5C27A

Crystal structure of syk in complex with compound 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
272
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 90
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c27A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c27A01
2I40A 4RJ3A 4F9CA 4ZJIA 4FV8A 4IW0A 5JK3A 1I44A 2B55A 3DLZA 2XF0A 4O2PA 4V0GA 3TG1A 3R9DA 4F0GA 5CNNA 1CKPA 2C6MA 3HYHA 3Q4TA 4RMZA 4O1OA 2RFEA 2JKQA 2BVAA 4OR5A 4MD8E 5DGZA 1G5SA 5CEKA 1OL7A 1GY3A 4WBOA 3EIDA 5F94A 3VF8A 5IQDA 2BIYA 3OCBA 5HE1A 3VRZA 1R39A 3AMBA 3RNIA 4HW7A 4E5AX 1FOTA 2VWVA 5FWKK 4RC2A 4KD1A 3MS9A 4Y8DA 4EOOA 5BNJA 3FLYA 1J3HA 1YXXA 3FBVA 3JS2A 4IX3A 4U5JA 2VTJA 5EYMA 4F70A 4CFMA 4NFNA 3WOWA 3HRBA 4RVMA 5LQFA 5IA5A 4CNHA 3ACJA 3IW6A 4FSQA 4XBUA 1WVXA 2GSFA 2XYNA 4W4WA 2W06A 1ZOEA 4OTDA 3IO7A 4TY1A 4WUAA 4D2WA 3LQ3A 1YW2A 4U80A 4U9AA 2XJ1A 4XYFA 4C0TA 3EQGA 3QAME 3BYSA 5GJDA 4BBEA 3P7CA 4N4SA 4DHFA 3ZYAA 3VS6A 4FGRA 2YDIA 2WQOA 2JDSA 2J0JA 4EH7A 2V22A 3KN5A 4R7HA 3C4EA 2IO6A 3FLNC 3HX4A 5DLSA 4GG7A 3RPVA 5CSVA 5E8ZA 2GQGA 2JDRA 3M11A 3QZGA 4KUJA 1ZAOA 4BKZA 3TDVA 3UMXA 5AADA 4NT4A 4BYJA 2QLUA 4R8QA 3FHIA 4N70A 3SAYA 4EKLA 5FXRA 3R02A 4FV9A 4AACA 1I09A 4ZTLA 5K4IA 4E26A 3C4WA 4WO5A 2UW4A 2YJSA 4MNFA 4O1PA 5HO8A 5CENA 1DS5A 5AUWA 4BCPA 4YPSA 5AP5A 5BVWA 3FZSA 3QWJA 3WZEA 4Z16A 3E8EA 1O6KA 4EH8A 5KX8A 2PZRA 2J0MB 4MX9A 3OBGA 3OY3A 3QKMA 1H26A 4E5BA 3OT3A 4QYFA 3PSBA 5DMZA 1CKIA 4K9YA 3QCYA 5BQ0A 2XK7A 2W1FA 2XIKA 3PWDA 3P0MA 3UGCA 3UIMA 4RX9A 3UQGA 2IW9A 3DNEA 3BYMA 4DGLC 3ORLA 4AF3A 3F3VA 2BROA 4DFYA 5I4NA 2PVHA 5JZJA 2R9SA 3SW7A 4RWIA 3C7QA 4A07A 2WPAA 4WBBB 2ITPA 3NUUA 4OBQA 2X4ZA 1OKWA 3LCSA 1MUOA 1ZRZA 3HMNA 3NW6A 3QTWA 3C4ZA 4YBJA 1JSTA 3O2MA 4BDFA 2Y6MA 1IR3A 2XNMA 4M97A 2YM4A 3QTSA 4L45A 3I6UA 5EQPA 3LHJA 3H9OA 2R4BA 3PSDA 4QP6A 5JN2A 4BDJA 3LMIA 3A7GA 3VULA 2OIBA 2BHEA 4CT2A 2H96A 4EORA 1FQ1B 3FZTA 4C57A 4MEDA 5JGDA 4YHJA 2IZUA 4DINA 2IG7A 5AV1A 2XVDA 2JDVA 3BEGA 3TXOA 1OBDA 2GCDA 2B9FA 4ZXTA 3PXYA 4DITA 2XCHA 2HIWA 5EM6A 4MNEB 4Z7HA 2OFVA 2JIUA 3E7OA 4P7EA 2ITUA 4H1MA 4KAOA 5D11A 4X3FC 5D7AA 5FXQA 5IU2A 5IEXA 4M14A 5IMEA 4BN1A 5AR3A 1OIQA 1ZMWA 4TW9A 2PUUA 3F61A 4ZTSA 2WNTA 4EOQA 3DZOA 3RK5A 2DUVA 4J52A 4O0VA 3R00A 3P7BA 1KV2A 1UV5A 2GU8A 4FYOA 4TYHA 4C62A 4NKSA 5CSPA 3R7GA 3AQVA 4HPUE 2ZDTA 1F5QA 3ZFYA 3DBQA 4BIEA 5ANIA 1BI8A 2XKFA 1OL1A 2HW6A 3ZO4A 1Q8UA 2QOIA 4ACMA 2GTMA 4DH7A 4FKTA 5D9HA 3FY0A 2X6DA 4IM0A 3DK6A 3TEIA 4R7BA 4X21A 4UMUA 4GJ2A 3REPA 3OZ6A 3HUCA 3CS9A 4MWHA 5F20A 5HNGA 3OW4A 3DBDA 2ESMA 2Z02A 3NW5A 3PVGA 4D4VA 2OU7A 2LGCA 5TR6A 3FPQA 5I9WA 4EQUA 4C4GA 3QTIA 4ZLZA 3JXWA 5JT2A 4R5SA 4R78A 4DTBA 1NY3A 1NA7A 3GU8A 2UV2A 3P23A 3PWYA 3SDJA 3SV0A 1AQ1A 1IA8A 2XKDA 4IQ6A 4L01A 4USDA 2BILB 3FL4A 4V0GB 4D0WA 2GMXA 4KSQA 5HBHA 3SHEA 3L8SA 4E4LA 4EJ7A 1ZMUA 3BLRA 3CE3A 2PYWA 4NEUA 2JIIA 4IHPA 2GQSA 1KWPA 1P4FA 3NPCA 5EI6A 2E9VA 5DT0A 5L8LA 3QRKA 3TI1A 4RRVA 1JSUA 3VBTA 3UQFA 3PY3A 4RFZA 3PJ1A 5J7HA 5AAFA 3Q4ZA 3ZC6A 3F2AA 4DCAA 5CQUA 3TNWA 4C38A 3VJOA 5ANDA 4O6LA 3AGLA 3OBJA 3F3UA 4UZDA 3RZBA 4YTCA 3UQCA 2R3IA 2OW3A 3BE9A 2XCKA 3FLZA 4FTRA 4TXCA 5IISA 1QMZA 3VBYA 3ZSGA 4GS6A 2C6LA 4GIIA 2P3GX 3R22A 3P4KA 1K9AA 5KNJA 5FDPA 5EDPA 4XOZA 3ZDUA 3EQHA 3RBWA 4YZDA 4A06A 4A9SA 3R9OA 1CKJA 3P7AA 2YIRA 3EQBA 2YM5A 5JKGA 1H28A 3ANRA 4GFGA 5I9UA 2BKKA 1XR1A 4ZP5A 1PXMA 2IJMA 3GVUA 3Q53A 3QTQA 2J0IA 3NSZA 5I9XA 4UX9A 3TZ7A 3V8SA 5B2MA 1REJA 4AT3A 1BI7A 4CG8A 3QRJA 3JVRA 4IADA 2IW6A 3QZIA 4BDHA 5AAGA 1M2RA 2JC6A 4CT1A 4MQ2A 5CX9A 4AW1A 2VGOA 3JY0A 2W7XA 4FSYA 1GAGA 5AM6A 1E9HA 1GOLA 2XB7A 4XNEA 5JFWA 3ZFMA 2C3KA 3RPRA 3ELJA 5BMSA 3LFNA 5AV4A 3O17A 2CHLA 2IZTA 3KRLA 2JBOA 4Y46A 1U46A 3R0TA 4F9BA 3FMJA 3M2WA 3DK7A 4DLIA 4Z7GA 4QP7A 1BYGA 4WSQA 3IPHA 4NTTA 2PE0A 3OEZA 4TYHB 3H9RA 5LVOA 3UMWA 4FTTA 4EOLA 1STCE 4K18A 4IZ7A 4UZHA 5AP1A 2VRXA 1ZOGA 4KKEA 2VWBA 4BI2A 3A8WA 3POOA 4ZZNA 4J8NA 2ONLA 4JQEA 4DGOA 4LGHA 3EL8A 2VWIA 4DYMA 4KNBA 2BFYA 3E3BX 3O8UA 4O0WA 1M7NA 2YCSA 3BYUA 4IVCA 1JPAA 4PP9A 3FEGA 4AZVA 3Q4CA 3W2PA 3FWQA 4JT3A 1FPUA 5EW9A 4QT1A 2WTWA 3AC1A 1NVRA 5L8JA 1YHVA 2QOLA 3KF4A 4L42A 4MF0A 5CEIA 3RALA 5EKOA 4BWXA 2I7QA 2HWPA 4UEUA 3HMIA 4YBKA 5AV0A 4FL3A 4FKOA 2IN6A 4ZSGA 4AGDA 1Y57A 3KRRA 5HI2A 4EHVA 2VWUA 1IAHA 4PDOA 3GENA 3TM0A 3T3VA 5IG1A 3CPBA 3ZLSA 4BKJA 4AQCA 3CY2A 5CU0A 4D1ZA 1PXOA 4CZYB 4TTHB 2WMXA 3QU0A 3NWWA 5AP6A 3I5NA 4J1RA 4M15A 3KK8A 5AIRA 5EQYA 3NCZA 3KKVA 4RC4A 4S34A 3ZRKA 5I0BA 3AXWA 2Q83A 3IDBA 1PXKA 2WMBA 1Q62A 2C5NA 3NGAA 4AA0A 5ICPA 3NUSA 5CU4A 5CANA 4C59A 4IANA 1W98A 4XCUA 4FTIA 2OG8A 4O7NA 2R7BA 5KMOA 3PDTA 4XG2A 4BDIA 4GT5A 3V04A 5K9IA 2R3FA 5HTBA 3WE8A 1YXUA 3L9MA 2YLEA 4MXYA 2C5YA 4FZAB 1W0XC 5HESA 3T3UA 4DG3E 4EHEA 4J8MA 5C8NA 3BV3A 5HORA 3BHYA 1H07A 1YQJA 2IWIA 4I94A 4WG3A 4QD6A 4A4OA 3OXZA 2X9EA 4BZDA 4O7ZA 1AGWA 3I7CA 4KIOA 4PTCA 3BRBA 4PPCA 3A61A 2ETRA 5EYKA 2WEVA 4L6QA 2JGZA 2OH4A 3KRJA 3KXNA 3FQSA 2W4OA 5EG3A 3GC9A 4PMPA 4FNWA 3BI6A 4GRBA 3G9NA 4FICA 4LG4A 1BKXA 2R64A 5HBEA 4A7CA 2C0OA 3OW3A 4L00A 4F64A 5AJQA 4KIQA 3CTJA 4W8EA 3U9CA 5TO8A 3MVJA 3WYYA 1RDQE 3QQKA 2QQ7A 4GK3A 3OP5A 3H3CA 2OZAB 3W2OA 5ETAA 1YKRA 5FD2A 5LARA 4ZJVA 3R1NA 4X3FB 4QMLA 3EB0A 4EQCA 3BU6A 4NK9A 4CRLA 4TL0A 4KRCA 2BKZA 2E9OA 1B6CB 3A99A 4JIAA 2QOHA 3FI3A 5HQ0A 3OOMA 3ZZEA 3Q60A 4D2VA 1PXIA 4U44A 2C5XA 3E3PA 1PXNA 5A4QA 4ZK5A 2VTOA 3D5UA 2W05A 2ERZE 3C5IA 2IZSA 4I41A 1U59A 4O38A 2WMUA 3BGZA 3TNPC 3HA6A 1WAKA 1TQPA 2O63A 4DE4A 1Y8GA 2JAVA 3MB7A 4FSUA 2P2HA 4KIKA 1JQHA 1UU7A 4EZ3A 3HDNA 1ZYLA 2HY81 2AUHA 4J7BA 3R8PA 4O2ZA 1BL6A 2YABA 5HD7A 3MTFA 3MVHA 5E1EA 4FT0A 4QTEA 3HMPA 3ZEPA 4E1ZA 3ORPA 3FXZA 3BWFA 5ETCA 2Y4PA 3CGOA 3F3ZA 2F49A 1OL5A 4JJRA 3NYVA 5BPYA 3HVCA 4FNYA 2PU8A 4FV3A 2WIPA 4Y85A 5CI7A 4ORKA 5CZIA 3PY1A 5BUJA 3GBZA 5CU3A 2PL0A 4EK4A 4ITHA 4JOAA 4L9IA 3ZEWA 4BZNA 1Q99A 4I1ZA 4XG7A 1R0EA 3WZJA 3QCSA 3ZC5A 2UZWE 5KHWA 1AD5A 4KKGA 4QPAA 3TNQB 3UOKA 4BHNA 2UZUE 3LCDA 4FKSA 3WBLA 4CV9A 3DPKA 1H01A 3MESA 4CD0A 5CXHA 2X7FA 2FYSA 5M55A 5EQEA 5KKRB 5DRBA 2FSLX 3NR9A 4YJQA 1LR4A 3NNVA 3IW7A 4G3CA 4IH8A 3LFQA 1JKKA 4MK0A 3RCJA 3WILA 2XRUA 5CSXA 2W99B 2WTKB 4O0SA 3PPJA 1UA2A 3POZA 2YWVA 4CFNA 4RJ7A 4DG2E 5M08A 4IB3A 4RX8A 4EK5A 5DBXA 4FKJA 1M7QA 1PRYA 4XOYA 3AD4A 1MQ4A 2EB3A 3FXWA 5CS6A 4UYAA 4ZS0A 5I9YA 4QPSA 4W4YA 3EWHA 4NM3A 3G9LX 3GOKA 2O3PA 2R3JA 3K2LA 5ANKA 2QCSA 3OVVA 1IASA 3GU6A 3DFAA 4BF2A 4TYEA 4QTAA 1CTPE 3JUHA 4DEAA 4HVIA 5IF1A 1O6YA 3DFCB 4R1VA 2OZOA 5DEYA 4EI4A 3HAMA 4MCVA 2GPHA 1OPLA 2BMCA 4ZTQA 4EWHA 2Z7RA 5KO1A 1TQMA 4ANOA 3O96A 3HV3A 2PUNA 4FOCA 4AT5A 4HJOA 5JFSA 1P2AA 2FSMX 2WU7A 3DV3A 3ULZA 4C02A 4X2FA 4CKJA 3L1SA 3FKLA 4TYGA 4E3CA 3SLSA 4ANSA 4FKWA 1ND4A 3NUXA 2XRWA 2WZJA 3RP9A 5C8KA 3CY3A 3LJ2A 5AR8A 3RHKA 2C47A 4YZ9A 4CCUA 2RL5A 2Y8OA 3LFBA 1CDKA 3MY0A 4ZSEA 3QQHA 1U5QA 4O82A 4ENXA 3BKBA 4ZY5A 4IAKA 2XKEA 1IRKA 1H4LA 4RIXA 4CTCA 5M07A 2OJ9A 5IQBA 1KE9A 5HIBA 3N9XA 3UZPA 3LIJA 2C5VA 3IONA 5AUVA 3FZ1A 5IH5A 4W9WA 3FHRA 3ZLWA 5JEBA 4R7IA 3L8VA 4YLLA 3VNTA 1H8FA 2HXQA 5J5SA 1KE8A 4CFVA 4RWKA 4IACA 2OBJA 4JX7A 4DEGA 3LFCA 4LRJA 4D9UA 4EYJA 2UZLA 3KCKA 2F57A 3AG9A 2EXEA 3FI2A 4KBCA 1E1VA 4XLIA 4UALA 1BX6A 5DPVA 4AW2A 4KIKB 3SC1A 2UW8A 4TKSA 4DGMA 3V3VA 4UMRA 3Q9XA 3LLTA 4I21A 3WF7A 4BDDA 3HGKA 2F2UA 4LOPA 3E88A 2XUUA 4AFEA 3KL8A 2HZ0A 3NEWA 4X2JA 3COKA 5HIDA 3EOCA 3HZTA 4QP9A 2O8YA 5J95A 3QTRA 2HZNA 5CVGA 4JBPA 4G16A 4PMSA 1ZYCA 5AUZA 3EN7A 4HVSA 5IQGA 4WT6A 2OXYA 5FTQA 1H1WA 1R0PA 3ODZX 1OKYA 4FIIA 5CI6A 4ZSAA 5DR2A 1WMKA 3COHA 3EH9A 5H8EA 5JMSA 5CVHA 2ZV8A 4ZLOA 4U40A 4R77A 3OHTA 4G9CA 3ZXZA 1OIRA 4R3RA 4ASXA 3PZEA 4O7WA 1PKDA 3OUKA 1DI8A 2OF4A 4EHZA 4F63A 3KEXA 2ZYBA 4L3PA 3MGYA 1J91A 5CT7A 5HCXA 5A4TA 1ZZLA 4HCUA 1UU9A 3LCTA 3ENMA 2WOUA 4JS8A 2Q0NA 4IIRA 4BZOA 2EUFB 2A19B 4RX7A 4Y95A 2YIYA 4LGGA 2ONLC 3QUDA 4O0TA 4D28A 5LMKC 3CTQA 2VX0A 3HP5A 4FV4A 4ZIMA 4ARKA 2KULA 2ZAZA 4O0YA 4EH5A 4EH2A 2Q0BA 5DOSA 5G1XA 3S3IA 3SW4A 3EYHA 2YIQA 4RZWA 1MRUA 4BDBA 5C1QB 4DCEA 3P9JA 3BQRA 4OUCA 2GFSA 4AZFA 2YHVA 3D5VA 3Q9YA 4YHTA 4OT5A 4WSYA 4ZS4A 3VHKA 4USFA 5ANEA 3F2RA 2B9IA 3QYZA 3VVHA 1XH5A 3DAEA 4U8ZA 3SRVA 4ASZA 4I5MA 2NPQA 2P33A 3Q9WA 4X6QC 4L53A 4DAWA 4GKIA 3AOXA 2PTKA 2QVSE 3SX9A 2JFLA 4CXAA 3ZM4A 3BEAA 4FVQA 4OAUC 3BHVA 2X4FA 3KY2A 4AP7A 2WMQA 4LGDA 3G5DA 4RVTA 5LMKA 5EW3A 2YN8A 4PQNA 2JD5A 4I4EA 5M4FA 5BYLA 4G6LA 3HNGA 3ZM9A 3HV5A 1E1XA 2ITQA 1GZ8A 3R21A 2WGJA 4I6FA 5DR6A 5JFVA 2R3MA 3QZFA 3PPZA 3QLFA 5KZIA 1R78A 5KMNA 3DZQA 5HO6A 4EOKA 1UNGA 3MI9A 4TNBA 3GXLA 5GNKA 3O23A 4GEOA 4AN3A 3PJ8A 4D4SA 2BTSA 1YOMA 5CVFA 1XBCA 5L6WL 3R8MA 1A06A 3EQPA 4C4EA 2OSCA 3LQ8A 5ACKA 4FTJA 3E63A 5CLPA 4RG0A 2W4JA 3MFRA 4Q2AA 3V6SA 1XBBA 3UPXA 2AYPA 5DT4A 3A4PA 3DXPA 3VS4A 2BRNA 4FKUA 1J1BA 2Z7QA 4BYIA 4QP8A 2C0TA 2WEIA 3ZFXA 4EC8A 2WAJA 2XNGA 3VS3A 2WTVA 2B53A 3OOGA 5HLPA 3QQFA 4O7SA 4I92A 3EN6A 4PPAA 5HBJA 4H39A 3RAHA 4ID7A 5CU2A 3JY9A 5CASA 3R7OA 2Z2WA 4BCKA 4KINA 3PXFA 5G6VA 3QTUA 3B2WA 5GZ9A 4B9DA 1OZ1A 5D7VA 3W33A 4JBQA 2FUMA 2UZNA 5B7VA 4IB1A 4RIYA 5KBQA 5J9LA 2ERKA 3KXXA 3RAIA 4AGCA 2BPMA 2XK9A 5AUYA 1H0WA 3G0FA 3QD0A 4ITIA 3UVQA 4F7NA 2BHHA 4IFCA 4XG4A 3DNDA 4KKHA 2GHMA 4QNAA 5AP2A 5KE0A 2HELA 3VF9A 4UN0C 5AA9A 5TF9A 4EONA 1YDTE 4CLJA 3E93A 4JX3A 5TOZA 3GU7A 3KMMA 3OY1A 4HNFA 4ZOGA 3RK9A 3OT8A 4DGGA 4DFUA 3W16A 3WI6A 3EN9A 1U54A 3OCTA 2X8DA 4PP7A 3EZRA 5BVFA 1ZYSA 3ATTA 4FNXA 2XIRA 1Z5MA 4LMUA 5IDPA 4RGJA 3FSKA 2FGIA 3K3IA 4XBRA 3WF5A 4D5HA 5M57A 5CQWA 3SG8A 5HLWA 3OMVA 4YJPA 4UMQA 4C58A 3EL7A 2B7AA 1WCCA 1J7LA 3LFSA 5EW8A 3RM7A 3P1AA 4IC8A 2G15A 3GC8A 3QC9A 3QKKA 1K3AA 1J7UA 3GNIB 3RINA 3CPCA 3F5UA 2YM8A 1LP4A 3TIYA 3ZO2A 4H58A 3HRCA 3DKGA 3KK9A 2J4ZA 4AZTA 4YR8A 4FL2A 2J5FA 5L8KA 4AX8A 2HCKA 4QMZA 2W1HA 4OLIA 4IMYA 4TZRA 3KA0A 5CYIA 4QP4A 4QMNA 5DI1A 4JL9A 3OC1A 1W82A 2CGXA 4DH1A 2PHKA 3TN8A 2F4JA 4O21A 3MB6A 3TKUA 2VTNA 4L8MA 2VWWA 4O7LA 1H1RA 4AN9A 1TQIA 2X8IA 4E5WA 3GP0A 3E64A 3PTGA 4G3EA 3HMMA 5HD4A 3E8CA 1W7HA 3TACA 4JDIA 4ZSLA 4TPTA 1OIYA 5M53A 2GDOA 4ZMEA 3QA0A 4IZYA 5EH0A 4EBWA 5DN3A 5BMMA 3RHXA 1U5RA 1Q4LA 2C6IA 4KBAA 3ZSIA 1FGKA 1KE6A 2ZJWA 5FRIA 4G31A 4PF4A 3MH2A 3QA8A 4UWBA 3NYXA 4RSSA 4O7VA 5CT0A 3I6WA 1OI9A 5CY3A 1J7IA 4AOJA 4FEQA 3F7ZA 4N57A 5CEOA 3D7ZA 4ZLYA 5E8UA 4ZEGA 3ZUUA 2OWBA 4NUSA 3W8LA 4IDVA 2REIA 5DWRA 3PIZA 3D0EA 4HZRA 5GZAA 3TTJA 2WTIA 3GEQA 4JG8A 4EUTA 3CXWA 5HLNA 1WBSA 3IDPA 2ZM3A 4FUYA 4G6NA 4K0YA 3ZH8A 3UNKA 3DKOA 4U42A 3ZHPC 4EH3A 2WB8A 4MBJA 3CKXA 1G3NA 1OMWA 2X6EA 2OJGA 3KRXA 4YTFA 2ITYA 4FTMA 5LXMA 3D15A 2W1GA 3PXQA 4TYJA 4GU6A 3RNYA 5ANGA 4QQCA 4X2KA 4YP8A 2X9FA 3R9HA 3W8QA 2BRBA 4LI5A 3TTIA 3ID6C 5CZHA 1F0QA 3JYAA 5F1ZA 4E7WA 3UOJA 3N51A 4U45A 5JRQA 4GK2A 2W0JA 4Q9SA 4JBOA 4DTKA 1PMUA 3VUIA 2HXLA 3AC3A 3HECA 4Y83A 1FMKA 5E91A 3RWQA 2CGVA 5AR2A 2I0EA 2WMSA 1Q5KA 2Y4IB 5CWZA 4NTSA 3R8VA 1OIUA 4XV1A 4JAIA 4MWIA 2JITA 3QX4A 4A9TA 5J9YA 4G1WA 3V5PA 3ORNA 5L2IA 2ZDUA 3GT8A 2DWBA 1JBPE 4F9WA 1FBNA 3IOKA 4F1MA 3CD3A 5L6OA 2O0UA 1ZYJA 4Z55A 3FI8A 3VS0A 3NVMB 4G17A 3EKKA 1PHKA 3OCSA 1Q8YA 4J53A 4KS7A 3A7FA 3D83A 4WKQA 3V5TA 3TKHA 4BC6A 4I5CA 3HMOA 5DVRA 2VTIA 2SRCA 2YCFA 3HUBA 4CFFA 5K0XA 4L44A 2GHGA 1SZMA 2ITOA 3DBEA 4H1JA 4YC8A 3UNJA 4BFMA 2YWPA 3IW5A 3QHRA 4F6UA 3PJ2A 3OXTA 2J9MA 5E8VA 3R8ZA 4HCTA 5C9CA 4WRGA 4QNYA 4EK3A 5ANJA 2OK1A 2VWXA 4DBNA 3PIYA 3ACKA 2YM7A 1QL6A 4QMXA 3U51A 3DKCA 4F08A 5HKMA 3R9NA 2WU6A 2IPXA 1LPUA 3HV6A 3UODA 3ZOSA 3R7IA 1APME 4BWPA 3O8TA 4G5PA 4FTLA 4E4NA 2VGPA 1KOAA 4NIFB 4JRNA 2NRUA 2X39A 3BZ3A 3VUTA 4B8LA 1IEPA 4MXCA 3W1FA 4R3CA 1KSWA 3DA6A 3KULA 2XEZA 3O71A 4K6ZA 4ZTRA 3QQUA 5A4CA 4U79A 1QPDA 2CCHA 4AA5A 3C4FA 3FMLA 4JQ8A 5CAQA 1TVOA 4GW8A 4KBKA 4FTUA 1A9UA 1WVYA 3OXIA 4JG6A 1OUKA 3U6IA 5KMKA 4ACCA 2ETKA 2WQMA 4CCBA 4FSNA 4ZTMA 1OBGA 1YWNA 2QURA 1H1QA 4FTAA 4CKIA 3TZ8A 2QR7A 3QXPA 2VTTA 2PVLA 1XH4A 2C1BA 2IVTA 2BAJA 3VUHA 2UW9A 3ZO3A 3ZUVA 5CAVA 1GIJA 4IWPA 1H08A 2VZ6A 3TV4A 3V5QA 4JG7A 3H0YA 2QO9A 2R3GA 2IVUA 3LJ0A 4Y5HA 4BCJA 2VX3A 3ZONA 5J87A 5HG8A 3FMMA 4BGQA 5CF6A 1XHAA 2QD9A 3SG9A 4PMTA 4CZTA 2F9GA 5BUIA 3AD5A 4UMPA 4LUDA 4YJRA 5GJFA 3NLBA 5EOLA 4EOJA 3BPRA 4EZ5A 4R1YA 2GNGA 4GVAA 4MBIA 3AT2A 3WIGA 4DH8A 1H24A 3NYNA 3RMFA 3QD3A 4CVAA 4FG9A 4WNKA 5FEEA 4BR3A 4R5YA 3ORMA 3LJ1A 3KRWA 2VTSA 4YURA 5E8WA 3L9PA 2RFSA 1JVPP 3CSVA 3Q6UA 4G2FA 3P5KA 3TJCA 5AUXA 3DY7A 4FK6A 3RVGA 4J98A 2X2LA 4LMNA 3AMYA 4O6EA 5EFQA 4BDGA 2CKOA 5IUHA 3FLSA 4NM0A 5AAEA 5BVDA 1W83A 1YWRA 3VO3A 2EVAA 3VS7A 4FTQA 4K2RA 1UKHA 1OKVA 3PRIA 4U41A 3G6GA 4O86A 3UG1A 4ACGA 3R7VA 5AR7A 4UWCA 4AGWA 4FGBA 4PTEA 1JKLA 1BUHA 5E8YA 4C4FA 1ZXEA 3A4OX 4AE9A 4QMUA 1KV1A 3A7HA 3I0QA 3CC6A 4FKPA 4LRKA 2JIVA 5AV3A 4Y73A 3RJCA 1M52A 3HKOA 4HGLA 3KXMA 4BKYA 5L2WA 4CG9A 3PA3A 2WO6A 2XIXA 4CV8A 4C7TA 3PPKA 4X2NA 4OW8A 1OITA 4OTRA 3TT0A 5A6OA 3R83A 5AFVA 3PUPA 4IB0A 5EDQA 5IZFA 2C3IB 2W1IA 2WQEA 4JDHA 4K1BA 4FIFA 4G3DA 3ZZWA 4BDEA 3FZPA 4FTKA 4FZFB 4BHZA 3QC4A 3LOKA 3IECA 1DAYA 3EHAA 3THBA 4CTBA 3FKOA 3A7IA 1YI4A 2OJFE 4TT7A 4EQMA 1KOBA 1MP8A 1FMOE 2YAAA 2R7IA 1RW8A 4ERKA 3Q3BA 4M0YA 4ACHA 4PDPA 3DBCA 3RGFA 2R3LA 2X2MA 5L2SA 1GIHA 3DU8A 1FVVA 3E87A 3PXKA 5H3QA 1YWVA 2UW6A 3QF9A 4JAJA 4V05A 1PXJA 5J1WA 1GZNA 4BBFA 3TDWA 2YCQA 1Q61A 4CKRA 5ETIA 4C4JA 3DB6A 1A48A 3BX5A 5KHXA 1WZYA 1ZMVA 3KU2A 3MA6A 5HG5A 4OTHA 4G3GA 2XJ0A 4M84A 4RWJA 3F5PA 3PG1A 4XG6A 2YFXA 4ANNA 3BHTA 4PMMA 2P0CA 1ZOHA 2IVSA 3IDCA 4O91A 2YIXA 3PRFA 2O64A 2PVNA 2VTHA 3GCQA 4DEBA 2XK6A 3GQIA 5EDRA 5IEYA 2H6DA 1PYEA 3R1SA 5M4CA 1URWA 2AC5A 2WQBA 4ERWA 4XLVA 4L43A 4Q9ZA 3IG7A 1V0BA 2OJIA 3ZO1A 2YITA 5IQFA 4M69B 4IX6A 3QALE 1XJDA 4TWCA 4QQ5A 2PUPA 5HX6A 2RF9A 3R01A 4YLJA 4FG8A 5EHLA 5HCYA 3L8XA 1JOWB 3GI3A 1Y8YA 2OZAA 1UKIA 4KRDA 4FKVA 2XK3A 4EL9A 2EU9A 4ASEA 5FXSA 3PP1A 1XWSA 4YZCA 4IM2A 3CJFA 4TWPA 3TIZA 2BUJA 3U4UA 4XP2A 4RX5A 5K0KA 1EH4A 3TWJA 4L7FA 2J0KA 1SM2A 5LVNA 5C4LA 3G33A 5LJJA 3LKMA 3FKNA 2NO3A 3NCGA 4II5A 2G2FA 5M09A 4W9XA 2VTMA 3UBDA 4OAVB 2Y4IC 3UTOA 1ZY5A 4C61A 4USEA 1OGUA 2X0GA 4JRVA 4IVBA 4OTPA 4A9RA 4EYMA 3FSFA 5DHJA 4B0GA 4IJ9A 4L46A 4N6YA 3R71A 4GFMA 3O50A 4L3LA 1UNHA 4RLLA 2PVRA 3QUPA 3MJ1A 2W1EA 4FMQA 4XJ0A 3SQQA 4NL0A 1JWHA 3U8WA 2BRMA 3UIUA 3MYGA 1T45A 4AU8A 3MVLA 2JEDA 4U3YA 1BMKA 5HHWA 4BCMA 3K3JA 2B1PA 3I4BA 3C50A 4FSRA 3TUCA 4AW0A 2CGUA 3NUAA 4MXZA 3HLLA 3F9NA 2WIHA 3CP9A 3R73A 4ACDA 4ZY4A 4NYEA 2XIYA 4CFWA 4JXFA 4JQ7A 2XMYA 3ITZA 4P5QA 2X7GA 3HL7A 3RPYA 3HA8A 3BWJA 3AC8A 1G8SA 3SGCA 3ZSHA 4QQJA 5EK7A 3UG2A 2GQRA 4F7LA 2B4SB 5EM7A 2WMTA 3NDMA 3QRIA 3RWPA 2ETMA 4X7QA 2QNJA 3UP7A 2XA4A 3EQDA 4RFYA 3SOCA 4DLJA 3ZLYA 3FAAA 3JPVA 3R7UA 4ENYA 2VTQA 3SOAA 3VW6A 5B0XA 4V01A 4C4HA 1H27A 4F6SA 3KXZA 3QQLA 4O22A 1PYXA 2FSOX 3FYJX 2DQ7X 3DKFA 4WNPA 3P86A 5L4QA 4BIBA 4F1TA 5FDXA 5J8IA 2V7AA 5HNBA 3OG7A 2RG5A 3OS3A 2QODA 3NAYA 4NU1A 4UWYA 4HVHA 2W9FB 4ZTHA 2W17A 4QTCA 2CLQA 4BTKA 5I3RA 2J90A 3QLGA 4ANMA 5J9ZA 4WUNA 4F0IA 4PRJA 1W84A 4TYIA 3GUBA 3R63A 3R04A 4HYSA 2QKRA 3D2KA 1FVRA 3KFAA 3MW1A 1UU3A 2YCRA 3BCEA 4JIKA 5B2KA 2X7OA 3BU5A 3L9NA 4KWPA 1ZARA 2XM8A 3O51A 4GSBA 5CU6A 3VS2A 4V04A 2GFCA 2Z60A 4DT9A 2CKQA 4K77A 1ZWSA 4LOQA 3HDMA 3PFQA 4M69A 4D1XA 1GZOA 1O9UA 4F09A 5KMLA 3Q6WA 4HYUA 2H34A 1Y91A 2PK9A 4S2ZA 2J51A 3MPMA 3VBWA 5JZNA 5ANOA 3D7TA 5EI8A 4E8AA 3FPMA 4IAIA 4I20A 5BVOA 2WTJA 4MH7A 3QQJA 3M1SA 3B8QA 3R28A 4Y5QA 2WTKC 4FC0A 3U6JA 1DM2A 3TUBA 1V1KA 2W1ZA 4QYYA 2VU3A 2UZVA 4FT3A 4YJNA 2KTYA 4IEBA 1YHWA 5AR4A 2DS1A 1TKIA 3C9WA 3F69A 4FV2A 2PVFA 3GB2A 3I81A 4D9TA 2YLFA 3EJ1A 2QU6A 4E6AA 4E93A 2WOTA 3NUYA 4BICA 3NX8A 3HEGA 4ZY6A 3ROYA 1LEWA 1PF8A 2RGPA 2VTPA 4RIXB 5FP5A 4BI1A 2Y6OA 4QMYA 5E7RA 4WRSA 1NVSA 4FOBA 1BLXA 1VZOA 1OKZA 1JNKA 4LV5A 1ERKA 1NT2A 3VUGA 4WOVA 3OF0A 2PVMA 5EOBA 4IZ5A 2JAMA 4HPTE 3FC1X 2CPKE 2PVJA 4EUUA 2WTCA 5ACBC 2E9PA 3UE4A 3TCPA 5AP7A 5E8TA 3UJGA 3UC3A 2X8EA 2Z8CA 5AP3A 4ZJJA 1REKA 5H9BA 2WMWA 3ENHA 3CQWA 4BBMA 5HEZA 3NVKI 4YNEA 3VUDA 1R1WA 1OPJA 4JDKA 5DE2A 4AA4A 3ZBFA 5HX8A 1W8CA 2C6EA 1DAWA 5TKDA 4C4IA 3VQHA 3W55A 5CTPA 3OWJA 2PPQA 3TNIA 3FMKA 4FSWA 3GOPA 2UW5A 1VEBA 4BTMA 2G2HA 5BUEA 3KXHA 5HVJA 3QWKA 4PTGA 4F99A 5BVEA 5JFXA 1OVEA 1XH8A 4YNOA 3ZDIA 2QG5A 4G5JA 4ITJA 5DH3A 4HGSA 4C2WA 2YM6A 3FMDA 3QGWA 3O7LD 2R3OA 3DJ6A 4IBMA 3BGPA 3NUPA 4DEHA 5HVKA 1SVHA 4HCVA 1P14A 1VJYA 2ITZA 4IVDA 3KREA 3C1XA 4FG7A 3WARA 5I5ZA 2JFMA 2LAVA 5E9EA 3MFTA 4JNWA 4YTHA 5LVLA 2XBJA 3FZRA 3GFWA 3QTXA 3ETAA 4I23A 4IVAA 2J0LA 2OXXA 2BRGA 4AXAA 3A8XA 1GIIA 3BBTB 4W4VA 3QFVA 2NRYA 2OGVA 4IDTA 2QC6A 3GCPA 4B6LA 4IE9A 2UVXA 1UNLA 3IS5A 2QOBA 4F0FA 5HIEA 3S00A 1WBPA 5E4HA 3QQGA 5GHVA 3PJ3A 1L8TA 2V0DA 3F6XA 3UYTA 2PE1A 3Q2JA 2WMVA 1KE5A 4IAZA 2RG6A 4G3FA 4OBPA 4LV8A 5K4JA 1VR2A 3R6XA 2GNJA 3W2RA 4O0RA 2W1DA 2EWAA 2HY0A 2W4KA 5KCVA 3E7VA 4MD9E 3K5UA 4P4CA 5DFPA 4R6VA 3DAKA 5EYCA 5B2LA 3LFEA 1PMEA 5JSMA 2RIOA 1T46A 4YJUA 4OTWA 2G1TA 4CMUA 2O5KA 5CF4A 3B2TA 3NNXA 5M56A 3DTCA 2CMWA 3I5ZA 4PPBA 5H2UA 1Q3WA 2UZDA 2WQNA 3O8PA 3R1QA 3EQFA 4QYHA 3TNHA 3VWAA 4GUBA 3ORIA 2AC3A 5FLFA 2YZAA 3RAWA 3RM6A 3ZLXA 4IX5A 5IH4A 3ERKA 3FI4A 4FVRA 4HGEA 4CFXA 1JAMA 3GU5A 4F7SA 4HVDA 2HZ4A 4NFMA 1FINA 3R30A 4FTOA 4MKCA 1UVRA 2Y7JA 3R7EA 4YO6A 4K8AA 2VV9A 3GFEA 2R3NA 4BDCA 1XH6A 4PDYA 4P90A 5DIAA 1YHSA 5AUUA 5M4IA 1DI9A 4RZVA 1YXSA 4EZ7A 3LVPA 1B38A 2CSNA 4QMOA 4YZBA 3CBLA 2R3QA 4K11A 3Q5ZA 4AZEA 3U9NA 5HU3A 3L9LA 5LVPA 5AP0A 3PY0A 4U43A 3WF9A 2OO8X 5GIOE 4QTDA 2BZJA 4I6HA 2ZVAA 3V8TA 5A4EA 3RK7A 5LMBA 4RFMA 2VN9A 5EM5A 3DS6A 2R3PA 4FT7A 3EQIA 2VO0A 3QX2A 4MVFA 4BTFA 5HNIX 2EXCX 1Q8WA 3GC0A 3R7YA 4CZUA 3KF7A 2PY3A 4BCNA 3E8NA 4JR3A 4YGAA 1H1SA 4AAAA 3QD4A 3VQUA 4MNEA 3DXQA 3KVWA 2QO2A 2VUWA 4XEYA 2ITXA 3L8PA 4I5PA 3PZHA 3FLWA 3CGFA 4CYIA 5LWNA 1LEZA 4QP1A 4EJNA 1YDRE 5E1SA 5DT3A 5A46A 1G8AA 1S9IA 4R3PA 4FI1A 1LUFA 4RQKA 1XBAA 4YJVA 3S4QA 3ZUTA 5BYYA 3BQCA 4U7ZA 4QMPA 3NIEA 2PWLA 4YU2A 3BLHA 3DJ7A 3OWKA 2V5QA 4MQ1A 1ZY4A 5D10A 1H1PA 1QPCA 3SA0A 4UXQA 4FKIA 2YERA 5DEWA 1WBNA 5E8SA 5JQ8A 4PUZA 4Q5HA 1H0VA 3T9IA 2ZB0A 4UMTA 3E5AA 3BLQA 3VJNA 3LXLA 2YZLA 4AOTA 1U54B 2HYYA 2ITNA 1L3RE 3KCFA 1KE7A 4WG4A 3NMUF 4M0ZA 4O96A 2W5BA 2R2PA 5EM8A 1PJKA 4ANQA 2C3JA 4JR7A 5AP4A 3E8DA 1GJOA 2XNBA 1SVGA 5EI2A 2UZTA 3Q32A 3NS9A 3TZ9A 3I1AA 3VAPA 4AW5A 5I9VA 3LCOA 1MRYA 3LE6A 4GG5A 4E6QA 3PIXA 3VUKA 5LVMA 1VYWA 2GS2A 3MFUA 1GZKA 4LRMA 2C6DA 3AD6A 1OPKA 1VYZA 4CQGA 1PW2A 4L3JA 5JGBA 3R9RA 4S32A 3MA3A 5DNRA 5FQDC 3ZCLA 4BCQA 1JKTA 1P5EA 3C0HA 3PP0A 4U3ZA 2PMLX 4MTAA 2EB2A 4FF8A 2ZM1A 3PLSA 4YLKA 4M13A 2PZYA 4AS0A 4CQEA 2V62A 2YEXA 5GZ8A 2YISA 4X3JA 2R5TA 4F65A 3U6HA 3RKBA 4NCTA 3W2CA 2UVYA 1WBVA 3BV2A 4XG3A 5CAUA 3FQHA 3II5A 3A2CA 5JQ5A 5AUTA 4J97A 3DOGA 2GNHA 2WELA 5KUPA 3IK3A 3AT3A 1JLUE 4A4LA 3UZTA 2VNWA 1UU8A 4I5HA 4D0XA 3SRVB 4HOKA 4J96A 5BVNA 3ALNA 3EN4A 4H3BA 3ROCA 5A9UA 1HOWA 3RZFA 5E90A 4EWQA 3UO5A 2R0UA 2C6TA 4TN6A 4BCOA 2YM3A 3DJ5A 3PJCA 1B39A 2VX1A 3RCDA 3U4WA 3RPOA 5A4LA 5IQEA 4GJ3A 4FKLA 2PUIA 2P2IA 4IB5A 3GGFA 5JRSA 3QL8A 4PNKA 3WIKA 2RSVA 4C33A 2J50A 2C5OA 2OJJA 2WXVA 1YXTA 3MPAA 5EHOA 4RJ4A 3U54A 3LW0A 2OLCA 1CM8A 5IQIA 3NNWA 3BE2A 3D5XA 3KMUA 4RBLA 4QMWA 2QU5A 5FBOA 3HV7A 3LPBA 4P5ZA 4J95A 3PG3A 3BU3A 3VBQA 2Y0AA 4OTIA 1CSNA 2EXMA 4RIWA 3VHEA 4BCIA 2VO6A 4G9RA 4KIPA 3NZ0A 4NZWB 4NH1A 2RFDA 4RC3A 3IOPA 4B4LA 4BDKA 5L3AA 4GVJA 1MRVA 4I3ZA 4NCTC 4IAYA 1RE8A 4YJOA 2BAKA 4LFIA 4D2PA 2J2IB 3NIZA 3S1HA 3S2PA 3QHWA 4XP0A 4BCFA 4ZAUA 4ALVA 5HCZA 2CNUA 1WBOA 1PMVA 2OIDA 1Q41A 2XNEA 4DGNA 5LMAA 3FJQE 4I6QA 1Q8TA 5A6NA 4NSTA 2B9JA 3VBVA 2CCIA 3AGMA 4EH9A 3VW8A 3DK3A 3ZRMA 4DC2A 5IPJA 4M8TA 5FEQA 5IA0A 3UO4A 4NWMA 2G01A 2ZV7A 4O0XA 5M4UA 3B8RA 3LXKA 1M2PA 4LM5A 4RIYB 2CKEA 5K5NA 4TWNA 4I24A 2VNYA 4CFUA 3OUNB 4IZAA 3MY5A 1V0PA 2A4LA 1OB3A 2CNQA 2WFYA 2BALA 4GH2A 4CMOA 3PLAE 2UW3A 1QPJA 3ANQA 2JBPA 5IUIA 2G9XA 4LOOA 4QPMA 4QYEA 4DTAA 3EZVA 3QRUA 3EQCA 4IWDA 4PDSA 2CN5A 3JR1A 4WNOA 4X6RA 5AMNA 5IDNA 4RWLA 3UOLA 3U55A 3FE3A 4CLIA 3A7JA 4FIHA 4EK8A 4I4FA 4YUQA 2NNWB 5HG7A 5KZ0A 3K5VA 1ATPE 3OCGA 4Q5EA 4P2KA 4C2VA 4GYIA 4H36A 2R0IA 3RPSA 4YZNA 4O7YA 5GINE 2YDKA 4WNMA 1K2PA 3SKCA 3UYSA 4D5KA 3V5JA 3IW8A 3CTHA 2QG7A 4YC3A 1XO2B 3DQXA 1O6LA 2B52A 3UPZA 3OEFX 3AC4A 4A9YA 5LCJA 3CKWA 4EOPA 1Z57A 1XQZA 4D2TA 3TKIA 4F4PA 4GK4A 2JDTA 3R8UA 3WZKA 4M68A 4E6DA 5IA4A 3MVMA 3KC3A 3GC7A 3TL8A 4C37A 2FO0A 2YAKA 5K5XA 3COMA 4QOXA 5A14A 4FVPA 1WBTA 1J1CA 3H10A 2XEYA 4FSZA 4Z3VA 3DBFA 1WFCA 5A54A 2HW7A 5JGAA 3V5LA 4YPDA 5D41A 4FT5A 3UOHA 5BVKA 4EOSA 3QUEA 2C68A 4FV7A 4HVGA 4OBOA 2OIQA 1V0OA 3DDPA 2ACXA 3GCVA 3S95A 3LZBA 4L67A 4HZSA 2BZIB 2CJMA 4WG5A 2ZV2A 4C3PA 4GV1A 4XV3A 2OH0E 4C34A 4DEDA 5C26A 4EHGA 3PXRA 4RIWB 4JLCA 4FEVA 4LQMA 4ONAA 3P79A 3BIZA 2UZOA 3F5XA 3NW7A 3ORTA 3FY2A 4K33A 5HO7A 3F7WA 2F7XE 3ZU7A 3S0OA 2GNIA 3UVRA 4FV6A 4IXPA 5D12A 3EYGA 3UNZA 3TV6A 1UWHA 4N0SA 3DQWA 2HOGA 3O7LB 3Q2MA 4DFZE 3C0GA 4RVLA 4AFJA 3VC4A 3FV8A 5IA2A 2QLQA 2I0HA 3MWUA 1CMKE 3FXXA 3A62A 3H30A 2A2AA 3P78A 5H8BA 2PSQA 4FKQA 3TJDA 4FKGA 4H3QA 2P55A 3T8OA 4EKKA 5HOAA 5T6KA 4XUFA 4DN5A 3IGGA 4NIFA 4TWOA 4ZZOA 3MN3A 4J99A 3UP2A 1URCA 4X0MA 2NP8A 4I6BA 4M12A 4GUEA 3F66A 3W2QA 5IH6A 5IA3A 5H8GA 3KGAA 4OGRA 4ALWA 2PMIA 3DGKA 4OTGA 5DG5A 4CRSA 3CCNA 2QHNA 4U81A 5FTOA 4APPA 2JKKA 2C3LA 4BY9E 3KQ7A 2ITVA 1SYKA 2VO7A 5AEPA 2QOFA 3EN5A 5IMXA 4FEWA 2HENA 2PZPA 3MFSA 3NYOA 2IZRA 3T9TA 3UC4A 3WE4A 5LWMA 2FSTX 5IQCA 3FZOA 3WYXA 3ET7A 3FQEA 4M66A 4C8BA 2OF2A 4FL1A 4EOMA 4YZMA 3BELA 3GQLA 4I0TA 4C3RA 2BTRA 2W5AA 3LM0A 4GKHA 2QR8A 3EQRA 4E4XA 1XKKA 3HV4A 2XJ2A 3C4CA 5C01A 1P4OA 3M42A 1OL6A 2Y9QA 3EMGA 3JVSA 3EFWA 3QGYA 2UVZA 3F3WA 4M3QA 3GCUA 4PX6A 1H25A 3LMGA 3VRYA 5AX9A 2CGWA 2I0VA 4XS2A 2UZEA 5DYJA 4QMQA 2QOCA 4M7IA 2RKUA 4FEXA 5FM2A 1ZLTA 2VO3A 2WMAA 3C4XA 2XNPA 1YRPA 4F7JA 4JDJA 3HRFA 5EHYA 3PA5A 3MV5A 2WTDA 4E20A 5F95A 2BIKB 3H9FA 5T68A 4GCJA 3BHUA 2XKCA 2BDFA 2XZSA 5HE0A 3MJ2A 5FTGA 4FYNA 3UVPA 5EKNA 2XK4A 4MBLA 4D4RA 1SNUA 2WD1A 3DLSA 5FUTA 5FEDA 2PMOX 3G2FA 3VS5A 4PWNA 4XMOA 3DDQA 4F9AA 3KN6A 2OKRA 4E6CA 4X3FA 5CEPA 4EH4A 2ZV9A 4EC9A 3N4TA 3PE2A 3EFKA 3N4VA 2H9VA 4AT4A 3DCVA 3PA4A 4I0SA 3D2IA 3OD6X 4CMTA 5IKWA 2C0IA 4BCHA 2PZIA 5E92A 5CAPA 3VUMA 3BBWA 3LFDA 3LQ5A 3D9VA 2C1AA 3R2YA 5LCKA 4HYHA 3CR0A 2YJRA 4MF1A 2QI8A 4PV0A 3C0IA 5HG9A 5J79A 4DT8A 3MPTA 4QQTA 4W4XA 2E9UA 2GTNA 2CNVA 4QP2A 2J7TA 2PZ5A 2R3KA 3D94A 1Q24A 4WA9A 1PMNA 4O7TA 1Q3DA 2G2IA 4TRLA 5CNOA 2PVKA 3DT1A 4L68A 4TNDA 5FG8A 5HTCA 3MBLA 4FR4A 5KMJA 3D4QA 5DRDA 3MH3A 3ODYX 1YI3A 4UB7A 4FIGA 5BX0A 2O65A 4Y72A 2PMNX 2HAKA 1XH9A 2FA2A 4AOIA 2GHLA 5CSHA 4FZDB 1U4DA 3BYOA 3DB8A 3CIKA 4EH6A 5FGKA 3W10A 4OTQA 4NKAA 4C36A 2VTLA 1YDSE 3CQEA 1YI6A 3FMNA 4NJDA 4LUEA 1M2QA 3O0GA 3AMAA 5FP6A 4XG8A 2Z7SA 3EFJA 3QKLA 4F9YA 3FDNA 4U97A 2UUEA 3R8LA 2PULA 2GNFA 3QBNA 3LCKA 2XIZA 4QMVA 5KMIA 4IAAA 4RA5A 5I9ZA 4O27B 4U0IA 3WF6A 3NAXA 3OWPA 4KSPA 2QOQA 4YHFA 3ORZA 2IW8A 4CGAA 1WVWA 4C3FA 4UV0A 3VIDA 3ULIA 5L2TA 5AIKA 3MY1A 2JKOA 3IKAA 2FVDA 2CN8A 2ITWA 2I0YA 1WBWA 2JKMA 3OTUA 3UO6A 2Z7LA 3MIAA 5HVYA 3MIYA 4YO4A 5IQAA 4KABA 4MXOA 3D7TB 1FGIA 1SVEA 4ZTNA 4O83A 2B9HA 5DR9A 3RTPA 4J71A 4AWIA 3COIA 5IUGA 5K3YA 4FKRA 2CDZA 2A1AB 4PNIA 4FK3A 4DBXA 3W2SA 3SXSA 1PXPA 3LAUA 5ETFA 3HP2A 2E2BA 3CQUA 1RJBA 2P4IA 2X81A 5E8XA 5C27A 2VTRA 4D2RA 3NNUA 3G6HA 2ZM4A 3PVUA 5KKRC 4MHAA 4BI0A 3V6RA 2CKPA 2WKMA 4JVGA 3WF8A 3KB7A 1XH7A 4EBVA 3ATSA 1RQQA 3R2BA 2A0CX 4WHZA 2BRHA 3E92A 1QCFA 4FZ7A 3UZRA 4I22A 2FB8A 3SD0A 1Z9XA 2RFNA 3FMEA 4IWQA 4IC7A 4GFOA 1YVJA 2VTAA 2H8HA 4D58A 1Q97A 2C69A 4BGHA 5CF8A 1OM1A 2J6MA 2ZMCA 3LM5A 4HYIA 2BAQA 4FSTA 5KMMA 3F3TA 1JSVA 4JBVA 4KB8A 4QYGA 5J5TA 1NW1A 3N4UA 4DEIA 4BTJA 5CAOA 2V55A 5CALA 4FT9A 4RJ8A 3SXRA 3DXNA 4QMSA 2XNOA 2I1MA 3C13A 5I3OA 4L7SA 2XM9A 5C8MA 4B99A 2UZBA 2WMRA 3ZTXA 4D2SA 3HAVA 3ZMMA 4D55A 2ZB1A 3FL5A 4XH6A 3AT4A 3PE1A 5HGIA 5HE3A 4RLKA 4XHKB 4CSVA 1F3MC 4O81A 2O2UA 4YSJA 4RT7A 4ZZMA 2JLDA 5A3XA 4F1OA 5LOHA 4FE2A 4PL3A 2BZHB 2FH9A 4FX3A 3CD8A 4M67A 4NM7A 4AUAA 4ANLA 1Y6BA 2CLXA 4H3PA 1MQBA 4ZSJA 3QXOA 5AWMA 3WZDA 2R3HA 4XG9A 5GJGA 1SMHA 2IVVA 4UBAA 3LXNA 4PL5A 2F7ZE 4S30A 4IWOA 3F2NA 4UY9A 1HCKA 4PL4A 1HCLA 2J5EA 4APCA 4FTCA 1IG1A 4FUXA 4LL5A 5IA1A 3G51A 3I60A 3Q5IA 3P08A 3Q96A 2V7OA 2XH5A 2UW0A 3D5WA 4RVKA 5T3QA 4ASDA 4CYJA 3ZS5A 2BDJA 3KMWA 2BCJA 3OTVA 4UXLA 4A4XA 4GL9A 2I6LA 4BWKA 4BGGA 4DH3A 3A60A 3QRTA 4F6WA 2X2KA 3ALOA 2W1CA 3Q9ZA 3PVBA 5M44A 3QZHA 4N6ZA 4QO9A 3GU4A 5TE0A 5HTIA 3VS1A 5BYZA 4DH5A 4FODA 3MTLA 3KVXA 4I93A 2DYLA 5AA8A 3C5UA 3V8WA 2VWYA 5D1JA 4EOIA 2A27A 4HGTA 4AN2A 5HICA 4AZSA 5IEVA 2OXDA 4BCGA 3EFLA 4A9UA 1PKGA 4S31A 4B8MA 4WD5A 5HZNA 4GMYA 4S33A 2PVYA 3G15A 1H00A 2XNNA 5HE2A 2C4GA 3QCQA 4O7RA 4IFGA 1OUYA 4FTNA 4GIHA 2YDJA 3G90X 3BYVA 2QO7A 5HU9A 4XV2A 4EK6A 4D4YA 3ZXTA 3G0EA 3AC2A 3TZMA 3W32A 2OI4X 2QHMA 4IAFA 4RIOA 5JH6A 1OECA 4G34A 4AE6A 4YSMA 4E73A 1YOLA 4XP3A 3K54A 3UIBA 2JDOA 3W18A 4DFXE 3V01A 4BVUA 2BDWA 2F2CB 2XS0A 4BB4A 4AZWA 2UW7A 1KUTA 3TUDA 4XX9A 5F4NA 1X8BA 5FBNC 3LXPA 3D14A 3QD2B 4CEGA 3OFMA 1ZZ2A 5GIPE 3CLYA 4QTBA 1Q8ZA 3MH0A 2E9NA 1BL7A 3QYWA 3ORKA 1JKSA 3R1YA 1M14A 2B54A 3WZUA 5J7BA 4JI9A 3NRMA 3U87A 4PY1A 4U6RA 3PYYA 4RJ5A 4XRLA 2BZKB 4AG8A 3MH1A 4WIHA 2QKWB 3F82A 4X2GA 1Y6AA 5AR5A 4FIJA 4NW5A 4I0RA 2GS6A 3IQ7A 3RAKA 2F7EE 3MSSA 5M51A 5IQHA 4RJ6A 4DFLA 3CEKA 1M17A 2BFXA 5CEMA 3C51A 4IX4A 2XP2A 4EEVA 3F88A 5L2QA 3UIXA 3ORXA 4RPVA 4FV5A 3VBXA 4BIDA 3AC5A 4ALUA 4FA2A 4H05A 4QP3A 3GCSA 2XBAA 2XK8A 2GS7A 5CEQA 3LMHA 3QTZA 4KS8A 3OWLA 2C6KA 3TV7A 3IGOA 5F9EA 3I7BA 1QPEA 3NUNA 2HZIA 4FBXA 4FZ6A 3ZRLA 4ANBA 3UDBA 3F5GA 4XRJA 2ITTA 4O0UA 4MAOA 1ZYDA 4FV0A 5AM7A 4HNIA 4AGUA 3EKNA 2WHBA 4RQVA 4DFBA 2X1NA 2VAGA 4XV9A 1PXLA 2GNLA 4YJTA 5L6PA 3BGQA 2B0QA 2QOKA 4E4MA 2HWOA 2HK5A 3QCXA 3DAJA 3IW4A 4NW6A 4OT6A 4YC6A 5AV2A 3FC2A 3V51A 2ZOQA 1IAJA 4UYNA 3FLQA 5CSWA 3E62A 4FV1A 3Q4UA 1SNXA 2W9ZB 4Z9LA 4DEEA 2OFUA 3I79A 4LYNA 5DA3A 3FYKX 5C4KA 4QMMA 1R3CA 4FSMA 3KXGA 2QOOA 2OICA 2R3RA 5ITAA 5J1VA 5C03A 4BL1A 4YMJA 3BHHA 1YXVA 4BDAA 2VWZA 3SXFA 3MDYA 3PVWA 3SVVA 3LLAA 1S9JA 3CJGA 4GYGA 4QMTA 3RI1A 2BR1A 4C35A 2QONA 4L52A 1FVTA 2C30A 2YIWA 3PSCA 3FMHA 4G6OA 2W5HA 4MYGA 4YJSA 4YTIA 4KA3A 4GT4A 2ZMDA 5TT7A 4B7TA 5M06A 3H0ZA 5KBRA 4MXAA 3Q52A 4GT3A 1IA9A 3OROA 4FEUA 4DA5A 4FNZA 5AX3A 1UWJA 1YOJA 2YA9A 3KULB 3LFFA 4BRXA 2PE2A 3V5WA 4NJ3A 4NM5A 1OL2A 4ZMFA 2W96B 4W8DA 3H4JA 4DG0E 1NXKA 2C6OA 4QRCA 5CXZA 5EYDA 3FUPA 4GU9A 3PXZA 4IM3A 4MD7E 3LFAA 4DF3A 2XYUA 5CF5A 4D1SA 4DFNA 3Q04A 4RA4A 4O84A 4OTFA 1PY5A 3I0OA 5FM3A 4IJPA 2VD5A 3VN9A 4MXXA 3DTWA 4LL0A 1GNGA 3ZBXA 1NVQA 4FIEA 2YACA
chains in the Genus database with same CATH superfamily
2I40A 4RJ3A 4F9CA 4ZJIA 4FV8A 4IW0A 5JK3A 1I44A 2B55A 3DLZA 2XF0A 4O2PA 4V0GA 3TG1A 3R9DA 4F0GA 5CNNA 1CKPA 2C6MA 3HYHA 3Q4TA 4RMZA 4O1OA 2RFEA 2JKQA 2BVAA 4OR5A 4MD8E 5DGZA 1G5SA 5CEKA 1OL7A 1GY3A 4WBOA 3EIDA 5F94A 3VF8A 5IQDA 2BIYA 3OCBA 5HE1A 3VRZA 1R39A 3AMBA 3RNIA 4HW7A 4E5AX 1FOTA 2VWVA 5FWKK 4RC2A 4KD1A 3MS9A 4Y8DA 4EOOA 5BNJA 3FLYA 1J3HA 1YXXA 3FBVA 3JS2A 4IX3A 4U5JA 2VTJA 5EYMA 4F70A 4CFMA 4NFNA 3WOWA 3HRBA 4RVMA 5LQFA 5IA5A 4CNHA 3ACJA 3IW6A 4FSQA 4XBUA 1WVXA 2GSFA 2XYNA 4W4WA 2W06A 1ZOEA 4OTDA 3IO7A 4TY1A 4WUAA 4D2WA 2XARA 3LQ3A 1YW2A 4U80A 4U9AA 2XJ1A 4XYFA 4C0TA 3EQGA 3QAME 3BYSA 5GJDA 4BBEA 3P7CA 4N4SA 4DHFA 3BL9A 3ZYAA 3VS6A 4FGRA 2YDIA 2WQOA 1XMMA 2JDSA 2J0JA 4EH7A 2V22A 3KN5A 4R7HA 3C4EA 2IO6A 3FLNC 3HX4A 5DLSA 4GG7A 3RPVA 5CSVA 5E8ZA 2GQGA 2JDRA 3M11A 3QZGA 4KUJA 1ZAOA 4BKZA 3TDVA 3UMXA 5AADA 4NT4A 4BYJA 2QLUA 4R8QA 3FHIA 4N70A 3SAYA 4EKLA 5FXRA 3R02A 4FV9A 4AACA 1I09A 4ZTLA 5K4IA 4E26A 3C4WA 4WO5A 2UW4A 2YJSA 4MNFA 4O1PA 5HO8A 5CENA 1DS5A 5AUWA 4BCPA 4YPSA 5AP5A 5BVWA 3FZSA 3QWJA 3WZEA 4Z16A 3E8EA 1O6KA 4EH8A 5KX8A 2PZRA 2J0MB 4MX9A 3OBGA 3OY3A 3QKMA 1H26A 4E5BA 3OT3A 4QYFA 3PSBA 5DMZA 1CKIA 4K9YA 3QCYA 5BQ0A 2XK7A 2W1FA 2XIKA 3PWDA 3P0MA 3UGCA 3UIMA 4RX9A 3UQGA 2IW9A 3DNEA 3BYMA 4DGLC 3ORLA 4AF3A 3F3VA 2BROA 4DFYA 5I4NA 2PVHA 5JZJA 2R9SA 3SW7A 4RWIA 3PUFC 3C7QA 4A07A 2WPAA 4WBBB 2ITPA 3NUUA 4OBQA 2X4ZA 1OKWA 3LCSA 1MUOA 1ZRZA 3HMNA 3NW6A 3QTWA 3C4ZA 4YBJA 1JSTA 3O2MA 4BDFA 2Y6MA 1IR3A 2XNMA 4M97A 2YM4A 3QTSA 4L45A 3I6UA 5EQPA 3LHJA 3H9OA 2R4BA 3PSDA 4QP6A 5JN2A 4BDJA 3LMIA 3A7GA 3VULA 2OIBA 2BHEA 4CT2A 2H96A 4EORA 1FQ1B 3FZTA 4C57A 4MEDA 5JGDA 4YHJA 2IZUA 4DINA 2IG7A 5AV1A 2XVDA 2JDVA 3BEGA 3TXOA 1OBDA 2GCDA 2B9FA 4ZXTA 3PXYA 4DITA 2XCHA 2HIWA 5EM6A 4MNEB 4Z7HA 2OFVA 2JIUA 3E7OA 4P7EA 2ITUA 4H1MA 4KAOA 5D11A 4X3FC 5D7AA 5FXQA 5IU2A 5IEXA 4M14A 5IMEA 4BN1A 5AR3A 1OIQA 1ZMWA 4TW9A 2PUUA 3F61A 4ZTSA 2WNTA 4EOQA 3DZOA 3RK5A 2DUVA 4J52A 4O0VA 3R00A 3P7BA 1KV2A 1UV5A 2GU8A 4FYOA 4TYHA 4C62A 4NKSA 5CSPA 3R7GA 3AQVA 4HPUE 2ZDTA 1F5QA 3ZFYA 3DBQA 4BIEA 5ANIA 1BI8A 2XKFA 1OL1A 2HW6A 3ZO4A 1Q8UA 2QOIA 4ACMA 2GTMA 4DH7A 4FKTA 5D9HA 3FY0A 2X6DA 4IM0A 3DK6A 3TEIA 4R7BA 4X21A 4UMUA 4GJ2A 3REPA 3OZ6A 3HUCA 3CS9A 4MWHA 5F20A 5HNGA 3OW4A 3DBDA 2ESMA 2Z02A 3NW5A 3PVGA 4D4VA 2OU7A 2LGCA 5TR6A 3FPQA 5I9WA 4EQUA 4C4GA 3QTIA 4ZLZA 3JXWA 5JT2A 4R5SA 4R78A 4DTBA 1NY3A 1NA7A 3GU8A 2UV2A 3P23A 3PWYA 3SDJA 3SV0A 1AQ1A 1IA8A 2XKDA 4IQ6A 4L01A 4USDA 2BILB 3FL4A 4V0GB 4D0WA 2GMXA 4KSQA 5HBHA 3SHEA 3L8SA 4E4LA 4EJ7A 1ZMUA 3BLRA 3CE3A 2PYWA 4NEUA 2JIIA 4IHPA 2GQSA 1KWPA 1P4FA 3NPCA 5EI6A 2E9VA 5DT0A 5L8LA 3QRKA 3TI1A 4RRVA 1JSUA 3VBTA 3UQFA 3PY3A 4RFZA 3PJ1A 5J7HA 5AAFA 3Q4ZA 3ZC6A 3F2AA 4DCAA 5CQUA 3TNWA 4C38A 3VJOA 5ANDA 4O6LA 3AGLA 3OBJA 3F3UA 4UZDA 3RZBA 4YTCA 3UQCA 2R3IA 2OW3A 3BE9A 2XCKA 3FLZA 4FTRA 4TXCA 4FJVA 4QDVA 5IISA 1QMZA 3VBYA 3ZSGA 4GS6A 2C6LA 4GIIA 2P3GX 3R22A 3P4KA 1K9AA 5KNJA 5FDPA 5EDPA 4XOZA 3ZDUA 3EQHA 3AKKA 3RBWA 4YZDA 4A06A 4A9SA 3R9OA 1CKJA 3P7AA 2YIRA 3EQBA 2YM5A 5JKGA 1H28A 3ANRA 4GFGA 5I9UA 2BKKA 1XR1A 4ZP5A 1PXMA 2IJMA 3GVUA 3Q53A 3QTQA 2J0IA 3NSZA 5I9XA 4UX9A 3TZ7A 3V8SA 5B2MA 1REJA 4AT3A 1BI7A 4CG8A 3QRJA 3JVRA 4IADA 2IW6A 3QZIA 4FRFA 4BDHA 5AAGA 1M2RA 2JC6A 4CT1A 4MQ2A 5CX9A 4AW1A 2VGOA 3JY0A 2W7XA 4FSYA 1GAGA 5AM6A 1E9HA 1GOLA 2XB7A 4XNEA 5JFWA 3ZFMA 2C3KA 3RPRA 4LV7A 3ELJA 5BMSA 3LFNA 5AV4A 3O17A 2CHLA 2IZTA 3KRLA 2JBOA 4Y46A 1U46A 3R0TA 4F9BA 3FMJA 3M2WA 3DK7A 4DLIA 4Z7GA 4QP7A 1BYGA 4WSQA 3IPHA 4NTTA 2PE0A 3OEZA 4TYHB 3H9RA 5LVOA 3UMWA 4FTTA 4EOLA 1STCE 4K18A 4IZ7A 4UZHA 5AP1A 2VRXA 1ZOGA 4KKEA 2VWBA 4BI2A 3A8WA 3POOA 4ZZNA 4J8NA 2ONLA 4JQEA 4DGOA 4LGHA 3EL8A 2VWIA 4DYMA 4KNBA 2BFYA 3E3BX 3O8UA 4O0WA 1M7NA 2YCSA 3BYUA 4IVCA 1JPAA 4PP9A 3FEGA 4AZVA 3Q4CA 3W2PA 3FWQA 2NYAA 4JT3A 1FPUA 5EW9A 4QT1A 2WTWA 3AC1A 1NVRA 5L8JA 1YHVA 2QOLA 3KF4A 4L42A 4MF0A 5CEIA 3RALA 5EKOA 4BWXA 2I7QA 2HWPA 4UEUA 3HMIA 4YBKA 5AV0A 4FL3A 4FKOA 2IN6A 4ZSGA 4AGDA 1Y57A 3KRRA 5HI2A 4EHVA 2VWUA 1IAHA 4PDOA 3GENA 3TM0A 3T3VA 5IG1A 3CPBA 3ZLSA 4BKJA 4AQCA 3TMOA 3CY2A 5CU0A 4D1ZA 1PXOA 4CZYB 4TTHB 2WMXA 3QU0A 3NWWA 5AP6A 3I5NA 4J1RA 4M15A 3KK8A 5AIRA 5EQYA 3NCZA 3KKVA 4RC4A 4S34A 3ZRKA 5I0BA 3AXWA 2Q83A 3IDBA 1PXKA 2WMBA 1Q62A 2C5NA 3NGAA 4AA0A 5ICPA 3NUSA 5CU4A 5CANA 4C59A 4IANA 1W98A 4XCUA 4FTIA 2OG8A 4O7NA 2R7BA 5KMOA 3PDTA 4XG2A 4BDIA 4GT5A 3V04A 5K9IA 2R3FA 5HTBA 3W0QA 3WE8A 1YXUA 3L9MA 2YLEA 4MXYA 2C5YA 4FZAB 1W0XC 5HESA 3T3UA 4DG3E 4EHEA 4J8MA 5C8NA 3BV3A 5HORA 3BHYA 1H07A 1YQJA 2IWIA 4I94A 4WG3A 4QD6A 4A4OA 3OXZA 2X9EA 4BZDA 4O7ZA 1AGWA 3I7CA 4KIOA 4PTCA 3BRBA 4PPCA 3A61A 2ETRA 5EYKA 2WEVA 3NFFB 4L6QA 2JGZA 2OH4A 3KRJA 3KXNA 3FQSA 2W4OA 5EG3A 3GC9A 4PMPA 4FNWA 3BI6A 4GRBA 3G9NA 4FICA 4LG4A 1BKXA 2R64A 5HBEA 4A7CA 2C0OA 3OW3A 4L00A 4F64A 5AJQA 4KIQA 3CTJA 4W8EA 3U9CA 5TO8A 3MVJA 3WYYA 1RDQE 3QQKA 2QQ7A 4GK3A 3OP5A 3H3CA 2OZAB 3W2OA 5ETAA 1YKRA 5FD2A 5LARA 4ZJVA 3R1NA 4X3FB 4QMLA 3EB0A 4EQCA 2XAMA 3BU6A 4NK9A 4CRLA 4TL0A 4KRCA 2BKZA 2E9OA 1B6CB 3A99A 4JIAA 2QOHA 3FI3A 5HQ0A 3OOMA 3ZZEA 3Q60A 4D2VA 1PXIA 4U44A 2C5XA 3E3PA 1PXNA 5A4QA 4ZK5A 2VTOA 3D5UA 2W05A 2ERZE 3C5IA 2IZSA 4I41A 1U59A 4O38A 2WMUA 3BGZA 3TNPC 3HA6A 1WAKA 1TQPA 2O63A 4DE4A 1Y8GA 2JAVA 3MB7A 4FSUA 2P2HA 4KIKA 1JQHA 1UU7A 4EZ3A 3HDNA 1ZYLA 2HY81 2AUHA 4J7BA 3R8PA 4O2ZA 1BL6A 2YABA 5HD7A 3MTFA 3MVHA 5E1EA 4FT0A 4QTEA 3HMPA 3ZEPA 4E1ZA 3ORPA 3FXZA 3BWFA 5ETCA 2Y4PA 3CGOA 3F3ZA 2F49A 1OL5A 4JJRA 3BL7A 3NYVA 5BPYA 3HVCA 4FNYA 2PU8A 4FV3A 2WIPA 4Y85A 5CI7A 4ORKA 5CZIA 3PY1A 5BUJA 3GBZA 5CU3A 2PL0A 4EK4A 4ITHA 4JOAA 4L9IA 3ZEWA 4BZNA 1Q99A 4I1ZA 4XG7A 1R0EA 3WZJA 3QCSA 3ZC5A 2UZWE 5KHWA 1AD5A 4KKGA 4QPAA 3TNQB 3UOKA 4BHNA 2UZUE 3LCDA 4FKSA 3WBLA 4CV9A 3DPKA 1H01A 3MESA 4CD0A 5CXHA 2X7FA 2FYSA 5M55A 5EQEA 5KKRB 5DRBA 2FSLX 3NR9A 4YJQA 1LR4A 3NNVA 3IW7A 4G3CA 4IH8A 3LFQA 1JKKA 4MK0A 3RCJA 3WILA 2XRUA 2ZFYA 5CSXA 2W99B 2WTKB 4O0SA 3PPJA 1UA2A 3POZA 2YWVA 4CFNA 4RJ7A 4DG2E 5M08A 4IB3A 4RX8A 4EK5A 5DBXA 4FKJA 1M7QA 1PRYA 4XOYA 3AD4A 1MQ4A 2EB3A 3FXWA 5CS6A 4UYAA 4ZS0A 5I9YA 3W0NA 4QPSA 4W4YA 3EWHA 4NM3A 3G9LX 3GOKA 2O3PA 2R3JA 3K2LA 5ANKA 2QCSA 3OVVA 1IASA 3GU6A 3DFAA 4BF2A 4DHIB 4TYEA 4QTAA 1CTPE 3JUHA 4DEAA 4HVIA 5IF1A 1O6YA 3DFCB 4R1VA 2OZOA 5DEYA 4EI4A 3HAMA 4MCVA 2GPHA 1OPLA 2BMCA 4ZTQA 4EWHA 2Z7RA 5KO1A 1TQMA 4ANOA 3O96A 3HV3A 2PUNA 4FOCA 4AT5A 4HJOA 5JFSA 1P2AA 2FSMX 2WU7A 3DV3A 3ULZA 4C02A 4X2FA 3W0RA 4CKJA 3L1SA 3FKLA 4TYGA 4E3CA 3SLSA 4ANSA 4FKWA 1ND4A 3NUXA 2XRWA 2WZJA 3RP9A 5C8KA 3CY3A 3LJ2A 5AR8A 3RHKA 2C47A 4YZ9A 4CCUA 2RL5A 2Y8OA 3LFBA 1CDKA 3MY0A 4ZSEA 4AXDA 3QQHA 1U5QA 4O82A 4ENXA 3BKBA 4ZY5A 4IAKA 2XKEA 1IRKA 1H4LA 4RIXA 4CTCA 5M07A 2OJ9A 5IQBA 1KE9A 5HIBA 3N9XA 3UZPA 3LIJA 2C5VA 4O4FA 3IONA 5AUVA 3FZ1A 5IH5A 4W9WA 3FHRA 3ZLWA 5JEBA 4R7IA 3L8VA 4YLLA 3VNTA 1H8FA 2HXQA 5J5SA 1KE8A 4CFVA 4RWKA 4IACA 2OBJA 4JX7A 4DEGA 3LFCA 4QEBA 4LRJA 4D9UA 4EYJA 2UZLA 3KCKA 2F57A 3AG9A 2EXEA 3FI2A 4KBCA 1E1VA 4XLIA 4UALA 1BX6A 5DPVA 4AW2A 4KIKB 3SC1A 2UW8A 4TKSA 4DGMA 3V3VA 4UMRA 3Q9XA 3LLTA 4I21A 3WF7A 4BDDA 3HGKA 2F2UA 4LOPA 3E88A 2XUUA 4AFEA 3KL8A 2HZ0A 3NEWA 4X2JA 3COKA 5HIDA 3EOCA 3HZTA 4QP9A 2O8YA 5J95A 3QTRA 2HZNA 5CVGA 4JBPA 4G16A 4PMSA 1ZYCA 5AUZA 3EN7A 4HVSA 5IQGA 4WT6A 2OXYA 5FTQA 1H1WA 1R0PA 3ODZX 1OKYA 4FIIA 5CI6A 4ZSAA 3AKJA 5DR2A 1WMKA 3COHA 3EH9A 5H8EA 5JMSA 5CVHA 2ZV8A 4ZLOA 4U40A 4R77A 3OHTA 4G9CA 3ZXZA 1OIRA 4R3RA 4ASXA 3PZEA 4O7WA 1PKDA 3OUKA 1DI8A 2OF4A 4EHZA 4F63A 3KEXA 2ZYBA 4L3PA 3MGYA 1J91A 5CT7A 5HCXA 5A4TA 1ZZLA 4HCUA 1UU9A 3LCTA 3ENMA 2WOUA 4JS8A 2Q0NA 4IIRA 4BZOA 2EUFB 2A19B 4RX7A 4Y95A 2YIYA 4LGGA 2ONLC 3QUDA 4O0TA 4D28A 5LMKC 3CTQA 2VX0A 3HP5A 4FV4A 4ZIMA 4ARKA 2KULA 2ZAZA 4O0YA 4EH5A 4EH2A 2Q0BA 5DOSA 5G1XA 3S3IA 3SW4A 3EYHA 2YIQA 4RZWA 1MRUA 4BDBA 5C1QB 4DCEA 3P9JA 3BQRA 4OUCA 2GFSA 4AZFA 2YHVA 3D5VA 3Q9YA 4YHTA 4OT5A 4WSYA 4ZS4A 3VHKA 4BJJA 4USFA 5ANEA 3F2RA 2B9IA 3QYZA 3VVHA 3TYKA 1XH5A 3DAEA 4U8ZA 3SRVA 4ASZA 4I5MA 2NPQA 2P33A 3Q9WA 4X6QC 4L53A 4DAWA 4GKIA 3AOXA 2PTKA 2QVSE 3SX9A 2JFLA 4CXAA 3ZM4A 3BEAA 4FVQA 4OAUC 3BHVA 2X4FA 3KY2A 4AP7A 2WMQA 4LGDA 3G5DA 4RVTA 5LMKA 5EW3A 2YN8A 4PQNA 2JD5A 4I4EA 5M4FA 5BYLA 4G6LA 3HNGA 3ZM9A 3HV5A 1E1XA 2ITQA 1GZ8A 3R21A 2WGJA 4I6FA 5DR6A 5JFVA 2R3MA 3QZFA 3PPZA 3QLFA 5KZIA 1R78A 5KMNA 3DZQA 5HO6A 4EOKA 1UNGA 3MI9A 4TNBA 3GXLA 5GNKA 3O23A 4GEOA 4AN3A 3PJ8A 4D4SA 2BTSA 1YOMA 5CVFA 1XBCA 5L6WL 3R8MA 1A06A 3EQPA 4C4EA 2OSCA 3LQ8A 5ACKA 4FTJA 3E63A 5CLPA 4RG0A 2W4JA 3MFRA 4Q2AA 3V6SA 1XBBA 3UPXA 2AYPA 5DT4A 3A4PA 3DXPA 3VS4A 2BRNA 4FKUA 1J1BA 2Z7QA 4BYIA 4QP8A 2C0TA 2WEIA 3ZFXA 1XMLA 4EC8A 2WAJA 2XNGA 3VS3A 2WTVA 2B53A 3OOGA 5HLPA 3QQFA 4O7SA 4I92A 3EN6A 4PPAA 5HBJA 4AXCA 4H39A 3RAHA 4ID7A 5CU2A 3JY9A 5CASA 3R7OA 2Z2WA 4BCKA 4KINA 3PXFA 5G6VA 3QTUA 3B2WA 5GZ9A 4B9DA 1OZ1A 5D7VA 3W33A 4JBQA 2FUMA 2UZNA 5B7VA 4IB1A 4RIYA 5KBQA 5J9LA 2ERKA 3KXXA 3RAIA 4AGCA 2BPMA 2XK9A 5AUYA 1H0WA 3G0FA 3QD0A 4ITIA 3UVQA 4F7NA 2BHHA 4IFCA 4XG4A 3DNDA 4AXFA 4KKHA 2GHMA 4QNAA 5AP2A 5KE0A 2HELA 3VF9A 4UN0C 5AA9A 5TF9A 4EONA 1YDTE 4CLJA 3E93A 4JX3A 5TOZA 3GU7A 3KMMA 3OY1A 4HNFA 4ZOGA 3RK9A 3OT8A 4DGGA 4DFUA 3W16A 3WI6A 3EN9A 1U54A 3OCTA 2X8DA 4PP7A 3EZRA 5BVFA 1ZYSA 3ATTA 4FNXA 2XIRA 1Z5MA 4LMUA 5IDPA 4RGJA 3FSKA 2FGIA 3K3IA 4XBRA 3WF5A 4D5HA 5M57A 5CQWA 3SG8A 5HLWA 3OMVA 4YJPA 4UMQA 4C58A 3EL7A 2B7AA 1WCCA 1J7LA 3LFSA 5EW8A 3RM7A 3P1AA 2IF8A 2G15A 4IC8A 3GC8A 3QC9A 3QKKA 1K3AA 1J7UA 3GNIB 3RINA 3CPCA 3F5UA 2YM8A 1LP4A 3TIYA 3ZO2A 4H58A 3HRCA 3DKGA 3KK9A 2J4ZA 4AZTA 4YR8A 5BV3A 4FL2A 2J5FA 4O4CA 5L8KA 4AX8A 2HCKA 4QMZA 2W1HA 4OLIA 4IMYA 4TZRA 3KA0A 5CYIA 4QP4A 4QMNA 5DI1A 4JL9A 3W0SA 3OC1A 1W82A 2CGXA 4DH1A 2PHKA 3TN8A 2F4JA 4O21A 3MB6A 3TKUA 2VTNA 4L8MA 2VWWA 4O7LA 1H1RA 4AN9A 1TQIA 2X8IA 4E5WA 3GP0A 3E64A 3PTGA 4G3EA 3HMMA 5HD4A 3E8CA 1W7HA 3TACA 4JDIA 4ZSLA 4TPTA 1OIYA 5M53A 2GDOA 4ZMEA 3QA0A 4IZYA 5EH0A 4EBWA 5DN3A 5BMMA 3RHXA 1U5RA 1Q4LA 1TZDA 2C6IA 4KBAA 1FGKA 1KE6A 3ZSIA 2ZJWA 5FRIA 4G31A 4PF4A 3MH2A 3QA8A 4UWBA 3NYXA 4RSSA 4O7VA 5CT0A 3I6WA 1OI9A 5CY3A 1J7IA 4AOJA 4FEQA 3F7ZA 4N57A 5CEOA 3D7ZA 4ZLYA 5E8UA 4ZEGA 3ZUUA 2OWBA 4NUSA 3W8LA 4IDVA 2REIA 5DWRA 3PIZA 3D0EA 4HZRA 5GZAA 3TTJA 2WTIA 3GEQA 4JG8A 4EUTA 3CXWA 4O4EA 5HLNA 1WBSA 3IDPA 2ZM3A 4FUYA 4G6NA 4K0YA 3ZH8A 3UNKA 3DKOA 2XALA 4U42A 3ZHPC 4EH3A 2WB8A 4MBJA 3CKXA 1G3NA 1OMWA 2X6EA 2OJGA 3KRXA 4YTFA 2ITYA 4FTMA 5LXMA 3D15A 2W1GA 3PXQA 4TYJA 4GU6A 3RNYA 5ANGA 4QQCA 4X2KA 4YP8A 2X9FA 3R9HA 3VONA 3W8QA 2BRBA 4LI5A 3TTIA 3ID6C 5CZHA 1F0QA 3JYAA 5F1ZA 4E7WA 3UOJA 3AKLA 4DHJA 3N51A 4U45A 5JRQA 4GK2A 2W0JA 4Q9SA 4JBOA 4DTKA 1PMUA 3VUIA 2HXLA 3AC3A 3HECA 4Y83A 1FMKA 5E91A 3RWQA 2CGVA 5AR2A 2I0EA 2WMSA 1Q5KA 2Y4IB 5CWZA 4NTSA 3R8VA 1OIUA 4XV1A 4JAIA 4MWIA 2JITA 3QX4A 4A9TA 5J9YA 4G1WA 3V5PA 3ORNA 5L2IA 2ZDUA 3GT8A 2DWBA 1JBPE 4F9WA 1FBNA 3IOKA 4F1MA 3CD3A 5L6OA 2O0UA 1ZYJA 4Z55A 3FI8A 3VS0A 3NVMB 4G17A 3EKKA 1PHKA 3OCSA 1Q8YA 4J53A 4KS7A 3A7FA 3D83A 4WKQA 3V5TA 4I6LA 3TKHA 4BC6A 4I5CA 3HMOA 5DVRA 2VTIA 2SRCA 2YCFA 3HUBA 4CFFA 5K0XA 3O5AA 4L44A 2GHGA 1SZMA 2ITOA 3DBEA 4H1JA 4YC8A 3UNJA 4BFMA 2YWPA 3IW5A 3QHRA 4F6UA 3PJ2A 3OXTA 2J9MA 5E8VA 3R8ZA 4HCTA 5C9CA 4WRGA 4QNYA 4EK3A 5ANJA 2OK1A 2VWXA 4DBNA 3PIYA 3ACKA 2YM7A 1QL6A 4QMXA 3U51A 3DKCA 4F08A 5HKMA 3R9NA 2WU6A 2IPXA 1LPUA 3HV6A 3UODA 3ZOSA 3R7IA 1APME 4BWPA 3O8TA 4G5PA 4FTLA 4E4NA 2VGPA 1KOAA 4NIFB 4JRNA 2NRUA 2X39A 3BZ3A 3VUTA 3W0OA 4B8LA 2AEGA 1IEPA 4MXCA 3W1FA 4R3CA 1KSWA 3DA6A 3KULA 2XEZA 3O71A 4K6ZA 4ZTRA 3QQUA 5A4CA 4U79A 1QPDA 2CCHA 4AA5A 3C4FA 3FMLA 4JQ8A 4O4DA 1TVOA 4GW8A 4KBKA 4FTUA 1A9UA 1WVYA 3OXIA 4JG6A 1OUKA 3U6IA 5KMKA 4ACCA 2ETKA 2WQMA 4CCBA 4FSNA 4ZTMA 1OBGA 1YWNA 2QURA 1H1QA 4FTAA 4CKIA 3TZ8A 2QR7A 3QXPA 2VTTA 2PVLA 4BJJB 1XH4A 2C1BA 2IVTA 2BAJA 3VUHA 2UW9A 3ZO3A 3ZUVA 5CAVA 1GIJA 4IWPA 1H08A 2VZ6A 3TV4A 3V5QA 4JG7A 3H0YA 2QO9A 2R3GA 2IVUA 3LJ0A 4Y5HA 4BCJA 2VX3A 3ZONA 5J87A 5HG8A 3FMMA 4BGQA 5CF6A 1XHAA 2QD9A 3SG9A 4PMTA 4CZTA 2F9GA 5BUIA 3AD5A 4UMPA 4LUDA 4YJRA 5GJFA 3NLBA 5EOLA 4EOJA 3BPRA 4EZ5A 4R1YA 2GNGA 4GVAA 4MBIA 3AT2A 3WIGA 4DH8A 1H24A 3NYNA 3RMFA 3QD3A 4CVAA 4FG9A 4WNKA 5FEEA 4BR3A 4R5YA 3ORMA 3LJ1A 3KRWA 2VTSA 4YURA 5E8WA 3L9PA 2RFSA 1JVPP 3CSVA 3Q6UA 4G2FA 3P5KA 3TJCA 5AUXA 3DY7A 4FK6A 3RVGA 4J98A 2X2LA 4LMNA 3AMYA 4O6EA 5EFQA 4BDGA 2CKOA 4MUQA 5IUHA 3FLSA 4NM0A 5AAEA 5BVDA 1W83A 1YWRA 3VO3A 2EVAA 3VS7A 4FTQA 4K2RA 1UKHA 1OKVA 3PRIA 4U41A 3G6GA 4O86A 3W0MA 3UG1A 4ACGA 3R7VA 5AR7A 4UWCA 4AGWA 4FGBA 4PTEA 1JKLA 1BUHA 5E8YA 4C4FA 1ZXEA 3A4OX 4AE9A 4QMUA 1KV1A 3A7HA 3I0QA 3CC6A 4FKPA 4LRKA 2JIVA 5AV3A 4Y73A 3RJCA 1M52A 3HKOA 4HGLA 3KXMA 4BKYA 5L2WA 4CG9A 3PA3A 2WO6A 2XIXA 4CV8A 4C7TA 3PPKA 4X2NA 4OW8A 1OITA 4OTRA 3TT0A 5A6OA 3R83A 5AFVA 3PUPA 4IB0A 5EDQA 5IZFA 2C3IB 2W1IA 2WQEA 4JDHA 4K1BA 4FIFA 4G3DA 3ZZWA 4BDEA 3FZPA 4FTKA 4FZFB 4BHZA 3QC4A 3LOKA 3IECA 1DAYA 3EHAA 3THBA 4CTBA 3FKOA 1G8JA 3A7IA 1YI4A 2OJFE 4TT7A 4EQMA 1KOBA 1MP8A 1FMOE 2YAAA 2R7IA 1RW8A 4ERKA 3Q3BA 4M0YA 4ACHA 4PDPA 3DBCA 3RGFA 2R3LA 2X2MA 5L2SA 1GIHA 3DU8A 1FVVA 3E87A 3PXKA 5H3QA 1YWVA 2UW6A 3QF9A 4QDEA 4JAJA 4V05A 1PXJA 5J1WA 1GZNA 4BBFA 3TDWA 2YCQA 1Q61A 4CKRA 5ETIA 4C4JA 3DB6A 1A48A 3BX5A 5KHXA 1WZYA 1ZMVA 3KU2A 3MA6A 5HG5A 4OTHA 4G3GA 2XJ0A 4M84A 4RWJA 3F5PA 3PG1A 4XG6A 2YFXA 4ANNA 3BHTA 4PMMA 2P0CA 1ZOHA 2IVSA 3IDCA 4O91A 2YIXA 3PRFA 2O64A 2PVNA 2VTHA 3GCQA 4DEBA 2XK6A 3GQIA 5EDRA 5IEYA 2X0PA 2H6DA 1PYEA 3R1SA 5M4CA 1URWA 2AC5A 2WQBA 4ERWA 4XLVA 4L43A 4Q9ZA 3IG7A 1V0BA 2OJIA 3ZO1A 2YITA 5IQFA 4M69B 4IX6A 3QALE 1XJDA 4TWCA 4QQ5A 2PUPA 5HX6A 2RF9A 3R01A 4YLJA 4FG8A 5EHLA 5HCYA 3L8XA 1JOWB 3GI3A