5AR5A

Rip2 kinase catalytic domain (1 - 310) complex with benzimidazole
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
284
Chain Sequence
EAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMEGGTIIYMPPENYEPSIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 284
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar5A00
3BE9A 3F5UA 3QFVA 3ALOA 4QMVA 2Y4IB 5TR6A 3PP0A 4RC3A 4DGMA 3F5XA 5C03A 5LCJA 1TQMA 3PFQA 3A4OX 5ACBC 4JBVA 4XP0A 3VULA 4LL5A 5M57A 4I41A 3C9WA 3ZXTA 2CGUA 3E3BX 3FMEA 3H9OA 2XA4A 4CD0A 2KULA 3P7CA 4ANOA 4W8EA 3QX2A 1KV2A 4W4XA 3S3IA 3VBYA 2WTDA 1P2AA 3C51A 4I5HA 3NCZA 2C6TA 3D7ZA 2OF4A 3E8DA 1OPLA 3MI9A 4D28A 3HRBA 4V0GB 1XHAA 3A4PA 5L2WA 2Z7LA 2AC5A 2HY81 3ORZA 3I7BA 3R7YA 1PXMA 5FRIA 4ZY6A 3ORXA 4PMTA 4RVLA 3KXHA 2UZUE 3FY0A 4FG9A 2CKEA 4CTBA 4PNKA 1WBNA 4RWKA 4JR3A 5L2SA 1M7QA 1GNGA 3MY5A 5CSXA 4C4GA 4FOCA 5ACKA 4UWBA 1O6LA 1ZY4A 4XOYA 5CT7A 4ZXTA 4BCOA 4BHNA 3NGAA 3F69A 4J96A 4BZNA 3HNGA 2FH9A 4N6YA 4D1XA 2OWBA 3UYTA 5AIKA 4CNHA 3U51A 3TIYA 2QVSE 3LJ1A 2GTNA 3R30A 3MVHA 1M2PA 5CF5A 2YWPA 4KSQA 1CKIA 3ZO4A 2XJ2A 2G2HA 5HICA 5BVEA 2YJSA 3QLGA 1SNUA 2XM9A 1UVRA 2YZAA 3IONA 4G16A 2IVUA 3AXWA 3QUDA 2X2KA 3PJ8A 2BIKB 4C58A 1J1BA 3VVHA 3DAKA 3TKIA 5M4CA 3VQHA 1Q8YA 2P2IA 1WAKA 5GNKA 5BUJA 2AC3A 2UV2A 3R21A 3RKBA 3FMJA 1WBOA 1GAGA 4U81A 5GJGA 4ALWA 4B7TA 3ZZWA 4YO4A 5K9IA 2OG8A 5FTQA 3VUGA 4U3YA 5BUEA 4S31A 4UMRA 3WF8A 2PE2A 1H27A 4FV1A 5AV2A 5HVYA 4O38A 1FVVA 3ETAA 3MY1A 3SW7A 3BE2A 4FTQA 2CN5A 5HIDA 1H08A 3E8CA 4F70A 3S95A 3RAHA 1UWJA 4A9TA 5G6VA 1ZYLA 1YRPA 2R3NA 4FT7A 4ZZMA 5E92A 3UOLA 4EI4A 3ZONA 5I9YA 4BCPA 2XKDA 2ZVAA 3R9DA 2G9XA 4FSWA 2JDOA 3IDCA 1AD5A 2CCHA 4G6LA 5BNJA 2VWZA 5AR2A 3NEWA 1WZYA 2PWLA 4H1JA 4YPSA 5FQDC 5B7VA 3TEIA 3VS2A 2JKQA 5EHLA 2VO3A 4F7JA 2F7XE 4TWPA 4TRLA 1OKVA 4FL3A 4IWDA 4ARKA 4CCBA 1H1WA 4YTHA 3HUBA 4EHEA 4FBXA 4I92A 2BRHA 3PSCA 4RA5A 3WILA 5HCXA 4P5ZA 4FZ7A 1KE8A 4L00A 2YM4A 1Q4LA 4O27B 5DBXA 1WCCA 2EUFB 4YP8A 3OROA 5KCVA 3BHYA 2IW6A 4R5YA 1JPAA 2J9MA 2XRWA 3F3UA 5AR7A 4TTHB 3O71A 5FXSA 3MH3A 4LMNA 4I6BA 3FKLA 3TZ9A 2IZRA 1O6YA 4L53A 4EBVA 2PHKA 4QMOA 5CVFA 4FV3A 4UMTA 3GFEA 1UU9A 4K18A 3AT4A 5HG7A 3QRTA 4LFIA 5TT7A 4M8TA 2ZMDA 3BWJA 4QNAA 3MBLA 3NDMA 3ZS5A 4U42A 4AW2A 5LVLA 4EWHA 1Q99A 5FDPA 2GTMA 3AC8A 5K5NA 4QP3A 1QL6A 4N0SA 1WVXA 3VS4A 2RIOA 3LW0A 5CSPA 3GQIA 2W99B 3TUDA 4FTMA 1JKTA 2ITUA 2WTWA 3RK5A 2UUEA 2W05A 3R8ZA 3W8QA 4EOKA 3GCUA 4D55A 3R1SA 3N9XA 3OT8A 3QUPA 4FICA 3VBVA 4XG9A 4S34A 2O5KA 1R3CA 4ITIA 4DAWA 3GGFA 1REJA 3CKWA 3A62A 2E9PA 5LVNA 1YOMA 4AXAA 3ZFMA 4FNWA 3AMAA 4JXFA 4FT3A 5DWRA 4V04A 3FMLA 2BZHB 4JS8A 4KKGA 5DR2A 4C4IA 3DGKA 3BEGA 3O50A 3NAXA 2FO0A 2VRXA 5JQ8A 2F2CB 2UVYA 5HO8A 3E7VA 3HEGA 4JL9A 4WRGA 4QT1A 4C4JA 3PUPA 5I3RA 2O8YA 3AGMA 5CU2A 4I94A 1OL5A 4I5PA 2VTJA 2IZUA 4TYIA 4PF4A 3JXWA 4CEGA 1YXUA 4IAIA 2ZM4A 3D14A 3Q52A 3FXZA 1U46A 3BBWA 2HK5A 1B6CB 4AAAA 4IX5A 3KB7A 2QCSA 3O17A 3NCGA 4DH3A 3MYGA 5K3YA 4YTCA 3DB6A 4I0SA 1YW2A 4YC3A 5FM2A 3RK9A 1BI7A 3SXSA 1Q41A 3UNZA 5AX9A 4HZRA 2NRUA 3DDPA 4QP9A 4BRXA 5BYYA 4X21A 4BDBA 2CDZA 4QMNA 4M68A 3U9NA 3KL8A 2REIA 4FKQA 4QNYA 1PXLA 3EYHA 4ZTMA 4O2ZA 5E1SA 2ZAZA 4E93A 2XK8A 4ZP5A 4PMPA 4O0XA 2B9HA 3GU4A 3P0MA 2OU7A 4UBAA 3PPZA 4FC0A 5GJDA 3ZLXA 4DEHA 3GU6A 4S32A 4IZYA 3C4EA 3UOJA 3FY2A 4PTCA 3ZH8A 1UU8A 4BDIA 5AUUA 2WQOA 5CU0A 2J5FA 4IEBA 4EBWA 3UG2A 3WE8A 4NEUA 3V5LA 3GU7A 3GCVA 4RZVA 4UXLA 5DE2A 3WF5A 1Q61A 2VV9A 4NCTA 3UE4A 3AG9A 1OL2A 1OUKA 5I9UA 5AX3A 2J0LA 5ANEA 4J52A 5KBQA 1ZMVA 2GNIA 2UZTA 3ENMA 5HE1A 3W33A 4BN1A 2XNPA 3VO3A 1OL1A 4QO9A 4EOIA 2GSFA 4D2TA 2X8IA 1UU3A 3CCNA 1IRKA 3VAPA 3CQWA 5A9UA 2BILB 4MNEB 3R7EA 1H24A 3FL4A 4FIJA 2WMRA 4PPBA 4WG5A 4YPDA 3TKUA 2BRGA 2V0DA 2QOQA 2W1ZA 1V0OA 5EI6A 5AP0A 5HE2A 3PXKA 1NVSA 2VTAA 2YN8A 1PXOA 5CY3A 1GIJA 5HLWA 2FSTX 3AC5A 4HCTA 4PL3A 4R5SA 2GS2A 3ZDUA 3HX4A 3EQFA 2W1EA 4MX9A 3FL5A 5F20A 2UZEA 3O8PA 4YTFA 3D5UA 2ZJWA 1YHVA 4I5MA 4ANMA 4C8BA 2HXLA 5IF1A 4ONAA 4ZLOA 1W8CA 3NAYA 3JYAA 3OW4A 4TYJA 3P9JA 3FV8A 5E8XA 3DOGA 3NW5A 4IAAA 4L42A 2IWIA 4FT5A 2X7OA 3H3CA 4XUFA 4EHZA 3R6XA 3R63A 1PYXA 5B0XA 3VWAA 3RAIA 4GIIA 4UALA 3HV4A 5DGZA 1XH9A 4RLKA 2JLDA 4RC4A 5A6OA 3UYSA 3CY3A 2JDTA 3DBQA 3PWDA 3HLLA 3QGWA 4U40A 3RPSA 3LZBA 4DEGA 2RFDA 3RPOA 5T6KA 5ICPA 3R8PA 2XIRA 4HGLA 4L7SA 4L44A 4IZ7A 2AUHA 2JFLA 4GJ2A 4I1ZA 3V5WA 4AOTA 4FTIA 4O21A 3AMBA 2DWBA 5JRSA 4AN2A 3VS0A 3E7OA 4G9RA 4YO6A 1YOJA 3RGFA 1OIUA 4PDPA 4UZDA 3FSKA 4W9XA 3QKKA 2C0TA 4MNEA 3R7OA 3NW7A 3BPRA 3M11A 4TKSA 4ASZA 3TNIA 1MQBA 2QR7A 1HCLA 1PMVA 2P3GX 2WU7A 3PXFA 4WNPA 4EK6A 1Y91A 4ACDA 5JH6A 1REKA 4K11A 1ZXEA 2IZTA 2YM7A 4NJ3A 4YJQA 4EEVA 4JX7A 3KU2A 5EH0A 4L68A 4JBOA 3E88A 2C6KA 3FMMA 4A06A 2FB8A 3Q9WA 4YMJA 4G9CA 2JIVA 4X2JA 2OI4X 3PXRA 2C5VA 4ANLA 2VGOA 4NJDA 3O7LB 2W9ZB 4C36A 3LOKA 4IXPA 1U5RA 3BYOA 5EDRA 4DGLC 4FSMA 5IZFA 3W2PA 4D4SA 2UW6A 5LJJA 3R1QA 5AP3A 5M56A 4PTGA 4E8AA 5F94A 4FSUA 4NFNA 4HNIA 3FXWA 3D7TB 4WHZA 4V05A 3DKCA 4BZDA 4G3CA 3QL8A 4OTDA 4WT6A 4D5HA 1VYZA 3F3TA 2BAKA 3KXZA 3LAUA 3MA6A 4FVQA 4X2FA 5DNRA 5HTBA 4XLIA 2J5EA 3GOPA 3DLZA 4GIHA 3U4UA 3DPKA 2BHEA 3IW8A 3NYNA 3G90X 5JEBA 5DR6A 4XRLA 1R1WA 3L8PA 3ODZX 4DH7A 5EKOA 5KMNA 5KHXA 4Y5QA 1IG1A 4CZYB 3FI3A 5KKRC 4FKTA 2VO7A 3V5TA 3OWJA 5EOBA 3TTIA 5EDQA 4LYNA 5LMAA 1KE5A 2YCFA 3QD2B 4AGCA 3ORIA 4FZ6A 2EU9A 1H25A 2XZSA 4JDJA 4RRVA 4FSYA 4NM7A 4ZS0A 5LQFA 3DBDA 4MBLA 4HGEA 1OVEA 4AT5A 3QHWA 3PYYA 3MGYA 5JKGA 3ANRA 3PY0A 3E87A 4FNXA 4ZTQA 3ACJA 3BELA 2Z7RA 5B2KA 1GIHA 4BGGA 3MPTA 3QZIA 4L9IA 3LCDA 4JRVA 1OPJA 4UMQA 3R9HA 3VQUA 1LPUA 3RMFA 1DI8A 3QWJA 2PMIA 2IW8A 2JD5A 3W2SA 4NK9A 3MJ1A 4UN0C 5T68A 2R3LA 2XKEA 3COKA 3SQQA 3I6WA 3FKNA 3ZSIA 3QD0A 1M14A 3TXOA 4DTKA 1CM8A 1JKKA 3KEXA 4AT3A 4DH5A 2JBOA 4OTWA 4IM2A 4MCVA 5M4UA 3NYOA 4D4VA 2E9VA 4D2WA 5DRBA 3VF9A 2AYPA 1IA8A 3A2CA 2QR8A 2WMWA 3FAAA 5DRDA 4KBCA 3WZEA 4AE9A 4CQGA 5CTPA 4LUEA 2J0MB 3AD4A 3C7QA 4GEOA 1CMKE 4FGBA 3EQPA 1PMEA 1WBTA 5F95A 5AV3A 2PK9A 3ERKA 4BBMA 2A4LA 2ZV9A 3LFCA 5AP1A 3HDMA 3GFWA 3VBXA 4XV2A 3V01A 4GUEA 3NX8A 4LRJA 2OFUA 4LV5A 2BHHA 3ZUVA 3PLSA 2PVHA 4DBNA 4USFA 2A27A 3E64A 4M15A 2QOFA 4E73A 4M67A 1OL7A 5HVKA 5HG9A 3O23A 4OT5A 3C50A 4GG5A 4TWCA 3HMPA 3BI6A 4O0WA 4WD5A 5BMMA 1OECA 3KN5A 2CN8A 3OBJA 2EWAA 4MAOA 4C02A 2XK4A 3A7FA 1UKIA 4S2ZA 3NUNA 3BV3A 4YJRA 4GMYA 3L9LA 3UG1A 3U8WA 4B99A 5LXMA 1BI8A 5TKDA 4O0TA 5JN2A 2ITPA 2XNEA 3FHRA 2GPHA 4D2VA 3PXYA 3W16A 4X3FA 1BMKA 3PXQA 3L1SA 2WTIA 3ULZA 5LVMA 4KKEA 3FQHA 2YAAA 3OY3A 4WSQA 4BIEA 2X6DA 5HI2A 5CS6A 4USEA 3G2FA 2ZV2A 2XVDA 3QKMA 3Q6WA 5HEZA 4CV9A 3ZHPC 2C3JA 3VBQA 4DINA 4FMQA 5D9HA 5EDPA 4ZTNA 2VWBA 5DT3A 4EK5A 5F9EA 1JBPE 4CT1A 5IMEA 3VUHA 1FVTA 2GDOA 4J71A 3DU8A 5A4EA 2OZAB 2PY3A 3MFRA 4J7BA 4FI1A 4I22A 4TN6A 3ZYAA 3NRMA 4ENXA 2R3PA 3BYSA 4HVSA 3DBCA 3GU5A 3FQEA 3OOMA 4L46A 2WGJA 2VTHA 3CBLA 1MRYA 2SRCA 3F3VA 4H3QA 2DQ7X 2QNJA 4QP6A 5DIAA 2JEDA 3PVBA 4PL4A 4OR5A 5EYMA 1MRVA 2X9EA 3W10A 5FEQA 2QOCA 4XEYA 3VS5A 5AUZA 4FTNA 4BI0A 1H00A 4WO5A 4EL9A 5IDNA 1M2QA 3ZO3A 2WMXA 2UW4A 4EKKA 4JDIA 3F82A 1OL6A 5C26A 1SMHA 3QWKA 3IOPA 3R7UA 2GNFA 1IEPA 2EB3A 2C3LA 4G3DA 5EHYA 4A07A 5D41A 3ET7A 5IG1A 1GIIA 2XS0A 3OXZA 4W8DA 4RJ6A 3UP2A 5AR4A 4Z7GA 3MA3A 4J53A 3MB6A 5AP6A 4AA5A 4S30A 4IVDA 4XOZA 1KWPA 5AP5A 4TYGA 2IVSA 4LMUA 5CEKA 3IW6A 4OTFA 3P1AA 5AV1A 2YHVA 5A4TA 4AACA 4JVGA 5AM7A 1KE9A 4QTCA 2O65A 4JLCA 4F6UA 3OZ6A 4RX9A 3CE3A 5AJQA 3NWWA 2OZAA 4HOKA 4XG4A 1R78A 2GHMA 5JSMA 5DT0A 4U45A 4M14A 4C57A 5FDXA 1OMWA 4FK3A 5HX6A 4IJ9A 1YWRA 3DS6A 2JAMA 4JQEA 4MXCA 3VBTA 4HYSA 1H28A 3KY2A 2BZIB 2GHLA 5CU4A 3QQJA 3NNWA 4EOSA 2X9FA 5EFQA 5AMNA 2W5HA 1OIQA 3QQUA 1GZ8A 2WELA 4MD8E 4F99A 4GS6A 4F0GA 4IADA 2ZV7A 3CQEA 2GS6A 4FKVA 3IGGA 2XK9A 3G0FA 4FUXA 4XG2A 4F08A 3R1NA 3O2MA 1VEBA 3QLFA 3HZTA 3N51A 5M55A 1BX6A 1YXTA 3V8TA 4M84A 4L3JA 2HXQA 4F09A 2P33A 2QKRA 4IFCA 4D1SA 3GQLA 5CYIA 5DPVA 2XNGA 4FOBA 3LCSA 4PV0A 1ZYCA 3QTXA 3ORKA 2VWXA 1JKSA 1H26A 1H1RA 2YEXA 4R3CA 2PZYA 3COHA 4CFMA 2BRBA 4W4VA 4EYMA 4P5QA 1FVRA 3C0HA 1TVOA 2XH5A 3P7AA 1RDQE 4PTEA 1PW2A 1QPDA 3KF7A 3A7JA 4KSPA 4TWNA 4YZCA 3CTJA 3CTQA 2G2FA 2WOTA 4HYHA 5HLPA 4AUAA 4FSZA 2YA9A 4KIPA 1PJKA 3W32A 2OIDA 4EOLA 5AP2A 2ZM3A 3MIAA 3OBGA 3ZSGA 4DITA 4EONA 1R39A 1S9JA 3OTUA 4C4HA 5LOHA 4A9UA 4E4LA 4BDDA 3RAKA 4E4NA 3CQUA 3D2IA 3BIZA 3FJQE 4JBPA 3HVCA 4EYJA 3WBLA 1CKJA 3GCPA 5FM3A 2OW3A 5LARA 2J4ZA 2OKRA 3GNIB 5KZ0A 4C3FA 4IVCA 4BCIA 4A9RA 4N4SA 4RJ8A 4A7CA 2H9VA 3OT3A 3W55A 1UNHA 3AD6A 5CZIA 2XRUA 4WBOA 3QA8A 5HNBA 3UBDA 3MWUA 4GYGA 2H6DA 4H3BA 2EB2A 5IPJA 4R1VA 3HV5A 3VUTA 3WI6A 4AGUA 4BL1A 4G6OA 4JIAA 4FV7A 5GJFA 3LCKA 2GU8A 4RIWB 1XH6A 4S33A 4YJNA 3ZBFA 3H9FA 4IM3A 4A4XA 4DG0E 1PMNA 2BAQA 3PSDA 2R2PA 4X2KA 1KSWA 4MKCA 4XX9A 3TG1A 4EORA 2HZ4A 2IZSA 2R3OA 4NM0A 3OY1A 4YNOA 4D2RA 3C0IA 3UDBA 4QPSA 4C34A 4F7LA 3KRWA 3FZOA 3SXRA 3A7GA 3LM5A 4MVFA 4YHJA 3LMGA 5G1XA 4JX3A 2P2HA 4UWYA 1PKDA 4F63A 3LXLA 3UODA 3D83A 2BFXA 4LRKA 4EZ7A 2WXVA 3NS9A 1FMKA 2I0EA 2YITA 2WTVA 2ETKA 4QD6A 1JQHA 3HRFA 4OBQA 3NUXA 3ZSHA 2XYNA 2JIUA 2IW9A 4NKAA 3UQGA 5CT0A 3SV0A 1PF8A 3QXPA 5B2LA 4QQ5A 4AF3A 4EUUA 3PG3A 1SZMA 4RFZA 3ZFXA 3ZO1A 4EWQA 4UMPA 5B2MA 3HP5A 4AW1A 3I4BA 1ZARA 3A60A 3FZTA 3L8XA 4Z7HA 5D7VA 5FBOA 3GP0A 3I6UA 3GXLA 3E62A 3RBWA 3SRVB 4MQ1A 3DK7A 3SLSA 4JBQA 1YDTE 1I44A 3CD8A 3Q96A 3KXMA 5GZ9A 2QOOA 2W06A 3DY7A 4GYIA 3Q6UA 4XNEA 4WIHA 3C1XA 5EG3A 3RNYA 4U41A 3EN9A 4ACGA 4CTCA 2QURA 3ZC6A 2ZMCA 1URWA 4F6WA 3O51A 2QOHA 2VTOA 4QTAA 3OC1A 5CWZA 2E9UA 4K0YA 2UW3A 4GSBA 4D2SA 4ZTSA 3MW1A 1J1CA 3VRZA 4RIWA 4NW5A 4I24A 5D7AA 5K5XA 5L6PA 1HCKA 4HGTA 2VX0A 4AZSA 4RX8A 3EMGA 4WUNA 1KOAA 5I0BA 4RQVA 4IACA 3QQFA 4CKJA 5HCYA 4PL5A 4JIKA 5CEIA 4FNZA 4KWPA 3FBVA 3QX4A 1YVJA 3Q4UA 2E9NA 5BUIA 2VTLA 2ZB0A 4APPA 5L3AA 1SM2A 4RX7A 5TF9A 2GS7A 4HVDA 3VHKA 3LIJA 2ITZA 4WOVA 5FP5A 4U3ZA 2WTKB 3WOWA 4RIXB 2IJMA 1XO2B 3QCQA 3R2YA 4EUTA 2YIQA 4JQ8A 1YHWA 4XV3A 2ITOA 2UZOA 1Y6BA 5HG8A 3FLNC 4BCHA 2GHGA 3EQCA 2BIYA 3BLQA 1H01A 5CNOA 3DJ7A 3T3VA 4BTKA 4DYMA 3R28A 5AA8A 2CGWA 3DZOA 3SX9A 3A99A 3SRVA 4E6CA 4U44A 3F88A 3QD3A 5ANDA 1MUOA 3BX5A 3FWQA 3JPVA 3PZHA 4LOOA 4QYGA 3BCEA 4PP7A 1L3RE 1T46A 3F61A 2XCHA 5EYDA 1H1SA 2HOGA 4WNMA 3FE3A 4MQ2A 1B38A 3ZLSA 3JY9A 3V3VA 4ENYA 3NIZA 2R3IA 3ZEWA 3QC4A 5IH6A 4E5WA 3S00A 2OJIA 2V62A 3IOKA 5E91A 1ZY5A 2BZKB 4ZTLA 2WMAA 4FIHA 2FVDA 2WMUA 2YISA 1JOWB 2WHBA 2CMWA 4FYNA 3CTHA 4C33A 5A4CA 1ZZ2A 3R71A 3FLQA 4GK2A 2QO9A 2VWVA 4ASEA 2C6OA 3PXZA 4BIBA 2ITVA 3EWHA 5E1EA 1R0EA 3D5VA 1OKYA 4QMLA 4EK3A 1Z57A 3D5WA 4RT7A 2QU6A 4UZHA 3UZTA 4KBKA 3UO6A 3P78A 4H36A 1E9HA 2XEYA 1OGUA 5L2TA 3I7CA 4FIEA 4QTBA 4GFOA 1RQQA 2PMOX 4R3RA 3RPRA 4CFVA 4Y72A 1ZOHA 1U59A 5HNGA 3O8UA 4RIXA 3E8EA 3LHJA 4IB0A 2F49A 3HUCA 2RFSA 2DYLA 4TZRA 4IB3A 4F9YA 4ZSGA 2YABA 3I0OA 3QZGA 4FSRA 2JKKA 3V04A 5C8MA 2WTCA 4GL9A 2ONLA 4D2PA 3SD0A 4JAIA 3QTIA 5I9XA 4IB1A 4ZSJA 3RTPA 2O63A 5A54A 5AM6A 4EOQA 3K5UA 3O96A 3R04A 4DHFA 1IASA 4ZY4A 3OOGA 4DG3E 3NW6A 4XH6A 4YHFA 2UZLA 5JGAA 4JAJA 4FYOA 4D58A 2ITNA 1B39A 3DTCA 3QF9A 4HYUA 4PWNA 5FP6A 3UJGA 5A4LA 1OPKA 3RP9A 3POZA 1Z9XA 3DXNA 4QMSA 5ANGA 5BVKA 5L8LA 4XG8A 4UEUA 3EOCA 4EC9A 3NSZA 3PWYA 4I20A 2W17A 1PMUA 4QQCA 4BKJA 5LMKA 1S9IA 3NUPA 4XYFA 5K4JA 3QGYA 3OWPA 2VNYA 5KX8A 4I23A 3E3PA 4QOXA 1SVHA 5JQ5A 3GCSA 2Z8CA 3PG1A 4NUSA 4ZJIA 1ZMUA 4IE9A 4MF1A 2JGZA 5JZJA 3SA0A 1PXNA 4AOJA 4QTEA 5FGKA 5L8KA 4C3PA 4PMMA 2JDVA 2UW8A 3IS5A 3PIZA 4GRBA 1FINA 1TKIA 4L67A 3QTZA 2C3KA 5J9ZA 3P4KA 4EZ5A 5L6WL 1UU7A 4WSYA 4RJ7A 5BVDA 2BMCA 4QMMA 4AA4A 4AWIA 4BCFA 2A19B 2BFYA 2W5AA 4K77A 4CFNA 3S4QA 4AN9A 2IVTA 2QKWB 3FXXA 2Y7JA 4NM3A 2XJ1A 4FV9A 1GJOA 4DC2A 5CEQA 3BBTB 3S1HA 1F5QA 4I21A 3D2KA 4QP2A 3AOXA 4RA4A 3IW7A 3KVXA 5AP7A 1H8FA 2YDIA 4U0IA 3TN8A 3DBEA 3UC3A 4Q5HA 1GZNA 1SVGA 4GV1A 4IANA 4OAUC 3B8RA 4A9SA 4FSTA 4IDTA 3MH0A 4HZSA 4YZNA 5LWMA 4C62A 1JSTA 2QOLA 3FI2A 4EH6A 2JKOA 3U6JA 4OUCA 2PE1A 2BRNA 2VWWA 2VTTA 4H39A 4L7FA 4C59A 2CHLA 4IIRA 4BTJA 3OMVA 3VUKA 5KUPA 2QO2A 1XBCA 4ALUA 1W84A 2RSVA 3EL8A 3H0YA 5A4QA 4KB8A 2VZ6A 4FV2A 4TT7A 4ZZOA 1BKXA 2C68A 4L52A 4AZEA 2XB7A 1X8BA 2O0UA 2WB8A 1APME 3Q60A 4K2RA 1JAMA 3EQHA 4NTTA 5IKWA 3CJGA 5A3XA 5LMBA 2YACA 3IDBA 3QTQA 4OW8A 2VNWA 3FUPA 2CLQA 2HW6A 1Q5KA 4XBUA 1BL7A 4KIOA 4MTAA 3FKOA 1NY3A 2YIRA 5KHWA 1H0VA 3PIXA 2C6EA 5HCZA 1H1QA 5CENA 3RPYA 5HD7A 3R7GA 4BCMA 5C01A 1YXVA 3TNWA 3MN3A 1R0PA 4L6QA 4RVKA 5BX0A 2BRMA 1LEZA 5CSVA 3LCOA 3PY1A 3QTRA 4EZ3A 5FXQA 4BDCA 4X6RA 2WQNA 2A0CX 2BDJA 3EFLA 3A7IA 1BUHA 2OJFE 4O6EA 3RNIA 1M7NA 3QQKA 3O7LD 3K3IA 3F2NA 3LFAA 5GHVA 4NH1A 4GCJA 4O0VA 4ZTRA 2B55A 1FQ1B 1WFCA 1RJBA 3F66A 4GU6A 3QUEA 3WZDA 2OXYA 4CKRA 1Q8UA 3UQCA 4YSMA 5CI6A 4R7IA 1W98A 3FPMA 3SXFA 2PVKA 3PPKA 4L8MA 3LM0A 1WVYA 4CMOA 1OIYA 3SVVA 3PIYA 4XCUA 3OF0A 3W2QA 2FYSA 2GNHA 4QQJA 5DR9A 2GFSA 2ZOQA 3CIKA 3TV4A 4C4FA 1ZLTA 5FG8A 5GZAA 5M4FA 2P4IA 3AT2A 3NNXA 2XIKA 3UIBA 3HDNA 5C9CA 3VIDA 2OXDA 2EXCX 5HBJA 4G5PA 4FTRA 2HWOA 4UB7A 5CASA 3GU8A 3E63A 3FPQA 4CQEA 1YXXA 4FKJA 5KNJA 4PUZA 3AC3A 4ALVA 2V22A 3ORPA 3EFWA 1Q24A 3DJ5A 2O64A 3DAEA 3QD4A 3KKVA 3LCTA 3QQGA 1XKKA 2WZJA 3UIUA 4QMTA 5HQ0A 5HU3A 2VWIA 3U9CA 3LJ0A 3IG7A 5AEPA 4BZOA 4BKYA 5HVJA 5KMKA 4M69A 2UW7A 4XLVA 5KBRA 2PUUA 5J5SA 3EN5A 2C5NA 4LI5A 4O0YA 4P7EA 2W1GA 3JVSA 1OKWA 3MJ2A 5DT4A 3KCFA 2R7IA 3DDQA 3W2OA 3TT0A 4KIKB 2X39A 4IC7A 3ZBXA 3II5A 2NPQA 2WKMA 2PSQA 3HMOA 3V5QA 4BYIA 5IU2A 1F3MC 1QPEA 3QTSA 1M52A 2OXXA 3M2WA 3QTWA 3DAJA 5ETAA 4A4LA 4QPAA 5CAOA 2O2UA 3BYVA 2CSNA 5JFSA 2C30A 3P23A 2PVFA 2G01A 4E3CA 5DHJA 5DLSA 2GNLA 3C4WA 2UVZA 4PPCA 4PNIA 4BDJA 5JRQA 5KMIA 1UNGA 4FZDB 5L4QA 2XIXA 3BYMA 2Z7SA 2J0KA 2X81A 3EH9A 3ZM4A 4ERKA 3R8UA 4C0TA 2FA2A 3VHEA 3ZCLA 4A9YA 1NVQA 3TNPC 3EQIA 5HOAA 4GT3A 4LUDA 4G1WA 4YLJA 4BBFA 1OI9A 1JKLA 3KRJA 4KRCA 2JFMA 5AR5A 2W4KA 3BV2A 4PRJA 4X3FB 2CCIA 4E6DA 4F9WA 2HELA 4IX6A 5IEXA 4L01A 5EKNA 3R83A 4Y5HA 1G5SA 3FZSA 3TUCA 4YNEA 2R64A 2HCKA 3HA8A 4AT4A 5CEMA 5K0XA 2XYUA 4RIYB 4HYIA 2R3KA 1FMOE 4B0GA 4J8MA 3PE1A 4GFGA 5I4NA 1JSUA 3DJ6A 3PRIA 2WEVA 5AV0A 1M17A 4FV4A 2HZNA 2YAKA 5CAUA 4AZVA 4QTDA 4KABA 4C3RA 1YQJA 4HCUA 1LEWA 2V5QA 3CPBA 4U8ZA 4B8LA 3NUUA 4KIKA 4E6AA 4MD7E 1JLUE 5K4IA 2EXEA 2OF2A 3LFSA 4NKSA 2VTMA 4YSJA 4ZAUA 2NRYA 4WBBB 3LFQA 4CSVA 3KQ7A 4EHGA 3OW3A 3PE2A 1V1KA 3BZ3A 2DS1A 4OAVB 3CS9A 3D15A 4O1PA 3OWLA 2XKCA 4HVHA 3VUIA 3H9RA 3QZFA 5C8NA 3Q4TA 4FODA 5C1QB 4XP2A 3NNVA 2W4OA 1RE8A 1UWHA 4NW6A 4PMSA 2QC6A 4TNBA 2YM5A 4UWCA 4O91A 3RZBA 2XJ0A 4YJUA 5E8TA 3RHKA 3EYGA 3W8LA 2XBJA 2PVJA 2YM8A 4E4XA 2Y4IC 4IX3A 3IKAA 2PZ5A 2W1IA 1A9UA 2XUUA 4DEIA 3TACA 3CPCA 3KRRA 4FG8A 4U97A 1Q8TA 3MDYA 4QMZA 5AUWA 5ETIA 3WIKA 4XJ0A 3T9TA 3LFBA 4AFEA 2YDKA 2BTRA 3I0QA 2JKMA 4QYYA 3BU3A 4MD9E 3E92A 4XP3A 2B1PA 3BLHA 4LQMA 3BHHA 4DFXE 2W0JA 2FSLX 4NTSA 4ACMA 2YFXA 5TO8A 3OCTA 4DFYA 3RM6A 4EH8A 4Q2AA 2J2IB 4RIYA 4I6HA 4J1RA 5CU3A 4FKWA 5EM8A 5H8GA 2WD1A 5CAVA 5KMOA 2PVLA 4CZUA 4GH2A 3LFNA 3Q9XA 3TL8A 5J9LA 3FMNA 3A7HA 2R9SA 4GVJA 2ETMA 1XH4A 4Y73A 4EH3A 2BROA 2HZ0A 4EOJA 3NUYA 1WBVA 1YWVA 4E20A 4WNKA 3LXPA 4CVAA 4K6ZA 4F1TA 5JFWA 2I0YA 2XK7A 4RZWA 2GQGA 2IN6A 3I79A 3PSBA 1SVEA 2WFYA 3QQHA 3V5PA 3TKHA 5EM7A 4YUQA 4BCQA 2HY0A 1NXKA 4EQMA 4K9YA 5J8IA 4WG4A 4Z9LA 3MFTA 5L8JA 4HJOA 5TOZA 4Y95A 3HECA 2C6LA 4FG7A 4QMPA 4HCVA 3AT3A 4JDKA 3WZKA 4B8MA 2YM3A 3VNTA 4IW0A 3MTLA 3EHAA 3UMXA 3BU6A 3EZRA 3TZ7A 2A1AB 2PE0A 3NIEA 3ZFYA 5CF4A 2OH4A 1WVWA 1P4FA 3OVVA 4FKPA 4BWPA 3GVUA 3Q9YA 5IH4A 5BVWA 3F5GA 1SYKA 4ZEGA 3ZDIA 4DH1A 3E8NA 3AC2A 5J79A 3VW8A 3GC7A 2NO3A 2W1HA 3PRFA 1ZZLA 4JRNA 2CGVA 3ORNA 2QONA 4P4CA 2OH0E 3ZO2A 1BL6A 4FL2A 4YJPA 3WF6A 2Y6OA 3MV5A 4EJNA 5HBEA 4QMYA 2JC6A 2RL5A 3IECA 2WTKC 2HZIA 4RMZA 5H2UA 2LAVA 4O0SA 4FEQA 3UQFA 4DFLA 1BYGA 4U7ZA 3QBNA 2VTRA 3CGFA 4OLIA 2ITTA 2B4SB 3CC6A 3D94A 4LGHA 3KF4A 4AGDA 2RG5A 2X2MA 5DG5A 3KN6A 1J3HA 2V7AA 2PTKA 1OB3A 3SKCA 4MNFA 2Q0BA 1YI4A 4ASDA 2WEIA 1XH8A 1YDRE 4X2NA 3GEQA 1M2RA 3HP2A 2Y6MA 3K2LA 1AGWA 1MQ4A 2WMVA 4I0RA 5IA4A 1WMKA 3C0GA 4C38A 5M4IA 2C5XA 1GZOA 3PVWA 4IZAA 5CI7A 3R7IA 4JI9A 4PDSA 3LFDA 3DKFA 3ZTXA 5EI2A 2PZIA 3MVMA 4AX8A 1NA7A 4BBEA 4LOQA 4CCUA 3GBZA 3I5NA 4IHPA 3ZRMA 4EK4A 3FDNA 4BCJA 5KKRB 4M7IA 1W83A 3RINA 5LMKC 3BLRA 4F9CA 5HBHA 4BDAA 5EW8A 3EL7A 5LVOA 2XBAA 5EW3A 5HE3A 4D4YA 3EQGA 1FGIA 1VYWA 4RSSA 3VUMA 3FLWA 2I0VA 4UY9A 5L6OA 2W9FB 2R3JA 4YBKA 3RWPA 1MRUA 2OIQA 5ANJA 3UIXA 4FKGA 3UMWA 2WAJA 1Y8GA 5J5TA 2UW0A 4RFYA 5AUYA 4G3GA 4TY1A 3R9NA 3NPCA 3EN6A 3MIYA 1ZOEA 2QG5A 4CV8A 3PJ3A 3MVJA 1XWSA 3MTFA 4BWKA 4BGHA 3BEAA 1XQZA 3BQRA 4JQ7A 4ZZNA 2ITYA 3G0EA 3GCQA 4NM5A 4E4MA 4EQCA 3D5XA 4C2VA 4ANBA 4IDVA 1WBPA 1GOLA 5IUGA 3FC1X 2OSCA 2J50A 4NCTC 2XIZA 2W7XA 5AA9A 2C6IA 2ITWA 4FTAA 3U87A 5IA3A 3OEFX 3L9PA 2V7OA 1LUFA 3FMKA 3QCXA 4JOAA 4XV1A 3ZZEA 4DEDA 3ZMMA 3KRXA 2C6DA 2FSOX 3F3WA 3SDJA 3I1AA 3FLZA 4Y85A 4Z3VA 3FC2A 4EH9A 3DLSA 4RIOA 3ORMA 2W96B 5AADA 4FV0A 2JBPA 3UVRA 2OK1A 5I9ZA 4HVGA 2XNBA 5EOLA 5H8EA 3C4XA 4G34A 3CY2A 3PA5A 3JY0A 5DVRA 3QHRA 3A8XA 3DV3A 1ZYSA 5DMZA 2X8EA 5CEOA 5J7HA 3QKLA 4YZMA 4AZFA 2G2IA 4DFNA 4EK8A 3LXNA 3BGPA 2EVAA 2OGVA 2R0UA 3TV6A 3PTGA 3SOAA 1KE7A 2QOKA 4DN5A 4I6QA 3ZUUA 2P0CA 5CQUA 3VS1A 4FVRA 4X3JA 4RQKA 3PP1A 1XH7A 3WYYA 3G51A 2E9OA 3HGKA 4AP7A 5I3OA 2JAVA 1BLXA 3GB2A 4GVAA 4BKZA 3IDPA 4YC8A 2X1NA 4H3PA 4CLJA 4EKLA 5H8BA 4LOPA 3PJ1A 1Q8WA 3KMMA 5AP4A 3TZMA 3DB8A 5FEEA 1PYEA 2A2AA 2VWUA 3PZEA 3ULIA 4IWPA 4MXOA 1Y6AA 3LPBA 4I3ZA 1WBWA 4NU1A 4GK4A 3SW4A 5J1WA 2GCDA 4B6LA 3RJCA 4PY1A 3KMWA 3OWKA 4OT6A 4DFZE 1LP4A 4OBOA 3UVPA 3PVGA 1YDSE 1Y57A 3OCSA 4RLLA 4TL0A 4O2PA 4QYHA 1H0WA 2R7BA 2JITA 2XIYA 2RFEA 1ZWSA 5CQWA 3EQRA 4FV8A 3ZC5A 4P2KA 5BMSA 3LQ8A 4FT9A 2PMLX 4ZSAA 2ACXA 3R01A 3ELJA 3RALA 5A14A 4CFFA 3UTOA 4B9DA 4BDGA 4IX4A 5E7RA 1YI3A 3C13A 3ORLA 3H0ZA 4BVUA 2F9GA 5ETCA 3DNEA 2OJ9A 4E26A 2R3QA 3MPMA 3ZOSA 2CLXA 4BCKA 3W2CA 4YJOA 3P08A 5HU9A 2XMYA 3TCPA 1CKPA 3CR0A 4FSNA 1V0PA 3WIGA 5EK7A 3VS6A 4BFMA 5BQ0A 1CSNA 4KD1A 2R5TA 1YHSA 2ERKA 5GZ8A 3BKBA 2WO6A 1AQ1A 4FX3A 2F57A 2W4JA 4FTLA 2IO6A 4GK3A 5IDPA 3K3JA 2YCQA 4NIFB 2Y0AA 3BQCA 2IVVA 4TW9A 2VTSA 5AWMA 3UPXA 5FBNC 5HIEA 4FZAB 4MBIA 4M66A 4AQCA 3MB7A 2YERA 3WF7A 3G6GA 2XM8A 1DM2A 4U79A 4AE6A 1V0BA 3FYJX 3COIA 1OIRA 4RC2A 1VZOA 4KNBA 3DTWA 4FKOA 5IH5A 4V0GA 3ZLWA 3QXOA 1ZOGA 4YR8A 4MXXA 4ZJVA 4J97A 3FYKX 3MH2A 4K33A 5D10A 2YIWA 4L3PA 3MFSA 1SNXA 2HWPA 3MVLA 4NWMA 3TWJA 4ZLYA 1CTPE 1W7HA 3DFCB 2Y9QA 5F1ZA 5CZHA 5EYCA 4IAYA 2QQ7A 4EOPA 4TNDA 3F7ZA 2B54A 4QYFA 5CXHA 3V5JA 4AOIA 4YJSA 4X6QC 2VTQA 4KA3A 2LGCA 2VO6A 2RF9A 5BVNA 3NLBA 4FV6A 4PPAA 3GC8A 3R1YA 4FKSA 4CLIA 3OTVA 4CKIA 4WUAA 4MH7A 5FWKK 3ZLYA 2PVYA 3R9OA 3Q9ZA 3WARA 5CVHA 5A6NA 2WOUA 5IA0A 5IUIA 4QMWA 4FIIA 4JG6A 3JS2A 3TNHA 3REPA 1GY3A 3K5VA 4RGJA 2C6MA 4WRSA 3HYHA 4M13A 4ERWA 2Y4PA 3UNKA 4MEDA 2WMSA 2X4FA 4ZSEA 3LJ2A 4X7QA 4QQTA 3TTJA 4I5CA 4NIFA 3A8WA 3LVPA 3QRIA 1PXKA 3Q5IA 3SC1A 5JT2A 3V51A 5HHWA 3NZ0A 4CXAA 4FF8A 3BYUA 1XH5A 4IFGA 4H1MA 2ZDUA 3Q53A 4KIQA 5CAPA 4KS8A 4FIGA 4HGSA 4O96A 4JNWA 3HKOA 3P79A 2ITXA 3DFAA 3MFUA 5FTOA 4DCEA 2R3FA 2C1BA 4E5BA 2VX3A 3SOCA 2WPAA 3NYVA 2B7AA 5DFPA 4Q9SA 3GOKA 2QU5A 4HPUE 3T3UA 5CX9A 2FUMA 3L8VA 4R8QA 4UYAA 4B4LA 4C37A 5IEYA 2W1CA 3JUHA 3KK9A 3POOA 4ITJA 4C61A 2OFVA 1QCFA 2C0IA 4ANQA 1K2PA 3NUSA 4G3FA 4IJPA 5C27A 2BR1A 3DK6A 3KRLA 5KZIA 2UZWE 3DKGA 5KO1A 2F2UA 5AR8A 2ITQA 3FLYA 4RVMA 4OTPA 3RHXA 4QP1A 3EN7A 4EQUA 2YIXA 3CJFA 4ACCA 4ZJJA 4BYJA 2G1TA 5EM5A 3PJCA 2OZOA 3I81A 4AZTA 3KK8A 5KMLA 3E93A 3FZ1A 4EH5A 2X4ZA 2X6EA 2J51A 3KMUA 5D11A 1Q3DA 4HW7A 3LXKA 3VC4A 4MWHA 3H4JA 1VJYA 4OGRA 5EYKA 4CFWA 3KGAA 4D0WA 4D9UA 3WF9A 4FKIA 3ODYX 4TWOA 4GG7A 4APCA 5HNIX 4X3FC 3ZRKA 5KMJA 2R3RA 5AAFA 2PMNX 3FSFA 2WIPA 1O6KA 3FMHA 4XS2A 4O22A 3F5PA 3H10A 3HA6A 3TIZA 4ZSLA 2PL0A 2VN9A 1H07A 4I4FA 3MY0A 3KFAA 2R0IA 4TXCA 3P5KA 5HO7A 4IQ6A 3AC1A 2J0JA 4YHTA 5HX8A 3DKOA 4EH2A 1OZ1A 3GENA 1JVPP 2OIBA 3KXXA 3V8WA 3CKXA 4MWIA 3TNQB 4Y8DA 3Q4CA 3Q4ZA 5LWNA 4FNYA 4PDOA 3VUDA 2H8HA 3WZUA 3G5DA 4LGDA 4J8NA 4JG8A 2UW9A 4P90A 5DEYA 2OJGA 4KRDA 2X7FA 1OM1A 3EIDA 4LM5A 4RFMA 3W1FA 5DI1A 3TJDA 2ZV8A 4ZOGA 2F7ZE 3IK3A 3DCVA 3UGCA 2FSMX 3QCYA 1DI9A 1Q97A 3VS7A 3W18A 1XJDA 1RW8A 4BTFA 4FTOA 4IC8A 3BHUA 4XRJA 3OCGA 2B9JA 2BKZA 4FA2A 5IA2A 3MPAA 3EJ1A 3DBFA 4XG6A 5H3QA 5HTCA 5JZNA 1OITA 3FI4A 3PA3A 4QP8A 3GUBA 5AAEA 1DAYA 3P86A 4CRLA 4FZFB 2VAGA 3QYZA 1ZYJA 4MXAA 2UW5A 5BVFA 4TYEA 2QOIA 3I60A 3RZFA 3HRCA 5ITAA 2WMQA 4FTCA 3BRBA 4IH8A 1A06A 2W1DA 3QALE 4WNOA 4YZ9A 5AUXA 5L2QA 5DA3A 3R8MA 2OO8X 3VRYA 4BF2A 3TUBA 4QMUA 3OXTA 4RJ3A 3MSSA 4QMQA 1KOBA 4BCGA 5D1JA 3LLTA 2Z7QA 3EFKA 3QA0A 3EN4A 3R02A 4QRCA 3BHVA 4YLLA 4WA9A 4U80A 4CRSA 4RJ4A 1TQPA 2BDFA 4BDHA 5E90A 5H9BA 4PQNA 5I9VA 3B2TA 4FK6A 4M3QA 3FLSA 3Q32A 5ANOA 5M44A 4M69B 5K0KA 4C35A 2OICA 3RM7A 4IAKA 3C5UA 3C4FA 2P55A 4FL1A 4M12A 4J99A 4I4EA 4E5AX 2XNOA 5E8WA 4O0RA 3C4CA 2GNGA 4BI2A 4BWXA 5LVPA 3QRUA 1OUYA 2X8DA 2I1MA 4RG0A 5E8VA 4F4PA 2QODA 4CYIA 3ACKA 4E7WA 3F2AA 4BCNA 1QMZA 2ZB1A 4ITHA 4EH4A 3OD6X 4YTIA 5L2IA 5J9YA 3EQDA 2GMXA 5JFVA 4XV9A 4O1OA 4F6SA 2H34A 4AU8A 1YXSA 2UZDA 3OP5A 4L45A 4ZIMA 3M1SA 3HL7A 3U6HA 3BHTA 1ZMWA 3FQSA 3OG7A 4D4RA 3FZPA 3LQ5A 3PVUA 3NR9A 3QAME 4O0UA 5AR3A 3VN9A 4N6ZA 4JDHA 5CEPA 3CD3A 2XCKA 4Q9ZA 4KINA 4QP4A 5M53A 2X0GA 4JR7A 5DN3A 4TYHB 3IW4A 4XHKB 3K54A 3ZXZA 4DGOA 4FR4A 2YLEA 3DQXA 2BVAA 4TPTA 4GUBA 5E8YA 3SHEA 3OXIA 5M51A 4IWOA 4KAOA 2BZJA 2ERZE 2GFCA 3QZHA 5ETFA 5AUVA 5HGIA 1DAWA 5BVOA 1P5EA 2XNNA 3A61A 2WMTA 2RGPA 5HORA 2VTIA 3LFEA 3GI3A 5HO6A 4BC6A 2WTJA 4IAZA 2C5OA 2J90A 3EKKA 4FVPA 2H96A 2J6MA 4Z55A 1YOLA 5E8ZA 4R3PA 2B52A 3R2BA 1DS5A 4IMYA 3B2WA 4MYGA 4FTJA 5I5ZA 4IVAA 4W4WA 2VUWA 5HKMA 3CEKA 2J7TA 4UXQA 4DGGA 5JGDA 3JVRA 4HPTE 4AG8A 3ZUTA 2XP2A 1WBSA 2DUVA 5C8KA 3O8TA 2YCSA 2WU6A 3DZQA 4U43A 2VTPA 4WKQA 2YM6A 3UNJA 4F64A 5JGBA 5DOSA 4RBLA 3RVGA 4CT2A 4BTMA 3I5ZA 4MK0A 1YKRA 4I93A 2CGXA 2NP8A 4YZBA 3VS3A 1XR1A 3U4WA 3GC9A 1ERKA 3Q2MA 5CU6A 3R0TA 4IWQA 3ZRLA 1JNKA 1GZKA 5T3QA 5IISA 2B9FA 5HESA 3UO4A 2C4GA 5KE0A 5E8UA 3C4ZA 1H1PA 3LFFA 4M0YA 1H4LA 2QI8A 4RWIA 5I9WA 4U5JA 5IEVA 2EXMA 4ID7A 5JK3A 2I6LA 2VX1A 3KXNA 2KTYA 2QHNA 2C47A 2Z2WA 4TYHA 5CAQA 2OBJA 3MH1A 4QPMA 3EKNA 4Z16A 4FTKA 4E1ZA 1UKHA 3VF8A 4EH7A 4ZY5A 3AQVA 5JFXA 2BDWA 3QTUA 1ZRZA 2WNTA 4UMUA 1P4OA 3ZEPA 5CF8A 2UZVA 3ROYA 4Y83A 4BIDA 4EC8A 4J95A 4CFXA 4LL0A 4GT5A 4PX6A 5ANKA 3QYWA 2CJMA 1J91A 4IZ5A 3UPZA 1VR2A 3OCBA 5CLPA 3FZRA 4N70A 4F7NA 5DH3A 3RCDA 4XG7A 1QPJA 3EFJA 2WQEA 4W9WA 3OHTA 3PY3A 4U6RA 3R7VA 4CMUA 5IA1A 1FOTA 3NNUA 3UIMA 3EQBA 4YGAA 3GC0A 3PA4A 3RAWA 2XK6A 1XBAA 1FGKA 5IA5A 4YBJA 4YLKA 2WQBA 1PXPA 2I40A 3ANQA 3V8SA 1PHKA 5LCKA 4AW0A 4BDFA 3W2RA 2JIIA 2BTSA 4NFMA 2RKUA 3BWFA 4DEEA 1ZYDA 4CZTA 1URCA 5F4NA 4OTQA 4K8AA 1Q8ZA 2CPKE 4E6QA 3D7TA 2HW7A 5AIRA 5EW9A 2ETRA 4AGWA 3EZVA 4G2FA 3AC4A 4R6VA 5EHOA 3HV6A 4KBAA 3HV7A 5HLNA 4GW8A 4FKUA 3QCSA 4RWJA 1YWNA 4H58A 2UVXA 4CFUA 1W82A 4EOOA 2WIHA 3M42A 1K3AA 4FKRA 4J98A 5A46A 3OUKA 2VTNA 3OFMA 3COMA 2J0IA 2FGIA 1MP8A 4FKLA 4AN3A 3ENHA 3F6XA 4DGNA 1U5QA 3DA6A 3IQ7A 2R3HA 3V6SA 3R8VA 4F9AA 3FHIA 4F0IA 2VU3A 3OS3A 4PP9A 2HENA 4DEBA 5CALA 3HV3A 2RFNA 4QYEA 3D4QA 2HAKA 2PZRA 2XF0A 1I09A 3Q3BA 4FTTA 5BPYA 2O3PA 3LE6A 4BB4A 4GJ3A 4FV5A 2W5BA 3UC4A 2Z60A 3OEZA 2HYYA 1ATPE 3QC9A 4RVTA 4XBRA 4GU9A 5CF6A 2ZM1A 5ANIA 3L8SA 2YCRA 4ZLZA 2B53A 4ZTHA 3KVWA 3IW5A 4LV8A 3G9LX 3HMIA 3QRKA 5CSHA 4ANSA 2V55A 1PXIA 1STCE 4IB5A 1K9AA 2X2LA 4OTGA 1E1VA 3KC3A 4YJVA 1U54B 2OJJA 2Y8OA 4MXYA 4R1YA 4AFJA 1W0XC 4CYJA 2E2BA 3D9VA 3H30A 3NYXA 4DLIA 4JJRA 4D5KA 4G17A 2B9IA 2QLQA 3QQLA 2QLUA 5J7BA 2RG6A 4KKHA 2VGPA 3R22A 5EM6A 3UP7A 3SAYA 3VBWA 3T8OA 3TJCA 3KA0A 2W1FA 5CANA 1U4DA 4BGQA 4W4YA 4AW5A 4G5JA 4LG4A 5CVGA 4BI1A 4D0XA 2QD9A 2XKFA 4USDA 3CLYA 3F9NA 3RK7A 5AUTA 3E5AA 4MXZA 4ZK5A 2C0OA 2VD5A 3UVQA 1Z5MA 4YC6A 3G6HA 4JT3A 3MS9A 1UA2A 2BCJA 4RWLA 1FPUA 1KE6A 1F0QA 1OKZA 4Q5EA 1Q62A 4NSTA 3VJOA 3PPJA 4DG2E 1Y8YA 3IGOA 4NZWB 1UNLA 2G15A 5FD2A 3TI1A 4BDKA 4BHZA 3BGZA 3QRJA 4NT4A 2ESMA 2HIWA 1QPCA 4HNFA 4RJ5A 2BALA 2ZDTA 5FEDA 3CGOA 4UYNA 5AAGA 4L3LA 5D12A 4MHAA 4OTHA 4BICA 3AMYA 3DK3A 3ZU7A 4F0FA 2PVMA 4DH8A 3CP9A 5FLFA 2R4BA 4G3EA 3TV7A 1JSVA 4AS0A 3AGLA 4OBPA 4QMXA 3UZPA 3WZJA 2VWYA 3T9IA 3CXWA 1NVRA 4L43A 2F4JA 2YIYA 3TZ8A 2ONLC 4AZWA 3DQWA 4IAFA 3ROCA 3S2PA 1U54A 3R00A 3DT1A 1CDKA 2C5YA 4EHVA 3U6IA 3ORTA 5JMSA 1E1XA 4CMTA 4I6FA 1UV5A 1TQIA 2XK3A 3RI1A 5EI8A 4QP7A 4V01A 4G31A 5AV4A 4OTIA 5HG5A 1LR4A 2BAJA 1IR3A 4F9BA 4D9TA 2XEZA 3KXGA 3B8QA 4MF0A 2F7EE 3RPVA 4RPVA 4F65A 4XMOA 5J1VA 3UOKA 5HE0A 3L9MA 5TE0A 3UO5A 3BGQA 4KS7A 4C2WA 4F1OA 4FSQA 2PZPA 4IM0A 4YURA 2C3IB 4FT0A 3Q04A 2C1AA 4G6NA 4LGGA 2C69A 2VO0A 3WYXA 4FUYA 4AA0A 5KMMA 4YZDA 4LRMA 3KULB 3R73A 2PVRA 3O0GA 3PJ2A 4D1ZA 3GT8A 1YI6A 4WG3A 5HIBA 4YU2A 4DEAA 3RCJA 3F7WA 4M0ZA 4C4EA 4M97A 2XNMA 2YDJA 4XG3A 5J95A 3V6RA 4X2GA 3IO7A 4F1MA 4UX9A 2BUJA 3AD5A 5BYZA 5E8SA 2R3GA 1PKGA 3WE4A 3QU0A 3R8LA 4FIFA 1JWHA 2R3MA 3IPHA 4K1BA 4UV0A 4OTRA 4ACHA 2WQMA 3FMDA 2I0HA 2QHMA 4FTUA 4ANNA 3UOHA 1KV1A 2QOBA 3HMNA 1Q3WA 5HZNA 3D0EA 5CSWA 3RWQA 4O6LA 1ZAOA 2ZYBA 3G33A 2PVNA 2JDRA 1T45A 3ITZA 5HD4A 3DNDA 2UZNA 2UZBA 4IVBA 4U9AA 5HTIA 4ASXA 4RX5A 4IBMA 1EH4A 2X7GA 3G9NA 4GFMA 2GNJA 5IMXA 4I0TA 4HVIA 1PY5A 5IUHA 5J87A 4JG7A 3THBA 2YJRA 4Y46A 2Q0NA 3BU5A 1O9UA 2YLFA 5CNNA 3ALNA 1P14A 2WMBA 5FXRA 2QO7A 3KCKA 1XBBA 3Q5ZA 2BPMA 4C7TA 3P7BA 1HOWA 3OUNB 3EB0A 3F3ZA 2JDSA 3KULA 4II5A 4A4OA 3HMMA 1G3NA 5DEWA 4GT4A 5CXZA 3VW6A 4EOMA 1PXJA 3VJNA 4BDEA 3S0OA 4F7SA 3L9NA 4YJTA 4MBJA 4R7HA 4X0MA 4DLJA
chains in the Genus database with same CATH superfamily
3BE9A 3F5UA 3QFVA 3ALOA 4QMVA 2Y4IB 5TR6A 3PP0A 4RC3A 4DGMA 3F5XA 5C03A 5LCJA 1TQMA 3PFQA 3A4OX 5ACBC 4JBVA 4XP0A 3VULA 4LL5A 5M57A 4I41A 3C9WA 3ZXTA 2CGUA 3E3BX 3FMEA 3H9OA 2XA4A 4CD0A 2KULA 3P7CA 4ANOA 4W8EA 3QX2A 1KV2A 4W4XA 3S3IA 3VBYA 2WTDA 1P2AA 3C51A 4I5HA 3NCZA 2C6TA 3D7ZA 2OF4A 3E8DA 1OPLA 3MI9A 4D28A 3HRBA 4V0GB 1XHAA 3A4PA 5L2WA 2Z7LA 2AC5A 2HY81 3ORZA 3I7BA 3R7YA 1PXMA 5FRIA 4ZY6A 3ORXA 4PMTA 4RVLA 3KXHA 2UZUE 3FY0A 4FG9A 2CKEA 4CTBA 4PNKA 1WBNA 4RWKA 4JR3A 5L2SA 1M7QA 1GNGA 3MY5A 5CSXA 4C4GA 4FOCA 5ACKA 4UWBA 1O6LA 1ZY4A 4XOYA 5CT7A 4ZXTA 4BCOA 4BHNA 3NGAA 3F69A 4J96A 4BZNA 3HNGA 2FH9A 4N6YA 4D1XA 2OWBA 3UYTA 5AIKA 4CNHA 3U51A 3TIYA 2QVSE 3LJ1A 2GTNA 3R30A 3MVHA 1M2PA 5CF5A 2YWPA 4KSQA 1CKIA 3ZO4A 2XJ2A 2G2HA 5HICA 5BVEA 2YJSA 3QLGA 1SNUA 2XM9A 1UVRA 2YZAA 3IONA 4G16A 2IVUA 3AXWA 3QUDA 2X2KA 3PJ8A 2BIKB 4C58A 1J1BA 3VVHA 3DAKA 3TKIA 5M4CA 3VQHA 1Q8YA 2P2IA 1WAKA 5GNKA 5BUJA 2AC3A 2UV2A 3R21A 3RKBA 3FMJA 1WBOA 1GAGA 4U81A 5GJGA 4ALWA 4B7TA 3ZZWA 4YO4A 5K9IA 2OG8A 5FTQA 3VUGA 4U3YA 5BUEA 4S31A 4UMRA 3WF8A 2PE2A 1H27A 4FV1A 5AV2A 5HVYA 4O38A 1FVVA 3ETAA 3MY1A 3SW7A 3BE2A 4FTQA 2CN5A 5HIDA 1H08A 3E8CA 4F70A 3S95A 3RAHA 1UWJA 4A9TA 5G6VA 1ZYLA 1YRPA 2R3NA 4FT7A 4ZZMA 5E92A 3UOLA 4EI4A 3ZONA 5I9YA 4BCPA 2XKDA 2ZVAA 3R9DA 2G9XA 4FSWA 2JDOA 3IDCA 1AD5A 2CCHA 4G6LA 5BNJA 2VWZA 5AR2A 3NEWA 1WZYA 2PWLA 4H1JA 4YPSA 5FQDC 5B7VA 3TEIA 3VS2A 2JKQA 5EHLA 2VO3A 4F7JA 2F7XE 4TWPA 4TRLA 1OKVA 4FL3A 4IWDA 4ARKA 4CCBA 1H1WA 4YTHA 3HUBA 4EHEA 4FBXA 4I92A 2BRHA 3PSCA 4RA5A 3WILA 5HCXA 4P5ZA 4FZ7A 1KE8A 4L00A 2YM4A 1Q4LA 4O27B 5DBXA 1WCCA 2EUFB 4YP8A 3OROA 5KCVA 3BHYA 2IW6A 4R5YA 1JPAA 2J9MA 2XRWA 3F3UA 5AR7A 4TTHB 3O71A 5FXSA 3MH3A 4LMNA 4I6BA 3FKLA 3TZ9A 2IZRA 1O6YA 4L53A 4EBVA 2PHKA 4QMOA 5CVFA 4FV3A 4UMTA 3GFEA 1UU9A 4K18A 3AT4A 5HG7A 3QRTA 4LFIA 5TT7A 4M8TA 2ZMDA 3BWJA 4QNAA 3MBLA 3NDMA 3ZS5A 4U42A 4AW2A 5LVLA 4EWHA 1Q99A 5FDPA 2GTMA 3AC8A 5K5NA 4QP3A 1QL6A 4N0SA 1WVXA 3VS4A 2RIOA 3LW0A 5CSPA 3GQIA 2W99B 3TUDA 4FTMA 1JKTA 2ITUA 2WTWA 3RK5A 2UUEA 2W05A 3R8ZA 3W8QA 4EOKA 3GCUA 4D55A 3R1SA 3N9XA 3OT8A 3QUPA 4FICA 3VBVA 4XG9A 4S34A 2O5KA 1R3CA 4ITIA 4DAWA 3GGFA 1REJA 3CKWA 3A62A 2E9PA 5LVNA 1YOMA 4AXAA 3ZFMA 4FNWA 3AMAA 4JXFA 4FT3A 5DWRA 4V04A 3FMLA 2BZHB 4JS8A 4KKGA 5DR2A 4C4IA 3DGKA 3BEGA 3O50A 3NAXA 2FO0A 2VRXA 5JQ8A 2F2CB 2UVYA 5HO8A 3E7VA 3HEGA 4JL9A 4WRGA 4QT1A 4C4JA 3PUPA 5I3RA 2O8YA 3AGMA 5CU2A 4I94A 1OL5A 4I5PA 2VTJA 2IZUA 4TYIA 4PF4A 3JXWA 4CEGA 1YXUA 4IAIA 2ZM4A 3D14A 3Q52A 3FXZA 1U46A 3BBWA 2HK5A 1B6CB 4AAAA 4IX5A 3KB7A 2QCSA 3O17A 3NCGA 4DH3A 3MYGA 5K3YA 4YTCA 3DB6A 4I0SA 1YW2A 4YC3A 5FM2A 3RK9A 1BI7A 3SXSA 1Q41A 3UNZA 5AX9A 4HZRA 2NRUA 3DDPA 4QP9A 4BRXA 5BYYA 4X21A 4BDBA 2CDZA 4QMNA 4M68A 3U9NA 3KL8A 2REIA 4FKQA 4QNYA 1PXLA 3EYHA 4ZTMA 4O2ZA 5E1SA 2ZAZA 4E93A 2XK8A 4ZP5A 4PMPA 4O0XA 2B9HA 3GU4A 3P0MA 2OU7A 4UBAA 3PPZA 4FC0A 5GJDA 3ZLXA 4DEHA 3GU6A 4S32A 4IZYA 3C4EA 3UOJA 3FY2A 4PTCA 3ZH8A 1UU8A 4BDIA 5AUUA 2WQOA 5CU0A 2J5FA 4IEBA 4EBWA 3UG2A 3WE8A 4NEUA 3V5LA 3GU7A 3GCVA 4RZVA 4UXLA 5DE2A 3WF5A 1Q61A 2VV9A 4NCTA 3UE4A 3AG9A 1OL2A 1OUKA 5I9UA 5AX3A 2J0LA 5ANEA 4J52A 5KBQA 1ZMVA 2GNIA 2UZTA 3ENMA 5HE1A 3W33A 4BN1A 2XNPA 3VO3A 1OL1A 4QO9A 4EOIA 2GSFA 4D2TA 2X8IA 1UU3A 3CCNA 1IRKA 3VAPA 3CQWA 5A9UA 2BILB 4MNEB 3R7EA 1H24A 3FL4A 4FIJA 2WMRA 4PPBA 4WG5A 4YPDA 3TKUA 2BRGA 2V0DA 2QOQA 2W1ZA 1V0OA 5EI6A 5AP0A 5HE2A 3PXKA 1NVSA 2VTAA 2YN8A 1PXOA 5CY3A 1GIJA 5HLWA 2FSTX 3AC5A 4HCTA 4PL3A 4R5SA 2GS2A 3ZDUA 3HX4A 3EQFA 2W1EA 4MX9A 2A98A 3FL5A 5F20A 2UZEA 3O8PA 4YTFA 3D5UA 2ZJWA 1YHVA 4I5MA 4ANMA 4C8BA 2HXLA 5IF1A 4ONAA 4ZLOA 1W8CA 3NAYA 3JYAA 3OW4A 4TYJA 3P9JA 3FV8A 5E8XA 3DOGA 3NW5A 4IAAA 4L42A 2IWIA 4FT5A 2X7OA 3H3CA 4XUFA 4EHZA 3R6XA 3R63A 1PYXA 5B0XA 3VWAA 3RAIA 4GIIA 4UALA 3HV4A 5DGZA 1XH9A 4RLKA 2JLDA 4RC4A 5A6OA 3UYSA 3CY3A 2JDTA 3DBQA 3PWDA 3HLLA 3QGWA 4U40A 3RPSA 3LZBA 4DEGA 2RFDA 3RPOA 5T6KA 5ICPA 3R8PA 2XIRA 4HGLA 4L7SA 4L44A 4IZ7A 2AUHA 2JFLA 4GJ2A 4I1ZA 3V5WA 4AOTA 4FTIA 4O21A 3AMBA 2DWBA 5JRSA 4AN2A 3VS0A 3E7OA 4G9RA 4YO6A 1YOJA 3RGFA 1OIUA 4PDPA 4UZDA 3FSKA 4W9XA 3QKKA 2C0TA 4MNEA 3R7OA 3NW7A 3BPRA 3M11A 4TKSA 4ASZA 3TNIA 1MQBA 2QR7A 1HCLA 1PMVA 2P3GX 2WU7A 3PXFA 4WNPA 4EK6A 1Y91A 4ACDA 5JH6A 1REKA 4K11A 1ZXEA 2IZTA 2YM7A 4NJ3A 4YJQA 4EEVA 4JX7A 3KU2A 5EH0A 4L68A 4JBOA 3E88A 2C6KA 3FMMA 4A06A 2FB8A 3Q9WA 4YMJA 4O4FA 4G9CA 2JIVA 4X2JA 2OI4X 3PXRA 2C5VA 4ANLA 2VGOA 4NJDA 3O7LB 2W9ZB 4C36A 3LOKA 4IXPA 1U5RA 3BYOA 5EDRA 4DGLC 4FSMA 5IZFA 3W2PA 4D4SA 2UW6A 5LJJA 3R1QA 5AP3A 5M56A 4PTGA 4E8AA 5F94A 4FSUA 4NFNA 4HNIA 3FXWA 3D7TB 4WHZA 4V05A 3DKCA 4BZDA 4G3CA 3QL8A 4OTDA 4WT6A 4D5HA 1VYZA 3F3TA 2BAKA 3KXZA 3LAUA 3MA6A 4FVQA 4X2FA 5DNRA 5HTBA 4XLIA 2J5EA 3GOPA 3DLZA 4GIHA 3U4UA 3DPKA 2BHEA 3IW8A 3NYNA 3G90X 5JEBA 5DR6A 4XRLA 1R1WA 3L8PA 3ODZX 4DH7A 5EKOA 5KMNA 5KHXA 4Y5QA 1IG1A 4CZYB 3FI3A 5KKRC 4FKTA 2VO7A 3V5TA 3OWJA 5EOBA 3TTIA 5EDQA 4LYNA 5LMAA 1KE5A 2YCFA 3QD2B 4AGCA 3ORIA 4FZ6A 2EU9A 1H25A 2XZSA 4JDJA 4RRVA 4FSYA 4NM7A 4ZS0A 5LQFA 3DBDA 4MBLA 4HGEA 1OVEA 4AT5A 3QHWA 3PYYA 3MGYA 5JKGA 3ANRA 3PY0A 3E87A 4FNXA 4ZTQA 3ACJA 3BELA 2Z7RA 5B2KA 1GIHA 4BGGA 3MPTA 3QZIA 4L9IA 3LCDA 4JRVA 1OPJA 4UMQA 3R9HA 3VQUA 1LPUA 3RMFA 1DI8A 3QWJA 2PMIA 2IW8A 2JD5A 3W2SA 4NK9A 3MJ1A 4UN0C 5T68A 2R3LA 2XKEA 3COKA 3SQQA 3I6WA 3FKNA 3ZSIA 3QD0A 1M14A 3TXOA 4DTKA 1CM8A 1JKKA 3KEXA 4AT3A 4DH5A 2JBOA 4OTWA 4IM2A 4MCVA 5M4UA 3NYOA 4D4VA 2E9VA 4D2WA 5DRBA 3VF9A 2AYPA 1IA8A 3A2CA 2QR8A 2WMWA 3FAAA 5DRDA 4KBCA 3WZEA 4AE9A 4CQGA 5CTPA 4LUEA 2J0MB 3AD4A 3C7QA 4GEOA 1CMKE 4FGBA 3EQPA 1PMEA 1WBTA 5F95A 5AV3A 2PK9A 3ERKA 4BBMA 2A4LA 2ZV9A 3LFCA 5AP1A 3HDMA 3GFWA 3VBXA 4XV2A 3V01A 4GUEA 3NX8A 4LRJA 2OFUA 4LV5A 2BHHA 3ZUVA 3PLSA 2PVHA 4DBNA 4USFA 2A27A 3E64A 4M15A 2QOFA 4E73A 4M67A 1OL7A 5HVKA 5HG9A 3O23A 4OT5A 3C50A 4GG5A 4TWCA 3HMPA 3BI6A 4O0WA 4WD5A 5BMMA 1OECA 3KN5A 2CN8A 3OBJA 2EWAA 4MAOA 4C02A 2XK4A 3A7FA 1UKIA 4S2ZA 3NUNA 3BV3A 4YJRA 4GMYA 3L9LA 3UG1A 3U8WA 4B99A 5LXMA 1BI8A 5TKDA 4O0TA 5JN2A 2ITPA 2XNEA 3FHRA 2GPHA 4D2VA 3PXYA 3W16A 4X3FA 1BMKA 1TZDA 3PXQA 3L1SA 2WTIA 3ULZA 5LVMA 4KKEA 3FQHA 2YAAA 3OY3A 4WSQA 4BIEA 2X6DA 5HI2A 5CS6A 4USEA 3G2FA 2ZV2A 2XVDA 3QKMA 3Q6WA 5HEZA 4CV9A 3ZHPC 2C3JA 3VBQA 4DINA 4FMQA 5D9HA 5EDPA 4ZTNA 2VWBA 5DT3A 4EK5A 5F9EA 1JBPE 4CT1A 5IMEA 3VUHA 1FVTA 2GDOA 4J71A 3DU8A 5A4EA 2OZAB 2PY3A 3MFRA 4J7BA 4FI1A 4I22A 4TN6A 3ZYAA 3NRMA 4ENXA 2R3PA 3BYSA 4HVSA 3DBCA 3GU5A 3FQEA 3OOMA 4L46A 2WGJA 2VTHA 3CBLA 1MRYA 2SRCA 3F3VA 4H3QA 2DQ7X 2QNJA 4QP6A 5DIAA 2JEDA 3PVBA 4PL4A 4OR5A 5EYMA 1MRVA 2X9EA 3W10A 5FEQA 2QOCA 4XEYA 3VS5A 5AUZA 4FTNA 4BI0A 1H00A 4WO5A 4EL9A 5IDNA 1M2QA 3ZO3A 2WMXA 2UW4A 4EKKA 4JDIA 3F82A 1OL6A 5C26A 1SMHA 3QWKA 3IOPA 3R7UA 2GNFA 1IEPA 2EB3A 2C3LA 4G3DA 5EHYA 4A07A 5D41A 3ET7A 5IG1A 1GIIA 2XS0A 3OXZA 4W8DA 4RJ6A 3UP2A 5AR4A 4Z7GA 3MA3A 4J53A 3MB6A 5AP6A 4AA5A 4S30A 4IVDA 4XOZA 1KWPA 5AP5A 4TYGA 2IVSA 4LMUA 5CEKA 3IW6A 4OTFA 3P1AA 5AV1A 2YHVA 5A4TA 4AACA 4JVGA 5AM7A 1KE9A 4QTCA 2O65A 4JLCA 4F6UA 3OZ6A 4RX9A 3CE3A 5AJQA 3NWWA 2OZAA 4HOKA 4XG4A 1R78A 2GHMA 5JSMA 4O4EA 5DT0A 4U45A 4M14A 4C57A 5FDXA 1OMWA 4FK3A 5HX6A 4IJ9A 1YWRA 3DS6A 2JAMA 4JQEA 4MXCA 3VBTA 4HYSA 1H28A 3KY2A 2BZIB 2GHLA 5CU4A 3QQJA 3NNWA 4EOSA 2X9FA 5EFQA 5AMNA 2W5HA 1OIQA 3QQUA 1GZ8A 2WELA 4MD8E 4F99A 4GS6A 4F0GA 4IADA 2ZV7A 3CQEA 2GS6A 4FKVA 3IGGA 2XK9A 3G0FA 4FUXA 4XG2A 4F08A 3R1NA 3O2MA 1VEBA 3QLFA 3HZTA 3N51A 5M55A 1BX6A 1YXTA 3V8TA 4M84A 4L3JA 2HXQA 4F09A 2P33A 2QKRA 4IFCA 4D1SA 3GQLA 5CYIA 5DPVA 2XNGA 4FOBA 3LCSA 4PV0A 1ZYCA 3QTXA 3ORKA 2VWXA 1JKSA 1H26A 1H1RA 2YEXA 4R3CA 2PZYA 3COHA 4CFMA 2BRBA 4W4VA 4EYMA 4P5QA 1FVRA 3C0HA 1TVOA 2XH5A 3P7AA 1RDQE 4PTEA 1PW2A 1QPDA 3KF7A 3A7JA 4KSPA 4TWNA 4YZCA 3CTJA 3CTQA 2G2FA 2WOTA 4HYHA 5HLPA 4AUAA 4FSZA 2YA9A 4KIPA 1PJKA 3W32A 2OIDA 4EOLA 5AP2A 2ZM3A 3MIAA 3OBGA 3ZSGA 4DITA 4EONA 1R39A 1S9JA 3OTUA 4C4HA 5LOHA 4A9UA 4E4LA 4BDDA 3RAKA 4E4NA 3CQUA 3D2IA 3BIZA 3FJQE 4JBPA 3HVCA 4EYJA 3WBLA 1CKJA 3GCPA 5FM3A 2OW3A 5LARA 2J4ZA 2OKRA 3GNIB 5KZ0A 4C3FA 4IVCA 4BCIA 4A9RA 4N4SA 4RJ8A 4A7CA 2H9VA 3OT3A 3W55A 1UNHA 3AD6A 5CZIA 2XRUA 4WBOA 3QA8A 5HNBA 3UBDA 3MWUA 4GYGA 2H6DA 4H3BA 2EB2A 5IPJA 4R1VA 3HV5A 3VUTA 3WI6A 4AGUA 4BL1A 4G6OA 4JIAA 4FV7A 5GJFA 3LCKA 2GU8A 4RIWB 1XH6A 4S33A 4YJNA 3ZBFA 3H9FA 4IM3A 4A4XA 4DG0E 1PMNA 2BAQA 3PSDA 2R2PA 4X2KA 1KSWA 4MKCA 4XX9A 3TG1A 2X0OA 2HZ4A 2IZSA 2R3OA 4NM0A 3OY1A 4YNOA 4D2RA 3C0IA 3UDBA 4QPSA 4C34A 4F7LA 3KRWA 3FZOA 3SXRA 3A7GA 3LM5A 4MVFA 4YHJA 3LMGA 5G1XA 4JX3A 2P2HA 4UWYA 1PKDA 4F63A 3LXLA 3UODA 3D83A 2BFXA 4LRKA 4EZ7A 2WXVA 3NS9A 1FMKA 2I0EA 2YITA 2WTVA 2ETKA 4QD6A 1JQHA 3HRFA 4OBQA 3NUXA 3ZSHA 2XYNA 2JIUA 2IW9A 4NKAA 3UQGA 5CT0A 3SV0A 1PF8A 3QXPA 5B2LA 4QQ5A 4AF3A 4EUUA 3PG3A 1SZMA 4RFZA 3ZFXA 3ZO1A 4EWQA 4UMPA 5B2MA 3HP5A 4AW1A 3I4BA 1ZARA 3A60A 3FZTA 3L8XA 4Z7HA 5D7VA 5FBOA 3GP0A 3I6UA 3GXLA 3E62A 3RBWA 3SRVB 4MQ1A 3DK7A 3SLSA 4JBQA 1YDTE 1I44A 3CD8A 3Q96A 3KXMA 5GZ9A 2QOOA 2W06A 3DY7A 4GYIA 3Q6UA 4XNEA 4WIHA 3C1XA 5EG3A 3RNYA 4U41A 3EN9A 4ACGA 4CTCA 2QURA 3ZC6A 2ZMCA 1URWA 4F6WA 3O51A 2QOHA 2VTOA 4QTAA 3OC1A 5CWZA 2E9UA 4K0YA 2UW3A 4GSBA 4D2SA 4ZTSA 3MW1A 1J1CA 3VRZA 4RIWA 4NW5A 4I24A 5D7AA 5K5XA 5L6PA 1HCKA 4HGTA 2VX0A 4AZSA 4RX8A 3EMGA 4WUNA 1KOAA 5I0BA 4RQVA 4IACA 3QQFA 4CKJA 5HCYA 4PL5A 4JIKA 5CEIA 4FNZA 4KWPA 3FBVA 3QX4A 1YVJA 3Q4UA 2E9NA 5BUIA 2VTLA 2ZB0A 4APPA 5L3AA 1SM2A 4RX7A 5TF9A 2GS7A 4HVDA 3VHKA 3LIJA 2ITZA 4WOVA 5FP5A 4U3ZA 2WTKB 3WOWA 4RIXB 2IJMA 1XO2B 3QCQA 3R2YA 4EUTA 2YIQA 4JQ8A 1YHWA 4XV3A 2ITOA 2UZOA 1Y6BA 5HG8A 3FLNC 4BCHA 2GHGA 3EQCA 2BIYA 3BLQA 1H01A 5CNOA 3DJ7A 3T3VA 4BTKA 4DYMA 3R28A 5AA8A 2CGWA 3DZOA 3SX9A 3A99A 3SRVA 4E6CA 4U44A 3F88A 3QD3A 5ANDA 1MUOA 3BX5A 3FWQA 3JPVA 3PZHA 4LOOA 4QYGA 3BCEA 4PP7A 1L3RE 1T46A 3F61A 2XCHA 5EYDA 1H1SA 2HOGA 4WNMA 3FE3A 4MQ2A 1B38A 3ZLSA 3JY9A 3V3VA 4ENYA 3NIZA 2R3IA 3ZEWA 3QC4A 5IH6A 4E5WA 3S00A 2OJIA 2V62A 3IOKA 5E91A 1ZY5A 2BZKB 4ZTLA 2WMAA 4FIHA 2FVDA 2WMUA 2YISA 1JOWB 2WHBA 2CMWA 4FYNA 3CTHA 4C33A 5A4CA 1ZZ2A 3R71A 3FLQA 4GK2A 2QO9A 2VWVA 4ASEA 2C6OA 3PXZA 4BIBA 2ITVA 3EWHA 5E1EA 1R0EA 3D5VA 1OKYA 4QMLA 4EK3A 1Z57A 3D5WA 4RT7A 2QU6A 4UZHA 3UZTA 4KBKA 3UO6A 3P78A 4H36A 1E9HA 2XEYA 1OGUA 5L2TA 3I7CA 4FIEA 4QTBA 4GFOA 1RQQA 2PMOX 4R3RA 3RPRA 4CFVA 4Y72A 1ZOHA 1U59A 5HNGA 3O8UA 4RIXA 3E8EA 3LHJA 4IB0A 2F49A 3HUCA 2RFSA 2DYLA 4TZRA 4IB3A 4F9YA 4ZSGA 2YABA 3I0OA 3QZGA 4FSRA 2JKKA 3V04A 5C8MA 2WTCA 4GL9A 2ONLA 4D2PA 3SD0A 4JAIA 3QTIA 5I9XA 4IB1A 4ZSJA 3RTPA 2O63A 5A54A 5AM6A 4EOQA 3K5UA 3O96A 3R04A 4DHFA 1IASA 4ZY4A 3OOGA 4DG3E 3NW6A 4XH6A 4YHFA 2UZLA 5JGAA 4JAJA 4FYOA 4D58A 2ITNA 1B39A 3DTCA 3QF9A 4HYUA 4PWNA 5FP6A 3UJGA 5A4LA 1OPKA 3RP9A 3POZA 1Z9XA 3DXNA 4QMSA 5ANGA 5BVKA 5L8LA 4XG8A 4UEUA 3EOCA 4EC9A 3NSZA 3PWYA 4I20A 2W17A 1PMUA 4QQCA 4BKJA 5LMKA 1S9IA 3NUPA 4XYFA 5K4JA 3QGYA 3OWPA 2VNYA 5KX8A 4I23A 3E3PA 4QOXA 1SVHA 5JQ5A 3GCSA 2Z8CA 3PG1A 4NUSA 4ZJIA 1ZMUA 4IE9A 4MF1A 2JGZA 5JZJA 3SA0A 1PXNA 4AOJA 4QTEA 5FGKA 5L8KA 4C3PA 4PMMA 2JDVA 2UW8A 3IS5A 3PIZA 4GRBA 1FINA 1TKIA 4L67A 3QTZA 2C3KA 5J9ZA 3P4KA 4EZ5A 5L6WL 1UU7A 4WSYA 4RJ7A 5BVDA 2BMCA 4QMMA 4AA4A 4AWIA 4BCFA 2A19B 2BFYA 2W5AA 4K77A 4CFNA 3S4QA 4AN9A 2IVTA 2QKWB 3FXXA 2Y7JA 4NM3A 2XJ1A 4FV9A 1GJOA 4DC2A 5CEQA 3BBTB 3S1HA 1F5QA 4I21A 3D2KA 4QP2A 3AOXA 4RA4A 3IW7A 3KVXA 5AP7A 1H8FA 2YDIA 4U0IA 3TN8A 3DBEA 3UC3A 4Q5HA 1GZNA 1SVGA 4GV1A 4IANA 4OAUC 3B8RA 4A9SA 4FSTA 4IDTA 3MH0A 4HZSA 4YZNA 5LWMA 4C62A 1JSTA 2QOLA 3FI2A 4EH6A 2JKOA 3U6JA 4OUCA 2PE1A 2BRNA 2VWWA 2VTTA 4H39A 4L7FA 4C59A 2CHLA 4IIRA 4BTJA 3OMVA 3VUKA 5KUPA 2QO2A 1XBCA 4ALUA 1W84A 2RSVA 3EL8A 3H0YA 5A4QA 4KB8A 2VZ6A 4FV2A 4TT7A 4ZZOA 1BKXA 2C68A 4L52A 4AZEA 2XB7A 1X8BA 2O0UA 2WB8A 1APME 3Q60A 4K2RA 1JAMA 3EQHA 4NTTA 5IKWA 3CJGA 5A3XA 5LMBA 2YACA 3IDBA 3QTQA 4OW8A 2VNWA 3FUPA 2CLQA 2HW6A 1Q5KA 2IF8A 4XBUA 1BL7A 4KIOA 4MTAA 3FKOA 1NY3A 2YIRA 5KHWA 1H0VA 3PIXA 2C6EA 5HCZA 1H1QA 5CENA 3RPYA 5HD7A 3R7GA 4O4CA 4BCMA 5C01A 1YXVA 3TNWA 3MN3A 1R0PA 4L6QA 4RVKA 5BX0A 2AQXA 2BRMA 1LEZA 5CSVA 3LCOA 3PY1A 3QTRA 4EZ3A 5FXQA 4BDCA 4X6RA 2WQNA 2A0CX 2BDJA 3EFLA 3A7IA 1BUHA 2OJFE 4O6EA 3RNIA 1M7NA 3QQKA 3O7LD 3K3IA 3F2NA 3LFAA 5GHVA 4NH1A 4GCJA 4O0VA 4ZTRA 2B55A 1FQ1B 1WFCA 1RJBA 3F66A 4GU6A 3QUEA 3WZDA 2OXYA 4CKRA 1Q8UA 3UQCA 4YSMA 5CI6A 4R7IA 1W98A 3FPMA 3SXFA 2PVKA 3PPKA 4L8MA 3LM0A 1WVYA 4CMOA 1OIYA 3SVVA 3PIYA 4XCUA 3OF0A 3W2QA 2FYSA 2GNHA 4QQJA 5DR9A 2GFSA 2ZOQA 3CIKA 3TV4A 4C4FA 1ZLTA 5FG8A 5GZAA 5M4FA 2P4IA 3AT2A 3NNXA 2XIKA 3UIBA 3HDNA 5C9CA 3VIDA 2OXDA 2EXCX 5HBJA 4G5PA 4FTRA 2HWOA 4UB7A 5CASA 3GU8A 3E63A 3FPQA 4CQEA 1YXXA 4FKJA 5KNJA 4PUZA 3AC3A 4ALVA 2V22A 3ORPA 3EFWA 1Q24A 3DJ5A 2O64A 3DAEA 3QD4A 3KKVA 3LCTA 3QQGA 1XKKA 2WZJA 3UIUA 4QMTA 5HQ0A 5HU3A 2VWIA 3U9CA 3LJ0A 3IG7A 5AEPA 4BZOA 4BKYA 5HVJA 5KMKA 4M69A 2UW7A 4XLVA 5KBRA 2PUUA 5J5SA 3EN5A 2C5NA 4LI5A 4O0YA 4P7EA 2W1GA 3JVSA 1OKWA 3MJ2A 5DT4A 3KCFA 2R7IA 3DDQA 3W2OA 3TT0A 4KIKB 2X39A 4IC7A 3ZBXA 3II5A 2NPQA 2WKMA 2PSQA 3HMOA 3V5QA 4BYIA 5IU2A 1F3MC 1QPEA 3QTSA 1M52A 2OXXA 3M2WA 3QTWA 3DAJA 5ETAA 4O4BB 4A4LA 4QPAA 5CAOA 2O2UA 3BYVA 2CSNA 5JFSA 2C30A 3P23A 2PVFA 2G01A 4E3CA 5DHJA 5DLSA 2GNLA 3C4WA 2UVZA 4PPCA 4PNIA 4BDJA 5JRQA 5KMIA 1UNGA 4FZDB 5L4QA 2XIXA 3BYMA 2Z7SA 2J0KA 2X81A 3EH9A 3ZM4A 4ERKA 3R8UA 4C0TA 2FA2A 3VHEA 3ZCLA 4A9YA 1NVQA 3TNPC 3EQIA 5HOAA 4GT3A 4LUDA 4G1WA 4YLJA 4BBFA 1OI9A 1JKLA 3KRJA 4KRCA 2JFMA 5AR5A 2W4KA 3BV2A 4PRJA 4X3FB 2CCIA 4E6DA 4F9WA 2HELA 4IX6A 5IEXA 4L01A 5EKNA 3R83A 4Y5HA 1G5SA 3FZSA 3TUCA 4YNEA 2R64A 2HCKA 3HA8A 4AT4A 5CEMA 5K0XA 2XYUA 4RIYB 4HYIA 2R3KA 1FMOE 4B0GA 4J8MA 3PE1A 4GFGA 5I4NA 1JSUA 3DJ6A 3PRIA 2WEVA 5AV0A 1M17A 4FV4A 2HZNA 2YAKA 5CAUA 4AZVA 4QTDA 4KABA 4C3RA 1YQJA 4HCUA 1LEWA 2V5QA 3CPBA 4U8ZA 4B8LA 3NUUA 4KIKA 4E6AA 4MD7E 1JLUE 5K4IA 2EXEA 2OF2A 3LFSA 4NKSA 2VTMA 4YSJA 4ZAUA 2NRYA 4WBBB 3LFQA 4CSVA 3KQ7A 4EHGA 3OW3A 3PE2A 1V1KA 3BZ3A 2DS1A 4OAVB 3CS9A 3D15A 4O1PA 3OWLA 2XKCA 4HVHA 3VUIA 3H9RA 3QZFA 5C8NA 3Q4TA 4FODA 5C1QB 4XP2A 3NNVA 2W4OA 1RE8A 1UWHA 4NW6A 4PMSA 2QC6A 4TNBA 2YM5A 4UWCA 4O91A 3RZBA 2XJ0A 4YJUA 1W2DA 5E8TA 3EYGA 3RHKA 3W8LA 2XBJA 2PVJA 2YM8A 4E4XA 2Y4IC 4IX3A 3IKAA 2PZ5A 2W1IA 1A9UA 2XUUA 4DEIA 3TACA 3CPCA 3KRRA 4FG8A 4U97A 1Q8TA 3MDYA 4QMZA 5AUWA 5ETIA 3WIKA 4XJ0A 3T9TA 3LFBA 4AFEA 2YDKA 2BTRA 3I0QA 2JKMA 4QYYA 3BU3A 4MD9E 3E92A 4XP3A 2B1PA 3BLHA 4LQMA 3BHHA 4DFXE 2W0JA 2FSLX 4NTSA 4ACMA 2YFXA 5TO8A 3OCTA 4DFYA 3RM6A 4EH8A 4Q2AA 2J2IB 4RIYA 4I6HA 4J1RA 5CU3A 4FKWA 5EM8A 5H8GA 2WD1A 5CAVA 5KMOA 2PVLA 4CZUA 4GH2A 3LFNA 3Q9XA 3TL8A 5J9LA 3FMNA 3A7HA 2R9SA