5C27A

Crystal structure of syk in complex with compound 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
272
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c27A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c27A01
3OCBA 3H9FA 2PE0A 4G5JA 4CLIA 5L6PA 3PRFA 4WD5A 3W16A 3CKXA 4X2JA 2C3KA 2R3JA 4JVGA 4AS0A 5CVGA 1U54B 3L8VA 3LFEA 4ZSAA 3BWJA 4M66A 4Z55A 5H9BA 3WZEA 1PW2A 4RLKA 4BN1A 4LOQA 2GPHA 3P78A 5IA3A 4FUXA 3CQWA 2BFXA 4U0IA 3QCSA 5EW9A 4D2TA 5AP7A 3M42A 5IDPA 2XKCA 3K5UA 4O7LA 4FT3A 4EJNA 3OF0A 5L8JA 1OUKA 2BHHA 2VX0A 2R3HA 4G6LA 4QPMA 1LUFA 4O2PA 4MNEA 3PP0A 5AR4A 3PLAE 5J8IA 3EB0A 3N51A 3LOKA 2R3OA 3DA6A 3TJDA 3LHJA 2BDWA 3TJCA 4RFYA 3Q2JA 4D58A 3DFCB 4CZTA 2PZPA 4DCAA 1KOBA 3SGCA 2R2PA 4EH4A 2B4SB 4YUQA 2J51A 3C1XA 3NAYA 3F88A 4R6VA 2CDZA 4FEUA 4KSQA 4BL1A 1XWSA 4C3PA 4OTWA 2I6LA 3P7AA 3R9NA 4UEUA 4EORA 4FSUA 4AF3A 5LWMA 3R7OA 1FOTA 2RKUA 5HO7A 3HV5A 3S2PA 4G3EA 5DE2A 3QX4A 4QTEA 5IQCA 3F3WA 4H1MA 3EL7A 3ZLXA 5FM2A 3O17A 3GGFA 3PZEA 5LMAA 3V6SA 2B54A 3QAME 4I1ZA 4AN9A 1GY3A 4FTCA 3D7TB 1X8BA 3AT4A 2IPXA 3MPMA 3NCGA 4IANA 4L7SA 5A4CA 2R3LA 3UBDA 5KX8A 3OG7A 3H0YA 1BX6A 4YJTA 5FXRA 1W82A 3DAEA 4KRDA 3GU8A 5BVKA 3R1NA 4FEQA 3VQHA 3W1FA 5EDQA 4ALVA 2CGXA 5EQEA 3SV0A 1UA2A 4IW0A 3CJFA 3I6WA 1BI8A 1Y6AA 2WHBA 4QP6A 1G8AA 2ZV7A 1NT2A 2OJFE 3TTJA 3ELJA 2F9GA 2PZ5A 4AZFA 5DR2A 2ETRA 2GNGA 3ORKA 4NM0A 3VF8A 5DBXA 5FEDA 3ETAA 1GJOA 2G9XA 3UVQA 4AGUA 2EUFB 2UZWE 3ORZA 3PRIA 3O8UA 3TT0A 5A9UA 4RJ6A 2R3GA 4UWYA 4XBRA 4KUJA 1K3AA 4LGDA 2Z7RA 2IZTA 3V8TA 4CV8A 2ZYBA 3DPKA 4IWQA 1JKSA 3GC7A 3HRFA 4LOPA 5BMMA 2J0IA 3SLSA 3PPJA 3HDNA 4ZIMA 3HNGA 4XV1A 3PVUA 4Y5QA 2BPMA 1OGUA 5CXZA 1EH4A 4O0UA 4XG9A 5DWRA 4TPTA 4ZXTA 2J0LA 2J0JA 4H1JA 3QCQA 3WF5A 3PY1A 5AUWA 4CTBA 3BBTB 5FUTA 3R0TA 3ACKA 2V55A 5CSWA 3EYHA 5L4QA 1KWPA 3KRLA 4K0YA 4XLIA 2VWZA 4D4RA 4O7RA 3JVRA 3QQGA 5HCZA 4E93A 4Y73A 3TN8A 4O86A 3A62A 3L8SA 1ZY4A 3DB8A 2IO6A 5IEYA 4NM5A 3RZBA 1W7HA 5AP0A 3ZM4A 1FVRA 4KIPA 4U6RA 4JLCA 2WMRA 2AUHA 4CCBA 4DGNA 3AGLA 4MXOA 3VRZA 3FMEA 3ZO4A 3FLQA 4WG3A 4ENXA 2QR7A 5FQDC 1UNLA 4ASXA 3HRCA 3L9PA 5BYLA 4WUNA 3U6IA 2X2MA 5B0XA 4JBOA 3LE6A 2UZUE 2HCKA 3N9XA 5DT0A 4UMPA 3ZXZA 2I40A 4RIOA 2AC3A 4ZSLA 3RAHA 2OH4A 1NY3A 4GK3A 4X6RA 5ANIA 4ARKA 4DITA 3TEIA 2JFMA 4HNIA 3E3PA 3FZ1A 3NVMB 1YXSA 4YLLA 4BF2A 4CGAA 3QTQA 2VO3A 1OKVA 1JKTA 3D5UA 3E5AA 5A54A 3BPRA 4PMSA 3TXOA 3F82A 2YJRA 5AR2A 3FZRA 3F66A 4YJSA 5HEZA 4E8AA 4BYJA 1I09A 3E63A 1FBNA 3GEQA 5JN2A 3QTIA 3MWUA 4IX6A 3GFEA 5DOSA 1H08A 1XO2B 4BICA 2V62A 4H3PA 4FKJA 1QCFA 2WEIA 2CHLA 2P2IA 1ZZLA 5DRDA 2UZVA 2EXEA 4GFGA 2CKEA 5M4CA 2W17A 5EI2A 5ETAA 3IK3A 3FI3A 1R39A 4O7NA 4ZS4A 4FT7A 4FOCA 4RGJA 4QQCA 3ZH8A 4QTDA 3I81A 1FINA 3ODZX 2UUEA 2H6DA 3KK9A 4R1YA 2V5QA 4LRMA 3QALE 3TV7A 3R7YA 4A4OA 4RBLA 4CMTA 5CALA 3UYTA 4X6QC 4O91A 4R3RA 1H24A 3DK7A 3Q04A 1R0EA 2XBAA 3UE4A 3Q4CA 4O21A 5IKWA 1O6LA 5KBRA 3EFLA 4RPVA 2XYNA 1UNGA 2WZJA 4OLIA 2DWBA 2O65A 4K2RA 3A4OX 3LJ2A 4OTDA 4FSMA 4D2SA 1QPEA 4IADA 3PSDA 4BDDA 2WQEA 3EL8A 5HVYA 2CN5A 4ASDA 4F7SA 3R7GA 2R3MA 3OWJA 3EFKA 3BHYA 1B38A 3EOCA 5B2KA 2YDIA 4W8DA 3SW4A 3TTIA 4J98A 4YTFA 1NVRA 1PXPA 2YM7A 3GCSA 2W99B 2OK1A 3KXXA 3ZEWA 3C4XA 2UW5A 2UW6A 4TZRA 4TYHB 1XH6A 1I44A 3UOJA 4YTHA 1A48A 4A4XA 4QNYA 3KXGA 4DEIA 3RK9A 3NNUA 4L8MA 2JAVA 3RCDA 1J1CA 3CJGA 3DKFA 3FHIA 4G3CA 4DEGA 2OBJA 4C59A 3H10A 4KS8A 5BNJA 5LCJA 1YHWA 4NTTA 2XKFA 3Q4TA 5HU9A 3NUNA 5E4HA 4APPA 2X0GA 1PXJA 4CFMA 5CQWA 3VS2A 3MFSA 2OIBA 4AOTA 2JKQA 2Z8CA 5BPYA 1G3NA 3M11A 5C01A 2BKZA 4AW2A 3MTLA 4DGGA 4YJUA 3D5XA 2IZRA 4FV0A 2BZKB 4UXQA 3S1HA 3QRKA 3E64A 4AT4A 3G51A 2VO7A 3O7LB 1JAMA 4N4SA 5IQGA 2NO3A 3NUAA 4GV1A 4C8BA 5HNBA 2HXLA 2C6OA 4XRJA 4B4LA 4RA4A 3DXPA 4DTBA 3SRVA 5IUGA 3SKCA 4II5A 3Q9ZA 4CQGA 2VUWA 5BMSA 3G9LX 3MW1A 5CEOA 3FSFA 3VBVA 2FO0A 3DFAA 1XHAA 3NWWA 2ITWA 3KVXA 3V5TA 1OIUA 5ANGA 4YNEA 4DFYA 5HVKA 3PA4A 2C5XA 4J96A 4Q2AA 4BCNA 1MUOA 2RFSA 1OPJA 5J9LA 1YXXA 2WIPA 5EHLA 4L01A 1BL7A 4IMYA 2QOLA 2X1NA 3HP5A 4AW1A 4XBUA 2PZYA 3HMIA 5GIPE 1R0PA 4JIKA 3MVHA 3BGPA 1SNXA 2VTRA 4F0GA 2ITUA 4I23A 2VWUA 3FXWA 3B8QA 5CLPA 1Q8ZA 3OY1A 2BZIB 5IEVA 2WMBA 3KKVA 4LV5A 2WMQA 3PIZA 1TQPA 3DBDA 4NW5A 4O6LA 2VV9A 3Q5IA 3P79A 1TVOA 5F94A 3PJCA 4U40A 5AM6A 2JKKA 4V04A 4YC3A 4D1SA 4YTCA 2JLDA 1O6KA 4EOSA 1PXKA 3QA0A 2UVXA 4FEVA 4FIGA 4NWMA 5K4JA 3DCVA 5AV0A 3RWPA 5AP5A 2J4ZA 4D0XA 3VBTA 3W2PA 3I7CA 5CEMA 2OO8X 3QBNA 4YJVA 5IA5A 2WMUA 3HMNA 5M44A 4EQUA 2BUJA 4NK9A 4Y85A 3UG1A 4CKIA 3CPBA 4AZEA 2HAKA 1YI4A 3ET7A 3LFBA 1L8TA 3RNYA 5EOBA 3KFAA 3Q52A 1W98A 4RMZA 5CU3A 3F5XA 3KK8A 4BKYA 4QQJA 3G33A 2GTMA 5F20A 4ANQA 1XR1A 4OR5A 3VUHA 2QVSE 3DJ6A 2YIYA 2ZDUA 3QKKA 5H3QA 3F69A 3R9OA 3ZTXA 4IWOA 5JFXA 4ZTRA 5CY3A 4FVQA 3W2RA 2QU5A 4Q9ZA 5FTGA 3FZOA 3K3IA 2F49A 3LXPA 5A3XA 4UXLA 1OB3A 4BRXA 2WTKB 2UZOA 2A19B 4HVGA 4ZY5A 2W9FB 1JQHA 1JKKA 3BX5A 4LG4A 3IGOA 4KS7A 5E7RA 4AA4A 3OCGA 4R3CA 2VTTA 3VS3A 3LXLA 2IN6A 1L3RE 4O0VA 4PP7A 1VYWA 3DBQA 4NTSA 3Q9WA 1WAKA 5CZIA 5HE3A 3DXQA 1UNHA 3W8QA 4C37A 1E9HA 5AEPA 3KULA 4RWLA 3WF7A 4LRJA 4KIKB 3QTXA 3NUPA 1YHSA 5IH4A 2C68A 3OFMA 4J1RA 4RIWA 4DFNA 3T9IA 2B52A 4FL2A 4CZYB 2OZAA 2UW0A 3EKNA 4S32A 5IMEA 3R00A 3D15A 2C5VA 2ETKA 3KXMA 3VUIA 4F9CA 2J5EA 4JR7A 3F7WA 4EBWA 4FZ7A 3ORMA 2PVFA 3TUCA 4BGHA 3FSKA 4G6NA 4WG4A 3RAKA 2R4BA 3QLGA 3ZLYA 5HNIX 3UYSA 4FX3A 4YR8A 5C27A 2QU6A 4FV9A 1UU9A 4U9AA 2GNIA 2X7FA 4DH5A 3KA0A 3QQKA 4QMOA 1OITA 3P08A 4IZ5A 3ZRKA 4I21A 5I9ZA 2OU7A 2W1FA 1RW8A 3R7VA 3RKBA 5AAGA 4DH3A 4USEA 4PPCA 4Z3VA 4BDEA 1XBAA 2R3QA 3EIDA 4M14A 4QQ5A 4ZSGA 5HBHA 5JFVA 3DK6A 3UPXA 4EWQA 3BYUA 4RFZA 3SG8A 1PMNA 1BLXA 3KCFA 2OLCA 3I5ZA 5L2QA 2HENA 3NNVA 3WZKA 4F64A 5BUEA 1H8FA 2C1BA 4YJOA 3NYNA 4R5SA 3AC1A 4BI2A 1M7QA 4KSPA 4G2FA 3RJCA 2G1TA 1OBGA 3F2NA 3G15A 5BYYA 3BLQA 4BCJA 2YWPA 2VTQA 5EM8A 4MNEB 3BLHA 3GU4A 4FSTA 2W1DA 3EN6A 5EKNA 4LMUA 2OSCA 4MX9A 4B7TA 5FEQA 3EQFA 1Q41A 4NSTA 1H1RA 5EI8A 3FE3A 4MD8E 3R7UA 4PTEA 2DQ7X 4AOIA 4FTRA 5M51A 4W9WA 4D2VA 4Y95A 5HG8A 4C62A 5BUIA 4TT7A 2V0DA 4CMUA 3QWKA 4FV6A 3F5GA 3HDMA 1RQQA 5LVLA 3PVGA 3MPTA 3ANQA 3FUPA 4UWCA 1FPUA 2ACXA 4XOYA 4EH8A 2X7OA 4OGRA 4JS8A 4CYIA 4DH7A 1K2PA 4E3CA 2XYUA 5K4IA 4KB8A 3E8EA 4P4CA 2Y0AA 5M4UA 4BI0A 2QONA 3K54A 4LGGA 4OT5A 4RSSA 5AUTA 4KKHA 4D1ZA 4IVAA 3UNKA 4HJOA 5A4TA 5AM7A 2I1MA 5ETIA 3IOKA 4ZTSA 2PVLA 3VIDA 4DT9A 1FVTA 1ZLTA 3WF6A 4BHZA 5GIOE 2XKEA 2G15A 4N0SA 2UW4A 4JDIA 2YHVA 4F9BA 2DS1A 4XG8A 5D41A 4FIJA 4BCQA 2O8YA 4YHTA 4RX9A 4JBQA 4PY1A 1BUHA 4U41A 4PDPA 4ENYA 5LQFA 4W8EA 4DBNA 1SMHA 2REIA 3EN4A 3DJ7A 5E8XA 2R0UA 3SAYA 5DYJA 3C0GA 5LXMA 3UGCA 2PULA 4XG2A 2PMIA 5HLPA 4M67A 1F0QA 2OJJA 3MSSA 4DINA 3DQXA 4G5PA 2W06A 1WVXA 2A0CX 4J8NA 2PHKA 3OTUA 2ONLA 3D0EA 4RA5A 5DT4A 4ZLYA 2ERKA 1RDQE 4QMVA 3EWHA 3F3VA 2ZMDA 2ZM1A 4DC2A 5CF8A 4I0RA 3GC8A 3IOPA 3LJ0A 5FEEA 3R8MA 1H0WA 3FMMA 4R5YA 5H2UA 4RZVA 5FP6A 4OTPA 1GIJA 2PVMA 3FYJX 4FKTA 4RVLA 3LCKA 5H8GA 3IECA 1W83A 4XG6A 4UALA 5J79A 3V5PA 2XIYA 1SZMA 2P33A 4QTCA 3DV3A 4EONA 3GQLA 4L00A 1GOLA 4WA9A 4YURA 3BU3A 2ITNA 2Y6OA 3C0IA 2QO2A 2G2IA 4KIQA 3ZC6A 4FGBA 1G5SA 1OUYA 1J7UA 3COKA 1YWVA 4ZMEA 5TE0A 4EC8A 4E26A 3RAIA 3R01A 2ITZA 2Y7JA 2O2UA 2YLFA 1WZYA 3HV4A 4QP8A 4RJ3A 2CCIA 4LL0A 3ZONA 1ZMWA 2BHEA 2X9EA 1NA7A 3GC9A 4ID7A 1H25A 4DFUA 3AD5A 2RSVA 2CLXA 2C4GA 4O1PA 3LIJA 3FI2A 3F2AA 4MYGA 4PPBA 4XX9A 3QD2B 4W9XA 3W55A 3GENA 3MH0A 4QRCA 5I0BA 5AR3A 2C3JA 2ZV2A 3ZU7A 2BAQA 3MN3A 3CC6A 3IQ7A 5AV4A 2XEZA 4CNHA 3DLSA 3OVVA 3OC1A 2ITQA 3BHHA 3EQPA 4GW8A 4XHKB 3CCNA 5L2IA 3CSVA 4DFXE 3MDYA 2EWAA 3F9NA 5CSXA 4GCJA 5CASA 1XBCA 4DAWA 2IZSA 5KMIA 2WMVA 5E8YA 3ZFXA 1G8SA 5IQHA 1IASA 2X2KA 3PJ2A 4DE4A 1T46A 4BCMA 4L46A 4DFBA 2YIQA 1H1SA 2VU3A 3BU5A 4GMYA 1Q5KA 1LEZA 2PL0A 3LFFA 3BWFA 3WE8A 4FODA 3DNEA 3MFRA 1M52A 3QTWA 4GFMA 3PVBA 2QKWB 3PA3A 3UTOA 4JNWA 2IVUA 3NYXA 4EC9A 3ODYX 4XG7A 2OJIA 4IDVA 4NJ3A 2QOBA 4EHVA 5HVJA 4FMQA 3BHVA 4LFIA 4PQNA 3DBEA 3FKNA 4B8MA 3TNQB 5IUIA 3KCKA 3KRWA 4FVPA 1SVHA 4K11A 4X3FA 4E5BA 1DM2A 5KMOA 4I0SA 5C4LA 2E2BA 3FMKA 3KRJA 4HNFA 5CAQA 3RPYA 1Q8WA 2GMXA 5HQ0A 3V51A 4PV0A 4M84A 3H4JA 2PTKA 1ZXEA 4GUBA 4S30A 4ZSJA 3UVPA 4LGHA 5B2LA 3R9RA 2YM5A 3GOPA 3R1YA 3GQIA 1PYXA 4M12A 2VTAA 4FIHA 5HTBA 3OZ6A 1YRPA 4B0GA 5L8KA 2VTOA 5HTCA 5IH6A 4ZTMA 4JIAA 2P55A 5ANOA 3GUBA 1OIQA 1JSTA 3ENMA 3MY1A 5C4KA 2RFNA 4RJ4A 4XNEA 3AQVA 2PUIA 4FTMA 3KRXA 5M4FA 5ANKA 3CLYA 3VNTA 1ZMUA 2E9UA 2QO7A 3OXIA 2I0VA 3BQRA 3PIXA 5FXSA 1IRKA 3O23A 4I93A 2UW3A 3PXKA 5AP3A 4YU2A 4HCUA 2WELA 5GZ8A 5KMNA 4MXXA 2RF9A 5EM6A 4BDHA 4AZVA 3UIMA 2H34A 3ENHA 3G90X 3L9NA 3OMVA 4QYYA 2C6EA 3DNDA 4MCVA 5EFQA 5K0KA 4D4SA 2I0EA 4UMRA 1Y91A 2R5TA 3C5UA 3R02A 3NEWA 1YVJA 4FZ6A 3VS5A 2XJ0A 4AW0A 3WZUA 4C3FA 3FDNA 5ANEA 2XKDA 1WMKA 3D5VA 5I9WA 2R7IA 4FG7A 3HA8A 3CKWA 1XH7A 3P4KA 3B2TA 5IPJA 5JT2A 3ZC5A 4L3JA 5D7VA 1YWRA 4Y83A 5CENA 4DEAA 3KF7A 4MXZA 4EOPA 3SRVB 4G34A 3DGKA 1OL5A 3ZBFA 1Z9XA 2YABA 4JI9A 3NUSA 3QTZA 3WOWA 3KN5A 2W1CA 2YA9A 1E1XA 3MBLA 5EDPA 2BRNA 5CEQA 1J1BA 4AT5A 3FHRA 1CM8A 2RL5A 4FSNA 4R8QA 2XBJA 3O96A 4HVHA 3Q60A 2JIUA 1REKA 3ROYA 4AZSA 4P5QA 4A9TA 3PE2A 4K1BA 2ITOA 4HZSA 1P14A 3C4ZA 5C8MA 4LUEA 1Y6BA 5D7AA 2W1GA 3PVWA 2HXQA 2X39A 5DEWA 4C4GA 3PE1A 3PA5A 4BTKA 4CG9A 3FY0A 3JVSA 1OKYA 3U4WA 4YHJA 3ZO2A 4CTCA 1UU8A 3JXWA 3QX2A 4PP9A 3LVPA 4EOLA 3O51A 5E1SA 5D12A 2PYWA 3BYSA 3HKOA 3AD4A 3FC2A 4O38A 4FEXA 4ORKA 5HG9A 4XH6A 3II5A 4JQEA 3JY9A 4CKRA 2ZB1A 3R9DA 4DT8A 4LUDA 4G9CA 3NUXA 4GT5A 1U4DA 2XK7A 2YERA 3GFWA 3D2KA 4M13A 3ORIA 4EH3A 4EOKA 3LQ3A 4O0YA 4I6BA 1YI6A 2HY0A 5IG1A 5AIRA 3RP9A 3OHTA 4DG2E 3R21A 4IC7A 2E9OA 1TQMA 1GZKA 4QT1A 1URCA 4DYMA 3Q53A 5KCVA 1QPJA 1WBVA 2RG6A 3MVJA 3UQGA 1IAJA 4BFMA 3ATTA 1PKDA 3PZHA 4QYFA 5EM5A 4D2RA 1M2RA 3O0GA 3QYWA 2IG7A 4FZDB 5E8UA 4FTOA 3U9CA 2AYPA 3L1SA 5E91A 2PVHA 3LMHA 4IB0A 4AQCA 3G6GA 5DI1A 3ALOA 3TKUA 3PJ3A 3TKHA 4WNKA 2C6LA 4XMOA 1ZYCA 3EFJA 4J95A 4V05A 3GCVA 1KSWA 4XJ0A 1ZMVA 3WIKA 4FTNA 4JOAA 4QMTA 1GAGA 4L44A 4F6SA 3PWDA 4ACHA 4D5HA 5KUPA 1H0VA 3BE9A 3C9WA 3ZHPC 3P7CA 3H30A 4KKGA 3CXWA 1UU3A 5FD2A 1PMUA 2JDRA 2YDJA 4IM0A 2GNFA 2VGOA 3T9TA 1Q99A 3OCTA 3WYYA 4BZOA 5KMJA 5EQYA 1YDSE 2GCDA 3LCTA 3ZSIA 3A60A 3GP0A 4DGMA 3MB6A 4BDBA 3QKMA 2WNTA 4MXCA 5EK7A 4IDTA 4L7FA 3AMYA 3F7ZA 2ZM3A 4WSYA 2W96B 3IS5A 4ZY4A 1IAHA 4FTIA 2PVYA 1OBDA 2A4LA 1Q97A 3NIEA 4ASEA 4RFMA 4KD1A 4QMQA 5L2TA 4DBXA 5IQBA 5CNOA 5EDRA 4JX3A 1HCKA 4M15A 5EYDA 3OTVA 1WBOA 4UX9A 4FG8A 3OD6X 4MF1A 4UYNA 5AP1A 2PUPA 4ANNA 1J91A 4E6DA 3TV4A 3CY2A 4NFMA 3OEZA 2Z02A 2P3GX 3Q9XA 1OI9A 3W18A 2JKOA 4ZMFA 2HZNA 1STCE 3BV3A 5JQ8A 3BHUA 5L2SA 2OGVA 4LMNA 4KABA 4HVIA 4CFWA 4O96A 3AGMA 2ZB0A 1P4FA 3JS2A 1B39A 2FSLX 4FKRA 4YBJA 5T3QA 4CEGA 5I9YA 4MQ1A 5BVOA 4C3RA 3UP2A 4WNMA 2W4OA 5M08A 3CTHA 3VVHA 4LI5A 3N4VA 1T45A 3VUTA 2J6MA 1Q24A 3QQLA 5ITAA 4IVBA 2ETMA 4G6OA 2QQ7A 2AC5A 2VWIA 3O71A 4I0TA 4JL9A 4QMMA 3WYXA 3ZBXA 2NNWB 3C0HA 5I5ZA 4FBXA 4MWIA 4BCHA 4E4NA 4O7SA 5ACBC 2XK6A 2WB8A 5HIDA 5C9CA 1DI9A 4ZS0A 1R1WA 2YFXA 5EYMA 4OW8A 5C03A 3OOGA 5JMSA 3P0MA 4AFJA 3BRBA 4FTQA 4X2FA 2CKPA 3NNWA 2WGJA 2WTWA 4MF0A 4J71A 3DZQA 2ONLC 3DAKA 3A4PA 3QFVA 1PHKA 3PTGA 3QD4A 4QMPA 3FLZA 5AP4A 1P4OA 2UZLA 4PPAA 4BIEA 5K9IA 5LVPA 4EUTA 5KNJA 5L2WA 3RINA 4R7IA 5CX9A 5J9YA 3HECA 4OT6A 3TZ7A 3BV2A 3KMWA 3ZFMA 1UWHA 4DFZE 3HV7A 5AFVA 5EQPA 3R2BA 1PXMA 4QD6A 4QYGA 1Q4LA 2KTYA 1B6CB 3DDPA 3ORXA 2FSOX 3ZZWA 2UW9A 4A9SA 4EH5A 5AADA 3DKCA 3QQUA 4TTHB 3K3JA 1H28A 3S0OA 2IW8A 5HE2A 3A2CA 3WZDA 4QYEA 4TNDA 5E8SA 4XRLA 2WTJA 3QTUA 2JBOA 5DHJA 3QF9A 4O0RA 4Q9SA 2QOCA 1ZYDA 3ZS5A 3ATSA 2E9PA 1PXLA 3SOAA 2QODA 4QMNA 4IIRA 3GC0A 2P0CA 4A07A 4BIDA 5IA1A 4DEEA 3VBQA 1UWJA 4FTTA 5J5SA 3KMMA 2WMSA 4BC6A 4NM3A 2F7EE 3W2SA 3AXWA 4JDJA 4UMTA 1FMKA 2XUUA 1JSVA 4QP1A 1WVWA 5HIBA 5KE0A 5DNRA 3EQBA 3COIA 2ITTA 4NH1A 4FKUA 4I6HA 3ZEPA 3PPZA 3ZUVA 3VS6A 5L8LA 3DZOA 4DF3A 4JXFA 4QMZA 2QLUA 1A9UA 2BDFA 4DN5A 5KMLA 4FG9A 4FV5A 3S95A 1CKJA 4EL9A 1PJKA 2J2IB 3FMJA 4FKOA 4MKCA 5C1QB 4UBAA 3FMNA 3DY7A 2QG5A 1UKIA 4J53A 4KKEA 3MGYA 3OW3A 4C4IA 2PZRA 4FKGA 3AMBA 2XNBA 4PTCA 3IO7A 4WNOA 2EXCX 1P2AA 4O0XA 3VS0A 3DTWA 4DG0E 4F70A 3KXHA 5FGKA 1IR3A 4JX7A 3AD6A 4ITJA 3JY0A 1OPLA 3FZTA 3PXQA 4UWBA 3BCEA 5KHWA 3KXZA 2W7XA 4DG3E 5CEPA 1YKRA 3ZXTA 1CTPE 4ERWA 1XKKA 1VR2A 4ITIA 2R3PA 5EM7A 2B53A 5DR6A 4BCPA 2W4JA 4GVAA 1YI3A 4JT3A 4B8LA 3QXPA 3LXKA 5BUJA 3CD3A 2C5OA 3FYKX 4PNKA 3MPAA 1ZY5A 4K9YA 3H3CA 4RWIA 3DU8A 1DS5A 2E9NA 2YITA 4I20A 5H8BA 5LMBA 5M57A 4YJNA 3UPZA 5CF6A 3NMUF 5DN3A 5HCXA 3BU6A 3DTCA 4MXAA 4X3FC 5TKDA 5JH6A 2WIHA 5CXHA 2YEXA 3PJ1A 1FMOE 2WQOA 1ZOEA 2W4KA 1V0PA 4PUZA 2BROA 5GZ9A 4FYNA 3CY3A 4APCA 5FG8A 2BTSA 3QD0A 2YM4A 3V8SA 3FXZA 3UIBA 4OTIA 4DGOA 3GCQA 1PMVA 3DBFA 2VN9A 4GS6A 4NJDA 2X7GA 1A06A 2QOKA 4LV8A 4NM7A 3FC1X 2QG7A 3NVKI 4FTAA 4N6YA 1HCLA 3D2IA 4OTFA 5HD7A 2ZV9A 5KMKA 3E7VA 2V7AA 4GRBA 4EHZA 2GHLA 2XK8A 3DKGA 3VS1A 2VTLA 4GIHA 1Q61A 2ZVAA 4MK0A 4CFFA 2QOOA 3OUKA 4I5PA 5AA8A 4TYJA 4LOOA 4QNAA 5LVNA 3CGFA 5L3AA 1OVEA 4GK4A 4ZJJA 2WOTA 3O7LD 4NUSA 4R1VA 5KBQA 3EN5A 4L3PA 5A6NA 1S9JA 4JRVA 3U87A 5IISA 4FKLA 4QMLA 3R30A 5CU2A 4EUUA 4BVUA 2BILB 5L6OA 5E8ZA 1OKWA 3QXOA 5FTOA 2YACA 4JG8A 4K8AA 2PWLA 4FKIA 3DBCA 4JQ8A 2UZEA 2WTDA 1FVVA 2X9FA 3R73A 4CV9A 4TWOA 3PG3A 4UZDA 5DA3A 5FLFA 3IW6A 5I3OA 2R3NA 4FL3A 4IQ6A 4X3FB 2GQSA 3CE3A 4S31A 5AA9A 4J7BA 2JFLA 3O50A 3QQJA 3TNPC 3ZYAA 3EN7A 2V7OA 3EMGA 2PMLX 5T68A 2XIRA 4EJ7A 4IFGA 4J8MA 5K5NA 2OI4X 3LPBA 3QHRA 3F5PA 3Q96A 2WQMA 4EBVA 3AT2A 1OIRA 3RPOA 3KQ7A 3MA6A 1PXIA 1ND4A 2BMCA 5GJGA 5K0XA 1U5QA 4DEDA 2WKMA 5FP5A 5C26A 2WQNA 5IMXA 4LQMA 5GZAA 1MP8A 3A7IA 3OUNB 4RVTA 3UOLA 3P7BA 3U8WA 4GKIA 2CJMA 4WRSA 2PVKA 4PL4A 2LAVA 3WARA 5A4EA 2OG8A 4FSQA 4H05A 4G3DA 5AUXA 5LWNA 2O0UA 2VWYA 3BEGA 2CMWA 4FV1A 4O84A 3VBXA 4FUYA 4FSWA 4NIFB 4HGLA 4JDKA 4JRNA 4F1MA 2BIKB 4L53A 4M69B 4G16A 3W32A 4I6QA 3LW0A 2QOIA 2XNOA 4EWHA 5DH3A 4MBJA 1M7NA 3HGKA 1P5EA 5L6WL 1OL2A 3FY2A 4FOBA 4E6CA 4KIOA 2RFDA 2WOUA 5CWZA 3FEGA 2R3KA 5IQFA 2FB8A 1KUTA 4LM5A 3AC5A 4ZLZA 3MYGA 4RZWA 3ROCA 2IVTA 4FSZA 4WUAA 3RCJA 3ZLWA 4D2WA 4ZJVA 5BVFA 4JQ7A 4CT2A 2Y6MA 2PE1A 1F5QA 3DLZA 3MY5A 3HV6A 4FI1A 4L67A 2VZ6A 4OTHA 5M55A 1U5RA 3VS4A 4D4VA 4KWPA 5BX0A 3LM0A 1FGKA 4U5JA 3BYVA 3A8WA 3L9MA 1E1VA 2YAAA 4TW9A 4U45A 4TXCA 3KGAA 4P2KA 1QPDA 3SHEA 2IW6A 3T8OA 1SYKA 4Z7HA 2UZNA 2DYLA 4DHFA 4AX8A 3POOA 3G0EA 5AIKA 5JQ5A 3ORNA 3Q9YA 4FKWA 3FBVA 4IXPA 2XIXA 3V04A 2WPAA 1W84A 5IQEA 3A61A 3OP5A 1CKIA 5B2MA 1FQ1B 2GU8A 4BKJA 4BBMA 1AQ1A 2A27A 3WI6A 4YJPA 2JC6A 2YIRA 4K18A 4IB5A 2OJGA 2HZ4A 4TYGA 4QP9A 4BI1A 4ZZOA 2OH0E 2QO9A 1Z5MA 4RLLA 4AE9A 1PY5A 5ANJA 5CAOA 2JAMA 4M3QA 3CGOA 3K2LA 4FNYA 5CQUA 3NYOA 5HOAA 3IW8A 5C8KA 2ZMCA 2QCSA 5TOZA 3UNJA 4ZAUA 5I9XA 1JOWB 2NRYA 4IZAA 5HORA 5K5XA 2WTCA 4JBPA 4J52A 2F7ZE 4E4MA 3SW7A 4BBEA 3RPVA 5CF4A 4E6AA 2C6KA 3OBGA 3BZ3A 5BYZA 2XM8A 2OIQA 3FJQE 4XG3A 3VWAA 2BDJA 2WFYA 4BIBA 3HUCA 3RNIA 3NUUA 4KBKA 3R6XA 4FIEA 3QU0A 3RM6A 4BWXA 5E9EA 2CGVA 3NW7A 3CS9A 2WU7A 2JIIA 3ITZA 5E8WA 2WEVA 2UW7A 5E8VA 4ALWA 1JLUE 2O5KA 5EW8A 3HV3A 3NPCA 3I7BA 5GJDA 3V5JA 3Q4ZA 2XCKA 2C5YA 3SXFA 4WNPA 3ZSGA 2XJ1A 2P4IA 5HHWA 5HI2A 4FNWA 3LFNA 5CSVA 3RTPA 3NDMA 3QA8A 3VF9A 2W5BA 5I3RA 1KE8A 2Z7LA 3NRMA 2WAJA 5HE1A 5HLWA 2W9ZB 3C4FA 4LL5A 3IDCA 2CLQA 4OBPA 3AC4A 5JZNA 1XH5A 2BIYA 3VHKA 5FTQA 4KA3A 1WBNA 4C4HA 3BLRA 2XM9A 4RVMA 4HVDA 1VEBA 1GZ8A 2QOHA 4L3LA 5H8EA 3ZSHA 4FICA 2XIKA 4BGGA 4TYHA 4C4EA 5JGBA 3HAVA 1OMWA 4C58A 2W5HA 2VTPA 4O82A 3TNHA 2QKRA 2QLQA 4RX7A 1ZYSA 4CYJA 2VNYA 2C6MA 4QMXA 3TNWA 3LFSA 4AWIA 2Z7SA 4YZMA 2XH5A 3MESA 4RC3A 2JDTA 5KHXA 3UVRA 4O0SA 5CTPA 3R04A 3OOMA 5CYIA 4U81A 2GS7A 4DA5A 2X81A 4YLJA 2JD5A 3VHEA 5EOLA 2HOGA 2G2HA 5LMKA 2FSMX 5AUVA 2XMYA 4W4WA 3E8NA 5D9HA 5HLNA 1ZYLA 4UZHA 4MHAA 1Y57A 3IDBA 3NR9A 4IZYA 5FM3A 4KINA 2R3RA 4C61A 2YZAA 4DEHA 2C0IA 3DAJA 4RJ7A 3MIYA 4CRLA 4CVAA 4FEWA 4BZDA 2H96A 2WMXA 5D10A 3CR0A 4XV2A 2VTIA 3HZTA 3NGAA 2OIDA 2QNJA 3R8LA 4BTFA 4C34A 4WRGA 1J7LA 4HYSA 1YQJA 2XNGA 1SNUA 2B7AA 1O6YA 3E62A 2VWWA 1FGIA 4OAVB 4OBOA 2G01A 3KEXA 2C6DA 5DG5A 2Z2WA 4ZJIA 2OICA 3F6XA 3GT8A 5AP2A 4XLVA 2F2CB 3RHKA 2ITVA 4Q5EA 2YDKA 1SM2A 3AMAA 4F4PA 5EHOA 3TZ8A 4PNIA 4L68A 1R78A 1H27A 2C3LA 3CD8A 3NUYA 4RT7A 1GIIA 5DVRA 4ZTHA 2O63A 4O7TA 1H26A 3SXRA 3TM0A 3AC2A 3D5WA 3NLBA 4IJPA 3U9NA 3CPCA 4WHZA 1QMZA 2ITPA 3A8XA 1JPAA 3COHA 2Y4IC 3EQDA 3HUBA 3ORPA 3JR1A 2YZLA 2IW9A 3NZ0A 4QO9A 5EHYA 5CI7A 2HW7A 3BKBA 1YDTE 3IPHA 4QQTA 3NIZA 3LMIA 3BQCA 3V8WA 3G9NA 5CZHA 2QOFA 4PDYA 5M53A 4WBBB 3LLAA 5AR5A 3MTFA 2QD9A 2YCSA 2YIXA 2ZDTA 3O8TA 3GXLA 1WBPA 3ZCLA 4YZCA 4ACDA 4EI4A 4IZ7A 1OZ1A 5JGAA 5KMMA 1YOMA 5G1XA 4IAKA 5AR7A 2VRXA 2HZ0A 4O7WA 4C4JA 3H9RA 1GIHA 4XP0A 2XRWA 5M07A 3UO5A 5DFPA 3EZVA 3PFQA 3R8PA 3HMPA 3ULZA 2Z7QA 3QUEA 4ACMA 3V3VA 3EQGA 4WSQA 4K77A 3QLFA 5DRBA 2FUMA 3ID6C 1JVPP 2UZDA 2ITXA 4IAIA 2BZJA 1OECA 3P5KA 1M2QA 4ASZA 5C8NA 3R8ZA 2PU8A 3BEAA 4ZZNA 4N70A 4Y8DA 4DEBA 2JIVA 4GKHA 1M2PA 4FV2A 2XIZA 3VJNA 3FMDA 2WMWA 4CZUA 2XEYA 1IA8A 5DMZA 3UIXA 3A7GA 3CIKA 4BYIA 4FZAB 4P90A 3JUHA 4UYAA 3FQEA 3UZRA 1LP4A 2PY3A 5ETFA 4IBMA 4TWNA 4W4XA 3UO4A 1U46A 2OXDA 4GFOA 3TCPA 2PE2A 2Y4IB 4W4VA 2UVYA 1CMKE 4NKAA 3PP1A 5M09A 2GFSA 5CF5A 4PMPA 2PZIA 3EH9A 3ERKA 5F95A 3SC1A 4O7YA 2YLEA 3FQSA 2XNMA 4KIKA 4CLJA 3MJ2A 2RIOA 2GSFA 3FZSA 4E1ZA 4BTMA 4R7BA 5JFSA 4ERKA 5AAEA 4FT9A 4C02A 3CQUA 3L8PA 4TY1A 3A7FA 2XZSA 3IKAA 4F9WA 1W8CA 3VS7A 5CT7A 2R9SA 1Q3DA 4YHFA 4CKJA 4IACA 4XP3A 4MTAA 1PXOA 2C69A 1ZARA 2WMTA 2QURA 3TZMA 4EH9A 1PF8A 5AV3A 5J1VA 4FF8A 4BTJA 4GT3A 3QQHA 3RPSA 4C57A 1SVEA 3EZRA 4QP2A 2H9VA 3EQIA 4L9IA 2XB7A 3FMHA 4BCIA 4X3JA 5HD4A 4F9AA 3UJGA 3DJ5A 3S3IA 2I0HA 5IDNA 4D4YA 1GNGA 2YISA 2BFYA 4IB1A 4UY9A 4ZEGA 3UODA 4A7CA 4BGQA 4M68A 1XH8A 1REJA 2ZOQA 2HIWA 2YCQA 1UKHA 3KXNA 2CGWA 1F3MC 2QI8A 2C3IB 4FSYA 4KRCA 5HE0A 3WF8A 2PUUA 3MS9A 1KV1A 2BAJA 4FTJA 3FLSA 4XEYA 2YM6A 4S33A 3R9HA 5IZFA 4O7VA 3TDWA 3KB7A 3GOKA 4RIXA 5F9EA 5EKOA 4U3ZA 2JKMA 4FVRA 4AA5A 3G5DA 4E4XA 3E87A 5EYKA 2LGCA 3FL4A 1ZRZA 5CU0A 2F7XE 3C50A 3ZDUA 4GEOA 5TT7A 4F65A 3PXFA 4F1OA 4AACA 3I0QA 4ZTLA 5I9UA 2B0QA 4HGSA 5AWMA 4P7EA 4IWDA 4EOMA 5CVHA 3HAMA 4OBQA 2HK5A 3R8VA 4O83A 3R1SA 3PWYA 3PIYA 1DI8A 3I5NA 4JBVA 3I60A 4C7TA 4A06A 3W2CA 2J90A 3DDQA 3DOGA 2VTHA 4YZDA 4FC0A 5CAVA 4G31A 5E92A 4YC8A 4MQ2A 1VJYA 4GIIA 4CRSA 1WFCA 3OWPA 3RVGA 4B9DA 2BCJA 3RMFA 3QGYA 4WG5A 4ACCA 4F0IA 5M4IA 3TZ9A 4I4EA 4YJRA 4O22A 3PG1A 3FLNC 3VBYA 4OUCA 5K3YA 3BYOA 2B9HA 4I22A 3REPA 3QKLA 2C1AA 1Q8TA 4BB4A 4PL5A 4FKQA 2J9MA 3PJ8A 5E90A 1YXVA 2Q0BA 4TKSA 3Q32A 4M0ZA 1OIYA 5CSPA 2BR1A 1WBWA 3I79A 4IH8A 4DCEA 3PY3A 3QRTA 4DTAA 3C13A 3HRBA 3MH1A 4USDA 5FDXA 3VBWA 3OWKA 4RIYA 5HESA 4D2PA 2XNEA 3WF9A 4AU8A 3W2QA 1GZOA 2GTNA 4QOXA 4FK3A 1PRYA 4FKVA 4YO6A 1KE5A 1UV5A 5DT3A 3TACA 4EKLA 3LFDA 2BRMA 4S2ZA 4H3QA 4NYEA 1IG1A 2GHGA 3KULB 4DH8A 3KY2A 4C38A 3AC8A 4G17A 3R7EA 5IQAA 2PMNX 2YAKA 3FMLA 5LJJA 1LPUA 4RIWB 2I0YA 4Y46A 4EH2A 4IX5A 3PXZA 3GU5A 2VO0A 2OZAB 3IW7A 1YOJA 2OJ9A 3R8UA 2J0MB 4QP7A 4AGWA 4EH7A 4I41A 1Y8YA 4IEBA 1DAWA 5JK3A 2QOQA 3QWJA 5GNKA 4GG5A 5BQ0A 4GK2A 3HP2A 2J50A 4M8TA 3EHAA 3D9VA 3LAUA 5E8TA 5HO8A 4Z7GA 3M1SA 4PDSA 3UO6A 3NW6A 5DR9A 2ERZE 3V5QA 3ZO3A 3OT3A 4WT6A 3TG1A 1SVGA 3PPKA 3RI1A 4CMOA 4IAYA 2YIWA 5G6VA 3PXYA 3DK3A 4WKQA 3FKLA 3ORTA 4BZNA 5BVDA 4RC2A 5EW3A 3SXSA 3C5IA 1BL6A 4ALUA 3E93A 4M0YA 4ZY6A 4AZTA 4CQEA 5M06A 3L9LA 2XS0A 3N4TA 3CTQA 3R28A 5HBJA 4BY9E 2PVRA 4JJRA 2OF2A 3F3TA 3F61A 4HW7A 4X21A 1J7IA 4C2VA 4L6QA 4IB3A 4R7HA 4QYHA 4IVCA 1H1QA 3PLSA 2B55A 2ZM4A 2CNQA 3RAWA 4NZWB 1KE6A 1KE9A 2A2AA 4NW6A 4G1WA 5AUZA 3VC4A 4HVSA 3ZFYA 1NVSA 2OXXA 5CT0A 1APME 3F5UA 1XBBA 4OTGA 4KBAA 2BALA 3B2WA 3RWQA 3DT1A 2UVZA 3QRJA 4AP7A 3QRUA 5JFWA 3LQ8A 2B9JA 4E73A 3P1AA 1Q8UA 3BBWA 3IG7A 2CKQA 5JZJA 2PUNA 4XCUA 2VO6A 4BDFA 5I4NA 4HOKA 5AAFA 1CDKA 3OCSA 1Z57A 2BRHA 4V0GA 3UC3A 1NW1A 3DS6A 2VTSA 4A9YA 4O27B 3F2RA 4MNFA 4Q5HA 3RGFA 5I9VA 1MQBA 4BDKA 4NT4A 4TWCA 3BGZA 4U8ZA 3LCDA 3QGWA 1OL7A 4D28A 3LZBA 4UB7A 3V01A 5CU6A 4U42A 2CPKE 3TNIA 3VULA 4M97A 2X8EA 2JBPA 3NNXA 4IHPA 4YP8A 4EOJA 4YO4A 5D11A 4UV0A 2IZUA 3KMUA 4A9UA 3OW4A 4IFCA 5AMNA 3GCUA 2VWVA 3LMGA 5LMKC 3U55A 4PX6A 2G2FA 1U59A 3D94A 3FZPA 4KNBA 2R0IA 4JR3A 4J97A 4YLKA 4Z16A 3SVVA 4H3BA 5CS6A 5JGDA 4EZ5A 2XA4A 1CKPA 3P9JA 4FNXA 4A9RA 5HX6A 2GQRA 4QP3A 1YOLA 4FKSA 4WOVA 4DFLA 2JITA 4EEVA 1TQIA 5AX3A 2JEDA 2GFCA 2OXYA 5HG5A 4ANSA 2UZBA 3U6HA 2EU9A 3HEGA 3U51A 3DB6A 2OFVA 3WILA 3KN6A 3CP9A 3UOKA 1H4LA 4EZ3A 4YTIA 2JGZA 2YN8A 4IAZA 1HOWA 4YPDA 3U4UA 3OWLA 2F2UA 3QZFA 4YJQA 5GHVA 4GG7A 1ZYJA 3RPRA 4O81A 1R3CA 2Q0NA 2X8IA 3HMOA 5CI6A 5IQIA 3H0ZA 4GUEA 5CSHA 4USFA 1ERKA 3I4BA 5IF1A 5T6KA 4WO5A 3AOXA 4EQMA 1H00A 2F4JA 4XOZA 5IA2A 3W8LA 2OF4A 4PL3A 5E1EA 3Q5ZA 3O8PA 4BDCA 3TUBA 4HGEA 1PXNA 4NEUA 4U80A 5CU4A 3MI9A 3TL8A 1S9IA 2WD1A 3QZIA 4BCOA 2HW6A 4QTAA 4AW5A 4AAAA 4BDJA 2E9VA 4X0MA 3ZDIA 3RHXA 3QTRA 2Y4PA 4IC8A 3TI1A 2VTJA 5HCYA 3GVUA 4CSVA 2ZAZA 3C51A 3SG9A 1RJBA 3EQRA 3FI4A 3ORLA 1DAYA 3FXXA 2C0OA 3R22A 4NCTA 1XJDA 4CFNA 5F1ZA 3TWJA 4AGCA 1XH9A 2WTIA 5ETCA 3UDBA 2YCFA 3NAXA 4YGAA 3UIUA 4XV9A 1BYGA 1H07A 2W05A 2JDOA 3COMA 3GBZA 3ZUUA 4XV3A 4AOJA 3FPMA 4U7ZA 4LYNA 2GNHA 3GNIB 4G9RA 4ZK5A 4AE6A 4D1XA 3LCOA 1U54A 4EOQA 3HYHA 2NP8A 5D1JA 1BI7A 2O64A 5TR6A 4AA0A 2V22A 4S34A 2VNWA 2QHMA 2GNJA 1JBPE 5TO8A 3PSBA 2C6IA 3SX9A 5IU2A 5FWKK 5HGIA 2QHNA 1YWNA 3D4QA 4H58A 3OBJA 4GJ3A 4BCKA 4DLJA 3AG9A 4F0FA 4F6WA 2YCRA 4L52A 4Y5HA 3ZLSA 4FR4A 1PMEA 5A4LA 2WMAA 3LFQA 2WTKC 2PMOX 3ACJA 2YM3A 3OT8A 5AP6A 4ZSEA 4NFNA 1ATPE 5HX8A 4D9TA 5A14A 4V01A 3PDTA 4FL1A 3VUMA 2CNUA 4YZNA 3Q6WA 4QMUA 4C0TA 4RX8A 4DH1A 2EB3A 4IM3A 3EKKA 3E3BX 1Q8YA 4YZBA 3W10A 3ZOSA 3FLYA 5AJQA 1M14A 2Z60A 4BBFA 1YW2A 4GT4A 3RK7A 3IW5A 3DQWA 3PYYA 3LFCA 3ZZEA 4DTKA 3HMMA 4OTRA 2RGPA 4ANLA 5IH5A 3T3VA 4OTQA 4KAOA 2IWIA 3P23A 3EQHA 3QCYA 4TWPA 4CT1A 4RQVA 3RZFA 4F99A 4JDHA 2XP2A 4F7JA 3MY0A 2B9IA 2XJ2A 3BI6A 4I24A 4ZP5A 5DPVA 4B99A 4F6UA 3C4EA 3HA6A 4FZFB 3HVCA 2BRBA 3RM7A 4C4FA 4QTBA 5HZNA 4EK8A 2CNVA 2ESMA 1AGWA 2YJSA 3M2WA 4TYEA 4EHEA 4AT3A 4I3ZA 3UNZA 3D7TA 4GU9A 2OWBA 5DGZA 2W1ZA 2UZTA 2PK9A 3FWQA 4AUAA 2UW8A 2IVSA 4BDGA 5JSMA 4EYJA 5IA4A 3OXTA 4C2WA 4FT0A 1M17A 3TIZA 2ZJWA 5J9ZA 4BWKA 3G6HA 3SA0A 5HKMA 3QRIA 4G3FA 3I1AA 4HGTA 5AUUA 4MD9E 2PVNA 3KC3A 3DXNA 3SDJA 5J1WA 4PRJA 4RG0A 2NRUA 4QPSA 4QMYA 4CXAA 4XUFA 5LVMA 4FV7A 4CFXA 2VD5A 1YXTA 4FKPA 4K6ZA 4KBCA 3AT3A 4MWHA 5HBEA 4YSMA 3TKIA 4FV8A 5ANDA 5HO6A 5HG7A 4NKSA 3WIGA 4ZLOA 2HWPA 2PSQA 2BRGA 4EYMA 3VUDA 4RQKA 5BVWA 1MQ4A 2X4ZA 5JKGA 4O0WA 1KOAA 3IW4A 3LQ5A 4RVKA 3UG2A 2FGIA 2QC6A 3VJOA 5AV1A 4IX3A 5M56A 5FBOA 3FQHA 2OFUA 2PVJA 3QUDA 5FRIA 4HYUA 4B6LA 4LRKA 3A7HA 5BVNA 2DUVA 3S00A 3LLTA 3UP7A 4FIIA 1NXKA 4L43A 5GJFA 4FNZA 3R7IA 2Y8OA 3LXNA 2PPQA 3C4WA 4EKKA 3K5VA 3MH2A 4RJ8A 3C7QA 3QC4A 4D0WA 3FPQA 3MVMA 5GINE 2XNNA 3MIAA 3NYVA 3ULIA 4FTLA 2BVAA 1BMKA 4BR3A 2FVDA 3PUPA 3VQUA 2RG5A 4O6EA 4WBOA 2J7TA 5HNGA 4I4FA 3MB7A 3EFWA 3JYAA 4MD7E 4N57A 2RFEA 3R63A 1QL6A 2XK3A 3CBLA 4C35A 4MBLA 2R64A 4AZWA 4R3PA 5JEBA 4FT5A 4R77A 5A4QA 1WBSA 3LFAA 4NU1A 3VW8A 3RBWA 4MAOA 4MEDA 3DKOA 4PMTA 1ZOHA 3HLLA 4ITHA 2HELA 4UMUA 4GJ2A 3OROA 3VRYA 3VUGA 3ZUTA 3EJ1A 2C0TA 2X2LA 4RIXB 2A1AB 2CKOA 3TIYA 3D83A 4FK6A 4U43A 4F7LA 2HZIA 2QR8A 4PMMA 4YZ9A 2EXMA 5CVFA 3KU2A 2WQBA 4TYIA 3AC3A 5KZ0A 2GS2A 4IJ9A 3PY0A 4I5MA 3Q3BA 4D55A 2X4FA 3E7OA 2XCHA 1H01A 4FIFA 4I5HA 5DIAA 5JRSA 4AN3A 5CAUA 4E7WA 5LOHA 3WE4A 3C4CA 3BE2A 1Y8GA 4RC4A 4ANOA 4ANBA 2VGPA 5AV2A 4HZRA 3SQQA 3ZRMA 3KRRA 1PYEA 3U6JA 4HCVA 1VYZA 2X6EA 4TN6A 1WVYA 3D14A 4EK5A 2IVVA 3T3UA 5J5TA 4HYIA 4O7ZA 1H1WA 3CEKA 3FLWA 5HICA 2C6TA 2BAKA 3MH3A 4GL9A 4AGDA 4H39A 4YPSA 2WXVA 4J99A 4FTUA 4D9UA 3CTJA 2EB2A 3SD0A 5HTIA 4XS2A 2CGUA 4XYFA 3WBLA 4R78A 2GS6A 3VW6A 2J0KA 2XNPA 4FA2A 2KULA 4X2KA 3I6UA 1ZAOA 4PDOA 2UV2A 2W0JA 2W5AA 4QP4A 3VUKA 1GZNA 3FV8A 3PXRA 3EQCA 3POZA 4FSRA 4RIYB 4TRLA 3UOHA 2WO6A 3WZJA 4C33A 2EVAA 4E6QA 4L42A 3NX8A 5HIEA 1O9UA 3ANRA 4RWJA 4AN2A 4PF4A 2JDVA 2VX3A 3O2MA 5B7VA 4BKZA 2JDSA 4GU6A 2HWOA 1LEWA 2C30A 3F3ZA 4I94A 3QHWA 4RJ5A 4X2GA 3Q4UA 4ONAA 3UMXA 4X2NA 4MH7A 5IQDA 3BHTA 3MJ1A 5EG3A 3UMWA 3W2OA 1OL1A 2BZHB 3JPVA 4FYOA 4A4LA 1WBTA 2W1HA 4O1OA 2Q83A 5CEKA 4ANMA 4IWPA 1UVRA 4HPUE 1VZOA 3LCSA 3QCXA 4I5CA 4UMQA 4YNOA 2BTRA 1KE7A 1OL6A 4U3YA 4I92A 4WIHA 1Q3WA 3IDPA 3OY3A 4MBIA 3ZRLA 1NVQA 2C5NA 4N6ZA 5J87A 2ITYA 3MFUA 2XF0A 1V0BA 3IONA 5DEYA 4ZTNA 2OZOA 3V6RA 5FBNC 4FV4A 4PWNA 1PKGA 2F57A 5BVEA 4ZZMA 4FV3A 3THBA 1V1KA 3R83A 3NS9A 3EN9A 3R1QA 1Q62A 4RWKA 1MRYA 2P2HA 5A6OA 4O0TA 1IEPA 4QPAA 5ACKA 5CAPA 1WCCA 5AX9A 3I0OA 4UN0C 4CFUA 1KV2A 2J5FA 3N4UA 1JNKA 4YBKA 4Z9LA 2GHMA 3F3UA 2X8DA 2XRUA 4TNBA 2GQGA 3GU7A 4Y72A 3E88A 3QD3A 5CANA 5KZIA 3GCPA 3OEFX 4EOIA 3G2FA 4IX4A 4EK6A 2YM8A 3MA3A 4FTKA 3UZPA 4EH6A 2W1IA 2VWXA 1V0OA 3EYGA 3P86A 5JRQA 3PSCA 3FI8A 1J3HA 4PTGA 4IE9A 3KREA 4CD0A 3U54A 1YHVA 3TV6A 2Y9QA 3W33A 5F4NA 2XK4A 4ACGA 4F9YA 2BKKA 3SOCA 4YSJA 4YC6A 1TKIA 3B8RA 4X7QA 3V5WA 1IA9A 3IGGA 2C47A 3VN9A 1MRVA 3BGQA 2FYSA 1OKZA 2WTVA 4FE2A 5EI6A 3QZHA 5LCKA 4CFVA 4D5KA 4EK3A 4GH2A 2CCHA 2VWBA 4W4YA 4I6FA 1OM1A 3G0FA 3GI3A 4ZTQA 5KO1A 3MV5A 4BCFA 4F08A 4NL0A 3MFTA 2VTMA 2W1EA 2XK9A 2NPQA 4H36A 4V0GB 3GB2A 4EOOA 3TUDA 2I7QA 1W0XC 2YWVA 3D7ZA 3OXZA 3KVWA 4AXAA 1AD5A 5EYCA 2GDOA 4DLIA 4F09A 5A46A 4GVJA 5J95A 5J7BA 4JAJA 2FH9A 3LKMA 1JKLA 5IA0A 4JAIA 1QPCA 4HPTE 4K33A 3V5LA 3TDVA 1UU7A 3MVLA 4OAUC 5TF9A 4JG7A 4EQCA 2IJMA 3E92A 3RALA 4E5WA 5J7HA 4U44A 1ZZ2A 3E8CA 4BDAA 3H9OA 4NCTC 5CNNA 4AG8A 3A7JA 3QZGA 5KKRC 4ZOGA 3A99A 4RX5A 3RK5A 2H8HA 4GYIA 2CSNA 1MRUA 1XH4A 3UZTA 3ZO1A 5AUYA 2O3PA 3ALNA 3CQEA 4YMJA 2B1PA 3NSZA 4MXYA 5IUHA 1K9AA 2ZV8A 3KL8A 1H1PA 4IM2A 3LJ1A 4IAAA 1JWHA 4F7NA 4QMWA 4GSBA 4TL0A 3UQFA 3QL8A 3R71A 4EHGA 4EK4A 2CN8A 1OPKA 2XVDA 3BYMA 3BELA 3L8XA 1RE8A 4M7IA 3QTSA 1ZOGA 5DLSA 4XP2A 4BCGA 3BIZA 3UC4A 3UQCA 4P5ZA 1JSUA 4U97A 2R3IA 5FDPA 3HL7A 3KF4A 4AFEA 2HY81 5EH0A 4RRVA 2X6DA 4IVDA 3FL5A 5AR8A 3OS3A 4U79A 2OKRA 3QQFA 3VO3A 4E5AX 4F1TA 5ICPA 4O2ZA 3GU6A 2FA2A 3VAPA 2FSTX 2SRCA 4IAFA 4DGLC 4JG6A 4FGRA 2R7BA 3QUPA 4MVFA 5CEIA 4HYHA 2VAGA 2VTNA 3Q6UA 4NIFA 5LARA 4C36A 3ZM9A 3QC9A 4CG8A 3NCZA 4XG4A 1YDRE 4M69A 4BWPA 4GYGA 4E4LA 4EZ7A 3HX4A 3S4QA 4CCUA 5LVOA 4QMSA 5IEXA 5FXQA 2GNLA 1CSNA 4BHNA 2R3FA 1XQZA 3LM5A 4HCTA 3NW5A 4BDIA 2VX1A 3ZMMA 4E20A 4F63A 2WU6A 3R2YA 4L45A 3FAAA 1ZWSA 3FKOA 3QYZA 3Q2MA 2OW3A 1URWA 1BKXA 2B9FA 5HU3A 5KKRB 1LR4A 3E8DA 4G3GA 1YXUA 2HYYA
chains in the Genus database with same CATH superfamily
3OCBA 3H9FA 2PE0A 4G5JA 4CLIA 5L6PA 3PRFA 4WD5A 3W16A 3CKXA 4X2JA 2C3KA 2R3JA 4JVGA 4AS0A 5CVGA 1U54B 3L8VA 3LFEA 4ZSAA 3BWJA 4M66A 4Z55A 5H9BA 3WZEA 1PW2A 4RLKA 4BN1A 4LOQA 2GPHA 3P78A 5IA3A 4FUXA 3CQWA 2BFXA 4U0IA 3QCSA 5EW9A 4D2TA 5AP7A 3M42A 5IDPA 2XKCA 3K5UA 4O7LA 4FT3A 4EJNA 3OF0A 5L8JA 1OUKA 2BHHA 2VX0A 2R3HA 4G6LA 4QPMA 1LUFA 4O2PA 4MNEA 3NFGB 3PP0A 4QEBA 5AR4A 3PLAE 5J8IA 3EB0A 3N51A 3LOKA 2R3OA 3DA6A 3TJDA 3LHJA 2BDWA 3TJCA 4RFYA 3Q2JA 4D58A 3DFCB 4CZTA 2PZPA 4DCAA 1KOBA 3SGCA 2R2PA 4EH4A 2B4SB 4YUQA 2J51A 3C1XA 3NAYA 3F88A 4R6VA 2CDZA 4FEUA 4KSQA 4BL1A 1XWSA 4C3PA 4OTWA 2I6LA 3P7AA 3R9NA 4UEUA 4EORA 4FSUA 4AF3A 5LWMA 3R7OA 1FOTA 2RKUA 5HO7A 3HV5A 3S2PA 4G3EA 5DE2A 3QX4A 4QTEA 5IQCA 3F3WA 4H1MA 3EL7A 3ZLXA 5FM2A 3O17A 3GGFA 3PZEA 5LMAA 3V6SA 1W2CA 2B54A 3QAME 4I1ZA 4AN9A 1GY3A 4FTCA 3D7TB 1X8BA 3AT4A 2IPXA 3MPMA 3NCGA 4IANA 4L7SA 5A4CA 2R3LA 3UBDA 5KX8A 3OG7A 3H0YA 1BX6A 4YJTA 5FXRA 1W82A 3DAEA 4KRDA 3GU8A 5BVKA 3R1NA 4FEQA 3VQHA 3W1FA 5EDQA 4ALVA 2CGXA 2XALA 2XARA 5EQEA 3SV0A 1UA2A 4IW0A 3CJFA 3I6WA 1BI8A 1Y6AA 2WHBA 4QP6A 1G8AA 2ZV7A 1NT2A 2OJFE 3TTJA 3ELJA 2F9GA 2PZ5A 4AZFA 5DR2A 2ETRA 2GNGA 3ORKA 4NM0A 3VF8A 5DBXA 5FEDA 3ETAA 1GJOA 2G9XA 3UVQA 4AGUA 2EUFB 2UZWE 3ORZA 3PRIA 3O8UA 3TT0A 5A9UA 4RJ6A 4JMQA 2R3GA 4UWYA 4XBRA 4KUJA 1K3AA 4LGDA 2Z7RA 2IZTA 3V8TA 4CV8A 2ZYBA 3DPKA 4IWQA 1JKSA 3GC7A 3HRFA 4LOPA 5BMMA 2J0IA 3SLSA 3PPJA 3HDNA 4ZIMA 3HNGA 4XV1A 3PVUA 4Y5QA 2BPMA 1OGUA 5CXZA 1EH4A 4O0UA 4XG9A 5DWRA 4TPTA 4ZXTA 2J0LA 2J0JA 4H1JA 3QCQA 3WF5A 3PY1A 5AUWA 4CTBA 3BBTB 5FUTA 3R0TA 3ACKA 1G8JA 2V55A 5CSWA 3EYHA 5L4QA 1KWPA 3KRLA 4K0YA 4XLIA 2VWZA 4D4RA 4O7RA 3JVRA 3QQGA 5HCZA 4E93A 4Y73A 3TN8A 4O86A 3A62A 3L8SA 1ZY4A 3DB8A 2IO6A 5IEYA 4NM5A 4LDTA 3RZBA 1W7HA 5AP0A 3ZM4A 1FVRA 4KIPA 4U6RA 4JLCA 2WMRA 2AUHA 4CCBA 4DGNA 3AGLA 4MXOA 3PUFC 3VRZA 3FMEA 3ZO4A 3FLQA 4WG3A 4ENXA 2QR7A 5FQDC 1UNLA 4ASXA 3HRCA 3L9PA 5BYLA 4WUNA 3U6IA 2X2MA 5B0XA 4JBOA 3LE6A 2UZUE 2HCKA 3N9XA 5DT0A 4UMPA 3ZXZA 2I40A 4RIOA 2AC3A 4ZSLA 3RAHA 2OH4A 1NY3A 4GK3A 4X6RA 5ANIA 4ARKA 4DITA 3TEIA 2JFMA 4HNIA 3E3PA 3FZ1A 3NVMB 1YXSA 4YLLA 4BF2A 4CGAA 3QTQA 2VO3A 1OKVA 1JKTA 3D5UA 3E5AA 5A54A 4AXFA 3BPRA 4PMSA 3TXOA 3F82A 2YJRA 5AR2A 3FZRA 3F66A 4YJSA 5HEZA 4E8AA 4BYJA 1I09A 3E63A 3UDSA 1FBNA 3GEQA 5JN2A 3QTIA 3MWUA 4IX6A 3GFEA 5DOSA 1H08A 1XO2B 4BICA 2V62A 4H3PA 4FKJA 1QCFA 2WEIA 2CHLA 2P2IA 1ZZLA 5DRDA 2UZVA 2EXEA 4GFGA 2CKEA 5M4CA 2W17A 5EI2A 5ETAA 3IK3A 3FI3A 1R39A 4O7NA 4ZS4A 4FT7A 4FOCA 4RGJA 4QQCA 3ZH8A 4QTDA 3I81A 1FINA 3ODZX 2UUEA 2H6DA 3KK9A 4R1YA 2V5QA 4LRMA 3QALE 3TV7A 3R7YA 4A4OA 4RBLA 4CMTA 5CALA 3UYTA 4X6QC 4O91A 4R3RA 1H24A 3DK7A 3Q04A 1R0EA 2XBAA 3UE4A 3Q4CA 4O21A 5IKWA 1O6LA 5KBRA 3EFLA 4RPVA 2XYNA 1UNGA 2WZJA 4OLIA 2DWBA 2O65A 4K2RA 3A4OX 3LJ2A 4OTDA 4FSMA 4D2SA 1QPEA 4IADA 3PSDA 4BDDA 2WQEA 3EL8A 5HVYA 2CN5A 4ASDA 4F7SA 3R7GA 2R3MA 3OWJA 3EFKA 3BHYA 1B38A 3EOCA 5B2KA 2YDIA 4W8DA 3SW4A 3TTIA 4J98A 4YTFA 1NVRA 1PXPA 2YM7A 3GCSA 2W99B 2OK1A 1W2DA 3KXXA 3ZEWA 3C4XA 2UW5A 2UW6A 4TZRA 4TYHB 1XH6A 1I44A 3UOJA 4YTHA 1A48A 4A4XA 4QNYA 3KXGA 4DEIA 3RK9A 3NNUA 4L8MA 2JAVA 3RCDA 1J1CA 3CJGA 3DKFA 3FHIA 4G3CA 4DEGA 2OBJA 4C59A 3H10A 4KS8A 5BNJA 5LCJA 1YHWA 4NTTA 2XKFA 3Q4TA 5HU9A 3NUNA 5E4HA 4APPA 2X0GA 1PXJA 4CFMA 5CQWA 3VS2A 3MFSA 2OIBA 4AOTA 2JKQA 2Z8CA 5BPYA 1G3NA 3M11A 5C01A 2BKZA 4AW2A 3MTLA 4DGGA 4YJUA 3D5XA 2IZRA 4FV0A 2BZKB 4UXQA 3S1HA 3QRKA 3E64A 4AT4A 3KIOC 3G51A 2VO7A 3O7LB 1JAMA 4N4SA 5IQGA 2NO3A 3NUAA 4GV1A 4C8BA 5HNBA 2HXLA 2C6OA 4XRJA 4B4LA 4RA4A 3DXPA 4DTBA 3SRVA 5IUGA 3SKCA 4II5A 3Q9ZA 4CQGA 2VUWA 5BMSA 3G9LX 3MW1A 5CEOA 3FSFA 3VBVA 2FO0A 3DFAA 1XHAA 3NWWA 2ITWA 3KVXA 3V5TA 1OIUA 5ANGA 4YNEA 4DFYA 5HVKA 3PA4A 2C5XA 4J96A 4Q2AA 4BCNA 1MUOA 2RFSA 1OPJA 5J9LA 1YXXA 2WIPA 5EHLA 4L01A 1BL7A 4IMYA 2QOLA 2X1NA 3HP5A 4AW1A 4XBUA 2PZYA 3HMIA 5GIPE 1R0PA 4JIKA 3MVHA 3BGPA 1SNXA 2VTRA 4F0GA 2ITUA 4I23A 2VWUA 3FXWA 3B8QA 5CLPA 1Q8ZA 3OY1A 2BZIB 5IEVA 2WMBA 3KKVA 4LV5A 2WMQA 3PIZA 1TQPA 3DBDA 4NW5A 4O6LA 2NYAA 2VV9A 3Q5IA 3P79A 1TVOA 5F94A 3PJCA 4F78A 4U40A 5AM6A 2JKKA 4V04A 4YC3A 4D1SA 4YTCA 2JLDA 1O6KA 4EOSA 1PXKA 3QA0A 1ST0A 2UVXA 4FEVA 4FIGA 4NWMA 5K4JA 3DCVA 5AV0A 3RWPA 5AP5A 2J4ZA 4D0XA 3VBTA 3W2PA 3I7CA 5CEMA 2OO8X 3QBNA 4YJVA 5IA5A 2WMUA 3HMNA 5M44A 4EQUA 2BUJA 4NK9A 4Y85A 3UG1A 4CKIA 3CPBA 4AZEA 2HAKA 3VONA 1YI4A 3ET7A 3LFBA 1L8TA 3RNYA 5EOBA 3KFAA 3Q52A 1W98A 4RMZA 5CU3A 3F5XA 3KK8A 4BKYA 4QQJA 3G33A 2GTMA 5F20A 4ANQA 1XR1A 4OR5A 3VUHA 2QVSE 3DJ6A 2YIYA 2ZDUA 3QKKA 5H3QA 3F69A 3R9OA 3ZTXA 4IWOA 5JFXA 4ZTRA 5CY3A 4FVQA 3W2RA 2QU5A 4Q9ZA 5FTGA 3FZOA 3K3IA 4AXEA 2F49A 3LXPA 5A3XA 4UXLA 1OB3A 4BRXA 2WTKB 2UZOA 2A19B 4HVGA 4ZY5A 2W9FB 1JQHA 1JKKA 3BX5A 4LG4A 3IGOA 4KS7A 5E7RA 4AA4A 3OCGA 4R3CA 2VTTA 3VS3A 3LXLA 2IN6A 1L3RE 4O0VA 4PP7A 1VYWA 3DBQA 4NTSA 3Q9WA 1WAKA 5CZIA 5HE3A 3DXQA 1UNHA 3W8QA 4C37A 4AXDA 1E9HA 5AEPA 3KULA 4RWLA 3WF7A 4LRJA 4KIKB 3QTXA 3NUPA 1YHSA 5IH4A 2C68A 3OFMA 4J1RA 4RIWA 4DFNA 3T9IA 2B52A 4FL2A 4CZYB 2OZAA 2UW0A 3EKNA 4S32A 5IMEA 3R00A 3D15A 2C5VA 2ETKA 3KXMA 3VUIA 4F9CA 2J5EA 4JR7A 3F7WA 4EBWA 4FZ7A 3ORMA 2PVFA 3TUCA 4BGHA 3FSKA 4G6NA 4WG4A 3RAKA 2R4BA 3QLGA 3ZLYA 5HNIX 3UYSA 4FX3A 4YR8A 5C27A 2QU6A 4FV9A 1UU9A 4U9AA 2GNIA 2X0QA 2X7FA 4DH5A 3KA0A 3QQKA 4QMOA 1OITA 3P08A 4IZ5A 2IEWA 4I21A 3ZRKA 2OU7A 5I9ZA 2W1FA 1RW8A 3R7VA 3RKBA 5AAGA 4DH3A 4USEA 4PPCA 4Z3VA 4BDEA 1XBAA 2R3QA 3EIDA 4M14A 4QQ5A 4ZSGA 5HBHA 5JFVA 3DK6A 3UPXA 4EWQA 3BYUA 4RFZA 3SG8A 1PMNA 1BLXA 3KCFA 2OLCA 3I5ZA 5L2QA 2HENA 3NNVA 3WZKA 4F64A 5BUEA 1H8FA 2C1BA 4YJOA 3NYNA 4R5SA 3AC1A 4BI2A 1M7QA 4KSPA 4G2FA 3RJCA 2G1TA 1OBGA 3F2NA 3G15A 5BYYA 3BLQA 4BCJA 2YWPA 2VTQA 1XMMA 5EM8A 4MNEB 3BLHA 3GU4A 4FSTA 2W1DA 3EN6A 4QDVA 5EKNA 4LMUA 2OSCA 4MX9A 4B7TA 5FEQA 3EQFA 1Q41A 4NSTA 1H1RA 5EI8A 3FE3A 4MD8E 3R7UA 4PTEA 2DQ7X 4AOIA 4FTRA 5M51A 4W9WA 4D2VA 4Y95A 5HG8A 4C62A 5BUIA 4TT7A 4BJJA 4DDIA 2V0DA 4CMUA 3QWKA 4FV6A 3F5GA 3HDMA 1RQQA 5LVLA 3PVGA 3MPTA 3ANQA 3FUPA 4UWCA 1FPUA 2ACXA 4XOYA 4EH8A 2X7OA 4OGRA 4JS8A 4CYIA 4DH7A 1K2PA 4E3CA 2XYUA 5K4IA 4KB8A 3E8EA 4P4CA 2Y0AA 5M4UA 4BI0A 2QONA 3K54A 4LGGA 4OT5A 4RSSA 5AUTA 4KKHA 4D1ZA 4IVAA 3UNKA 4HJOA 5A4TA 5AM7A 2I1MA 5ETIA 3IOKA 4ZTSA 2PVLA 3VIDA 4DT9A 1FVTA 1ZLTA 3WF6A 4BHZA 5GIOE 2XKEA 2G15A 4N0SA 2UW4A 4JDIA 2YHVA 4F9BA 2DS1A 4XG8A 5D41A 4FIJA 4BCQA 2O8YA 4YHTA 4RX9A 4JBQA 4PY1A 1BUHA 4U41A 4PDPA 4ENYA 5LQFA 4W8EA 4DBNA 1SMHA 2REIA 2X0PA 3EN4A 3DJ7A 5E8XA 2R0UA 3SAYA 5DYJA 3C0GA 5LXMA 3UGCA 2PULA 4XG2A 2PMIA 5HLPA 4M67A 1F0QA 2OJJA 3MSSA 4DINA 3DQXA 4G5PA 2W06A 1WVXA 2A0CX 4J8NA 2PHKA 3OTUA 2ONLA 3D0EA 4RA5A 5DT4A 4ZLYA 2ERKA 1RDQE 4QMVA 3EWHA 3F3VA 2ZMDA 2ZM1A 4DC2A 5CF8A 4I0RA 3GC8A 3IOPA 3LJ0A 5FEEA 3R8MA 1H0WA 3FMMA 4R5YA 5H2UA 4RZVA 5FP6A 4OTPA 1GIJA 2PVMA 3FYJX 4FKTA 4RVLA 3LCKA 5H8GA 3IECA 1W83A 4XG6A 4UALA 5J79A 3V5PA 2XIYA 1SZMA 2P33A 4QTCA 3DV3A 4EONA 3GQLA 4MUQA 4L00A 1GOLA 4WA9A 4YURA 3BU3A 2ITNA 2Y6OA 3C0IA 2QO2A 2G2IA 4KIQA 3ZC6A 1OGYA 4FGBA 1G5SA 1OUYA 1J7UA 3COKA 1YWVA 4ZMEA 5TE0A 4EC8A 4E26A 3RAIA 4AXCA 3R01A 2ITZA 2Y7JA 2O2UA 2YLFA 1WZYA 3HV4A 4QP8A 4RJ3A 2CCIA 4LL0A 3ZONA 1ZMWA 2BHEA 2X9EA 1NA7A 3GC9A 4ID7A 1H25A 4DFUA 3AD5A 2RSVA 2CLXA 2C4GA 4O1PA 3LIJA 3NFFB 3FI2A 3F2AA 4MYGA 4PPBA 4XX9A 3QD2B 4W9XA 3W55A 3GENA 3MH0A 4QRCA 5I0BA 5AR3A 2C3JA 2ZV2A 3ZU7A 2BAQA 3MN3A 3CC6A 3IQ7A 5AV4A 2XEZA 4CNHA 3DLSA 1XMLA 3OVVA 3OC1A 2ITQA 3BHHA 3EQPA 4GW8A 4XHKB 3CCNA 5L2IA 3CSVA 4DFXE 3MDYA 2EWAA 3F9NA 5CSXA 4GCJA 5CASA 1XBCA 4DAWA 2IZSA 5KMIA 2WMVA 5E8YA 3ZFXA 1G8SA 5IQHA 1IASA 2X2KA 3PJ2A 4DE4A 1T46A 4BCMA 4L46A 4DFBA 2YIQA 1H1SA 2VU3A 3BU5A 4GMYA 1Q5KA 1LEZA 2PL0A 3LFFA 3BWFA 3WE8A 4FODA 3DNEA 3MFRA 1M52A 3QTWA 4GFMA 3PVBA 2QKWB 3PA3A 3UTOA 4JNWA 2IVUA 3NYXA 4EC9A 3ODYX 4XG7A 2OJIA 4IDVA 4NJ3A 2QOBA 4EHVA 5HVJA 4FMQA 3BHVA 4LFIA 4PQNA 3DBEA 3FKNA 4B8MA 3TNQB 5IUIA 3KCKA 3KRWA 4FVPA 1SVHA 4K11A 4X3FA 4E5BA 1DM2A 5KMOA 3ML1A 4I0SA 5C4LA 2E2BA 3FMKA 3KRJA 4HNFA 5CAQA 3RPYA 1Q8WA 2GMXA 5HQ0A 3V51A 4PV0A 4M84A 3H4JA 2PTKA 1ZXEA 4GUBA 4S30A 4ZSJA 3UVPA 4LGHA 5B2LA 3R9RA 2YM5A 3GOPA 3R1YA 3GQIA 1PYXA 4M12A 2VTAA 4FIHA 5HTBA 3O5AA 3OZ6A 1YRPA 4B0GA 5L8KA 2VTOA 5HTCA 5IH6A 4ZTMA 4JIAA 2P55A 5ANOA 3GUBA 1OIQA 1JSTA 3ENMA 3MY1A 5C4KA 2RFNA 4RJ4A 4XNEA 3AQVA 2PUIA 4FTMA 3KRXA 5M4FA 5ANKA 3CLYA 3VNTA 1ZMUA 2E9UA 2QO7A 3OXIA 2I0VA 3BQRA 3PIXA 5FXSA 1IRKA 3O23A 4I93A 2UW3A 3PXKA 5AP3A 4YU2A 4HCUA 2WELA 5GZ8A 5KMNA 4MXXA 2RF9A 5EM6A 4BDHA 4AZVA 3UIMA 2H34A 3ENHA 3G90X 3L9NA 3OMVA 4QYYA 2C6EA 3DNDA 4MCVA 5EFQA 5K0KA 4D4SA 2I0EA 4UMRA 1Y91A 2R5TA 3C5UA 3R02A 3NEWA 1YVJA 4FZ6A 3VS5A 2XJ0A 4AW0A 3WZUA 4C3FA 3FDNA 3AKLA 5ANEA 2XKDA 1WMKA 3D5VA 5I9WA 2R7IA 4FG7A 3HA8A 3CKWA 1XH7A 3P4KA 3B2TA 5IPJA 5JT2A 3ZC5A 4L3JA 5D7VA 1YWRA 4Y83A 5CENA 4DEAA 3KF7A 4MXZA 4EOPA 3SRVB 4G34A 3DGKA 1OL5A 3ZBFA 1Z9XA 2YABA 4JI9A 3NUSA 3QTZA 3WOWA 3KN5A 2W1CA 2YA9A 1E1XA 3MBLA 5EDPA 2BRNA 5CEQA 1J1BA 4AT5A 3FHRA 1CM8A 2RL5A 4FSNA 4R8QA 2XBJA 3O96A 4HVHA 3Q60A 2JIUA 1REKA 3ROYA 4AZSA 4P5QA 4A9TA 3PE2A 4K1BA 2ITOA 3W0NA 4AQKA 4HZSA 1P14A 3C4ZA 5C8MA 4LUEA 1Y6BA 5D7AA 2W1GA 3PVWA 2HXQA 2X39A 5DEWA 4C4GA 3PE1A 3PA5A 4BTKA 4CG9A 3FY0A 3JVSA 1OKYA 3U4WA 4YHJA 3ZO2A 4CTCA 1UU8A 3JXWA 3QX2A 4PP9A 3LVPA 4EOLA 3O51A 5E1SA 5D12A 2PYWA 3BYSA 3HKOA 3AD4A 3FC2A 4O38A 4FEXA 4ORKA 5HG9A 4XH6A 3II5A 4JQEA 3JY9A 4CKRA 2ZB1A 3R9DA 4DT8A 4LUDA 4G9CA 3NUXA 4GT5A 1U4DA 2XK7A 2YERA 3GFWA 3D2KA 4M13A 3ORIA 4EH3A 4EOKA 3LQ3A 4O0YA 4O4EA 4I6BA 1YI6A 2HY0A 5IG1A 5AIRA 3RP9A 3OHTA 4DG2E 3R21A 4IC7A 2E9OA 1TQMA 1GZKA 4QT1A 1URCA 4DYMA 3Q53A 5KCVA 4DHIB 1QPJA 1WBVA 2RG6A 3MVJA 3UQGA 1IAJA 4BFMA 3ATTA 1PKDA 3PZHA 4QYFA 5EM5A 4D2RA 1M2RA 3O0GA 3QYWA 2IG7A 4FZDB 5E8UA 4FTOA 3U9CA 2AYPA 3L1SA 5E91A 2PVHA 3LMHA 4IB0A 4AQCA 3G6GA 5DI1A 3ALOA 3TKUA 3PJ3A 3TKHA 4WNKA 2C6LA 4XMOA 1ZYCA 3EFJA 4J95A 4V05A 3GCVA 1KSWA 4XJ0A 1ZMVA 3WIKA 4FTNA 4JOAA 4QMTA 1GAGA 4L44A 4F6SA 3PWDA 4ACHA 4D5HA 5KUPA 1H0VA 3BE9A 3C9WA 3ZHPC 3P7CA 3H30A 4KKGA 3CXWA 1UU3A 5FD2A 1PMUA 2JDRA 2YDJA 4IM0A 2GNFA 2VGOA 3T9TA 1Q99A 3OCTA 3WYYA 4BZOA 5KMJA 5EQYA 1YDSE 2GCDA 3LCTA 3ZSIA 3A60A 3GP0A 4DGMA 3MB6A 4BDBA 3QKMA 2WNTA 4MXCA 5EK7A 4IDTA 4L7FA 3AMYA 3F7ZA 2ZM3A 4WSYA 2W96B 3IS5A 4ZY4A 1IAHA 2XAMA 4FTIA 2PVYA 1OBDA 2A4LA 1Q97A 3NIEA 4ASEA 4RFMA 4KD1A 4QMQA 5L2TA 4DBXA 5IQBA 5CNOA 5EDRA 4JX3A 1HCKA 4M15A 5EYDA 3OTVA 1WBOA 4UX9A 4FG8A 3OD6X 4MF1A 4UYNA 5AP1A 2PUPA 4ANNA 1J91A 5BV3A 4E6DA 3TV4A 3CY2A 4NFMA 3OEZA 3AKKA 2Z02A 2P3GX 3Q9XA 1OI9A 3W18A 2JKOA 4ZMFA 2HZNA 1STCE 3BV3A 5JQ8A 3BHUA 5L2SA 2OGVA 4LMNA 4KABA 4HVIA 4CFWA 4O96A 3AGMA 2ZB0A 1P4FA 3JS2A 1B39A 2FSLX 4FKRA 4YBJA 5T3QA 4CEGA 5I9YA 4MQ1A 5BVOA 4C3RA 3UP2A 4WNMA 2W4OA 5M08A 3CTHA 3VVHA 4LI5A 3N4VA 1T45A 3VUTA 2J6MA 1Q24A 3QQLA 5ITAA 4IVBA 2ETMA 4G6OA 2QQ7A 2AC5A 2VWIA 3O71A 4I0TA 4JL9A 4QMMA 3WYXA 3ZBXA 2NNWB 3C0HA 5I5ZA 4FBXA 4MWIA 4BCHA 4E4NA 4O7SA 5ACBC 2XK6A 2WB8A 5HIDA 5C9CA 1DI9A 4ZS0A 1R1WA 2YFXA 5EYMA 4OW8A 5C03A 3OOGA 5JMSA 3P0MA 4AFJA 3BRBA 4FTQA 4X2FA 2CKPA 3NNWA 2WGJA 2WTWA 4MF0A 4J71A 3DZQA 2ONLC 3DAKA 3A4PA 3QFVA 1PHKA 3PTGA 3QD4A 4QMPA 3FLZA 5AP4A 1P4OA 2UZLA 4PPAA 4BIEA 5K9IA 5LVPA 4EUTA 5KNJA 5L2WA 3RINA 4R7IA 5CX9A 5J9YA 3HECA 4OT6A 3TZ7A 3BV2A 3KMWA 3ZFMA 1UWHA 4DFZE 3HV7A 5AFVA 5EQPA 3R2BA 1PXMA 4QD6A 4QYGA 1Q4LA 2KTYA 1B6CB 3DDPA 3ORXA 2FSOX 3ZZWA 2UW9A 4A9SA 4EH5A 5AADA 3DKCA 3QQUA 4TTHB 3K3JA 1H28A 4FRFA 3S0OA 2IW8A 5HE2A 3A2CA 3WZDA 4QYEA 4TNDA 5E8SA 4XRLA 2WTJA 3QTUA 2JBOA 5DHJA 3QF9A 4O0RA 4Q9SA 2QOCA 1ZYDA 3ZS5A 3ATSA 2E9PA 1PXLA 3SOAA 2QODA 4QMNA 4IIRA 3GC0A 2P0CA 4A07A 4BIDA 5IA1A 4DEEA 3VBQA 1UWJA 4FTTA 5J5SA 3KMMA 2WMSA 4BC6A 4NM3A 2F7EE 3W2SA 3AXWA 4JDJA 4UMTA 1FMKA 2XUUA 1JSVA 4QP1A 1WVWA 5HIBA 5KE0A 5DNRA 3EQBA 4QDEA 3COIA 2ITTA 4NH1A 4FKUA 4I6HA 3ZEPA 3PPZA 3ZUVA 3VS6A 5L8LA 3DZOA 4DF3A 4JXFA 4QMZA 2QLUA 1A9UA 2BDFA 4DN5A 1TFFA 5KMLA 4FG9A 4FV5A 3S95A 1CKJA 4EL9A 1PJKA 2J2IB 3FMJA 4FKOA 4MKCA 5C1QB 4UBAA 3FMNA 3DY7A 2QG5A 1UKIA 4J53A 4KKEA 3MGYA 3OW3A 4C4IA 2PZRA 4FKGA 3AMBA 2XNBA 4PTCA 3IO7A 4WNOA 2EXCX 1P2AA 4O0XA 3VS0A 3DTWA 4DG0E 4F70A 3KXHA 5FGKA 1IR3A 4JX7A 3AD6A 4ITJA 3JY0A 1OPLA 3FZTA 3PXQA 4UWBA 3BCEA 5KHWA 3KXZA 2W7XA 4DG3E 5CEPA 1YKRA 3ZXTA 1CTPE 4ERWA 1XKKA 1VR2A 4ITIA 2R3PA 5EM7A 2B53A 5DR6A 4BCPA 2W4JA 4GVAA 1YI3A 4JT3A 4B8LA 3QXPA 3LXKA 5BUJA 3CD3A 2C5OA 3FYKX 4PNKA 3MPAA 1ZY5A 4K9YA 3H3CA 4RWIA 3DU8A 1DS5A 2E9NA 2YITA 4I20A 5H8BA 5LMBA 5M57A 4YJNA 3UPZA 5CF6A 3NMUF 5DN3A 5HCXA 3BU6A 3DTCA 4MXAA 4X3FC 5TKDA 5JH6A 2WIHA 5CXHA 2YEXA 3PJ1A 1FMOE 2WQOA 1ZOEA 2W4KA 1V0PA 4PUZA 2BROA 5GZ9A 4FYNA 3CY3A 4APCA 5FG8A 2BTSA 3QD0A 2YM4A 3V8SA 1VLRA 3FXZA 3UIBA 4OTIA 4DGOA 3GCQA 1PMVA 3DBFA 2VN9A 4GS6A 4NJDA 2X7GA 1A06A 2QOKA 4LV8A 4NM7A 3FC1X 2QG7A 3NVKI 4FTAA 4N6YA 1HCLA 3D2IA 4OTFA 5HD7A 2ZV9A 5KMKA 3E7VA 2V7AA 4GRBA 4EHZA 2GHLA 2XK8A 3DKGA 3VS1A 2VTLA 4GIHA 1Q61A 2ZVAA 3W0QA 4MK0A 4CFFA 2QOOA 3OUKA 4I5PA 5AA8A 4TYJA 4LOOA 4QNAA 5LVNA 3CGFA 5L3AA 1OVEA 4GK4A 4ZJJA 2WOTA 3O7LD 4NUSA 2A98A 4R1VA 5KBQA 3EN5A 4L3PA 5A6NA 1S9JA 4JRVA 3U87A 5IISA 4FKLA 4QMLA 3R30A 5CU2A 4EUUA 4BVUA 2BILB 5L6OA 5E8ZA 1OKWA 3QXOA 5FTOA 2YACA 4JG8A 4K8AA 2PWLA 4FKIA 3DBCA 4JQ8A 2UZEA 2WTDA 1FVVA 2X9FA 3R73A 4CV9A 4TWOA 3PG3A 4UZDA 5DA3A 5FLFA 3IW6A 5I3OA 2R3NA 4FL3A 4IQ6A 4X3FB 2GQSA 3CE3A 4S31A 5AA9A 4J7BA 2JFLA 3O50A 3QQJA 3TNPC 3ZYAA 3EN7A 2V7OA 3EMGA 2PMLX 5T68A 2XIRA 4EJ7A 4IFGA 4J8MA 5K5NA 2OI4X 3LPBA 3QHRA 3F5PA 3Q96A 2WQMA 4EBVA 3AT2A 1OIRA 3RPOA 3KQ7A 3MA6A 1PXIA 1ND4A 2BMCA 5GJGA 5K0XA 1U5QA 4DEDA 2WKMA 5FP5A 5C26A 2WQNA 5IMXA 4LQMA 5GZAA 1MP8A 3A7IA 3OUNB 4RVTA 3UOLA 3P7BA 3U8WA 4GKIA 2CJMA