5AR5A

Rip2 kinase catalytic domain (1 - 310) complex with benzimidazole
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
284
Chain Sequence
EAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMEGGTIIYMPPENYEPSIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 284
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar5A00
2WKMA 2R3KA 4RVMA 4GT4A 2BAKA 1UVRA 2ZV9A 4P4CA 3R7GA 3BLQA 1ZYJA 2OZAA 2YM5A 3QXPA 4X0MA 1FGKA 1M52A 5C1QB 4A9TA 2ESMA 2O5KA 1V0PA 3ZO2A 3F82A 3I5NA 5ANEA 3DKCA 1OZ1A 2GS7A 4H3QA 3PA5A 3BLRA 4LQMA 2QHNA 1M17A 3LFBA 2G15A 2PK9A 1NVRA 2GTMA 4GRBA 4U81A 4MD7E 5AR8A 3C4XA 4L01A 2ZV8A 4NTSA 4BGHA 4DAWA 1BLXA 1YOMA 2R3MA 2WQOA 3B8QA 4MWHA 3FLQA 3QLFA 3F6XA 2OJ9A 3PYYA 4J97A 1QPDA 4EOOA 4YSMA 5FLFA 4EOLA 2OF2A 3EQHA 2GDOA 3L1SA 5KHWA 3DK3A 4B7TA 5IA4A 2XIKA 5EHLA 2ETKA 4G34A 3MH3A 5C03A 3QQUA 5FBNC 2RL5A 3DBDA 1NA7A 4IB5A 1KE8A 3OW3A 4L53A 1ZOHA 3C1XA 4QP7A 1E1XA 3CQEA 4H36A 4RRVA 4FSRA 4E6CA 4LMUA 3R1SA 3PVWA 4M14A 3OWLA 3MI9A 3KRXA 3RK5A 4YC6A 5AWMA 1REJA 2QKWB 2XJ0A 2OH4A 4X2FA 4C2WA 3E5AA 3VBQA 3VHKA 4F99A 4ZTNA 3RK9A 3IDBA 3H9OA 4QMZA 2CCHA 3T9IA 2OH0E 4FI1A 4CRSA 4FG8A 4AA5A 2QOHA 2W9ZB 5IG1A 3OOGA 4XV1A 4BHNA 4DINA 3UYSA 5FXRA 4WG5A 3HV3A 3NW7A 5BVEA 3RMFA 3UMXA 3ZFYA 3QL8A 2WEIA 4NM3A 3SDJA 3O23A 5H9BA 3KEXA 4CFNA 3LFQA 3UGCA 5A4EA 2BMCA 1ZWSA 4I23A 4L8MA 5HO7A 2RKUA 4O1OA 4CMOA 1LUFA 5I9ZA 4FK6A 5GNKA 4CFUA 1WVWA 2YJRA 3ETAA 4OTPA 4YBKA 5F1ZA 3VBVA 3FZRA 3QFVA 5TKDA 2J2IB 4FSQA 4LI5A 1YXUA 5DFPA 4X2JA 3I60A 5J7HA 3F69A 4C4GA 4L46A 3TJCA 3MFUA 4GIHA 3Q9WA 5HNBA 5DG5A 1YDSE 3NCGA 1H25A 3DLSA 3TWJA 3FYKX 5FDXA 2C30A 5C8NA 5LCJA 3GC7A 4ITIA 4Q5EA 4TWCA 3GCSA 3OT3A 2XYUA 4QMSA 4PPBA 4W4VA 2HWOA 5HGIA 3BYSA 1U54B 2BZKB 4BTJA 3NCZA 4RVKA 3P0MA 3UNKA 2XK3A 2JLDA 4ZXTA 3EQCA 5IH6A 5H8GA 4NKSA 3IO7A 2VWIA 3PPZA 4JR7A 3PY1A 4FNWA 4FUXA 1XWSA 2PVKA 3DJ6A 5LVOA 2RFDA 4N70A 4FG9A 4ZSJA 4D5KA 5CAPA 2OJJA 4W8DA 3F5PA 3FLSA 5B0XA 3IW6A 1PKGA 4W9XA 3R8PA 2JDSA 3MH2A 4FV9A 3BQCA 4NCTC 4X6QC 3CD3A 3FMJA 1YXTA 1SVHA 3UP7A 2WOUA 1OKZA 3DJ5A 4R8QA 2Y0AA 3SOCA 2OIBA 2ZJWA 3AC2A 5HLNA 3CS9A 3QU0A 1CDKA 3LCDA 4UMTA 3R8UA 2XCHA 1Q4LA 3BHUA 4RIYB 3SW4A 1OMWA 5CNNA 4M0ZA 4DGOA 1GIJA 5E91A 4G1WA 3K5VA 4FYOA 4IB3A 1ZYDA 2XP2A 3QKLA 3BGQA 2H34A 4QQ5A 3LFNA 1ZOEA 2BDJA 4NSTA 4HGLA 4TTHB 3QTQA 4G16A 3CQWA 4HCTA 3F3ZA 4XLIA 3W1FA 4DN5A 4V01A 4RLLA 4DH1A 3H0ZA 2G9XA 4YHTA 5BNJA 2GHMA 3MVHA 3UP2A 3ZEWA 5IUGA 3AOXA 2OWBA 2ITYA 2VTPA 4AXAA 1FMKA 3K54A 3HMMA 3BELA 3QA0A 5B2MA 5IMXA 5L2TA 3T3UA 3ZSGA 4YTIA 3VS5A 5BVNA 4JG6A 1K9AA 1YDRE 3VC4A 3GBZA 3NAYA 4N0SA 4HNIA 4BTMA 1H1SA 5EW9A 5JK3A 2UZBA 3DS6A 4ENYA 3TT0A 4M66A 3WF9A 5IDPA 3NRMA 3VBYA 4EH9A 5JFSA 3TACA 2R7IA 4Q9SA 4A9RA 4FMQA 5J9YA 3OUKA 2C68A 3MV5A 4LFIA 4ZS0A 2QOCA 5EM8A 3RJCA 4BDKA 4AG8A 5L6WL 2HXLA 3BV2A 4JNWA 1U5QA 4BF2A 3C4WA 4FIEA 3HMPA 4N6YA 4QP3A 3TZ8A 5LWNA 5I9UA 2UZLA 3H9FA 3HL7A 5F4NA 4X7QA 4U45A 4BI1A 3Q4TA 2C0OA 4FTTA 5KMNA 3RWPA 3OBGA 4KSQA 4JI9A 4GW8A 5EW3A 4JDIA 5DWRA 3FC1X 2ITNA 1YI4A 3NUYA 5EM6A 1M14A 3QZFA 2C1BA 4IEBA 4ZY4A 4ASZA 4RJ4A 2BTRA 4ZTMA 3NUNA 5DE2A 2XS0A 4YLJA 3GU7A 4TZRA 3CTHA 1URCA 1XKKA 1CMKE 2B7AA 3MY0A 3UTOA 3CQUA 5DIAA 3TZMA 4MD8E 2PWLA 4ONAA 2CPKE 4H1MA 2VO6A 3HECA 3R7UA 3FL5A 2W4JA 4BZOA 1W84A 2WU7A 3KXGA 3AC8A 2W5AA 3PXKA 3CY3A 1OIYA 3QZGA 4HYIA 3W33A 3PZHA 4TY1A 3FI3A 3DPKA 3FYJX 4YJSA 4M15A 5ANKA 1OKYA 3THBA 4D4SA 3MYGA 4JDHA 2PMIA 3EKKA 2A19B 2ZM1A 5M57A 3VULA 5HICA 2BAJA 1LR4A 4NW6A 4TYIA 4FKIA 2EB2A 1BUHA 2JKOA 3O8PA 4HPTE 4ITJA 3UOLA 4AGWA 2WTVA 2X2LA 5HD4A 4AW2A 2ZM4A 3IECA 3G0EA 1YQJA 2H96A 3I7BA 4ID7A 3RGFA 4MF1A 2UW4A 1FMOE 3C4FA 1NVQA 5M4IA 4IDVA 4F0GA 3EN6A 3V01A 2HYYA 4TYGA 3QTUA 4FTIA 4GT3A 3TCPA 1M7QA 3BE9A 4CKRA 5IF1A 3FV8A 3U9CA 4XHKB 3NDMA 3ZDUA 3M1SA 4PPAA 2QI8A 4USFA 5CASA 4J8NA 2VWUA 4GVJA 5CALA 4L3PA 5L2WA 3VQHA 5A4CA 3WOWA 1ZMUA 3RCJA 3ZRKA 3GU4A 4R1YA 3Q5ZA 3MB7A 4XLVA 5A3XA 3E8CA 3KF7A 1KE9A 2PZYA 3UVPA 3R21A 3SD0A 3R8MA 1YRPA 3GU6A 4F9AA 3PPKA 2C3IB 2C3KA 2VWWA 5DEWA 1YWNA 4FODA 4U97A 3MW1A 5C01A 3EFLA 2YJSA 3KRWA 4FEQA 5EG3A 4Z7GA 4PMTA 4UZDA 1TVOA 3RKBA 5A14A 4XG2A 3PFQA 2XYNA 4MX9A 3KF4A 2W1HA 3UQCA 1UA2A 3GQIA 3H10A 4S33A 1KWPA 3D94A 3GXLA 5BPYA 4FKSA 3ROYA 1U54A 4EK5A 4PUZA 4ZJIA 3CTJA 3BIZA 3G6GA 4YZMA 3SXSA 4MHAA 3N9XA 2VV9A 1Q3DA 2Y8OA 4G5PA 3RPYA 2BUJA 1OUYA 2VTLA 4KBKA 5DH3A 1QMZA 2E9OA 4Y5QA 4AZEA 4WUNA 4FV4A 4BHZA 4DEDA 4IM2A 5J9ZA 2YN8A 3HA8A 4EK3A 4JQ7A 5K4JA 5BVDA 2C69A 3ZRLA 4C62A 4EH6A 3EB0A 4L42A 5HVYA 3EH9A 4TYEA 3T3VA 1BYGA 3A4OX 3ZBFA 3B8RA 4WRGA 2WHBA 4WNKA 4U0IA 1LEZA 4EQMA 4YR8A 5CANA 4I0SA 2ITTA 2Y6MA 1V0BA 3FE3A 5EI2A 1M2QA 3RI1A 2VTQA 2OXYA 1K2PA 3COIA 2QOBA 2ZM3A 3RHKA 4BIBA 4RIYA 2X8DA 3NPCA 5JMSA 5IUIA 3QWJA 2GMXA 5DBXA 5IA3A 4ZSEA 4RJ6A 3ZS5A 1JWHA 2WU6A 3PSBA 1O6YA 3FUPA 3LMGA 4LGHA 4MQ2A 4OBPA 2WMTA 3WZEA 3REPA 4I5MA 4PDPA 3COMA 4FKTA 4CFFA 4XP3A 3WILA 4AACA 2NPQA 4FIGA 2Q0NA 4DH5A 1SNUA 4IIRA 2J5FA 2GCDA 3LCTA 4LL5A 4RIXB 4S31A 3LFFA 1JKSA 2J0KA 2QG5A 2BALA 4ZTRA 3UPXA 4CYJA 3I5ZA 4Y95A 5FTQA 4QQTA 3TUDA 5EHOA 2UVZA 2XIRA 3PJ3A 2WIPA 5M55A 4J98A 4C2VA 2X2MA 4O0XA 5CI6A 2B52A 2W5BA 3LJ1A 3BQRA 3ZO1A 3PRFA 4K18A 2XNNA 4XH6A 3DTWA 2KTYA 5HE0A 2WMVA 2P55A 4AE6A 1JLUE 4I0RA 2JDOA 4RVLA 4GJ3A 5L6PA 3MJ2A 3GT8A 3HP2A 4I5HA 3D9VA 4W4WA 4OTIA 5E8TA 4W4YA 4F7SA 1IEPA 1YW2A 2E2BA 5AP7A 3Q2MA 3S2PA 3OTUA 4FKVA 4TXCA 5GJDA 4NKAA 3RNYA 3V3VA 4CMUA 1REKA 4BCJA 5HQ0A 3BKBA 4A4LA 3KVXA 3W2PA 4EH7A 2XM8A 4U42A 4ZEGA 3I1AA 1HCLA 3ZYAA 3FQHA 3PWYA 5AV2A 5LOHA 2KULA 4JOAA 3JY9A 2A2AA 4O0WA 1RDQE 4L52A 1NVSA 1U46A 4V04A 3HKOA 4XOYA 3QC9A 3UO4A 4D1XA 4DHFA 2CLQA 5FXSA 4EK4A 3IKAA 4FTUA 4PY1A 3BX5A 4G6NA 4DLIA 5ICPA 3ORXA 5GZ9A 4D1SA 4HW7A 1OVEA 3MPMA 4FV0A 2Y4PA 4HGSA 5TO8A 3ZFXA 5A54A 3GVUA 4BCKA 5KMKA 2W7XA 2XKFA 3L8XA 3MDYA 3FLYA 5CSVA 4ENXA 5CU6A 5AR5A 3RZFA 4JX7A 1M2RA 2ITOA 4I94A 5CEIA 5GJGA 3AC4A 4F09A 4EI4A 4ANBA 2ZOQA 2YIYA 4APCA 2UZUE 4FT0A 5CTPA 3EKNA 2E9VA 3GB2A 5AAFA 2H6DA 2XF0A 3KFAA 3TEIA 3DOGA 2YDIA 3AGMA 3DZQA 4CVAA 3VS3A 1E9HA 5DRDA 1IRKA 3PRIA 3KVWA 4Y8DA 4D0WA 2G1TA 2CCIA 3QD4A 3QTSA 4OR5A 4FT5A 4XG3A 3UO6A 4YC8A 2XCKA 1AD5A 3QA8A 4F7JA 4FZ6A 3W18A 4RFMA 4TT7A 3PVBA 3S3IA 5HBHA 5M4CA 4QTCA 4X2NA 2QVSE 2V55A 4ASEA 5CQWA 4CTBA 3NW5A 3FLZA 3QALE 5HIDA 3VS7A 4C61A 5AUZA 2B9HA 4FKRA 4HZSA 2UW8A 3RM6A 3SXRA 4GJ2A 3UNZA 3ZLWA 4BI0A 4PTCA 5HCXA 4RIWB 5CEPA 1PMVA 2BFXA 4Z7HA 2A1AB 4D9UA 3BHTA 3R71A 4DFXE 3OWPA 4Q2AA 3ANRA 3L8PA 1YI3A 2DYLA 4IAYA 4WOVA 4DH7A 5AP5A 3BEGA 5IUHA 4FKJA 2PY3A 1ZZ2A 5T68A 3PIXA 1WVXA 4EEVA 5KX8A 3D14A 5EI6A 3KC3A 4TN6A 1H1WA 2Y6OA 1X8BA 4UZHA 4AZSA 3QKKA 2JITA 3NUPA 2BRHA 3UQGA 5BQ0A 3VVHA 2J0JA 2F7XE 5D7VA 2OIQA 1KV1A 3UIBA 4PP7A 2HZIA 2WD1A 3DV3A 2HENA 1Z57A 4C34A 1P4OA 3UZTA 4BCQA 3OZ6A 2C6DA 3U6IA 4ACMA 3Q53A 1PXIA 1DI9A 1W7HA 3EHAA 3FMHA 5AADA 1JPAA 3PA4A 4I5PA 3DY7A 4FTKA 3BRBA 4FNYA 2BAQA 2OFVA 5CT7A 3DBFA 4L00A 5BVFA 3QF9A 1FVVA 2YACA 2YA9A 1T45A 1DI8A 4EKLA 2XKEA 4RX5A 4YLLA 4NFMA 4E4NA 4EUTA 1UKHA 5J87A 4M68A 3OCSA 4NT4A 4C37A 2BROA 3ET7A 3G0FA 2WMQA 2VZ6A 3IGOA 3NNWA 2CDZA 4L7SA 2JDVA 3A60A 4RZWA 4EOKA 2WO6A 4GFGA 1L3RE 4BCMA 4ZJVA 5J9LA 3SA0A 2CGXA 1ZYCA 4EOMA 1TQPA 4A7CA 4FV2A 4EH3A 2F7EE 5F20A 2VNYA 2JKKA 2WTDA 4CT2A 2RFSA 1Y6BA 3SKCA 4F6WA 4M3QA 5HI2A 2VWVA 3WZDA 4F70A 5J1VA 4DG0E 4PPCA 2XNGA 3V5PA 3LAUA 2EB3A 5A9UA 3C4CA 4E4XA 5HBJA 4WG4A 4ANQA 4FGBA 4TWNA 3UOKA 3TI1A 4YSJA 4F0IA 5I0BA 2JAVA 3L8VA 2JDRA 4BDGA 3U6HA 3AMYA 3DJ7A 4O0RA 2QOQA 5HOAA 4WD5A 2ACXA 4LOQA 1T46A 2PHKA 3QTWA 1ZARA 3R9OA 3ZC6A 4BCFA 1W98A 3I7CA 2C3LA 5CXHA 5H8BA 4D4RA 1HCKA 4KB8A 3KN5A 4EORA 2QQ7A 4FTAA 4R3CA 3LW0A 3SRVB 4E8AA 3S1HA 2YEXA 4C59A 4A9YA 4E6QA 3FQSA 3MY1A 1RQQA 3FXZA 5AA8A 3HMNA 4F9YA 5CAUA 3R1YA 4BRXA 3MH0A 5L8KA 2PE1A 5FD2A 3QTRA 5HKMA 3M2WA 4H39A 3OP5A 3PWDA 4IB0A 5KBQA 1ZZLA 3QYZA 3LXNA 4BWKA 3CGOA 1RJBA 3GCVA 2R3RA 1RW8A 2IVUA 4E93A 5AAEA 2RFNA 3F5UA 1Q24A 3FBVA 3FMMA 4O0TA 3VUTA 3ORPA 3CGFA 1SVEA 2HOGA 4K33A 4FZDB 3P23A 4KINA 5K5XA 2PZRA 2HW7A 2Z7QA 3GGFA 4IHPA 1A9UA 3HNGA 3KXZA 3LXLA 2UZVA 4FVQA 4G3DA 4KIKB 3R63A 5AMNA 3VO3A 4R3RA 4AOJA 4UYAA 4UXQA 4ZLYA 2WMAA 3MVLA 4EH4A 5CXZA 4FSMA 3QCXA 5A4QA 4J96A 4YZCA 2VWXA 4FV8A 3HRBA 4GFOA 4ACHA 4U41A 4PMMA 4JQEA 4M84A 4V0GB 5CT0A 3PJ2A 3E93A 4ZIMA 5HVKA 5K0KA 3V5TA 2WNTA 4S34A 4CCUA 3NEWA 2EUFB 1FPUA 2IJMA 2UW5A 5IPJA 2J9MA 2XNPA 4E26A 1VYWA 3D83A 1K3AA 2V62A 1H1PA 1PXLA 3R1NA 3DKOA 2FH9A 5EHYA 3V5LA 2BPMA 4J95A 3MIAA 5HE1A 5CENA 1WVYA 2PVNA 2Z7SA 4HGTA 3KKVA 3ZTXA 1QL6A 1PMUA 2IVVA 4G9CA 3KRLA 4C4HA 2X7FA 3I6UA 3A61A 4FV7A 3ZZWA 1VYZA 4BDHA 2P33A 2X6EA 3RPRA 2UUEA 4NTTA 1W82A 3PJ1A 4HVIA 1LPUA 2XEYA 1H1RA 1OPLA 5HTCA 3FMEA 4F08A 4NM0A 2BRMA 3GC0A 4QP4A 1JKLA 5BVOA 3RCDA 3WI6A 4BTFA 3F7ZA 1XJDA 3GEQA 4JT3A 4MAOA 4EOQA 2G2FA 3Q9YA 3O50A 4OW8A 1P2AA 4JRNA 4UY9A 5DEYA 5LQFA 4IVBA 4PDOA 5BUJA 2BRGA 2X9EA 4CT1A 5CSHA 4QYHA 1QCFA 2V5QA 5M4UA 4YJTA 4KBCA 3PVGA 4WT6A 2YCSA 4FSUA 4P90A 4RIWA 5ANDA 3SX9A 4ANSA 5HX8A 2ONLA 4FSZA 3WF6A 3ITZA 4I4EA 3RHXA 5CQUA 2BCJA 4OTDA 1YXVA 3KXMA 4WBBB 3E3PA 2CGWA 4HGEA 2WMXA 2W06A 4F4PA 2OJFE 4OBQA 1Q62A 3FPQA 3EL8A 4KS8A 3TJDA 1H0VA 4WKQA 5M53A 4AW0A 4FKLA 2OU7A 5AV1A 3M42A 3KMUA 4E6AA 3FJQE 4ZLZA 4NM7A 3AD5A 1OIRA 3DTCA 2Y4IC 3JPVA 5E92A 1XH6A 4R7IA 3NUUA 3NUXA 2WGJA 1P4FA 3BHHA 4HVGA 3VS6A 3NSZA 1YHWA 5FBOA 2UVXA 1DS5A 2RGPA 4XRLA 2GPHA 3CJFA 3D15A 3R1QA 5AUTA 4GCJA 2ZVAA 2QO2A 5EDPA 3CR0A 3NS9A 1H00A 4KNBA 1NXKA 2I40A 3HRFA 4DTKA 2OGVA 3BV3A 4H3PA 1MRVA 3PY3A 5AR2A 3PXYA 4AUAA 3F3UA 2B53A 4LOPA 4RWKA 4XUFA 4EOSA 1PMNA 3GU8A 4MBJA 4F7NA 3S0OA 3GCQA 4RJ5A 2X81A 5CF6A 4YNEA 1OECA 1TQMA 4PMPA 2WPAA 4E4LA 2YABA 4I22A 3NNUA 1MQ4A 3CKWA 3O17A 1FGIA 2QOFA 5HBEA 2FVDA 3TKHA 3V8TA 4W4XA 4EBVA 2R3JA 3CJGA 4DH3A 1FQ1B 2GU8A 4BKYA 2R3GA 3TTIA 4QYEA 4EZ3A 4BDFA 4QMXA 5E1SA 3TV7A 1H24A 5HO6A 2HY81 1J3HA 4S30A 4NIFB 4JR3A 4CTCA 3W8QA 4GV1A 4O1PA 3MTLA 3A4PA 4QMVA 4AT3A 5ETIA 1UNGA 4BBEA 1EH4A 2UZEA 3QKMA 4R5YA 1DM2A 3BEAA 4G3GA 4KKGA 2I1MA 5CSPA 3QX4A 2A0CX 4QNAA 3PE2A 2XJ2A 1S9IA 3VHEA 5DGZA 4IAZA 4XJ0A 2GNJA 4IX3A 4ANLA 5JH6A 2OF4A 1UU8A 2VTIA 4OAVB 4LUEA 1R0EA 1U4DA 3UJGA 2YIQA 4LV8A 4ASXA 4JQ8A 3NYVA 5L2QA 3CIKA 3R6XA 3SRVA 2Q0BA 4MKCA 4Y46A 5EI8A 4RFZA 4NEUA 5FXQA 4TL0A 3R7VA 2UZWE 4I6HA 4XV2A 3Q96A 2OW3A 2W1CA 3IDPA 3EL7A 3SQQA 4XV3A 2W1GA 2XJ1A 5AR3A 3FZTA 2W0JA 4UMPA 2EWAA 4LRJA 1WBOA 1XQZA 4D5HA 4L6QA 3MA3A 1Z9XA 3MFSA 3KRJA 1S9JA 2OI4X 3EN5A 2QU5A 3UC3A 3KK9A 3O0GA 3O8UA 2F2UA 4KIKA 4M7IA 4NJ3A 2IW8A 3ZEPA 3P86A 3FMKA 3MBLA 4B6LA 4E73A 1J1CA 1UKIA 3NNVA 3Q6WA 1QPJA 4Z3VA 1B38A 2FYSA 1MRYA 2J7TA 2W99B 3TNQB 2FUMA 3VJNA 1BL6A 5ANIA 5LWMA 1GIIA 4V0GA 1OKVA 4U40A 5J8IA 1YKRA 3QCSA 3POOA 1H8FA 3I0QA 3QTXA 4AF3A 4PNKA 2R4BA 3LFEA 4QO9A 2IZSA 4QMLA 5LXMA 5J1WA 1IA8A 3FKNA 1OL1A 2JKQA 4PMSA 2PVYA 2F57A 2W1IA 4BBMA 5JGBA 4CQEA 2V7OA 4YPSA 4B8MA 5AUVA 2QODA 1HOWA 1H1QA 2WQNA 4EH8A 3EWHA 3RVGA 4NW5A 5C27A 3Q52A 3LFCA 3B2TA 5KKRC 2QOIA 4EHVA 4RZVA 2QU6A 2BIKB 4X3FC 1DAYA 3G90X 3SXFA 2P4IA 4FC0A 4UEUA 5FP6A 5LVMA 4TYHB 1WAKA 3ORLA 2LAVA 3ORTA 3OF0A 4EC9A 3QZIA 3WF8A 1W83A 1H27A 4I24A 2Z8CA 4GFMA 4DGLC 3PJ8A 1FOTA 4QPAA 5T3QA 5KHXA 4XYFA 3R9NA 4RMZA 5J5TA 2OBJA 4G6LA 4BI2A 1ZYLA 3R0TA 4D9TA 2OJGA 5H3QA 3O2MA 3R00A 2JDTA 4IACA 2O65A 1OIQA 1OL2A 3P7BA 5FWKK 3Q6UA 3PE1A 3OW4A 3TL8A 4FBXA 3VF9A 5HU3A 5JFVA 2OXXA 3DAEA 1OIUA 1WBVA 3POZA 3ZFMA 4ACDA 4EOIA 4EZ5A 2VO3A 2VNWA 3PG3A 2OZOA 4ZP5A 2YIWA 3F2NA 4KRCA 2VTRA 3CCNA 4FIJA 3COKA 3Q3BA 4QMPA 3UE4A 2J0MB 3IG7A 5CVGA 5JFXA 4AA0A 1ZY4A 2PMLX 4OTGA 4XBRA 2QLUA 4XS2A 3IDCA 4U43A 4YZBA 1Y8YA 4F1OA 5FEQA 2WTIA 5JRSA 4YGAA 4E5AX 4FNXA 2IO6A 5CSWA 5JT2A 2ZB1A 2X39A 4IANA 1JBPE 2YERA 5HVJA 3WIKA 4G17A 4RVTA 5E8XA 3A99A 2LGCA 4YTCA 1Y57A 2XIZA 4DLJA 3WARA 5CI7A 3SHEA 4IX4A 3O8TA 4CD0A 5E8YA 1CKPA 4C3PA 5DRBA 4O21A 2SRCA 4JAIA 4RX9A 3C4EA 3IPHA 3MH1A 5G1XA 5KNJA 4RLKA 1YWVA 1PXOA 3A7GA 4GEOA 3QRJA 3QUPA 2HWPA 4Z16A 3KXXA 4ZZMA 4ALWA 3IW7A 3U51A 3EFWA 3BGZA 5HCYA 2JIUA 3CEKA 3QHWA 1F3MC 2VTOA 4WG3A 4EK6A 2Z60A 2XK7A 5E90A 3FL4A 5CEKA 3HMOA 1H08A 4W9WA 3EYGA 4GMYA 4BBFA 3W2SA 4BDAA 4LRMA 3LE6A 5BYYA 3CKXA 3R30A 4IZ7A 5HNGA 4F65A 5BMMA 4FKOA 3TNWA 1PXPA 4CFWA 3ZUUA 1DAWA 3OBJA 3QQHA 2W96B 5DHJA 4ANOA 4X3JA 3CP9A 5FM2A 2X7GA 4ALUA 4CMTA 4LYNA 2BFYA 3IONA 4PNIA 4YJQA 1UWHA 3ACJA 3HEGA 3PP0A 4PDSA 4UWCA 3WE8A 4ANMA 3QTZA 2VTTA 2WFYA 3QYWA 2J5EA 4NIFA 3VIDA 2WMUA 2C6MA 4F1MA 3A62A 4R3PA 5IH4A 5H2UA 3KU2A 4YUQA 3DB8A 2ZDTA 3QLGA 5I3RA 1UU7A 4D2PA 2QR7A 1LEWA 3VNTA 1GZNA 3UYTA 2IZTA 4BICA 3UC4A 4UN0C 2I6LA 4GL9A 1P5EA 3MVJA 3GC8A 4WRSA 4Y72A 5IMEA 4DGGA 3H9RA 1XBBA 3ZLXA 2F9GA 4BYJA 2I0HA 3ORNA 3QQFA 4I0TA 4Y83A 3OWJA 5D7AA 3W32A 3VBXA 4BDIA 3LJ2A 4IAIA 5JFWA 2I0EA 3LCSA 3KN6A 3OWKA 1CM8A 4OGRA 4U3ZA 5CAVA 2QO9A 5ITAA 2W05A 4QNYA 3TNPC 1WBNA 4U3YA 4RT7A 4BCIA 4EUUA 3W55A 3DFAA 3JVRA 2QNJA 4NWMA 3D5XA 3E63A 4AW5A 3EQDA 3S4QA 4C4JA 4E3CA 3F9NA 3ZXTA 2XRUA 1U5RA 2WQMA 4P5QA 2XNEA 2Z2WA 2C5XA 3DK6A 2GNIA 5KZIA 3TNIA 3VBWA 3G6HA 4C0TA 1ZMWA 2CLXA 3KCKA 4MXOA 3NWWA 4CLIA 1OL7A 4IADA 5T6KA 2F2CB 5BUIA 4WUAA 2R0UA 3MVMA 3OOMA 2W1EA 3NAXA 1ZRZA 4IXPA 4M67A 2E9PA 5CS6A 3U4UA 3F3WA 3AT2A 3JXWA 4YLKA 4D55A 5LMAA 4IC7A 2I0VA 1P14A 3BU3A 3EQPA 2XUUA 3G33A 4BKZA 5BVWA 3E88A 3OROA 4IWOA 3S95A 1GJOA 2R3PA 3FY0A 4S32A 5HG9A 4YTHA 2P0CA 3VW6A 3AC5A 3U4WA 4EC8A 5EK7A 3DAKA 2A4LA 2AYPA 2JFLA 1WFCA 1XBAA 4PL5A 4YZ9A 4MCVA 4X21A 3W8LA 2F4JA 2XIXA 4K1BA 4I6FA 5CVFA 3FMNA 3E8EA 3JY0A 5F9EA 4QMTA 1YWRA 4CCBA 4IWDA 4O38A 5KMLA 3EN4A 1BKXA 3IW4A 4MH7A 2B9IA 2PVHA 3C13A 5KCVA 3P79A 4OAUC 1G3NA 2BIYA 5AP4A 3SAYA 4FL1A 4ZTHA 4RA5A 4QMMA 4I21A 3QCQA 3DDPA 2BVAA 3OEZA 4QMYA 3PTGA 3QC4A 3UIMA 4EWHA 1R0PA 2OK1A 2BZIB 1H0WA 3DQWA 4MXCA 3WF5A 3ALNA 3NGAA 4O27B 4TYHA 4DGNA 3EZVA 5TE0A 3E87A 4I93A 5AX3A 4ZLOA 5DMZA 2IWIA 3ANQA 2WMBA 3EN7A 3ORKA 4F9BA 4YHJA 5A6OA 3Q9ZA 4C57A 4IFCA 4NJDA 4QTEA 3OXIA 4EL9A 4EYMA 4FIIA 4ANNA 3KA0A 3H0YA 5LVNA 3MIYA 4FOCA 4UB7A 4D2RA 5M44A 3ELJA 4KKHA 4BKJA 4F0FA 4USEA 4MWIA 2P2HA 4ERWA 4C35A 1YDTE 4AN2A 5LMKA 2CHLA 5ANGA 2W1DA 4Y85A 2WELA 5JQ8A 3ZO4A 4YO4A 3UIUA 2WMSA 4ACCA 1ZY5A 3K2LA 4AW1A 4MEDA 4FG7A 2CGVA 2QR8A 4ZY5A 4DG3E 4JDKA 4K8AA 4IM0A 2XK9A 5AM7A 4YTFA 5CU2A 4UWBA 2WQBA 3TV6A 1YVJA 4B0GA 4IMYA 5BYZA 5LARA 3EQBA 4HVSA 1F0QA 4L68A 3RWQA 3CC6A 3AC3A 1GY3A 2RIOA 2XRWA 3MFTA 4N6ZA 4CKJA 3MFRA 2VRXA 3N51A 1CSNA 4FL2A 2RG5A 3VUMA 2HAKA 4PP9A 3PA3A 3NUSA 1R1WA 4OBOA 2PVFA 2OO8X 3T9TA 4UMUA 5L8LA 4JG7A 2BZJA 2XNMA 2YLEA 3V6SA 5LMBA 2XVDA 2OJIA 2VTNA 4NZWB 4AWIA 2XMYA 5M51A 2VUWA 4DITA 2CMWA 3OMVA 2VTMA 4R1VA 5JGAA 1WZYA 3UBDA 2R3OA 3JYAA 4FZ7A 3W10A 4F6UA 3F3VA 5I9WA 1PY5A 4C7TA 3GOKA 5LVLA 3SC1A 5L3AA 3DBEA 2R3FA 4YP8A 3A7JA 3MB6A 5AV3A 3KGAA 1SYKA 4YJNA 3O7LB 3E8NA 1W0XC 2BRBA 2YCRA 5DR6A 2QLQA 4JAJA 4EYJA 3NW6A 3TUBA 1CKIA 1JQHA 4HYUA 3LLTA 4H3BA 1APME 4BYIA 2ETMA 3BLHA 4IZYA 1V1KA 2RSVA 4GK4A 4KRDA 1XH5A 2YIXA 3QCYA 4IW0A 5HCZA 3OFMA 3R28A 3FPMA 2VN9A 2W1ZA 4HYSA 3D2IA 5FRIA 4AT4A 4BGQA 1Q97A 2IZUA 4ERKA 4D2TA 2UW6A 2WOTA 4JBPA 5CAQA 4XOZA 2JBPA 4DFNA 4PL4A 3GFEA 4FIHA 4U79A 2IZRA 3OCTA 2J90A 3QAME 1UNLA 4XX9A 4CFMA 4RPVA 2GFCA 3HZTA 3C5UA 2PZIA 4QYYA 5DR9A 1R3CA 3TIYA 3PSCA 3DCVA 3GNIB 2C6LA 4JG8A 2ZAZA 2C6OA 1UU3A 3RBWA 4JVGA 4TW9A 4IC8A 4IVAA 4YZDA 4E6DA 4IH8A 5KMJA 4HOKA 3DBCA 2VD5A 2WXVA 4C36A 1WBWA 3VUDA 5HNIX 2HZNA 4EWQA 5AA9A 5CU0A 4G2FA 4YURA 3Q04A 3UOJA 4E20A 4IZAA 4UMRA 5KO1A 2XM9A 3UQFA 4LM5A 4IB1A 3C0IA 3QRTA 3BHVA 4RX8A 3HGKA 3TZ7A 4CZYB 4PX6A 1KE6A 2GFSA 4ZSGA 4ZJJA 4BVUA 5HORA 2QC6A 4WA9A 4JBQA 3A7FA 1Q3WA 5FG8A 3QGWA 4M0YA 4FF8A 1GAGA 3P4KA 4BWPA 4E5BA 3EFJA 4BGGA 1XH7A 3HUBA 3ZDIA 4C3RA 3IQ7A 4GT5A 4CXAA 4FKQA 5I9YA 4AU8A 1XHAA 3L9LA 2JGZA 3V5WA 4AP7A 4UMQA 4IZ5A 3W16A 3R2YA 5DPVA 3UODA 3C0HA 4O2PA 3UIXA 5LCKA 4EKKA 4A9UA 3ZRMA 4PV0A 1H26A 5BUEA 4AOTA 3V8WA 3LQ8A 4IVCA 1JKKA 5A4TA 4RIXA 3D7TB 3PZEA 2G2IA 4L7FA 4DEHA 3KQ7A 3AT4A 2VTSA 1Q61A 3QUEA 2UW7A 4WNMA 3UG2A 3ZC5A 2O8YA 3D7ZA 3ZLYA 5CZIA 2OICA 4XV9A 2PSQA 5AR7A 4BDCA 5TT7A 4JIKA 4FKGA 4BB4A 2EXEA 2PE2A 4BN1A 1J91A 3FKOA 3FSFA 1PHKA 5AP3A 3KY2A 3D5UA 3VW8A 3OS3A 3D2KA 2ITZA 3GCUA 2OKRA 4K9YA 4Z55A 3Q32A 4RBLA 4I4FA 3BYUA 4HCUA 3ORMA 3L8SA 4YO6A 2VX0A 4YJUA 5ETAA 5EYCA 4DGMA 2OXDA 3AC1A 3HV5A 1Y91A 3RPVA 3IS5A 4X3FB 5ACKA 2PE0A 4MBLA 4XNEA 4WO5A 3AQVA 1ERKA 3VWAA 2Z7RA 2J0LA 3SW7A 2QOOA 5JRQA 3AD4A 4KD1A 4KKEA 4KABA 1JOWB 1YXXA 2PTKA 1UV5A 4FV1A 2XNOA 3Q9XA 3TIZA 5L2IA 3PJCA 3TNHA 3OXTA 4K77A 5FDPA 1BX6A 4JRVA 3VF8A 2GQGA 2ITPA 5IISA 3COHA 1G5SA 2X4FA 3FXXA 4R5SA 2FA2A 3VUKA 3BPRA 3BU6A 3C4ZA 4QMOA 2ITQA 1PMEA 2ZB0A 2PZPA 4PL3A 3ACKA 4QOXA 2GHLA 2XNBA 3E64A 4FZFB 5I9VA 4GG7A 4DC2A 3ZLSA 1O9UA 2JIVA 3QTIA 3ULZA 3ORIA 3HYHA 5ANJA 3BE2A 5E1EA 5HESA 3TXOA 1Y6AA 2RG6A 4FUYA 4WNPA 2WQEA 4GYGA 2DS1A 4AZTA 5HG8A 2F7ZE 4AZFA 4ZAUA 3KMMA 2GSFA 5HE3A 2OIDA 3WE4A 5FP5A 3DKFA 3QD2B 3R7IA 3VS1A 5HU9A 1OKWA 3FWQA 4FTOA 4BIDA 3BZ3A 4O0YA 1YHSA 4XMOA 1Y8GA 2UZOA 1SMHA 4O2ZA 1F5QA 4MBIA 1BL7A 4RG0A 4YJRA 3MPAA 4YC3A 4CSVA 5EYDA 4F9CA 2BDFA 5FEEA 3ULIA 3MN3A 4IWPA 1ATPE 4LGDA 2WTCA 4RJ3A 4C4EA 2NRYA 1SVGA 1OM1A 3DDQA 3IW8A 3P9JA 4EK8A 3BYMA 3R8ZA 3VUIA 1IG1A 2R2PA 3G2FA 4TNDA 5E8VA 2PUUA 1SZMA 4NFNA 4IE9A 4AE9A 5B2LA 2IVTA 5CX9A 2NRUA 4BFMA 4C38A 2XKCA 2O3PA 4FKUA 4JXFA 5HE2A 4A4XA 5CEOA 1GZOA 4FIFA 2WZJA 5GZAA 3IW5A 2IW9A 4F63A 3WF7A 2J50A 4RGJA 2BR1A 2WIHA 3O71A 2R3HA 4WIHA 4ZY6A 4A06A 4ZSLA 3FC2A 3DT1A 4AFJA 2JKMA 2YM3A 1WBPA 3KXNA 3F5GA 5L8JA 3UDBA 3ZSHA 5HX6A 5HZNA 3ZUVA 5KE0A 5CU4A 4MYGA 5AEPA 2YITA 2C6EA 4Y73A 5GHVA 4U5JA 2QONA 3LOKA 3S00A 1TQIA 3VRYA 5IEYA 1CKJA 4PTEA 3UVRA 2XK4A 4RFYA 2C0TA 3AXWA 3E8DA 4R6VA 4C4FA 2EXCX 3KULB 4K0YA 4UBAA 3F3TA 5HLPA 4DCEA 4G5JA 4I20A 2QCSA 4CZUA 4V05A 1PKDA 5L2SA 3F66A 1GIHA 3V5QA 4MXYA 1YXSA 4YU2A 3R7OA 4AN9A 4KWPA 3HLLA 2J6MA 2REIA 4PF4A 4XG9A 4F9WA 3EIDA 1KOBA 2B9JA 4QPSA 4NH1A 2G2HA 3KB7A 5E8SA 3NIZA 5EOBA 2YHVA 4JBVA 4MNEB 5C8MA 3DGKA 1JSTA 2GHGA 3D0EA 4II5A 2RF9A 2WTKC 1WBTA 4NUSA 3KMWA 5KZ0A 4C4IA 4J7BA 1FINA 4D28A 2DWBA 3ALOA 2ITXA 4BCOA 3UVQA 4PTGA 5AX9A 3FI4A 3G51A 4AZWA 2BILB 3GUBA 4RX7A 3DB6A 4J8MA 4LL0A 4HVHA 2YWPA 4U9AA 4ITHA 4RQKA 2UVYA 3WIGA 5HD7A 4DFYA 3PY0A 2I0YA 5D9HA 4NCTA 4XRJA 3V5JA 1H4LA 2O64A 2ZMCA 5K3YA 5CSXA 2HCKA 1XR1A 3P78A 3D4QA 3R9DA 5I4NA 4XP2A 1QPEA 3P1AA 4BTKA 4FOBA 2ONLC 5FEDA 2ERZE 3EFKA 4IX5A 5A46A 4BCHA 2Y9QA 4FSWA 3RP9A 3W2CA 4Q9ZA 2G01A 5FTOA 5E7RA 5C9CA 3P7AA 3FLWA 2X6DA 3EQFA 2EVAA 4FTCA 4WBOA 4RC4A 2ZV2A 2YCFA 1TKIA 3F7WA 1IR3A 2GS2A 3C0GA 3GI3A 3LM0A 4HZRA 1ZLTA 2YDJA 3D7TA 3LPBA 4C33A 4IDTA 4FTQA 5EM5A 4RIOA 2HW6A 1NY3A 4Q5HA 3VAPA 4ZZNA 4BC6A 5D12A 1YHVA 3IGGA 2VTAA 4MXXA 4PWNA 3FY2A 4QP6A 4YPDA 4BDEA 5J95A 4IX6A 3A8XA 5EH0A 3UG1A 2XIYA 4OLIA 2UW0A 4YZNA 5D11A 2RFEA 4AGCA 4GK2A 2DUVA 2AC5A 2ETRA 3GENA 5ANOA 4FICA 2YM8A 3HUCA 3HRCA 2QD9A 3TN8A 4DEEA 3E7VA 5KMOA 3NYXA 4UWYA 1O6KA 5JEBA 4QPMA 1AQ1A 4D1ZA 4Z9LA 4OT6A 5CEQA 3UNJA 5BMSA 4X3FA 2UZNA 2VO0A 5B2KA 3ZHPC 1SM2A 4KSPA 4O0VA 4QT1A 2R5TA 4AGDA 3A8WA 1XH4A 3PXFA 2PMOX 4M97A 5EW8A 4UXLA 3TG1A 3NIEA 3CTQA 3DNEA 4L44A 3U6JA 1YI6A 4M12A 2O0UA 4FSNA 4EZ7A 4DYMA 3Q4ZA 3OHTA 1R39A 1OITA 4MNFA 4QMQA 1VZOA 4FV3A 2XK8A 4KBAA 3I81A 3HMIA 4JJRA 3QZHA 5M56A 4E4MA 3RNIA 2C47A 2PVRA 4Y5HA 4MF0A 2C6TA 4I5CA 3DU8A 3ERKA 2C4GA 5TF9A 2IW6A 3KK8A 4LOOA 4DEIA 2YM7A 3ZM4A 3CLYA 4C8BA 2H8HA 2PVMA 2W17A 4M69B 3VS0A 3UPZA 3O96A 4OTQA 4XG8A 5DVRA 5AAGA 5IEXA 5E8WA 2W4OA 2E9UA 5IKWA 2GNFA 3QD3A 4C58A 4EQUA 4QP1A 4DEBA 4O96A 5LVPA 4DEGA 4QTAA 4OT5A 3A2CA 1FVTA 3FHRA 3JUHA 3RM7A 2HELA 4OUCA 4IAAA 4FTMA 3H3CA 4YNOA 3AG9A 4RWIA 4IWQA 2AC3A 3QD0A 5FGKA 5C8KA 3F88A 3OY3A 2JAMA 2Y7JA 4QMUA 3HV4A 2C0IA 2CKEA 3FLNC 1VEBA 1R78A 3LFDA 4I3ZA 4U7ZA 4AX8A 4IAKA 1W8CA 5DN3A 3NX8A 5AP0A 4BDBA 3UZPA 5BX0A 4C3FA 5EYMA 4L3LA 5AIKA 5DR2A 4CFXA 3OUNB 3ZBXA 5TOZA 2C1AA 3LFSA 3OEFX 4QQCA 1Q41A 1AGWA 1URWA 5M4FA 4J53A 5CWZA 4D4VA 4TRLA 5FM3A 4GSBA 4GU9A 2C6KA 2XB7A 4HPUE 2YLFA 2GNHA 2ITUA 3O51A 3I4BA 3SLSA 3M11A 3EJ1A 4MXAA 4U6RA 2EU9A 5LJJA 1OI9A 3FQEA 4GIIA 4WSYA 3RINA 2X9FA 3QRKA 5ACBC 5DT0A 3II5A 5CAOA 4ZZOA 4B99A 2WMRA 2J51A 5AV0A 5IZFA 3KULA 4GS6A 4AA4A 4I6BA 5J79A 2NP8A 5ETCA 2B55A 3GCPA 4EHEA 3WZKA 1Q5KA 3SV0A 4CV8A 4QRCA 4ARKA 2VWZA 3MGYA 4HJOA 3CD8A 4OTFA 3NNXA 5DI1A 4QMWA 4S2ZA 1ZXEA 3W2RA 3C51A 3RTPA 4TWOA 3CE3A 3LVPA 1M2PA 4EONA 4U80A 5CEMA 2W9FB 3MS9A 3GC9A 3Q4CA 3VS2A 5CVHA 4DEAA 2UW9A 5HG7A 4JS8A 4XG7A 3FZ1A 4MNEA 4EOPA 3IOKA 4RJ8A 5IDNA 2CSNA 4EOJA 2FSOX 2X8EA 5AR4A 3BU5A 4AGUA 4X2KA 5E8UA 3A7IA 3ZU7A 5GZ8A 3AT3A 1MP8A 4CYIA 1PXJA 2BHEA 2VTHA 1XH8A 5AP6A 4K2RA 5DT3A 4JL9A 5DNRA 1JSVA 4OTRA 2PL0A 2PMNX 4G3FA 5IU2A 2EXMA 4GUEA 5CF8A 5DLSA 3EQRA 4OTWA 4I1ZA 4XG6A 4LV5A 5J5SA 4O6LA 3G5DA 5C26A 4G3CA 5IA0A 2VWBA 4FYNA 4FX3A 4LUDA 3TV4A 4O22A 4CEGA 2YIRA 2GNLA 5KMIA 4ZTQA 1LP4A 3WBLA 4QYFA 3TUCA 4A4OA 3LZBA 4D2WA 1O6LA 3PIYA 5AIRA 4FKPA 3NYOA 3EYHA 1PXNA 4A9SA 3VRZA 5IEVA 4R7HA 2ZV7A 1JVPP 2C5NA 2JEDA 1BI7A 2V22A 3FSKA 5EKNA 2YFXA 3EQGA 3G9NA 3MJ1A 4G3EA 3C50A 2XH5A 3E3BX 5HTBA 5CLPA 4DFZE 2X2KA 3QX2A 4MVFA 5JZNA 3VQUA 3ENMA 3V51A 5CZHA 4GK3A 3LM5A 3PUPA 2PZ5A 3ENHA 3GP0A 1V0OA 2ITVA 1Q8UA 5AP1A 3R8VA 3ZXZA 3QQLA 5AJQA 3JVSA 2GNGA 3DFCB 3QUDA 4YJVA 4AAAA 4AN3A 5IA2A 3OTVA 4ZTLA 3JS2A 3PVUA 3I0OA 3QGYA 4TWPA 4YJPA 4F1TA 4BZNA 5CF5A 3HV7A 4BWXA 1CTPE 4FTRA 4L9IA 5AUXA 2R3NA 3QHRA 3BCEA 4IBMA 5HO8A 1ZAOA 4C02A 3LXPA 5AM6A 1A06A 3PIZA 1KE7A 5EFQA 3R8LA 4QP8A 1UU9A 3LXKA 4M8TA 3F61A 3BWFA 4QP9A 2A27A 5JZJA 5K9IA 3MPTA 2VX3A 2DQ7X 2XK6A 3ZONA 4GYIA 5IA5A 1OL5A 2V7AA 5HIEA 1GNGA 4HNFA 3OC1A 2OFUA 3Q4UA 2UV2A 3BBWA 2ZMDA 4USDA 3SOAA 2JC6A 2CJMA 3DQXA 4IJ9A 4ZOGA 2J0IA 1H01A 2CGUA 5JN2A 3BWJA 2R3IA 3V04A 3WYYA 1FVRA 2HIWA 3F2AA 4AS0A 4EQCA 3HDNA 3W2OA 1XO2B 4CV9A 4D2VA 3QWKA 3FKLA 1GOLA 3LCKA 1E1VA 5HG5A 4EHZA 3DA6A 4JX3A 3R22A 5J7BA 2B9FA 3MTFA 4M69A 4D4YA 1OPKA 3KCFA 4WSQA 4FZAB 5DOSA 2CN5A 3FHIA 3ZMMA 4IVDA 3UMWA 1OPJA 3GU5A 4XP0A 2C5VA 3BBTB 5CF4A 3ODYX 3OT8A 4IQ6A 5AUUA 4FTNA 4F6SA 3P7CA 4BL1A 2YCQA 3PG1A 4MXZA 2R3QA 4EBWA 2QHMA 3FZOA 1GZ8A 2HY0A 3AMAA 2JIIA 1KSWA 3TTJA 4APPA 2VWYA 5FQDC 3QQJA 3C9WA 5HIBA 1SNXA 2BHHA 3H30A 3UO5A 3ORZA 2X0GA 5EDRA 5G6VA 2H9VA 3K3IA 4K11A 2R3LA 2F49A 3F5XA 2JFMA 1STCE 2UZDA 3BYVA 5JSMA 3LJ0A 4GH2A 3DLZA 3VS4A 1KV2A 5GJFA 1JAMA 4RJ7A 3OXZA 3ZZEA 2R9SA 4K6ZA 2BTSA 3BHYA 2X4ZA 4EHGA 4U8ZA 4AQCA 2XA4A 4MD9E 4QD6A 5ETFA 3IK3A 3AGLA 4RC2A 2O63A 2YDKA 4DH8A 2WB8A 4XCUA 3AD6A 2X7OA 2YM6A 4TKSA 3ZSIA 3L9MA 2B54A 4ZTSA 3TZ9A 3WZUA 4EH5A 5AV4A 2X8IA 5DA3A 2B1PA 2O2UA 4KAOA 4NM5A 4UALA 4WHZA 5F95A 3U9NA 2YAKA 3VUGA 2R64A 3BYOA 4FSYA 3LCOA 4QQJA 4E7WA 4AT5A 5JQ5A 1PYXA 4J71A 2VTJA 4FT9A 4OTHA 4TPTA 3OCGA 4EH2A 1VJYA 5CU3A 5HEZA 4ASDA 4YJOA 3MA6A 3L9PA 3DKGA 1OUKA 3FDNA 4QMNA 1KOAA 2Y4IB 2J4ZA 2FSTX 2BZHB 4KIQA 3FMLA 4JIAA 2ERKA 1BI8A 3DNDA 4I41A 2YM4A 3RK7A 5AUWA 2ZYBA 1OGUA 3DZOA 5CNOA 4BDJA 4X6RA 2YISA 3NR9A 1IASA 4I92A 3R83A 3K3JA 4B4LA 5D1JA 4O0UA 4H1JA 2FSMX 4MTAA 5DT4A 5K4IA 3VUHA 2WAJA 4L45A 3FMDA 4H58A 4FNZA 2BDWA 3U8WA 4AOIA 2WTKB 4BCNA 3ZUTA 3GFWA 5K5NA 2FGIA 1Q8WA 3KL8A 3RAIA 3EQIA 4D58A 4UX9A 3RZBA 5K0XA 2FSLX 3CBLA 3Q5IA 4J52A 3QQGA 5L4QA 2VU3A 3H4JA 4G9RA 1UWJA 3RPSA 5I9XA 3D5VA 1U59A 4P7EA 4F7LA 4EJNA 2OZAB 1YOLA 3HDMA 4B9DA 3FI2A 2V0DA 5AUYA 3WZJA 4LG4A 5HHWA 2C5OA 4QTDA 4F64A 2OG8A 3MY5A 5LMKC 3TKIA 4TYJA 1B39A 4GU6A 3O7LD 1JNKA 2WMWA 3PXRA 4ALVA 3V6RA 4DBNA 3DXNA 3PXQA 2C3JA 2VO7A 3OVVA 4CNHA 4ZK5A 4LMNA 4J1RA 4GG5A 5L6OA 4LRKA 5EM7A 3QBNA 1OB3A 4HCVA 3C7QA 4NU1A 4CKIA 3KXHA 2HZ0A 3PXZA 3RAWA 3CPCA 3SVVA 3I79A 4CLJA 3AMBA 1BMKA 3MWUA 3VN9A 1Q8YA 3EZRA 1XBCA 2P2IA 4O6EA 5EYKA 3FZSA 4FT3A 4W8EA 2ZDUA 1Q8ZA 4PRJA 1WBSA 5D41A 2FB8A 5H8EA 4BDDA 4FSTA 4FVRA 4FT7A 4RC3A 4YHFA 4RWLA 4N4SA 3QQKA 3EN9A 4NK9A 3WYXA 3ZOSA 4JLCA 4M13A 4I6QA 3ROCA 3LIJA 3KRRA 4JDJA 3PSDA 4FL3A 4CRLA 1JKTA 4IM3A 4CQGA 4ZSAA 3HA6A 3VJOA 5HTIA 2W5HA 4D2SA 1M7NA 4FTLA 4BIEA 1H07A 5EOLA 5HLWA 4CFVA 3R9HA 3VBTA 4HVDA 4BZDA 2OSCA 3R02A 3R7YA 3BGPA 3NLBA 3P5KA 4RQVA 1I44A 3FZPA 3K5UA 1UNHA 3R73A 2AUHA 5IA1A 3ZH8A 3CPBA 2VGPA 3EMGA 1YOJA 3GOPA 4TNBA 2W4KA 4QTBA 4E5WA 4G6OA 5B7VA 2YZAA 4LGGA 1I09A 3CY2A 3FAAA 3ZCLA 2WTJA 1RE8A 2IN6A 3LFAA 2NO3A 1H28A 4IFGA 3L9NA 2GTNA 4RWJA 1PXMA 3R01A 3RAKA 3R2BA 2C6IA 2JD5A 5I5ZA 4FVPA 4A07A 4FKWA 4BCPA 3B2WA 2R0IA 2B4SB 2XBJA 3CXWA 4IJPA 3R7EA 3RALA 2PVLA 3FXWA 2HXQA 4KS7A 4XG4A 3RPOA 2VAGA 5TR6A 1WCCA 3TKUA 5A4LA 4PQNA 2GS6A 1B6CB 3R04A 5EDQA 3PLSA 4MQ1A 1ZOGA 3DBQA 2BRNA 3DK7A 3HVCA 4O91A 3V8SA 4KA3A 5KUPA 3ODZX 4XBUA 2P3GX 4X2GA 2IVSA 4HYHA 4B8LA 5KKRB 4QP2A 2UW3A 4CZTA 4YMJA 3OCBA 4KIOA 4G31A 3RAHA 2XKDA 1PJKA 4FK3A 3QRUA 2QKRA 4UV0A 5KMMA 4DFLA 2YAAA 2BKZA 1KE5A 4E1ZA 2X1NA 3A7HA 1JSUA 3UOHA 4DG2E 3GQLA 2Z7LA 1Q99A 2R7BA 3Q60A 4O0SA 4RSSA 4KIPA 3T8OA 4BCGA 3LHJA 5BVKA 5JKGA 3NYNA 2QOKA 4P5ZA 3OY1A 4GVAA 4L43A 4P2KA 4YBJA 4WNOA 3HP5A 1XH9A 1Z5MA 2E9NA 3G9LX 2W1FA 1QPCA 2WTWA 3DAJA 2WEVA 4AZVA 1PYEA 3HV6A 1VR2A 5AP2A 4RA4A 3PP1A 3P08A 3BI6A 1J1BA 2HK5A 4J99A 3E7OA 4MK0A 1MUOA 1WMKA 3ZO3A 4D0XA 5JGDA 5CY3A 4ACGA 5IH5A 4U44A 4QYGA 3U87A 4L67A 2UZTA 3NZ0A 1OL6A 5I3OA 1Q8TA 4FV5A 1MRUA 1MQBA 2QO7A 2ITWA 3D5WA 2QOLA 2XBAA 3I6WA 2FO0A 3QXOA 1ZMVA 2QURA 5CYIA 2XEZA 2HZ4A 5D10A 3QRIA 5A6NA 3EOCA 5F94A 1PXKA 3OD6X 4FA2A 4XEYA 4UYNA 4FTJA 2XZSA 3OG7A 2JBOA 4IAFA 3E92A 1PF8A 4AFEA 2PVJA 5E8ZA 5EKOA 2CN8A 3W2QA 3LQ5A 3PPJA 2C5YA 4L3JA 3IOPA 4JBOA 1ZYSA 1GZKA 1PW2A 2VGOA 2VX1A 3HX4A 4FV6A 4GUBA 5KBRA 3E62A 3MSSA 4FR4A
chains in the Genus database with same CATH superfamily
2WKMA 2R3KA 4RVMA 4GT4A 2BAKA 1UVRA 2ZV9A 4P4CA 3R7GA 3BLQA 1ZYJA 2OZAA 2YM5A 3QXPA 4X0MA 1FGKA 1M52A 5C1QB 4A9TA 2AQXA 2ESMA 2O5KA 1V0PA 3ZO2A 3F82A 3I5NA 5ANEA 3DKCA 1OZ1A 2GS7A 4H3QA 3PA5A 3BLRA 4LQMA 2QHNA 1M17A 3LFBA 2G15A 2PK9A 1NVRA 2GTMA 4GRBA 4U81A 4MD7E 5AR8A 3C4XA 4L01A 2ZV8A 4NTSA 4BGHA 4DAWA 1BLXA 1YOMA 2R3MA 2WQOA 3B8QA 4MWHA 3FLQA 3QLFA 3F6XA 2OJ9A 3PYYA 4J97A 1QPDA 4EOOA 4YSMA 5FLFA 4EOLA 2OF2A 3EQHA 2GDOA 3L1SA 5KHWA 3DK3A 4B7TA 5IA4A 2XIKA 5EHLA 2ETKA 4G34A 3MH3A 5C03A 3QQUA 5FBNC 2RL5A 3DBDA 1NA7A 4IB5A 1KE8A 3OW3A 4L53A 1ZOHA 3C1XA 4QP7A 1E1XA 3CQEA 4H36A 4RRVA 4FSRA 4E6CA 4LMUA 3R1SA 4O4BB 3PVWA 4M14A 3OWLA 3MI9A 3KRXA 3RK5A 4YC6A 5AWMA 1REJA 2QKWB 2XJ0A 2OH4A 4X2FA 4C2WA 3E5AA 3VBQA 3VHKA 4F99A 4ZTNA 3RK9A 3IDBA 3H9OA 4QMZA 2CCHA 3T9IA 2OH0E 4FI1A 4CRSA 4FG8A 4AA5A 2QOHA 2W9ZB 5IG1A 3OOGA 4XV1A 4BHNA 4DINA 3UYSA 5FXRA 4WG5A 3HV3A 3NW7A 5BVEA 3RMFA 3UMXA 3ZFYA 3QL8A 2WEIA 4NM3A 3SDJA 3O23A 5H9BA 3KEXA 4CFNA 3LFQA 3UGCA 5A4EA 2BMCA 1ZWSA 4I23A 4L8MA 5HO7A 2RKUA 4O1OA 4CMOA 1LUFA 5I9ZA 4FK6A 5GNKA 4CFUA 1WVWA 2YJRA 3ETAA 4OTPA 4YBKA 5F1ZA 3VBVA 3FZRA 3QFVA 5TKDA 2J2IB 4FSQA 4LI5A 1YXUA 5DFPA 4X2JA 3I60A 5J7HA 3F69A 4C4GA 4L46A 3TJCA 3MFUA 4GIHA 3Q9WA 5HNBA 5DG5A 1YDSE 3NCGA 1H25A 3DLSA 3TWJA 3FYKX 5FDXA 2C30A 5C8NA 5LCJA 3GC7A 4ITIA 4Q5EA 4TWCA 3GCSA 3OT3A 2XYUA 4QMSA 4PPBA 4W4VA 2HWOA 5HGIA 3BYSA 1U54B 2BZKB 4BTJA 3NCZA 4RVKA 3P0MA 3UNKA 2XK3A 2JLDA 4ZXTA 3EQCA 5IH6A 5H8GA 4NKSA 3IO7A 2VWIA 3PPZA 4JR7A 3PY1A 4FNWA 4FUXA 1XWSA 2PVKA 3DJ6A 5LVOA 2RFDA 4N70A 4FG9A 4ZSJA 4D5KA 5CAPA 2OJJA 4W8DA 3F5PA 3FLSA 5B0XA 3IW6A 1PKGA 4W9XA 3R8PA 2JDSA 3MH2A 4FV9A 3BQCA 4NCTC 4X6QC 3CD3A 3FMJA 1YXTA 1SVHA 3UP7A 2WOUA 1OKZA 3DJ5A 4R8QA 2Y0AA 3SOCA 2OIBA 2ZJWA 3AC2A 5HLNA 3CS9A 3QU0A 1CDKA 3LCDA 4UMTA 3R8UA 2XCHA 1Q4LA 3BHUA 4RIYB 3SW4A 1OMWA 5CNNA 4M0ZA 4DGOA 1GIJA 5E91A 4G1WA 3K5VA 4FYOA 4IB3A 1ZYDA 2XP2A 3QKLA 3BGQA 2H34A 4QQ5A 3LFNA 1ZOEA 2BDJA 4NSTA 4HGLA 4TTHB 3QTQA 4G16A 3CQWA 4HCTA 3F3ZA 4XLIA 3W1FA 4DN5A 4V01A 4RLLA 4DH1A 3H0ZA 2G9XA 4YHTA 5BNJA 2GHMA 3MVHA 3UP2A 3ZEWA 5IUGA 3AOXA 2OWBA 2ITYA 2VTPA 4AXAA 1FMKA 3K54A 3HMMA 3BELA 3QA0A 5B2MA 5IMXA 5L2TA 3T3UA 3ZSGA 4YTIA 3VS5A 5BVNA 4JG6A 1K9AA 1YDRE 3VC4A 3GBZA 3NAYA 4N0SA 4HNIA 4BTMA 1H1SA 5EW9A 5JK3A 2UZBA 3DS6A 4ENYA 3TT0A 4M66A 3WF9A 5IDPA 3NRMA 3VBYA 4EH9A 5JFSA 3TACA 2R7IA 4Q9SA 4A9RA 4FMQA 5J9YA 3OUKA 2C68A 3MV5A 4LFIA 4ZS0A 2QOCA 5EM8A 3RJCA 4BDKA 4AG8A 5L6WL 2HXLA 3BV2A 4JNWA 1U5QA 4BF2A 3C4WA 4FIEA 3HMPA 4N6YA 4QP3A 3TZ8A 5LWNA 5I9UA 2UZLA 3H9FA 3HL7A 5F4NA 4X7QA 4U45A 4BI1A 3Q4TA 2C0OA 4FTTA 5KMNA 3RWPA 3OBGA 4KSQA 4JI9A 4GW8A 5EW3A 4JDIA 5DWRA 3FC1X 2ITNA 1YI4A 3NUYA 5EM6A 1M14A 3QZFA 2C1BA 4IEBA 4ZY4A 4ASZA 4RJ4A 2BTRA 4ZTMA 3NUNA 5DE2A 2XS0A 4YLJA 3GU7A 4TZRA 3CTHA 1URCA 1XKKA 1CMKE 2B7AA 3MY0A 3UTOA 3CQUA 1W2DA 5DIAA 3TZMA 4MD8E 2PWLA 4ONAA 2CPKE 4H1MA 2VO6A 3HECA 3R7UA 3FL5A 2W4JA 4BZOA 1W84A 2WU7A 3KXGA 3AC8A 2W5AA 3PXKA 3CY3A 1OIYA 3QZGA 4HYIA 3W33A 3PZHA 4TY1A 3FI3A 3DPKA 3FYJX 4YJSA 4M15A 5ANKA 1OKYA 3THBA 4D4SA 3MYGA 4JDHA 2PMIA 3EKKA 2A19B 2ZM1A 5M57A 3VULA 5HICA 2BAJA 1LR4A 4NW6A 4TYIA 4FKIA 2EB2A 1BUHA 2JKOA 3O8PA 4HPTE 4ITJA 3UOLA 4AGWA 2WTVA 2X2LA 5HD4A 4AW2A 2ZM4A 3IECA 3G0EA 1YQJA 2H96A 3I7BA 4ID7A 3RGFA 4MF1A 2UW4A 1FMOE 3C4FA 1NVQA 5M4IA 4IDVA 4F0GA 3EN6A 3V01A 2HYYA 4TYGA 3QTUA 4FTIA 4GT3A 3TCPA 1M7QA 3BE9A 4CKRA 5IF1A 3FV8A 3U9CA 4XHKB 3NDMA 3ZDUA 3M1SA 4PPAA 2QI8A 4USFA 5CASA 4J8NA 2VWUA 4GVJA 5CALA 4L3PA 5L2WA 3VQHA 5A4CA 3WOWA 1ZMUA 3RCJA 3ZRKA 3GU4A 4R1YA 3Q5ZA 3MB7A 4XLVA 5A3XA 3E8CA 3KF7A 1KE9A 2PZYA 3UVPA 3R21A 3SD0A 3R8MA 1YRPA 3GU6A 4F9AA 3PPKA 2C3IB 2C3KA 2VWWA 5DEWA 1YWNA 4FODA 4U97A 3MW1A 5C01A 3EFLA 2YJSA 3KRWA 4FEQA 5EG3A 4Z7GA 4PMTA 4UZDA 1TVOA 3RKBA 5A14A 4XG2A 3PFQA 2XYNA 4MX9A 3KF4A 2W1HA 3UQCA 1UA2A 3GQIA 3H10A 4S33A 1KWPA 3D94A 3GXLA 5BPYA 4FKSA 3ROYA 1U54A 4EK5A 4PUZA 4ZJIA 3CTJA 3BIZA 3G6GA 4YZMA 3SXSA 4MHAA 3N9XA 2VV9A 1Q3DA 2Y8OA 4G5PA 3RPYA 2BUJA 1OUYA 2VTLA 4KBKA 5DH3A 1QMZA 2E9OA 4Y5QA 4AZEA 4WUNA 4FV4A 4BHZA 4DEDA 4IM2A 5J9ZA 2YN8A 3HA8A 4EK3A 4JQ7A 5K4JA 5BVDA 2C69A 3ZRLA 4C62A 4EH6A 3EB0A 4L42A 5HVYA 3EH9A 4TYEA 3T3VA 1BYGA 3A4OX 3ZBFA 3B8RA 4WRGA 2WHBA 4WNKA 4U0IA 1LEZA 4EQMA 4YR8A 5CANA 4I0SA 2ITTA 2Y6MA 1V0BA 3FE3A 5EI2A 1M2QA 3RI1A 2VTQA 2OXYA 1K2PA 3COIA 2QOBA 2ZM3A 3RHKA 4BIBA 4RIYA 2X8DA 3NPCA 5JMSA 5IUIA 3QWJA 2GMXA 5DBXA 5IA3A 4ZSEA 4RJ6A 3ZS5A 1JWHA 2WU6A 3PSBA 1O6YA 3FUPA 3LMGA 4LGHA 4MQ2A 4OBPA 2WMTA 3WZEA 3REPA 4I5MA 4PDPA 3COMA 4FKTA 4CFFA 4XP3A 3WILA 4AACA 2NPQA 4FIGA 2Q0NA 4DH5A 1SNUA 4IIRA 2J5FA 2GCDA 3LCTA 4LL5A 4RIXB 4S31A 3LFFA 1JKSA 2J0KA 2QG5A 2BALA 4ZTRA 3UPXA 4CYJA 3I5ZA 4Y95A 5FTQA 4QQTA 3TUDA 5EHOA 2UVZA 2XIRA 3PJ3A 2WIPA 5M55A 4J98A 4C2VA 2X2MA 4O0XA 5CI6A 2B52A 2W5BA 3LJ1A 3BQRA 3ZO1A 3PRFA 4K18A 2XNNA 4XH6A 3DTWA 2KTYA 5HE0A 2WMVA 2P55A 4AE6A 1JLUE 4I0RA 2JDOA 4RVLA 4GJ3A 5L6PA 3MJ2A 3GT8A 3HP2A 4I5HA 3D9VA 4W4WA 4OTIA 5E8TA 4W4YA 4F7SA 1IEPA 1YW2A 2E2BA 5AP7A 3Q2MA 3S2PA 3OTUA 4FKVA 4TXCA 5GJDA 4NKAA 3RNYA 3V3VA 4CMUA 1REKA 4BCJA 5HQ0A 3BKBA 4A4LA 3KVXA 3W2PA 4EH7A 2XM8A 4U42A 4ZEGA 3I1AA 1HCLA 3ZYAA 3FQHA 3PWYA 5AV2A 5LOHA 2KULA 4JOAA 3JY9A 2A2AA 4O0WA 1RDQE 4L52A 1NVSA 1U46A 4V04A 3HKOA 4XOYA 3QC9A 3UO4A 4D1XA 4DHFA 2CLQA 5FXSA 4EK4A 3IKAA 4FTUA 4PY1A 3BX5A 4G6NA 4DLIA 5ICPA 3ORXA 5GZ9A 4D1SA 4HW7A 1OVEA 3MPMA 4FV0A 2Y4PA 4HGSA 5TO8A 3ZFXA 5A54A 3GVUA 4BCKA 5KMKA 2W7XA 2XKFA 3L8XA 3MDYA 3FLYA 5CSVA 4ENXA 5CU6A 5AR5A 3RZFA 4JX7A 1M2RA 2ITOA 4I94A 5CEIA 5GJGA 3AC4A 4F09A 4EI4A 4ANBA 2ZOQA 2YIYA 4APCA 2UZUE 4FT0A 5CTPA 3EKNA 2E9VA 3GB2A 5AAFA 2H6DA 2XF0A 3KFAA 3TEIA 3DOGA 2YDIA 3AGMA 3DZQA 4CVAA 3VS3A 1E9HA 5DRDA 1IRKA 3PRIA 3KVWA 4Y8DA 4D0WA 2G1TA 2CCIA 3QD4A 3QTSA 4OR5A 4FT5A 4XG3A 3UO6A 4YC8A 2XCKA 1AD5A 3QA8A 4F7JA 4FZ6A 3W18A 4RFMA 4TT7A 3PVBA 3S3IA 5HBHA 5M4CA 4QTCA 4X2NA 2QVSE 2V55A 4ASEA 5CQWA 4CTBA 3NW5A 3FLZA 3QALE 5HIDA 3VS7A 4C61A 4DCEA 5AUZA 2B9HA 4FKRA 4HZSA 2UW8A 3RM6A 3SXRA 4GJ2A 3UNZA 3ZLWA 4BI0A 4PTCA 5HCXA 4RIWB 5CEPA 1PMVA 2BFXA 4Z7HA 2A1AB 4D9UA 3BHTA 3R71A 4DFXE 3OWPA 4Q2AA 3ANRA 3L8PA 1YI3A 2DYLA 4IAYA 4WOVA 4DH7A 5AP5A 3BEGA 5IUHA 4FKJA 2PY3A 1ZZ2A 5T68A 3PIXA 1WVXA 4EEVA 5KX8A 3D14A 5EI6A 3KC3A 4TN6A 1H1WA 2Y6OA 1X8BA 4UZHA 4AZSA 3QKKA 2JITA 3NUPA 2BRHA 3UQGA 5BQ0A 3VVHA 2J0JA 2F7XE 5D7VA 2OIQA 1KV1A 3UIBA 4PP7A 2HZIA 2WD1A 3DV3A 2HENA 1Z57A 4C34A 1P4OA 3UZTA 4BCQA 3OZ6A 2C6DA 3U6IA 4ACMA 3Q53A 1PXIA 1DI9A 1W7HA 3EHAA 3FMHA 5AADA 1JPAA 3PA4A 4I5PA 3DY7A 4FTKA 3BRBA 4FNYA 2BAQA 2OFVA 5CT7A 3DBFA 4L00A 5BVFA 3QF9A 1FVVA 2YACA 2YA9A 1T45A 1DI8A 4EKLA 2XKEA 4RX5A 4YLLA 4NFMA 4E4NA 4EUTA 1UKHA 5J87A 4M68A 3OCSA 4NT4A 4C37A 2BROA 3ET7A 3G0FA 2WMQA 2VZ6A 3IGOA 3NNWA 2CDZA 4L7SA 2JDVA 3A60A 4RZWA 4EOKA 2WO6A 4GFGA 1L3RE 4BCMA 4ZJVA 5J9LA 3SA0A 2CGXA 1ZYCA 4EOMA 1TQPA 4A7CA 4FV2A 4EH3A 2F7EE 5F20A 2VNYA 2JKKA 2WTDA 4CT2A 2RFSA 1Y6BA 3SKCA 4F6WA 4M3QA 2X0OA 5HI2A 2VWVA 3WZDA 4F70A 5J1VA 4DG0E 4PPCA 2XNGA 3V5PA 3LAUA 2EB3A 5A9UA 3C4CA 4E4XA 5HBJA 4WG4A 4ANQA 4FGBA 4TWNA 3UOKA 3TI1A 4YSJA 4F0IA 5I0BA 2JAVA 3L8VA 2JDRA 4BDGA 3U6HA 3AMYA 3DJ7A 4O0RA 2QOQA 5HOAA 4WD5A 2ACXA 4LOQA 1T46A 2PHKA 3QTWA 1ZARA 3R9OA 3ZC6A 4BCFA 1W98A 3I7CA 2C3LA 5CXHA 5H8BA 4D4RA 1HCKA 4KB8A 3KN5A 4EORA 2QQ7A 4FTAA 4R3CA 3LW0A 3SRVB 4E8AA 3S1HA 2YEXA 4C59A 4A9YA 4E6QA 3FQSA 3MY1A 1RQQA 3FXZA 5AA8A 3HMNA 4F9YA 5CAUA 3R1YA 4BRXA 3MH0A 5L8KA 2PE1A 5FD2A 3QTRA 5HKMA 3M2WA 4H39A 3OP5A 3PWDA 4IB0A 5KBQA 1ZZLA 3QYZA 3LXNA 4BWKA 3CGOA 1RJBA 3GCVA 2R3RA 1RW8A 2IVUA 4E93A 5AAEA 2RFNA 3F5UA 1Q24A 3FBVA 3FMMA 4O0TA 3VUTA 3ORPA 3CGFA 1SVEA 2HOGA 4K33A 4FZDB 3P23A 4KINA 5K5XA 2PZRA 2HW7A 2Z7QA 3GGFA 4IHPA 1A9UA 3HNGA 3KXZA 3LXLA 2UZVA 4FVQA 4G3DA 4KIKB 3R63A 5AMNA 3VO3A 4R3RA 4AOJA 4UYAA 4UXQA 4ZLYA 2WMAA 3MVLA 4EH4A 5CXZA 4FSMA 3QCXA 5A4QA 4J96A 4YZCA 2VWXA 4FV8A 3HRBA 4GFOA 4ACHA 4U41A 4PMMA 4JQEA 4M84A 4V0GB 5CT0A 3PJ2A 3E93A 4ZIMA 5HVKA 5K0KA 4O4CA 3V5TA 2WNTA 4S34A 4CCUA 3NEWA 2EUFB 1FPUA 2IJMA 2UW5A 5IPJA 2J9MA 2XNPA 4E26A 1VYWA 3D83A 1K3AA 2V62A 1H1PA 1PXLA 3R1NA 3DKOA 2FH9A 5EHYA 3V5LA 2BPMA 4J95A 3MIAA 5HE1A 5CENA 1WVYA 2PVNA 2Z7SA 4HGTA 3KKVA 3ZTXA 1QL6A 1PMUA 2IVVA 4G9CA 3KRLA 4C4HA 2X7FA 3I6UA 3A61A 4FV7A 3ZZWA 1VYZA 4BDHA 2P33A 2X6EA 3RPRA 2UUEA 4NTTA 1W82A 3PJ1A 4HVIA 1LPUA 2XEYA 1H1RA 1OPLA 5HTCA 3FMEA 4F08A 4NM0A 2BRMA 3GC0A 4QP4A 1JKLA 5BVOA 3RCDA 3WI6A 4BTFA 3F7ZA 1XJDA 3GEQA 4JT3A 4MAOA 4EOQA 2G2FA 3Q9YA 3O50A 4OW8A 1P2AA 4JRNA 4UY9A 5DEYA 5LQFA 4IVBA 4PDOA 5BUJA 2BRGA 2X9EA 4CT1A 5CSHA 4O4DA 1QCFA 2V5QA 4QYHA 5M4UA 4YJTA 4KBCA 3PVGA 4WT6A 2YCSA 4FSUA 4P90A 4RIWA 5ANDA 3SX9A 4ANSA 5HX8A 2ONLA 4FSZA 3WF6A 3ITZA 4I4EA 3RHXA 5CQUA 2BCJA 4OTDA 1YXVA 3KXMA 4WBBB 3E3PA 2CGWA 4HGEA 2WMXA 2W06A 4F4PA 2OJFE 4OBQA 1Q62A 3FPQA 3EL8A 4KS8A 3TJDA 1H0VA 4WKQA 5M53A 4AW0A 4FKLA 2OU7A 5AV1A 3M42A 3KMUA 4E6AA 3FJQE 4ZLZA 4NM7A 3AD5A 1OIRA 3DTCA 2Y4IC 3JPVA 5E92A 2A98A 1XH6A 4R7IA 3NUUA 3NUXA 2WGJA 1P4FA 3BHHA 4HVGA 3VS6A 3NSZA 1YHWA 5FBOA 2UVXA 1DS5A 2RGPA 4XRLA 2GPHA 3CJFA 3D15A 3R1QA 5AUTA 4GCJA 2ZVAA 2QO2A 5EDPA 3CR0A 3NS9A 1H00A 4KNBA 1NXKA 2I40A 3HRFA 4DTKA 2OGVA 3BV3A 4H3PA 1MRVA 3PY3A 5AR2A 3PXYA 4AUAA 3F3UA 2B53A 4LOPA 4RWKA 4XUFA 4EOSA 1PMNA 3GU8A 4MBJA 4F7NA 3S0OA 3GCQA 4RJ5A 2X81A 5CF6A 4YNEA 1OECA 1TQMA 4PMPA 2WPAA 4E4LA 2YABA 4I22A 3NNUA 1MQ4A 3CKWA 3O17A 1FGIA 2QOFA 5HBEA 2FVDA 3TKHA 3V8TA 4W4XA 4EBVA 2R3JA 3CJGA 4DH3A 1FQ1B 2GU8A 4BKYA 2R3GA 3TTIA 4QYEA 4EZ3A 4BDFA 4QMXA 5E1SA 3TV7A 1H24A 5HO6A 2HY81 1J3HA 4S30A 4NIFB 4JR3A 4CTCA 3W8QA 4GV1A 4O1PA 3MTLA 3A4PA 4QMVA 4AT3A 5ETIA 1UNGA 4BBEA 1EH4A 2UZEA 3QKMA 4R5YA 1DM2A 3BEAA 4G3GA 4KKGA 2I1MA 5CSPA 3QX4A 2A0CX 4QNAA 3PE2A 2XJ2A 1S9IA 3VHEA 5DGZA 4IAZA 4XJ0A 2GNJA 4IX3A 4ANLA 5JH6A 2IEWA 2OF4A 1UU8A 2VTIA 4OAVB 4LUEA 1R0EA 1U4DA 3UJGA 2YIQA 4LV8A 4ASXA 4JQ8A 3NYVA 5L2QA 3CIKA 3R6XA 3SRVA 2Q0BA 4MKCA 4Y46A 5EI8A 4RFZA 4NEUA 5FXQA 4TL0A 3R7VA 2UZWE 4I6HA 4XV2A 3Q96A 2OW3A 2W1CA 3IDPA 3EL7A 3SQQA 4XV3A 2W1GA 2XJ1A 5AR3A 3FZTA 2W0JA 4UMPA 2EWAA 4LRJA 1WBOA 1XQZA 4D5HA 4L6QA 3MA3A 1Z9XA 3MFSA 3KRJA 1S9JA 2OI4X 3EN5A 2QU5A 3UC3A 3KK9A 3O0GA 3O8UA 2F2UA 4KIKA 4M7IA 4NJ3A 2IW8A 3ZEPA 3P86A 3FMKA 3MBLA 4B6LA 4E73A 1J1CA 1UKIA 3NNVA 3Q6WA 1QPJA 4Z3VA 1B38A 2FYSA 1MRYA 2J7TA 2W99B 3TNQB 2FUMA 3VJNA 1BL6A 5ANIA 5LWMA 1GIIA 4V0GA 1OKVA 4U40A 5J8IA 1YKRA 3QCSA 3POOA 1H8FA 3I0QA 3QTXA 4AF3A 4PNKA 2R4BA 3LFEA 4QO9A 2IZSA 4QMLA 5LXMA 5J1WA 1IA8A 3FKNA 1OL1A 2JKQA 4PMSA 2PVYA 2F57A 2W1IA 4BBMA 5JGBA 4CQEA 2V7OA 4YPSA 4B8MA 5AUVA 2QODA 1HOWA 1H1QA 2WQNA 4EH8A 3EWHA 3RVGA 4NW5A 5C27A 3Q52A 3LFCA 3B2TA 5KKRC 2QOIA 4EHVA 4RZVA 2QU6A 2BIKB 4X3FC 1DAYA 3G90X 3SXFA 2P4IA 4FC0A 4UEUA 5FP6A 5LVMA 4TYHB 1WAKA 3ORLA 2LAVA 3ORTA 3OF0A 4EC9A 3QZIA 3WF8A 1W83A 1H27A 4I24A 2Z8CA 4GFMA 4DGLC 3PJ8A 1FOTA 4QPAA 5T3QA 5KHXA 4XYFA 3R9NA 4RMZA 5J5TA 2OBJA 4G6LA 4BI2A 1ZYLA 3R0TA 4D9TA 2OJGA 5H3QA 3O2MA 3R00A 2JDTA 4IACA 2O65A 1OIQA 1OL2A 3P7BA 5FWKK 3Q6UA 3PE1A 3OW4A 3TL8A 4FBXA 3VF9A 5HU3A 5JFVA 2OXXA 3DAEA 1OIUA 1WBVA 3POZA 3ZFMA 4ACDA 4EOIA 4EZ5A 2VO3A 2VNWA 3PG3A 2OZOA 4ZP5A 2YIWA 3F2NA 4KRCA 2VTRA 3CCNA 4FIJA 3COKA 3Q3BA 4QMPA 3UE4A 2J0MB 3IG7A 5CVGA 5JFXA 4AA0A 1ZY4A 2PMLX 4OTGA 4XBRA 2QLUA 4XS2A 3IDCA 4U43A 4YZBA 1Y8YA 4F1OA 5FEQA 2WTIA 5JRSA 4YGAA 4E5AX 4FNXA 2IO6A 5CSWA 5JT2A 2ZB1A 2X39A 4IANA 1JBPE 2YERA 5HVJA 3WIKA 4G17A 4RVTA 5E8XA 3A99A 2LGCA 4YTCA 1Y57A 2XIZA 4DLJA 3WARA 5CI7A 3SHEA 4IX4A 3O8TA 4CD0A 5E8YA 1CKPA 4C3PA 5DRBA 4O21A 2SRCA 4JAIA 4RX9A 3C4EA 3IPHA 3MH1A 5G1XA 5KNJA 4RLKA 1YWVA 1PXOA 3A7GA 4GEOA 3QRJA 3QUPA 2HWPA 4Z16A 3KXXA 4ZZMA 4ALWA 3IW7A 3U51A 3EFWA 3BGZA 5HCYA 2JIUA 3CEKA 3QHWA 1F3MC 2VTOA 4WG3A 4EK6A 2Z60A 2XK7A 5E90A 3FL4A 5CEKA 3HMOA 1H08A 4W9WA 3EYGA 4GMYA 4BBFA 3W2SA 4BDAA 4LRMA 3LE6A 5BYYA 3CKXA 3R30A 4IZ7A 5HNGA 4F65A 5BMMA 4FKOA 3TNWA 1PXPA 4CFWA 3ZUUA 1DAWA 3OBJA 3QQHA 2W96B 5DHJA 4ANOA 4X3JA 3CP9A 5FM2A 2X7GA 4ALUA 4CMTA 4LYNA 2BFYA 3IONA 4PNIA 4YJQA 1UWHA 3ACJA 3HEGA 3PP0A 4PDSA 4UWCA 3WE8A 4ANMA 3QTZA 2VTTA 2WFYA 3QYWA 2J5EA 4NIFA 3VIDA 2WMUA 2C6MA 4F1MA 3A62A 4R3PA 5IH4A 5H2UA 3KU2A 4YUQA 3DB8A 2ZDTA 3QLGA 5I3RA 1UU7A 4D2PA 2QR7A 1LEWA 3VNTA 1GZNA 3UYTA 2IZTA 4BICA 3UC4A 4UN0C 2I6LA 4GL9A 1P5EA 3MVJA 3GC8A 4WRSA 4Y72A 5IMEA 4DGGA 3H9RA 1XBBA 3ZLXA 2F9GA 4BYJA 2I0HA 3ORNA 3QQFA 4I0TA 4Y83A 3OWJA 5D7AA 3W32A 3VBXA 4BDIA 3LJ2A 4IAIA 5JFWA 2I0EA 3LCSA 3KN6A 3OWKA 1CM8A 4OGRA 4U3ZA 5CAVA 2QO9A 5ITAA 2W05A 4QNYA 3TNPC 1WBNA 4U3YA 4RT7A 4BCIA 4EUUA 3W55A 3DFAA 3JVRA 2QNJA 4NWMA 3D5XA 3E63A 4AW5A 3EQDA 3S4QA 4C4JA 4E3CA 3F9NA 3ZXTA 2XRUA 1U5RA 2WQMA 4P5QA 2XNEA 2Z2WA 2C5XA 3DK6A 2GNIA 5KZIA 3TNIA 3VBWA 3G6HA 4C0TA 1ZMWA 2CLXA 3KCKA 4MXOA 3NWWA 4CLIA 1OL7A 4IADA 5T6KA 2F2CB 5BUIA 4WUAA 2R0UA 3MVMA 3OOMA 2W1EA 3NAXA 1ZRZA 4IXPA 4M67A 2E9PA 5CS6A 3U4UA 3F3WA 3AT2A 3JXWA 4YLKA 4D55A 5LMAA 4IC7A 2I0VA 1P14A 3BU3A 3EQPA 2XUUA 3G33A 4BKZA 5BVWA 3E88A 3OROA 4IWOA 3S95A 1GJOA 2R3PA 3FY0A 4S32A 5HG9A 4YTHA 2P0CA 3VW6A 3AC5A 3U4WA 4EC8A 5EK7A 3DAKA 2A4LA 2AYPA 2JFLA 1WFCA 1XBAA 4PL5A 4YZ9A 4MCVA 4X21A 3W8LA 2F4JA 2XIXA 4K1BA 4I6FA 5CVFA 3FMNA 3E8EA 3JY0A 5F9EA 4QMTA 1YWRA 4CCBA 4IWDA 4O38A 5KMLA 3EN4A 1BKXA 3IW4A 4MH7A 2B9IA 2PVHA 3C13A 5KCVA 3P79A 4OAUC 1G3NA 2BIYA 5AP4A 3SAYA 4FL1A 4ZTHA 4RA5A 4QMMA 4I21A 3QCQA 3DDPA 2BVAA 3OEZA 4QMYA 3PTGA 3QC4A 3UIMA 4EWHA 1R0PA 2OK1A 2BZIB 1H0WA 3DQWA 4MXCA 3WF5A 3ALNA 3NGAA 4O27B 4TYHA 4DGNA 3EZVA 5TE0A 3E87A 4I93A 5AX3A 4ZLOA 5DMZA 2IWIA 3ANQA 2WMBA 3EN7A 3ORKA 4F9BA 4YHJA 5A6OA 3Q9ZA 4C57A 4IFCA 4NJDA 4QTEA 3OXIA 4EL9A 4EYMA 4FIIA 4ANNA 3KA0A 3H0YA 5LVNA 3MIYA 4FOCA 4UB7A 4D2RA 5M44A 3ELJA 4KKHA 4BKJA 4F0FA 4USEA 4MWIA 2P2HA 4ERWA 4C35A 1YDTE 4AN2A 5LMKA 2CHLA 5ANGA 2W1DA 4Y85A 2WELA 5JQ8A 3ZO4A 4YO4A 3UIUA 2WMSA 4ACCA 1ZY5A 3K2LA 4AW1A 4MEDA 4FG7A 2CGVA 2QR8A 4ZY5A 4DG3E 4JDKA 4K8AA 4IM0A 2XK9A 5AM7A 4YTFA 5CU2A 4UWBA 2WQBA 3TV6A 1YVJA 4B0GA 4IMYA 5BYZA 5LARA 3EQBA 4HVSA 1F0QA 4L68A 3RWQA 3CC6A 3AC3A 1GY3A 2RIOA 2XRWA 3MFTA 4N6ZA 4CKJA 3MFRA 2VRXA 2IF8A 1W2FA 3N51A 1CSNA 4FL2A 2RG5A 3VUMA 2HAKA 4PP9A 3PA3A 3NUSA 1R1WA 4OBOA 2PVFA 2OO8X 3T9TA 4UMUA 5L8LA 4JG7A 2BZJA 2XNMA 2YLEA 3V6SA 5LMBA 2XVDA 2OJIA 2VTNA 4NZWB 4AWIA 2XMYA 5M51A 2VUWA 4DITA 2CMWA 3OMVA 2VTMA 4R1VA 5JGAA 1WZYA 3UBDA 2R3OA 3JYAA 4FZ7A 3W10A 4F6UA 3F3VA 5I9WA 1PY5A 4C7TA 3GOKA 5LVLA 3SC1A 5L3AA 3DBEA 2R3FA 4YP8A 3A7JA 3MB6A 5AV3A 3KGAA 1SYKA 4YJNA 3O7LB 3E8NA 1W0XC 2BRBA 2YCRA 5DR6A 2QLQA 4JAJA 4EYJA 3NW6A 3TUBA 1CKIA 1JQHA 4HYUA 3LLTA 4H3BA 1APME 4BYIA 2ETMA 3BLHA 4IZYA 1V1KA 2RSVA 4GK4A 4KRDA 1XH5A 2YIXA 3QCYA