 3WIKA 3ZFXA 2A19B 2W1ZA 3R22A 2QQ7A 1XH4A 2O8YA 4QMMA 3Q9XA 4V01A 3C4XA 3AXWA 3V5JA 5HBHA 2QLQA 4ERWA 4DEDA 3UVPA 4IIRA 4CFFA 2W1GA 4FV9A 4ALUA 4JIKA 4MCVA 5DR6A 2ITQA 3FZ1A 4GT3A 4HGSA 4I93A 3QCYA 4RFYA 2VAGA 3CQWA 4LYNA 4PP9A 5J5SA 5J7HA 3D14A 5D7AA 3U8WA 4UMPA 1ZXEA 2R7BA 3GENA 3KF4A 2WD1A 3UBDA 5ETAA 2HZIA 4G3DA 4AOJA 3TG1A 1U59A 4D5HA 2V22A 3SC1A 3QCXA 4WRSA 2QOHA 3VO3A 2XIXA 3A7GA 3HGKA 3C4WA 1UU9A 4OBPA 4JDHA 4YLKA 5KMKA 4FG7A 3O8UA 3PWYA 2RGPA 4P5QA 5AUVA 5LMAA 3ZO4A 3T9TA 4EZ5A 4LV5A 4QP4A 1H28A 2JFLA 2JITA 4IVBA 1MRYA 5TT7A 3ORXA 4AW5A 5K3YA 1UU8A 2YM4A 1O9UA 4M69A 3F3TA 2C5OA 4G3FA 1A06A 3OEZA 1ZAOA 3LCDA 2ZV2A 1NXKA 2E9NA 4N6YA 3D83A 4O0XA 5D11A 1H27A 2QR7A 3O7LD 4Q2AA 3U4WA 2B9HA 3G9NA 4JLCA 3D94A 3PJ1A 3ROCA 3D9VA 2PVYA 4AUAA 1ZWSA 5BVDA 2QNJA 3VS1A 3EN9A 4JJRA 3R9HA 2QG5A 3M1SA 2JKQA 2YIQA 3LFFA 4AZSA 3R9OA 3PVWA 5D41A 4YP8A 4YC8A 3BHTA 2GS2A 3O8PA 4FT0A 1YI3A 2B52A 4M0YA 4MYGA 4DFNA 4MH7A 1PXLA 3QRIA 4FG9A 1JNKA 4EC9A 4ANLA 4RFMA 3U4UA 3LXPA 5FBOA 3OVVA 4IFCA 3CD8A 3RZBA 3WE4A 4LGDA 1YWVA 3MW1A 4FTNA 4ITJA 5L8JA 3TZMA 3VHEA 4ACGA 2Y4PA 2XZSA 4U79A 3DZOA 3LFEA 3PE1A 4I94A 4QQTA 4R3RA 4O0WA 3NUXA 5HE0A 4BDGA 2E2BA 2R3QA 2UVXA 4IEBA 4TW9A 4GCJA 2F7XE 3T3VA 3KULA 4NKAA 3OW4A 2Y8OA 3C0HA 4DBNA 4HCUA 4GK4A 3RAKA 1XWSA 2Y0AA 4TWOA 5I0BA 3FQEA 2H96A 4K1BA 3RM7A 2PE0A 4J52A 2QOIA 4B8LA 3GB2A 3UC4A 2F2UA 4PTCA 3R7IA 3CKWA 1TVOA 5GHVA 1ZZ2A 4ZSAA 2ITUA 2V7OA 1S9IA 1PF8A 2WTCA 3AC8A 3FYJX 3AG9A 3MVLA 1UNGA 4WUNA 1YHSA 2VWUA 3ZLXA 2WAJA 2YHVA 3DLZA 3H9FA 5IISA 1XH8A 3I6UA 3QZFA 4F7LA 4IFGA 4JIAA 1W83A 4FZAB 5H8BA 4BYJA 5IEVA 4M14A 3EL8A 3NPCA 5L2WA 2Q0NA 4BKJA 4Y85A 3U9NA 3LM5A 4NK9A 3MYGA 4XNEA 1MP8A 4CFMA 4D2TA 5LWMA 5AUXA 3FHRA 4L45A 4ZY5A 4X7QA 5B0XA 3MY0A 3NUSA 2ITXA 3R1NA 3R83A 3VBWA 2W99B 4MXXA 3VS2A 3DTWA 2G9XA 3NNUA 5CSVA 2UW8A 1ZZLA 2VX0A 5EM8A 4YTFA 5BQ0A 2P55A 3DTCA 3UO4A 3WYYA 4CFUA 2GNFA 4N0SA 2FB8A 4IZ5A 2C68A 2C6LA 2O0UA 3G90X 4FSZA 2ZDUA 4BCHA 4DEAA 2VTRA 5JQ8A 2O65A 1R78A 2JD5A 3LJ1A 4OLIA 4UMTA 4BYIA 3ZXZA 4C59A 2J5FA 5JMSA 3PSBA 4I24A 2QKWB 4QPMA 4DFYA 4HVGA 4YTHA 2DYLA 4O22A 1YKRA 4EK5A 3ZSGA 4F6UA 5JSMA 2W4KA 4FOCA 4KIPA 5C01A 2BAQA 3Q6WA 3PG3A 5FEEA 3B8QA 5AM7A 2C6KA 3O23A 5AJQA 4XRJA 4DEHA 4HNIA 5JRQA 5LVNA 2VWWA 3MJ1A 4NIFB 4JQ7A 2QURA 1DS5A 3CD3A 4EK8A 2PZYA 2V55A 5L3AA 3U6JA 4BGQA 3WI6A 3SAYA 2BZHB 5KMNA 2GNLA 3EWHA 4MXOA 4CMTA 4F9WA 3CEKA 3I6WA 3D5WA 3ZTXA 3OXZA 3UIUA 4D9TA 2XBAA 3RI1A 1SVGA 3D0EA 3FLQA 4LRMA 4PL3A 4L43A 2V7AA 2X39A 2PE2A 4Y83A 4LM5A 1EH4A 4PL5A 2CGUA 3RCJA 4DLJA 4ZLZA 4HOKA 1GNGA 1A9UA 1YI4A 3I7CA 3W1FA 3F3WA 2VO6A 3FJQE 2UW0A 1XBBA 3CJGA 3MFTA 3OXIA 4IX5A 3FE3A 4BBEA 4JDJA 1Q3DA 2C5YA 5AP5A 5C27A 2YM3A 5BUIA 2YDIA 3E8CA 4EH5A 5CAOA 4U6RA 3C4ZA 3U9CA 2C69A 5ANDA 4C4HA 3ZBFA 3WZDA 3KMWA 4U9AA 3GBZA 4NM3A 1J1BA 4FT3A 5FP6A 4M7IA 4IB1A 1Q8ZA 1Q8WA 5F94A 2I0YA 2R2PA 2XCKA 4IX3A 5FQDC 5BNJA 4DTKA 4KWPA 3S0OA 4O0UA 4A9TA 3VN9A 4YJSA 2QHNA 3R1YA 3R28A 4P4CA 3BYSA 4TTHB 4X2NA 5EI8A 1UU7A 2UVYA 3FBVA 3HX4A 1PYXA 2OFVA 3DBQA 2YIRA 4FICA 4WBOA 2BZKB 2C3LA 4D2RA 5L8LA 3BEAA 3QALE 2QKRA 4ANMA 5CXZA 1H26A 5EYDA 2IW9A 4E5BA 3S95A 3PXZA 3QC4A 4D0XA 3V5TA 1Q8YA 3C4CA 4CYJA 4EOQA 3BBTB 1KE6A 5EDQA 1DM2A 2E9PA 1W82A 2ETMA 3S3IA 5E8YA 2RSVA 3T9IA 4YJQA 4I0TA 3RM6A 2GCDA 3MH1A 4O27B 3UOHA 4RIWA 3BHHA 4O0SA 2R3RA 2UZVA 4JG6A 2OGVA 5FEQA 3MVJA 3LCOA 2ETRA 5C03A 5AM6A 4ZJVA 4CXAA 2PWLA 5IEYA 3PJ8A 2XB7A 5JFVA 4XG7A 2XRUA 1H0VA 2YCSA 4ZJIA 1IRKA 4EUTA 5CASA 2WZJA 5J1VA 5KMLA 4RVMA 4UWYA 2XK8A 3KXMA 5LCJA 5CAVA 4EYMA 1JWHA 3EFLA 3CPBA 3KK8A 3QLGA 3AD6A 3R0TA 1R0PA 2XK7A 3TNIA 4C0TA 2XNBA 3FZSA 4H36A 4MD7E 3OY3A 4RA5A 2PMNX 2VGPA 2EWAA 2PVKA 3WYXA 5T6KA 2R3PA 3BZ3A 4FZFB 4F09A 3D5XA 3OCSA 3COHA 2WMBA 4TZRA 4C8BA 5AMNA 2GU8A 1U54B 5FM3A 2GNIA 5EG3A 5JFWA 4CV8A 3VVHA 3UE4A 3MPMA 3VS3A 3POZA 4O6LA 4MX9A 1K2PA 5IH5A 3PVUA 4AT3A 1YXTA 4BWPA 1OUKA 4UXQA 5AEPA 3FDNA 1YOMA 2OIQA 5LCKA 1JKTA 2CN8A 5L8KA 5IA2A 3NW6A 4L01A 4PPBA 4W8EA 3WZEA 2PMLX 4RWIA 5E91A 2BDJA 3EZRA 3DBFA 2ZJWA 4YSMA 5AV3A 3U6IA 3R7GA 4MD8E 4ACMA 3W2RA 3OP5A 5CEOA 3CP9A 1GJOA 1IR3A 4GG5A 3EOCA 2R9SA 2QOLA 1REJA 5A46A 1HCLA 4EEVA 3E8NA 2GHMA 3O8TA 4YUQA 4UYAA 3EN5A 4FNZA 4BCKA 3IDCA 2C6DA 4AOIA 2OSCA 3RP9A 4AU8A 5A4QA 5IPJA 4WSQA 2PZPA 3HNGA 4I4FA 4YJOA 3BGZA 4BDDA 3E93A 4W9XA 3R7VA 3Q6UA 3TUBA 1R3CA 3PRIA 1LEZA 2NRYA 4BDKA 5JGBA 2X6EA 1OITA 4DH8A 3QF9A 4A4XA 3KXXA 1KE7A 2WMRA 4PNIA 5FD2A 5CF6A 4Q9ZA 5EW3A 3DOGA 3R8ZA 3VF8A 3AGLA 5CXHA 5EK7A 4ZTLA 2VWXA 3DFCB 3D2IA 4TYGA 5DT0A 3RAIA 3RMFA 2XNMA 3K5UA 2X0GA 3VS5A 5IG1A 4ANNA 4UMRA 3UOLA 4AOTA 5HHWA 3GCPA 2VN9A 2JC6A 2GQGA 2WMWA 3P5KA 4FMQA 4G6OA 4KRCA 1UNHA 3ZFYA 4USEA 1TQPA 2CMWA 4L52A 2BFXA 4RPVA 2Z8CA 3E62A 4RQKA 4WSYA 5IA1A 3VIDA 2X7FA 2W1CA 4RWJA 1FGIA 2E9OA 4JR3A 3FY0A 5HVYA 2XS0A 2CGWA 3DQWA 4EQCA 1CM8A 4AN2A 4FKVA 3W2QA 5DGZA 4MNEA 5H8GA 4IDTA 1J3HA 5FP5A 2W0JA 3QWJA 2BPMA 3LPBA 5A6OA 5LOHA 4ZOGA 5EW8A 2PY3A 3UG2A 4RVLA 5AUWA 4HVDA 5B2MA 3MN3A 4M13A 5KNJA 3ULIA 4PY1A 2WOTA 5H3QA 3ZHPC 5KBRA 3OZ6A 2UZNA 4GFOA 4D9UA 5HBJA 2CGVA 1GZOA 3RKBA 4GYGA 1XHAA 1YWRA 3Q52A 2WTVA 3GCUA 2XYUA 3F6XA 3OOMA 4D2PA 3ZOSA 4CFXA 4D0WA 2CPKE 3R63A 5F95A 2WQOA 3CTHA 4J97A 3TV7A 3HV7A 2OZAA 2XP2A 4XYFA 3P0MA 4DLIA 2CJMA 2DQ7X 4ANSA 4V05A 3JVRA 3E8DA 4C2VA 5CY3A 2ITTA 5HO7A 1G5SA 2J0JA 1WVXA 4NWMA 3A60A 4L3LA 5LVLA 4BCOA 2YM8A 2HW6A 4XBUA 3T3UA 2WMQA 4QD6A 4C36A 4F6WA 4PRJA 1YDRE 3POOA 4U97A 4K9YA 4X6QC 3SX9A 4IW0A 2HW7A 4FL1A 5G1XA 5CU2A 3ORMA 1WBTA 4O21A 1TKIA 3O51A 2IN6A 3D4QA 2OXYA 5AR7A 3L9LA 3UOJA 4C34A 3HP2A 4IMYA 3UO6A 1XJDA 1YQJA 3BLHA 3QD4A 2GMXA 4RZVA 5FXSA 4NIFA 4C33A 4Z55A 5LQFA 1R39A 2PZIA 2NO3A 4BC6A 4O0RA 4KS7A 2F7EE 3P79A 3S4QA 5IMXA 5CS6A 3KMUA 3F66A 1YDSE 1ERKA 3K2LA 2PVJA 1CDKA 2KULA 4NM7A 1Z9XA 3JUHA 5J8IA 4BIDA 3RK9A 3ACKA 4WG5A 4BDEA 5HLNA 3IDBA 3ZO3A 3E63A 2OZOA 1P5EA 4C35A 2BHEA 4RC4A 4CQEA 3ORNA 4BDJA 1FINA 5CU4A 5CF5A 3UZPA 4NCTA 3RHKA 4X3JA 4GVAA 5IH4A 3F5PA 3KGAA 4F0IA 3ITZA 5DH3A 2JDTA 3MI9A 3UGCA 4R1VA 3QX2A 3RNIA 4AE6A 4AZWA 3HLLA 4EHGA 1KSWA 3T8OA 5BMMA 3NSZA 3IQ7A 1WBWA 3A2CA 4MBLA 5CAUA 1XH5A 3VW6A 5FDXA 4DH1A 3JPVA 4QMWA 5EOBA 4ZTMA 2UZWE 3IECA 1YXXA 4YZMA 3DKOA 4XOZA 3UYTA 4FBXA 2ZV9A 3LOKA 4HVHA 1BI7A 1IA8A 3C1XA 2OU7A 2C1BA 3GOKA 3GQLA 4G5JA 3V6SA 3AT2A 4PUZA 5HG8A 1P4FA 1UU3A 1Y6AA 3QQFA 3QCSA 3LCTA 2WMTA 2KTYA 1M2RA 3IW5A 4XJ0A 5DPVA 4W4VA 1SNUA 4L6QA 4MK0A 3CTQA 3AOXA 4JS8A 4DFLA 3MA3A 3R8PA 3ROYA 4YJVA 4GU9A 4X2JA 3OT3A 2WMUA 4K18A 1M7QA 2VWZA 3PLSA 4GRBA 3VUTA 2ITPA 3ZC6A 3FZOA 3EN4A 4ITIA 2WB8A 2LAVA 4A9SA 2RKUA 4E5WA 4C61A 2VTHA 3TJDA 3PY3A 1Y57A 4YZDA 3R8LA 3VRZA 1SZMA 4H58A 3OCBA 3FMDA 3C51A 5I9VA 1JSUA 1ZOHA 2G2FA 2IZRA 4MQ1A 4WOVA 4O2ZA 3VRYA 3IO7A 1CSNA 2UZUE 4TRLA 4D4VA 4IAAA 3Q2MA 1URCA 3CBLA 3QLFA 3HMPA 4IADA 4IZAA 4JG7A 4BDCA 4QTEA 4QTBA 4EK3A 5A14A 4IB3A 2RIOA 3KVXA 4GIHA 1Q41A 1ATPE 4GUEA 1WFCA 4DAWA 2W5BA 4GUBA 4FK3A 1ZYLA 3Q60A 5F4NA 2VTAA 4EYJA 2XJ0A 4DC2A 4C3PA 3RAHA 2JIUA 2JKKA 4FV2A 3QWKA 4HGLA 2UZLA 4PF4A 4YR8A 3A7HA 3Q4UA 1XH6A 5TO8A 4U7ZA 2JGZA 4QYFA 5E8SA 5GJGA 4I1ZA 5TE0A 3MGYA 4P90A 4KINA 4X3FC 3BEGA 4I5CA 2WU6A 3CLYA 3W16A 3Q4CA 3ANRA 2BTSA 3QD3A 3QA8A 3FXZA 2R4BA 3R8VA 1U54A 4XG9A 4FOBA 2VWIA 4MF1A 4FV1A 1H4LA 4HPUE 3ZRLA 3KRWA 3OCTA 4I4EA 1F0QA 3UNZA 4F08A 1NVRA 3AC4A 2YCQA 4DINA 4EONA 4FKWA 3G51A 4FSUA 1OPJA 4DN5A 4KBAA 1JSVA 1X8BA 3H3CA 4C37A 5C8MA 3NW7A 2X2LA 3UIBA 3AD4A 3FLSA 2BRNA 5DG5A 4FTCA 3GXLA 3UP7A 4LRJA 3ZUUA 2X2KA 3HMNA 5HX6A 2HWPA 3Q4ZA 1PMNA 3VAPA 4FKJA 4TKSA 3P23A 3VBYA 4CZUA 1W98A 4I5PA 4E6AA 2NP8A 4J96A 2ZV8A 3RPRA 3BQCA 4IC7A 4QMQA 3FZPA 4FUYA 5CAPA 3D5UA 4FSQA 4YO6A 3FSFA 4FKPA 5HLWA 2QI8A 3LE6A 1IEPA 1F3MC 3QCQA 3V8SA 4UZDA 4ASDA 1LEWA 1LUFA 4BCPA 2HENA 4EHEA 1T46A 4XG8A 4RJ7A 4RGJA 2B7AA 4YJRA 2F2CB 4KKEA 5AUYA 4FG8A 2PVHA 4EOPA 2RFEA 3LCKA 5HOAA 4LMNA 3P7AA 4C3RA 3DQXA 2GDOA 2UW4A 1JKSA 4E8AA 4BI0A 3MH3A 2H34A 4PMPA 3KMMA 4DGNA 3FMLA 3EQCA 2C5XA 2XIYA 5BVKA 1SNXA 1WVWA 4OTQA 4J8NA 2C0TA 4S33A 4FZ7A 1KV2A 3NWWA 2ITVA 5ETFA 1OIYA 3R7EA 4ANBA 4L53A 2C3KA 4HZSA 4FSRA 2Y7JA 4EH4A 4JRVA 4WUAA 1JOWB 2RFSA 5CVFA 3QD0A 4N4SA 3DS6A 4FI1A 5HO6A 4OTWA 5EYKA 3Q96A 1O6LA 1ZMUA 2ZAZA 2VTJA 3BU5A 1UWJA 3WOWA 4BTJA 3LJ0A 5M57A 5E90A 3RK5A 4G3EA 4NT4A 2YN8A 4BIEA 1PXKA 3LJ2A 5D10A 2HCKA 2W1HA 4IDVA 4NM5A 3VUIA 4DEGA 2IZSA 2J90A 1VR2A 4DGGA 2RFDA 4BCQA 2YM5A 1VJYA 4U3ZA 5CU3A 2QLUA 3BLQA 3E87A 1PMVA 3ORIA 1FGKA 5D7VA 2PMIA 2OKRA 1YOLA 4EOLA 4O2PA 5CTPA 3ZONA 3A4PA 4M15A 5L2SA 1JKLA 1H00A 3MFRA 3RPYA 3DK3A 3DNEA 5CYIA 2JAMA 1SVHA 4AQCA 4BF2A 4C4EA 3SLSA 4EL9A 3NYVA 1U46A 4F4PA 5JK3A 4MXZA 4NM0A 5HTIA 5E8XA 3GT8A 2XMYA 4GT5A 4ZTHA 5FXQA 3EHAA 5ANKA 5IA0A 4FZDB 1H1QA 2OO8X 4RJ4A 4W8DA 4ERKA 1VYZA 3PPKA 5KKRB 3OY1A 1B6CB 4FTJA 3R8MA 3TNWA 4PTEA 3CC6A 3E64A 4PWNA 5HKMA 2JFMA 3F9NA 2F49A 2OK1A 2WNTA 3E7OA 4DYMA 4FKRA 4BBMA 1UNLA 3QTXA 4KB8A 5K9IA 3PY1A 4DH5A 2FGIA 3CXWA
chains in the Genus database with same CATH superfamily
3FXXA 1URWA 3BX5A 4ZZMA 5IZFA 3NYOA 3UNJA 4BVUA 3PSCA 3N51A 3QRUA 3A4OX 4FV4A 4I22A 2EUFB 3IGGA 3V6RA 4IX6A 4K11A 4O6EA 4EZ7A 3VJOA 5HD7A 1FVTA 2OJJA 4QYGA 4YTCA 5IA3A 3VUDA 5IA4A 2YLEA 3PJ3A 3QGWA 4G3CA 4RIOA 5AR2A 5BVEA 4CT1A 1OKZA 1OI9A 5A4CA 4USFA 4R6VA 4C62A 3PA4A 3KVWA 5A3XA 3IK3A 4DFZE 3OT8A 5JN2A 2VTMA 3QZGA 4ASZA 2XK9A 4D55A 5KMOA 3OG7A 5EH0A 4F1OA 4I6QA 3KXGA 1H24A 3M42A 4FKUA 3UJGA 5E8VA 4FV0A 3IGOA 4LOOA 2ZOQA 4F63A 2XH5A 3NW5A 4QMXA 4E5AX 1R0EA 4M68A 3DXNA 3QQLA 1P2AA 2YCRA 4JRNA 2XKEA 4HCVA 4KRDA 2AUHA 4JX7A 5ANJA 4ZIMA 3ZBXA 4EBVA 2QOBA 3DFAA 3FKLA 4I41A 4RSSA 1ZLTA 4TWPA 3E7VA 1V1KA 3P7CA 3KRXA 3RNYA 3OFMA 5FDPA 1XH7A 5GJDA 2ZV7A 4K0YA 3ZO2A 4NTTA 3TTIA 4B6LA 2J0MB 3KRRA 3WZKA 2GTNA 3MWUA 4H3PA 3SV0A 2UW5A 4D28A 1NVQA 3IOPA 4LI5A 3ZUVA 5J79A 1K9AA 1FOTA 4DH7A 3HRCA 1V0BA 1OL2A 3LZBA 5K4IA 1UKHA 3RPVA 3MBLA 4NSTA 4MNEB 4OTGA 1M2PA 4C38A 3ORZA 4CV9A 3TNQB 2ZYBA 2YCFA 4EH6A 4FVPA 1BL7A 5J95A 5JKGA 4CCBA 3PXKA 4X2GA 4I23A 2XKCA 1J91A 4JXFA 4I0SA 4IWQA 3I79A 4QQ5A 4ZY6A 4IXPA 4NCTC 3EQFA 2R7IA 2UW3A 3BU6A 4AGUA 4QO9A 4K8AA 4U3YA 3LFBA 4FX3A 4BRXA 4BIBA 2BDWA 3L1SA 3ZFMA 3TNPC 3FSKA 1ZRZA 2F4JA 1WVYA 2RFNA 3EQGA 4QP8A 4M66A 3EFKA 2B9JA 4LUEA 4RX8A 4R3CA 3MH2A 4R5SA 4C3FA 4XG2A 2W1FA 3HUCA 4JBOA 3PXYA 4QPSA 3FY2A 2OZAB 4K33A 3F3UA 3R9NA 3ORTA 2QHMA 5DHJA 1ZMVA 5FM2A 4FVRA 5HD4A 3FLZA 4BTKA 4EWHA 1PYEA 4PDSA 1XKKA 4RWKA 5EI2A 5HBEA 3I60A 3R2YA 3COIA 4IAZA 4X2FA 1MQBA 2BVAA 1PXIA 3K3JA 3Q9WA 5I9YA 1M17A 3RK7A 3AMYA 1ZYJA 4YSJA 3KN6A 3ZZWA 2W96B 4O1PA 4O91A 4QT1A 5CZIA 3I1AA 2O63A 4FL3A 2C6IA 3G6HA 2W17A 2VV9A 2CCIA 1W7HA 2XYNA 3LW0A 3C5UA 5AP4A 4ARKA 3HECA 2R64A 4GEOA 5HG9A 4ASXA 3LFSA 5CSPA 2FSTX 5AP3A 3KRJA 4EH7A 5ANOA 5EFQA 3GC9A 4HW7A 2PVRA 3QQHA 3R01A 4IZ7A 5AX9A 1OPLA 4BCIA 3HRBA 5L6OA 5EI6A 3G0FA 5A4LA 2GHLA 3EFJA 2XNEA 5KCVA 4DGLC 3NGAA 3HZTA 3QFVA 2UZEA 4JAJA 4UMQA 4UWCA 1PXOA 3MB6A 2J7TA 3F88A 3H30A 4K77A 4A9UA 2SRCA 1WBNA 4GK3A 3O0GA 4TN6A 3TL8A 3QQGA 3VQUA 5CX9A 2WFYA 4O1OA 1PW2A 2CGXA 3FMHA 4HYHA 4P5ZA 4HVIA 2DWBA 3TIYA 3D5VA 4LL5A 5BUJA 5FGKA 3KA0A 3HL7A 4AA0A 2X8EA 2UW7A 2RG5A 3R2BA 2Z60A 3FLYA 3LM0A 5JGDA 5AV2A 2AQXA 2BAKA 3LMGA 3BYUA 2CKEA 4G3GA 5KHWA 3H4JA 3W2PA 3TKHA 5CEKA 4WT6A 4EH3A 2GPHA 3CR0A 4QMPA 2QVSE 3VC4A 2RG6A 5CEQA 5HIBA 4QRCA 4KNBA 4MKCA 4MXAA 3G33A 4RJ6A 1FMOE 4IAYA 3THBA 4CLJA 3G6GA 3V5WA 3H9OA 4IVDA 4O0YA 1QCFA 4CKIA 2OFUA 4GW8A 2B53A 4KIOA 5CI7A 2JBPA 2B4SB 4XG6A 4EQUA 2G1TA 3ZLYA 3H0YA 2Y9QA 5IMEA 4QP2A 2PK9A 4NU1A 2ZVAA 5I3OA 5ETIA 3GUBA 5HIDA 4RG0A 4F7NA 1JPAA 1RW8A 4RX7A 2ITNA 1LP4A 2GTMA 4RLLA 1PMEA 3DDPA 4BDHA 3JXWA 4JI9A 4ZTNA 3SXFA 2FYSA 5L2TA 3UTOA 5DN3A 2Z7RA 2UZDA 1E9HA 2VUWA 3KY2A 4B4LA 2W4JA 4G6NA 1Q61A 2XNGA 3FQHA 3TCPA 2QC6A 3M2WA 4FV8A 3HVCA 3QUDA 2W1EA 1OVEA 3EN6A 3V8TA 3DV3A 4NUSA 5GZ8A 2ITYA 3LFAA 2X1NA 2YZAA 4G16A 2VWVA 4S31A 3A62A 3KK9A 5DE2A 4I6HA 1OZ1A 3O96A 4O4DA 4KSQA 5AIRA 3ENHA 4ZSGA 5IUIA 1KOBA 3ZSHA 3TTJA 4A4LA 2VTNA 2UW9A 5FTQA 3RBWA 1M2QA 1Z5MA 3CQEA 3A8WA 3DKCA 3AQVA 3VS0A 4AW0A 5A6NA 3NIEA 2ITZA 1OB3A 2X0QA 4JBPA 4KD1A 3RALA 3SD0A 1OGUA 4YLJA 2XNNA 3PA5A 4FT5A 4IM3A 3EIDA 2QR8A 4S32A 3RWPA 4K2RA 3VUKA 2XRWA 5E8ZA 2OW3A 3LFDA 4WIHA 5KBQA 4CFVA 3N9XA 2QD9A 5DWRA 4JDKA 5EDRA 1CMKE 3CTJA 2QODA 4ZY4A 5AV1A 5C8KA 4PQNA 2H6DA 3LFCA 4YU2A 1GZNA 3WF9A 4TWNA 4WNOA 3QBNA 5AV4A 5M51A 1BI8A 4LRKA 4TXCA 2FSLX 2R3HA 3HV5A 2ITWA 3PZEA 5HGIA 3EKKA 5HLPA 2JDRA 5D9HA 4CYIA 2OICA 4EOKA 3P86A 4J53A 4B9DA 5A4TA 1G3NA 3C7QA 3PY0A 4IACA 4RJ3A 3HRFA 4QTCA 1HCKA 1AGWA 3FXWA 3HA8A 3OTVA 2R3LA 3UO5A 1SVEA 3UQGA 5AAEA 3ULZA 1OPKA 4YO4A 2YAAA 5JFSA 5BX0A 4WNMA 2QO7A 3QUEA 1ZY5A 4AGCA 3MVHA 2JEDA 4FKSA 4IC8A 4DCEA 2FVDA 4H3QA 4J98A 3TV6A 4Y72A 4W4XA 1CKJA 3O7LB 5JRSA 5ITAA 5AIKA 2R3FA 5TR6A 1SM2A 4C4GA 3QRKA 4IH8A 4XG3A 3UODA 3VW8A 2B9FA 3Q5IA 5B2KA 4WA9A 4L46A 5ANGA 4BDFA 5IEXA 5LMKA 3QQUA 4IAKA 3JY9A 4AZTA 3BV3A 1NVSA 2W5AA 4G1WA 4EHZA 3LHJA 1IG1A 4EJNA 4QMVA 2YJRA 4W4YA 4RT7A 3ORKA 5ACKA 4EI4A 1PXJA 4I3ZA 5AP0A 2FH9A 2O64A 4MTAA 1K3AA 4QQJA 5JT2A 4ALWA 3G2FA 3ZUTA 3ANQA 4F64A 3CY3A 3PJCA 2XA4A 3HDNA 4V0GB 2VZ6A 4OR5A 4YURA 2JDVA 4QNYA 4RX5A 2QU5A 3HV6A 3DT1A 2A98A 3LAUA 4CFNA 3FMEA 1FVVA 5LWNA 5FBNC 3IONA 3SW7A 3GU8A 5HCYA 3UMWA 4ACHA 3TUDA 4FTIA 5CF4A 3OUKA 1OMWA 2EVAA 5B7VA 5L6PA 2EB2A 3EJ1A 4FIJA 2ITOA 1JVPP 4TWCA 4WBBB 3ZH8A 5I9UA 4EOOA 4YZBA 4EOJA 1ZOGA 3QTRA 3ORPA 4CMOA 3K5VA 3BHUA 2Q0BA 5CQWA 3ZC5A 3CS9A 3G0EA 3D2KA 4RIYB 4JAIA 3PG1A 4BWKA 4AT5A 3OWPA 2IZTA 4RC3A 5EM7A 3VBTA 4KSPA 4WO5A 4EC8A 4IHPA 5LARA 3FV8A 3EQDA 4RVKA 5CEPA 1PKDA 2OJIA 3R02A 3MY1A 4MNFA 5HNIX 4XV1A 2ETKA 5C26A 4F99A 4RVTA 1WBOA 4KKHA 2J51A 3DCVA 4NJDA 5HTCA 3F5UA 4OTDA 3H9RA 2R3GA 3P9JA 3L9NA 4O0TA 2HWOA 4ACDA 4YBJA 2HY81 4M12A 4EKLA 3MIYA 4UALA 3UQFA 2Y4IB 4IVCA 4U81A 4L8MA 3CKXA 3NNVA 4EOIA 4Z16A 3PVGA 5F20A 5HE2A 3A7IA 2AC5A 2PSQA 3QKMA 3R7OA 3VNTA 4CRSA 4ENYA 4WG4A 3BCEA 3WF5A 3NUYA 5BPYA 4BI1A 3LVPA 3R21A 4TYHA 4BTFA 4EK4A 4O4FA 5CNOA 5I5ZA 3ZO1A 2BRGA 2YABA 3OS3A 3GQIA 4DGOA 1JQHA 2I40A 4I92A 3BWFA 1H07A 2I0EA 4IM2A 3RHXA 2JLDA 3BPRA 4AS0A 4D58A 4C57A 3P78A 3LFQA 4R7HA 4OBOA 3LXKA 4A7CA 2C3JA 3B2WA 4M97A 5LVMA 4MBJA 3ZMMA 5BYZA 1KE5A 5M55A 5KMJA 4KBKA 4YMJA 4F1MA 3C9WA 4TYIA 4BCGA 4EUUA 3Q32A 4B99A 5AA8A 4AGWA 5ETCA 4JR7A 4PPAA 2OF2A 1XBAA 4F1TA 2C5VA 4QQCA 3TEIA 3R8UA 4PMTA 4QMYA 2BCJA 4TNDA 2BZIB 3PTGA 2VNYA 3JS2A 2YJSA 3NUNA 5AUZA 3DAJA 4NFMA 2WTKB 3MFUA 2WQMA 5EYMA 5AUTA 3QHRA 4DH3A 1OECA 4ASEA 3QZIA 4C2WA 3HMIA 2J9MA 4KS8A 1ZYDA 5M56A 2C30A 4MBIA 3PXRA 3QXOA 4IANA 4XMOA 5T3QA 1IASA 4DITA 2WQBA 1WMKA 3PUPA 3I81A 4M3QA 1WBVA 2XIZA 2IVTA 3C0IA 5BVWA 1O6KA 4P2KA 3C13A 5HE3A 2VTIA 3P7BA 2JIVA 3C0GA 4AG8A 5CEMA 3DJ7A 3GVUA 3I7BA 4D1ZA 1GIIA 3MDYA 1Q3WA 4UMUA 3DBEA 3VJNA 4D2VA 1ZMWA 2XJ2A 3BYMA 5J9LA 5DRDA 1Y8YA 4LOPA 4RQVA 5HNBA 2WIPA 3FKNA 3MPTA 2PVFA 5E7RA 4CKJA 5HO8A 4BKYA 3DNDA 4NFNA 2V5QA 5EHOA 4TPTA 2F9GA 3NDMA 4USDA 2GNHA 3U6HA 3IPHA 3C4FA 4PMMA 2O2UA 4U42A 5AADA 3E5AA 5I9ZA 3V01A 5M4UA 3BE9A 2J0LA 4XP3A 4XOYA 4XV9A 1S9JA 2WELA 2R3KA 4FV7A 5CVHA 3QTSA 3QTQA 2WXVA 3PZHA 2EU9A 4CFWA 3GCSA 2XEZA 2QONA 2WGJA 2WPAA 4TT7A 2XNPA 4APCA 3R71A 3G9LX 2CCHA 4JOAA 1JKKA 2HZNA 3BBWA 2X7OA 4E4LA 2PHKA 5L4QA 4MD9E 5CALA 3QKKA 4FKLA 5JZNA 4MEDA 4D4YA 4OT5A 4IQ6A 4UXLA 4C4IA 2BTRA 5ANEA 2Y6MA 4BGGA 3TACA 5T68A 3F69A 4J95A 4LOQA 2R3NA 1AD5A 3DAEA 4K6ZA 4TNBA 4F6SA 2X4ZA 4HYIA 5CSXA 4AA5A 5FXRA 4AW1A 5HVKA 1UVRA 3CE3A 4XLIA 4NKSA 4E73A 3R1SA 2XM8A 3V5LA 2PZ5A 4FA2A 3F61A 3HP5A 2J5EA 4R5YA 5JFXA 2YITA 4MXYA 4FNXA 4FTMA 1E1VA 5CENA 4XLVA 2XJ1A 5EM5A 2A0CX 4G2FA 3L8SA 4MAOA 3FMJA 4WG3A 4F0FA 3KL8A 2A2AA 3B8RA 5E8TA 4EHVA 3FWQA 2UW6A 4F7JA 3PA3A 4EQMA 4QTAA 5E8UA 4NW6A 4JG8A 3RTPA 1YW2A 3IW4A 4QYHA 3GC0A 1OIQA 1YVJA 4OT6A 3F3ZA 4I0RA 4YC3A 2QOFA 3Q5ZA 2C6MA 5HICA 3ERKA 2VTOA 5L6WL 3BWJA 2OJ9A 4HJOA 3NUPA 3RCDA 5J9ZA 4RZWA 5HX8A 3UMXA 4P7EA 4AGDA 3FZTA 2UVZA 5AP2A 4D4SA 2BHHA 3PIYA 5TF9A 1GAGA 3GU4A 3DDQA 4CNHA 5IDNA 4ACCA 2WO6A 3EL7A 5EYCA 5JZJA 2ZMDA 5EKOA 3RVGA 2BR1A 1H08A 2R3OA 3ZDIA 5FRIA 3VWAA 3QUPA 3VUHA 3ZM4A 3S00A 5KZIA 1PKGA 3DLSA 3FLNC 2VTPA 3BRBA 4E7WA 4Z7GA 3LQ5A 5EW9A 5KKRC 4L3JA 4JQ8A 3FMMA 3REPA 2BALA 3ELJA 5EDPA 2OJGA 2HZ4A 3KN5A 3EH9A 2H9VA 2QOCA 3LQ8A 3WILA 1M14A 3OD6X 1GIHA 4LQMA 5AV0A 2J6MA 1OL6A 4PX6A 3WE8A 1CKPA 3ETAA 5ICPA 4N70A 4CSVA 3HKOA 3SRVA 3Q4TA 4A9YA 3G5DA 5G6VA 3MIAA 4U8ZA 1KWPA 2IZUA 5HG5A 3OTUA 4BZOA 2JAVA 3TUCA 3WF8A 1RDQE 1KOAA 4CQGA 4F9CA 2Z7SA 4V0GA 4FIIA 3II5A 1BUHA 3RPSA 1CKIA 2VO0A 2X2MA 4FKQA 4Y5HA 1GIJA 1ZOEA 1W0XC 2I0VA 4QMZA 4CT2A 5KO1A 4KIKB 3TZ7A 5DT4A 5IA5A 4UBAA 3U87A 1ZY4A 3MPAA 4FTKA 4DHFA 3VS6A 4QMTA 4UX9A 3UC3A 5LMKC 3KXZA 4E6QA 4FSWA 4JT3A 3DJ5A 3MV5A 4YZ9A 4XUFA 2EXEA 2QOQA 4FTAA 3LFNA 3MVMA 4FT9A 3NNXA 3OBJA 4LGGA 5FLFA 1T45A 4ZZOA 4UWBA 3A7FA 4IE9A 3WBLA 4J99A 3QQJA 2PVNA 4FF8A 4RIYA 3GGFA 3VBQA 2RL5A 2JKOA 4X3FB 4BZNA 3UVRA 3PPJA 1MRVA 4TL0A 3WZJA 4QMOA 4NH1A 5CNNA 4ZSLA 3SQQA 3DK7A 3DKGA 4HYSA 4Z7HA 4BHZA 2GS7A 3KFAA 3FLWA 2PMOX 4NW5A 5CU0A 2ONLA 2OBJA 4W4WA 2BILB 3PP1A 2AYPA 3FI3A 4I5MA 5AR4A 2V0DA 5IUGA 5AP1A 2ZM4A 3IKAA 3IW7A 4YPSA 3RJCA 3FMKA 4ITHA 4FIFA 1Z57A 5DVRA 2WOUA 4LUDA 5DEWA 3BGPA 4ZSEA 2WMVA 2QO9A 2W4OA 4BN1A 4J8MA 4BZDA 3VS7A 3NS9A 3EN7A 4OW8A 4ZSJA 2ZDTA 2GHGA 4FEQA 5CI6A 5LJJA 3GOPA 4AACA 4QMNA 3DK6A 3WARA 3QTWA 4OTFA 4UYNA 4E1ZA 1PHKA 1M7NA 4M0ZA 3EQBA 4D4RA 3UNKA 3AC5A 3CQUA 4GMYA 4FNYA 2CN5A 3K54A 3E3BX 3MTFA 3GFEA 4OUCA 4ZAUA 4OAUC 1Q5KA 4QP1A 5DFPA 4FSNA 2FSMX 3DA6A 5E92A 3QHWA 3BI6A 4YJUA 3HMMA 4CKRA 4XH6A 2IWIA 4WNKA 4CMUA 4BDAA 4YZCA 3ZDUA 4ENXA 4H1JA 4U0IA 3QRTA 2CLXA 5CSWA 4UEUA 5HTBA 3KXNA 4H1MA 5DOSA 4O4EA 4ZJJA 1H0WA 3CY2A 3UDBA 4EKKA 4M84A 3W32A 2OI4X 4LMUA 1OIRA 3BHYA 5AAGA 5FTOA 4R3PA 3MS9A 2O5KA 4JVGA 5AX3A 2HYYA 5HI2A 5HEZA 4HZRA 1NA7A 2XUUA 3GU5A 4M8TA 2QU6A 5M4FA 4JDIA 3AGMA 2GFSA 5K0XA 4CCUA 2ERKA 2R3IA 2VO7A 1M52A 4KAOA 3QA0A 4KIQA 3TJCA 4AXAA 3HMOA 3KC3A 4X21A 3OOGA 4FYOA 1DAYA 5CANA 3PXFA 3FHIA 4WKQA 4FV5A 3R30A 5IF1A 2IEWA 2PVLA 2VNWA 4NJ3A 5EKNA 1W8CA 3DPKA 5HORA 2BRHA 4OGRA 4D2SA 3OEFX 4R7IA 3CGFA 4YC6A 3EQHA 3EQRA 4V04A 3QXPA 2BZJA 4BICA 4JBQA 2W7XA 1E1XA 1O6YA 3RWQA 3OMVA 4Z3VA 2BFYA 2YISA 2WEVA 3OW3A 4ZTSA 4DGMA 4U43A 2BDFA 3QYZA 3ZU7A 4FSTA 1ZARA 4F7SA 4BI2A 5DMZA 4NZWB 2BIKB 4ONAA 3Q3BA 4YNOA 2HK5A 3Q9ZA 4AX8A 4W9WA 4XG4A 3V51A 4EH9A 3WZUA 1JBPE 4OTHA 5HCZA 4B7TA 3BYVA 2IVSA 3R7YA 1Q62A 5K4JA 4N6ZA 1Q99A 1OKWA 4CD0A 4OAVB 5BVFA 3OWLA 3DBDA 5CLPA 5M4CA 3GP0A 1BYGA 1PXPA 2NPQA 1P14A 2OH4A 2H8HA 3DU8A 4AW2A 1H1PA 4YGAA 2BRBA 4PDPA 2HZ0A 1QPDA 5CEIA 2RF9A 4FV6A 4S34A 4PMSA 2W1IA 1XBCA 2IVUA 3ZRMA 1FVRA 5HNGA 1SYKA 2W06A 3DB8A 4G5PA 4U45A 4QTDA 5LXMA 4C58A 4TYHB 4BB4A 3UG1A 3L8VA 3HV3A 4MQ2A 1DAWA 4GH2A 2IF8A 2VX1A 4RWLA 3V8WA 4WRGA 4AF3A 3KCKA 1YHVA 2HAKA 4S2ZA 4B0GA 4PTGA 2QOKA 2R5TA 3R9DA 4C4JA 3TKUA 2X9EA 2XNOA 2BRMA 3MJ2A 5EOLA 4AZVA 3W10A 1OKVA 2IJMA 2LGCA 3HUBA 1GZ8A 2OIDA 4RIXB 4BTMA 4HGEA 3C50A 3NIZA 4FVQA 1PJKA 3MFSA 3TZ8A 2CDZA 2YIWA 1MQ4A 4CVAA 5A9UA 3BGQA 3F5XA 4EH8A 2B1PA 3ZSIA 3KXHA 3IW8A 4DEBA 1UKIA 2X81A 2B9IA 1JAMA 4CZTA 1H8FA 1MRUA 2HIWA 4ALVA 1WZYA 4IM0A 1Y91A 2FSOX 3JYAA 4I6BA 3QKLA 3NLBA 3EFWA 3R73A 3W2CA 4MF0A 3IS5A 4YPDA 4E26A 1YXSA 3QX4A 5LVPA 1B38A 5HU3A 3BHVA 3W18A 2Y6OA 3NYNA 5GZAA 1YHWA 4G17A 4R8QA 2W05A 4A9RA 2HXLA 1OL1A 4TYJA 3ZZEA 3GC7A 4QMSA 3WIGA 5HQ0A 4JX3A 4J1RA 2XKDA 3VUGA 4BKZA 4IVAA 3VBVA 4A4OA 3SOCA 2BAJA 2ACXA 2BMCA 2C47A 4U80A 3ZLSA 3QQKA 5AR8A 5H2UA 2V62A 4KBCA 2P3GX 3UVQA 5DIAA 4G9RA 4YBKA 3M11A 3PXQA 4HCTA 3L8PA 3O17A 5AA9A 4FKIA 3Q9YA 4QP7A 4FIGA 4PP7A 2BROA 2EXMA 4RJ8A 3W55A 3S1HA 1W2DA 5F1ZA 3V5QA 2YWPA 1PXNA 2G15A 2R0IA 2C1AA 2YIYA 3PYYA 4AN9A 3W2SA 1MUOA 3PWDA 4JL9A 4ANOA 5C8NA 3GEQA 1OM1A 3FZRA 3NAXA 1FQ1B 2J50A 4B8MA 4E6DA 3R00A 4IBMA 5BVOA 5KX8A 5AR3A 3W8LA 5E1EA 4YTIA 2X6DA 3ZCLA 2C3IB 5KHXA 2DUVA 4GV1A 4KA3A 2C0OA 4L7SA 2XBJA 3DB6A 4YJNA 5JH6A 4XP0A 3ODYX 5AAFA 5M4IA 5KZ0A 2JIIA 1XH9A 1Y8GA 3VHKA 5IDPA 2VTSA 1OUYA 3SOAA 4JBVA 3TNHA 2GSFA 2GNJA 4FTUA 4RJ5A 3P1AA 1I44A 2VTLA 2WTWA 3CPCA 3OROA 1STCE 4KIKA 4X0MA 1PXMA 3MY5A 3FI2A 4TY1A 3AMAA 4AT4A 3DKFA 3IDPA 3IW6A 4EK6A 3UPZA 4PDOA 5EHLA 4CTBA 4PL4A 2WMSA 3PRFA 1UV5A 2OXXA 3BU3A 4Q5HA 3DY7A 2XVDA 3LIJA 4L42A 4YJTA 4Y5QA 3NCZA 4Y8DA 3ZLWA 4ZLOA 1P4OA 3TKIA 4X3FA 3IG7A 2AC3A 4CEGA 2VRXA 4RFZA 5CVGA 5DEYA 2VTTA 5TKDA 4AFEA 3R6XA 4GJ2A 3COKA 1YRPA 3JY0A 5CQUA 3LLTA 2X8DA 2YAKA 1H1WA 2BKZA 3BYOA 3HA6A 4XCUA 3NR9A 3GU7A 5I9WA 3W33A 4BWXA 3QTIA 3MSSA 2YA9A 1WAKA 2X7GA 3ORLA 4ZXTA 3NCGA 2XCHA 3UOKA 3LCSA 2W5HA 2R3MA 1GZKA 5FG8A 4BDIA 5EHYA 4RLKA 4Y73A 2PUUA 3F2AA 1TQIA 1HOWA 3RINA 3I0OA 1QPEA 4E93A 3A61A 2WMAA 4OTRA 3COMA 3GFWA 4GFGA 3ZRKA 2XK4A 2OIBA 4D1XA 1KV1A 3DGKA 3NNWA 4UY9A 2XIKA 4XEYA 3I0QA 3FL4A 3KEXA 3VBXA 4IB0A 1WCCA 4QNAA 3PFQA 5DR9A 4FKTA 5DI1A 2J2IB 5HZNA 4YHFA 4GL9A 3TWJA 2ONLC 2WKMA 1I09A 5CWZA 4I5HA 4PPCA 1Q97A 4RC2A 5HU9A 2WTIA 3FUPA 4L9IA 4CZYB 4EWQA 1YDTE 2C6EA 2P2HA 4XRLA 5I3RA 5M44A 2UV2A 4NEUA 4BHNA 3OWKA 3UIMA 2X0PA 3P08A 1JLUE 1WBSA 2HELA 2A27A 3RGFA 4UZHA 2Y4IC 2YERA 1NY3A 4IWOA 4XV2A 3ODZX 3RPOA 5BVNA 3BIZA 2IW8A 2JBOA 4Y46A 4ZZNA 3D7TB 2NRUA 3DJ6A 4FUXA 1SMHA 2E9VA 4X6RA 5HG7A 4AFJA 3IOKA 5IUHA 3SRVB 4HVSA 2O3PA 3VQHA 4XBRA 3UQCA 5HCXA 2CHLA 5JEBA 2P4IA 4HYUA 4FYNA 5AR5A 2XEYA 4QYYA 3UP2A 3VF9A 4CRLA 4F65A 4EOSA 3CGOA 2G01A 3PIZA 4G34A 2G2HA 3NYXA 4AE9A 3SVVA 5IU2A 3KKVA 1H1RA 3FL5A 1BX6A 5I9XA 3E92A 5ACBC 5HVJA 3FYKX 4GYIA 1BMKA 1OIUA 4IB5A 2YM7A 4Z9LA 1PMUA 3VS4A 3PVBA 1VZOA 3EB0A 2CLQA 3FAAA 1F5QA 3SA0A 1CTPE 1XQZA 3PPZA 4GS6A 1Y6BA 5DBXA 5E1SA 2Z2WA 1UWHA 2I1MA 2VX3A 2C6OA 3OXTA 5AP7A 1QL6A 5DA3A 2JKMA 3QZHA 3HV4A 4I6FA 4ZEGA 3AD5A 4O96A 5J9YA 4FKOA 2EB3A 5CT7A 2VO3A 4BCJA 1KE9A 4BCFA 2WTKC 4G31A 2C5NA 2ESMA 3KQ7A 4FZ6A 4LG4A 3DBCA 1DI9A 5AWMA 5LVOA 4QOXA 2GS6A 3BLRA 4EH2A 3UYSA 3QTUA 3QU0A 2OXDA 5J7BA 3MB7A 3TIZA 4F9YA 3D15A 3BKBA 3EYGA 4FTOA 2XK3A 3EKNA 2FUMA 4YJPA 2P33A 3KF7A 2UUEA 3FC2A 3QL8A 1RE8A 4FKGA 5DT3A 1Q8TA 2YM6A 3K3IA 2WTDA 5CT0A 5CF8A 3KU2A 3SKCA 2R3JA 3U51A 3I5NA 2HOGA 5L2QA 4IJ9A 3HEGA 5KE0A 2BUJA 2DS1A 2WEIA 3AMBA 2PE1A 4C7TA 4U41A 4DEEA 4JQEA 2P0CA 3F3VA 2F57A 4APPA 2F7ZE 4FTLA 2OG8A 3ACJA 4GK2A 4XS2A 3AC3A 3ZS5A 1YXVA 4I20A 2WQNA 3F5GA 4JNWA 4GSBA 4QYEA 5K0KA 5K5XA 2JDSA 3Q53A 4E6CA 5CU6A 3FQSA 1OL7A 1V0OA 1VYWA 2IVVA 4M69B 3FKOA 4RIXA 4M67A 2VGOA 1REKA 4KKGA 3A8XA 4EORA 1Q4LA 4YHTA 2YDKA 5C9CA 1ZYSA 2R0UA 3UIXA 3TXOA 5BUEA 4O0VA 2A1AB 1APME 2OF4A 3DAKA 4BFMA 4E4NA 3I5ZA 3D7ZA 2ZM1A 3F7ZA 4DG0E 2OJFE 4F9BA 2XF0A 4NTSA 2PTKA 5GNKA 3V5PA 3OC1A 3F82A 5TOZA 4IAIA 1YI6A 1DI8A 4S30A 3GU6A 4DG3E 2G2IA 4QP9A 3PJ2A 4IZYA 4BL1A 2QO2A 3O2MA 3QD2B 4ID7A 4WD5A 5AUUA 4E4MA 2PZRA 2BIYA 2C4GA 4RBLA 3EQIA 3I4BA 3MH0A 3OF0A 4XV3A 1R1WA 3SXSA 3V04A 5J1WA 4H3BA 4IWDA 3LXLA 5C1QB 3A7JA 4QP3A 4ANQA 4AP7A 2VD5A 3MTLA 4YNEA 3JVSA 5CSHA 1LPUA 5EM6A 2UZOA 4U44A 4ZTRA 5F9EA 1RQQA 2OH0E 4GT4A 1XR1A 5IKWA 3ZXTA 5GJFA 2XK6A 4FR4A 5DNRA 1PY5A 2OWBA 1B39A 3KULB 4IX4A 4TYEA 2HXQA 2X4FA 4AAAA 4EBWA 5LMBA 3OHTA 4MXCA 3GCVA 4MHAA 2Z7LA 4U5JA 4DG2E 4ZTQA 5J5TA 3KB7A 5DRBA 2PL0A 2X8IA 2I6LA 3H0ZA 4I21A 4AA4A 3GNIB 3O71A 1YWNA 1ZYCA 4L00A 3W2OA 4E20A 2YIXA 3PSDA 2XIRA 4R1YA 3GI3A 5HE1A 2B54A 4GG7A 3WF6A 4YZNA 3QRJA 3L9MA 3TT0A 1QPCA 2YLFA 3F7WA 4UV0A 5ANIA 2VWYA 4YLLA 3CIKA 4QMUA 4Q5EA 4BBFA 2FA2A 4ZK5A 4AZFA 3AC2A 3W8QA 4BGHA 3AC1A 3UZTA 3FC1X 2YEXA 5AP6A 3FPQA 4HGTA 3V3VA 5KUPA 4U40A 3HDMA 4FNWA 3VUMA 2ZM3A 4FSMA 3GCQA 4BCNA 3GC8A 3HYHA 5JQ5A 2C6TA 3FMNA 4LL0A 4FTRA 3RZFA 4A06A 4IAFA 2QCSA 4RX9A 2J0KA 4AZEA 3FPMA 2W9FB 3EYHA 2X9FA 4X2KA 1GY3A 2XM9A 4Q9SA 3B2TA 4FIHA 2W1DA