5C27A

Crystal structure of syk in complex with compound 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
272
Chain Sequence
b'VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c27A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c27A01
2BFXA 3A99A 2XNEA 5HD4A 2VGOA 5BVEA 5K0XA 5M56A 4YC3A 3FHRA 3RALA 2RG6A 3LCSA 5EKNA 2WTCA 3QL8A 2YM7A 3QQFA 3DNDA 4IC7A 3G33A 3BYVA 1CTPE 4IAYA 4L01A 4F9CA 2W1IA 4XNEA 2CNUA 4FT5A 4DGGA 1PMUA 4FV8A 1KWPA 3MY1A 5IQEA 3PXRA 2C5NA 3QRUA 1P4OA 3QTXA 2I40A 5HD7A 4GRBA 3P1AA 2ZYBA 5IMXA 3F61A 5IA3A 5CF4A 3ZSIA 4W4VA 4QP1A 3OWJA 3NYOA 3RPRA 4A06A 5M51A 4D4YA 1OIUA 4ACGA 2BFYA 2A0CX 5J79A 2F9GA 4ORKA 4P90A 2HENA 4DH8A 2C3LA 5GHVA 4I6HA 4EHGA 2E9VA 5EQYA 2I1MA 4K9YA 2VAGA 2OJIA 5E8SA 5LWMA 1WAKA 2VTQA 2YM6A 4XH6A 1QL6A 2PVHA 3EQCA 3FLZA 2RIOA 3P9JA 2OH4A 2QHMA 2OBJA 4O2PA 4C59A 3POZA 4FTUA 5CAPA 3PDTA 5M08A 1XH5A 1LP4A 4YZNA 1TVOA 3IDCA 3DU8A 1A48A 4KKEA 3MN3A 1MRYA 4OW8A 4LL0A 3LCOA 2GNIA 4FIIA 4YGAA 5AV0A 4D1ZA 5EDPA 2ITNA 3OUKA 3RBWA 5JEBA 5GZ8A 4N6ZA 1CMKE 3EQFA 4NKAA 1U54A 3E62A 4OTGA 1Q8WA 4WT6A 3KXMA 1L3RE 2GNLA 4G9RA 2HW7A 4XRJA 5M57A 4FT0A 3MFSA 2WIHA 3FLNC 4AGCA 4BF2A 3F3WA 3KULB 4FTTA 5FGKA 1PXKA 3I81A 1OL1A 4RMZA 2W99B 4ZSLA 3R9NA 3ZSHA 5ANDA 4M8TA 2XKEA 4QYHA 4BI1A 3OTVA 4O38A 3V5PA 4CFMA 1T46A 2YAAA 3GCPA 3QQGA 3CLYA 3EZRA 3HLLA 3QTRA 5KMJA 3CCNA 2WQBA 5FM3A 3FMLA 4IVAA 2C0IA 3NUUA 3VBTA 3V5JA 1JPAA 2A2AA 3E8CA 2XRWA 3Q32A 5AP3A 5T3QA 3RINA 4X2KA 2JBOA 4QQCA 3ZC5A 1OIYA 5FG8A 4ZZOA 3D7ZA 2ZV8A 4IB3A 5M09A 5HVKA 4MAOA 1ATPE 5ICPA 5HCYA 2QO9A 4NIFA 3ZUVA 4GFGA 4MWIA 2OWBA 2A19B 5H8BA 2GQSA 3L8XA 5CXZA 2QHNA 3UNKA 3CSVA 4TL0A 2X6EA 4HGLA 5E8WA 5CSWA 2WZJA 1ZYLA 3DJ6A 4G16A 2YABA 3RAHA 4RVMA 5CTPA 3ZUUA 4EH7A 4F1TA 4ZK5A 4YJNA 3QKMA 2VTMA 3H9OA 2Y7JA 4C58A 4PPAA 2YCRA 3NX8A 4NW6A 2GQRA 3QTZA 1PY5A 4OUCA 2OH0E 2VWWA 1JNKA 4GT5A 4JR7A 2BIYA 2HCKA 4IAFA 1YXVA 1JLUE 3Q5IA 4F9AA 5HU3A 2YLFA 4C33A 2J0IA 3Q4UA 2VO7A 4F7NA 4IVDA 4ITHA 3U6JA 4BI2A 4CCUA 4IX5A 3ZLYA 3A2CA 4O84A 3VC4A 4QP3A 4P5QA 2SRCA 3PXFA 4I24A 4BB4A 4A9UA 4EQCA 4IC8A 2V22A 4E7WA 1K9AA 4JDIA 2E9PA 3KN5A 4JLCA 4ZZMA 2QOIA 1CM8A 3BU6A 2BKZA 3LFDA 3L9NA 2JDTA 5F20A 5HTCA 1H1PA 2WMVA 2J4ZA 1V0OA 2QNJA 4O0YA 4NT4A 2QU5A 4F0IA 1J1CA 4FG8A 4D4VA 3CBLA 3ZEPA 2QOLA 5AUXA 4H05A 3BEAA 2UW9A 2QOFA 4YJQA 2Q0BA 4M67A 3FSKA 4G9CA 4USEA 4USDA 4O7WA 1G5SA 4XP3A 5HNIX 4E6CA 4EOOA 2CDZA 4IACA 3WZEA 1H4LA 3P7CA 3EN6A 2DS1A 2BHHA 2RL5A 3PE1A 4RC3A 4UY9A 2JKQA 4LUDA 5C26A 4OT6A 4C34A 4ACDA 5AP5A 3NGAA 4FKIA 4WIHA 2GPHA 3NEWA 5HG7A 1M2QA 5CF8A 1GY3A 4MXAA 1SZMA 3G0FA 3DDQA 4QYEA 4BYJA 3ZO2A 4YBJA 5BYYA 4Y83A 2FB8A 2O2UA 2R3MA 3QA8A 2XM8A 5EK7A 4BCHA 5M4CA 5AEPA 3QRTA 4F7JA 1WBPA 2UVXA 4E5AX 2OK1A 3COMA 4GFMA 4F0GA 4XMOA 4QMNA 4OTPA 2ITPA 1W98A 4RWKA 2FA2A 2XIYA 5IUIA 5LXMA 3ZXZA 4FKLA 3S3IA 3DAKA 2J0JA 4BTMA 2VNYA 3CPCA 3VBXA 1Y8GA 3AT4A 1IAJA 4QRCA 3FC1X 3KFAA 1OL7A 1KUTA 2ESMA 2H6DA 4YSJA 1YVJA 3ORPA 3VUKA 4C7TA 2VTAA 4FV7A 3SW7A 3ZRLA 1FINA 2HXQA 3KMUA 1R3CA 4E20A 5KMOA 4FKRA 3G9NA 3ZHPC 2C1AA 2H34A 3DB6A 3HUCA 3I0OA 5FBOA 3R9RA 3S1HA 4X2NA 4TYHB 4PWNA 4DFNA 1UWJA 1JWHA 5DE2A 1W7HA 2PVRA 5T68A 5IH5A 3FI3A 2BAJA 2V5QA 3OZ6A 2OICA 3UQFA 3KRXA 4JS8A 1WVYA 2XK7A 2BKKA 3OFMA 3BLHA 1OGUA 2I7QA 4NCTC 1JVPP 4FK6A 3SV0A 3TZ7A 3SD0A 3ZEWA 3GBZA 3R7EA 5ITAA 5L4QA 2XCKA 4XCUA 4PMTA 4JRVA 4OAUC 2R9SA 3KXXA 2XNOA 1HCLA 5J5TA 5CVFA 5ANIA 3FQHA 1JBPE 5IG1A 2R64A 2UZLA 2WOTA 3OWPA 3VF8A 3BHYA 4M97A 1H1SA 4K2RA 3R8ZA 4FI1A 5IA1A 3TNWA 2CMWA 1RQQA 1L8TA 5DEWA 5CENA 4I6QA 1M52A 4C36A 3FZTA 2CNVA 2I0VA 4Q5EA 2Y0AA 2XM9A 2WO6A 1XWSA 4JNWA 3Q96A 5AAGA 3AD5A 4CZYB 4FTQA 3LXPA 1QPCA 3DS6A 4DFUA 4MD9E 4LMUA 2GS7A 3BQRA 2IW8A 5LJJA 4EJ7A 1BKXA 3GCVA 2X0GA 1LR4A 4BCPA 4GU6A 5TR6A 4AOIA 3SC1A 5DOSA 5ETAA 4CV9A 4TN6A 5DRDA 3BHUA 4I6FA 4DAWA 2OZOA 5HZNA 3Q2MA 1UA2A 3QWKA 3GFEA 4JIKA 1PF8A 2FSOX 1Q3DA 1R78A 2YISA 3VF9A 1YDSE 3NYVA 4M84A 3QFVA 4FKUA 3DFCB 5HO8A 4YNOA 3ORIA 3SXSA 4BKYA 2YERA 5F4NA 5GJFA 3NUYA 5HQ0A 3WIKA 1Q61A 3AXWA 2BRMA 3TNPC 5A9UA 4M0ZA 1UKHA 1UNLA 3D0EA 4G5PA 4FSNA 5DG5A 2BAKA 1XBCA 5KMIA 1ZOGA 2B53A 4H58A 3CTQA 3E7VA 3EQHA 3QLFA 4FV6A 1OIRA 5AR4A 4AW5A 2WMWA 4O1PA 4G3FA 4EWQA 4IAIA 4CSVA 4LI5A 5LWNA 3KCFA 2YHVA 1M2PA 2VTNA 4O0WA 4FZFB 3WF6A 3NZ0A 1XH4A 4CYIA 5KMKA 2YIWA 3E64A 5IISA 5KO1A 4QMLA 2YWPA 4NZWB 5HBHA 3UBDA 1A9UA 1O6KA 1OPLA 1YHWA 1OM1A 2PVMA 2ZOQA 3ZO4A 4FODA 4DGOA 3DBCA 5LMKA 2R3LA 3HP2A 3LQ8A 3F7WA 4I0TA 5AA8A 2WEIA 3PZEA 3R00A 2GS6A 2XB7A 5FWKK 3ODYX 5JN2A 1F3MC 3UPXA 2GMXA 3PA4A 3AQVA 5CZIA 5DT0A 3FXXA 4ERWA 3QD0A 5CF5A 3GQLA 5IUHA 4HYIA 5F9EA 2PTKA 1PXIA 2X81A 3ZFXA 1YXTA 4GK4A 4U81A 5G6VA 3RAIA 4NL0A 3R1QA 5JK3A 4FGBA 2KTYA 3F2AA 3MIAA 1P4FA 2V62A 3C4EA 4BDDA 3IW7A 4YTIA 1PYEA 3ORMA 3OWKA 3UPZA 3HECA 3LFNA 1YHSA 3FY2A 3Q3BA 4DFYA 1OKVA 2NNWB 2PYWA 1SVGA 1YOJA 3JUHA 2XK3A 4O0VA 4AQCA 5KHXA 4GG5A 3I60A 3C7QA 2VU3A 3EN7A 3UVQA 2WU6A 5IDNA 2IN6A 4Y72A 3G15A 4TWNA 4XG7A 2UW5A 4V0GB 3UMWA 2QQ7A 2QR7A 1G8SA 3O71A 4ZSGA 4TNDA 3QX4A 3NIZA 3E3BX 2EUFB 4CMUA 4ACHA 5JFVA 4F08A 4HVHA 4D28A 5TOZA 1VJYA 5I9ZA 4ASZA 3HAVA 3G5DA 4AW1A 4BCFA 4BTJA 4DT9A 2BZIB 4L6QA 4FV4A 2W9ZB 4QD6A 3DKFA 4GSBA 5IA4A 2VX3A 4J98A 2W7XA 4A7CA 4R78A 4WRGA 5L2WA 1CKIA 4F1MA 5H2UA 3GC0A 5A4EA 4HNFA 3VAPA 3TL8A 4JVGA 4EC9A 2UW0A 3CKXA 1NA7A 3GOPA 4ANQA 2C6LA 3ORXA 4O7YA 2ITVA 3FKOA 4L3JA 3O51A 1FVRA 3LPBA 4YC6A 4HJOA 4FNYA 4IWPA 4JXFA 2PMIA 2BIKB 3JYAA 2C30A 2OU7A 2XA4A 4MTAA 3RMFA 4IEBA 4EH4A 4AOTA 4DCAA 2A1AB 4BCIA 4BCGA 1UU3A 4WG3A 4YLJA 5LVOA 3VWAA 2YM5A 3GU8A 5CVGA 4OAVB 4FNZA 5IQDA 1WFCA 4DTAA 3R1YA 1BL6A 3ZS5A 3D5VA 1ZOHA 3AT2A 3OCTA 3QQKA 2WTVA 3OCSA 5HNBA 4MH7A 3V8TA 3W8LA 2PU8A 4O7VA 3I5NA 3GGFA 1KOAA 5FEQA 2X39A 4D2SA 3L9LA 2BAQA 2AYPA 3OT8A 3ZZWA 2Q83A 3FMDA 4CYJA 4EK4A 5C8MA 2C6OA 3UVPA 4Y95A 3GT8A 3QQUA 5EHLA 5AADA 5HGIA 1YDTE 3BEGA 3NUSA 4CKJA 4GYGA 4KBCA 4LOQA 1Y91A 3TUDA 4WNOA 3VJOA 4BZNA 4I5MA 4EHZA 1FGIA 4PL4A 5ANGA 4C4FA 4O96A 2VTHA 3DA6A 3LM0A 4QP9A 5CEIA 2ONLA 4D2PA 5BPYA 5C8KA 2CN5A 2ZB1A 1Y6AA 4R6VA 3SLSA 3DXNA 5FRIA 4G1WA 4J1RA 5K4IA 3KN6A 4Y73A 2B52A 3ZBXA 3N4VA 4FEXA 2WTJA 5AIKA 3BYUA 4Y85A 3QCQA 4N57A 4GIIA 4PNIA 4PF4A 3NUPA 3GI3A 5H8EA 4EOSA 3RGFA 3TXOA 4E5WA 3NUAA 1XO2B 4ZJJA 3M42A 4DFXE 1VEBA 4O7LA 4X2GA 2ZMCA 3II5A 1OL5A 2JEDA 4RSSA 3CTHA 5HHWA 2C3KA 3SRVA 1ND4A 4BY9E 1YOMA 3BWJA 3R6XA 2HY81 4FC0A 3R7OA 3FZSA 2OXXA 3NNVA 3VN9A 3LHJA 1J3HA 5HNGA 5I9WA 1G8AA 4U41A 3GCUA 5EI6A 4FV3A 3KB7A 5E8XA 4ZTHA 4ZTSA 3LAUA 5KZ0A 4D58A 1J7LA 4FEVA 2CSNA 3RM7A 5FM2A 3RK7A 4QPSA 2Z60A 3VBYA 4WBOA 2C4GA 2Z7LA 3DTCA 4BZDA 5AUZA 3PRIA 5D41A 4CT2A 4YHJA 3R9OA 3W2QA 3UYSA 4OTFA 4IAAA 3VUTA 3O8TA 4BDEA 2W1DA 4EK6A 5LMBA 1Q99A 4QMWA 4IVBA 4YHTA 4RIYB 2REIA 2YZLA 2XYUA 3S0OA 2XIRA 2RG5A 2W4KA 5CI6A 3K5UA 3UNJA 4C61A 1HOWA 3A7IA 4C37A 3F5XA 4JOAA 1JSUA 4B6LA 4R77A 4HYUA 5AA9A 2RF9A 2FYSA 2XNNA 5EYMA 4RC4A 4I1ZA 5HE3A 4CTCA 4FA2A 5C8NA 3UQCA 5IKWA 1J7UA 4DH5A 3LMHA 3LFCA 3C51A 1FVVA 5GINE 4MX9A 4X7QA 1FMOE 2NO3A 4WBBB 3RVGA 3BE9A 5CNNA 4TYJA 3R7IA 3RAKA 2RFEA 2F57A 5LARA 3A7FA 3R22A 3C1XA 3RP9A 1H08A 4DGMA 5AP1A 3NVMB 1QCFA 3DKGA 3COKA 3DPKA 1J91A 4IX3A 2BUJA 2JKMA 4KINA 4PQNA 5AR8A 2VTSA 2JGZA 4ITIA 4KD1A 5DRBA 5AP7A 3I0QA 5HE0A 4K11A 1B39A 4I22A 3TJCA 5M53A 1WBOA 3WF5A 5BVOA 2EB3A 4O91A 2XIZA 5AV3A 3TIZA 1XH6A 2JFMA 3BRBA 3C4WA 3ETAA 4A07A 3LOKA 4LGDA 5HI2A 5IEXA 3OW3A 3UVRA 4CG8A 1ZMUA 4WG5A 3L8VA 1PW2A 3R83A 3NWWA 4R7HA 4ENYA 3QQHA 2WTIA 5L2QA 4FZDB 5CYIA 4Y5HA 3EFWA 4MBIA 1BUHA 1XH7A 4EUTA 4O7TA 4KB8A 3UOHA 3RHXA 3OOMA 4UMPA 2YCQA 1Y8YA 4FSUA 2YDJA 2UZNA 4AXAA 1NVRA 3EB0A 4IAKA 4ZY4A 4QT1A 4ZS4A 3VJNA 2VRXA 4AGUA 3WYYA 3FJQE 3V8WA 4YHFA 3W1FA 2PZYA 5I9VA 2QD9A 2QKRA 2WTKC 4M69B 4FEWA 5JQ8A 3DB8A 4GFOA 5GJDA 4NWMA 3AGLA 4K8AA 3IW8A 4PDPA 4YMJA 4YLKA 2DUVA 1BMKA 1XKKA 3R1SA 4X2FA 5IU2A 3ENMA 4ACMA 1WMKA 3RTPA 5EOLA 2ZV9A 5LVPA 4LYNA 4LMNA 4M69A 4ASXA 3SXFA 1YWVA 3CQWA 3EN4A 4FKQA 4M13A 4O0TA 4XP2A 5A14A 3HV3A 5IH4A 4UZDA 3BIZA 5GZ9A 4YTCA 4W4WA 3I5ZA 1H24A 1Q41A 2PK9A 3GENA 3KRLA 3PRFA 3PY1A 4Q9ZA 1JKSA 4P4CA 4CEGA 4RC2A 2WFYA 4NM5A 1ZRZA 1PXJA 3TNQB 3WZJA 4YC8A 3C0GA 5DR9A 5CAUA 1O6YA 2HOGA 5J87A 3W10A 4RZVA 2PUNA 1ZY4A 4ALUA 4GKIA 3ORZA 3R7GA 3UO4A 3VUHA 3PG1A 3WYXA 3QWJA 4JDHA 4MD8E 5CS6A 4JBPA 5IUGA 4A9YA 5EYDA 2RFDA 5CASA 4GYIA 2OLCA 3G6GA 3OOGA 5D7AA 4XS2A 1TQMA 5BMMA 5CAOA 4FEUA 5AR7A 1Y57A 2UW6A 2VUWA 3D2KA 5EYKA 3EYHA 5DR6A 3AC3A 4B7TA 1XBBA 3EH9A 3HGKA 4EH3A 5E8VA 3FZRA 3QUEA 1Q97A 1R1WA 4UWBA 5FP6A 4UX9A 2VNWA 3O7LB 4F99A 1YWRA 4NKSA 1ZYSA 3I1AA 2CNQA 3FYJX 1PKGA 3IW4A 2OJ9A 5HLWA 5IQFA 2YN8A 1KSWA 3R71A 5KKRB 3M11A 1GIIA 2QURA 2Y4IC 2ETKA 4YZDA 5J9LA 5TT7A 2ZM4A 4AZWA 2GTNA 4TWPA 3NNUA 4GVAA 4FNXA 4WNKA 1CDKA 4ACCA 4DG0E 3VUMA 4ASDA 3GCSA 4FBXA 4XG6A 5DI1A 4ZAUA 4DFZE 5BMSA 5AR5A 4ZIMA 2H8HA 3LE6A 4RX8A 5CZHA 3TV6A 3D5XA 3ZFMA 4O82A 5E1SA 1QPDA 1M7NA 5DN3A 4J96A 1PXPA 4HVGA 5E91A 5AM6A 3IPHA 2NPQA 4CFVA 4RPVA 2KULA 3FSFA 3S2PA 4XOYA 4D5KA 4GMYA 3PSDA 3ZUTA 3K3IA 1OPJA 4IWOA 4HW7A 1W8CA 3MSSA 4MVFA 2W4JA 5FEEA 5AIRA 5M44A 4MF0A 1BL7A 2JDRA 4RX7A 5BYZA 4NTTA 4BDJA 4IZYA 5DT4A 2EB2A 2J2IB 2G2IA 3FE3A 4FTKA 4QO9A 3R0TA 4RT7A 5AP6A 1JOWB 2B54A 2BRNA 4EYMA 4HVSA 4Z16A 3ITZA 2YIRA 3HEGA 3NUXA 1Q24A 3F9NA 5CI7A 3TTIA 4D2WA 3ET7A 2JAMA 3G6HA 1ZLTA 5HORA 3EFJA 1LPUA 3R7YA 3BGZA 4F6SA 2I0EA 2Z8CA 3AC1A 4I0RA 3VQHA 3PWDA 5CXHA 5HCZA 2QI8A 4QPAA 5B0XA 3F7ZA 3IGGA 3QYWA 4RJ6A 4RG0A 5IPJA 4BCKA 4C02A 2C0OA 4IW0A 2AC3A 4ERKA 3MS9A 5LCJA 5E4HA 1U54B 3CY3A 4I20A 1KV2A 3G9LX 4FTCA 4BDFA 3UG1A 1ZOEA 3O50A 3NS9A 1GZNA 1Z9XA 3K2LA 4RVTA 4FTRA 4QMOA 3RPOA 1O9UA 1Q3WA 4I5CA 4JAJA 3M1SA 3MB6A 4PPBA 3WARA 3PPKA 2FSMX 3CXWA 4DGNA 2HK5A 3D15A 1YHVA 2VO6A 4X6QC 4EOLA 5A4LA 4UWYA 1YXUA 3A4PA 3GC9A 2O8YA 3FL5A 5CQWA 2ERKA 4H1JA 4AT5A 1OB3A 1WBWA 2CCHA 3QU0A 3P79A 3MGYA 3OC1A 2HZ4A 3FY0A 2W9FB 4FIJA 3FLWA 4ZXTA 3TJDA 4XHKB 4IB5A 3HV7A 4IZAA 4EJNA 5HE2A 4NCTA 2X9EA 4TT7A 4L9IA 3R9HA 2XZSA 4MXCA 4DGLC 4YPSA 4BIDA 4DCEA 3W2SA 4RBLA 4ZLOA 4NIFB 3KCKA 4LGHA 3TT0A 4FGRA 1SM2A 1P2AA 1W83A 3C13A 3LQ3A 5C4KA 1BLXA 2ZMDA 3H10A 3LCDA 3EYGA 3CKWA 4HYHA 3PPZA 2C6IA 4YZBA 5FBNC 3NNXA 4C35A 4QMTA 4DC2A 4PMSA 3U8WA 1GZKA 4A4XA 2X1NA 3BE2A 2GS2A 3U9NA 3U51A 4FSRA 4BCQA 4S30A 4G34A 3BBTB 5EYCA 3UQGA 2C5OA 3LVPA 5K3YA 2IWIA 5J1VA 3HRCA 4Q5HA 4YZMA 5HCXA 3GU7A 4FVQA 1KV1A 3WE4A 3BWFA 5GIPE 2Z02A 5IF1A 5DGZA 2JLDA 2LGCA 4DTKA 3FXWA 2R7BA 3QGWA 4CKRA 2YJRA 4ZY5A 2R0UA 2VD5A 2H9VA 1PMNA 3CP9A 1H28A 3H0ZA 4OTIA 2X8IA 4NTSA 1PXNA 3UODA 4EKKA 4UN0C 3R2YA 2BCJA 1KOBA 1WBSA 4X6RA 1BI7A 3IONA 4QP8A 2UZWE 5CX9A 4L43A 3WZKA 4BGHA 2W4OA 4BWKA 1PHKA 3ANRA 4F6UA 1WCCA 1VZOA 5LVNA 4YTHA 3LKMA 3HDMA 4KBAA 4CZUA 1GIHA 3PYYA 2O3PA 3PA5A 2C6DA 4KIKA 4QP7A 5HOAA 2R3QA 4O21A 3OXIA 4C3FA 2WQEA 2IG7A 4AA4A 2YCSA 3TWJA 2B9HA 4CQGA 1H0VA 4C3PA 2WPAA 2CGUA 3LLTA 4WG4A 3VIDA 5AP0A 1KE7A 4XG2A 4AZEA 5D7VA 1Q5KA 3OP5A 2ERZE 4IE9A 4WOVA 4BR3A 2YDIA 3GB2A 2BDFA 2VN9A 4E26A 5GJGA 3QUPA 3CC6A 3I6WA 1U5QA 3DNEA 3RK9A 4U42A 4XP0A 3A62A 3OF0A 4YJUA 3EWHA 3U4UA 1WBNA 3QGYA 5CAVA 4MK0A 1F0QA 4HCVA 2CPKE 2J50A 5AUTA 3VHKA 2R3IA 2GU8A 5EDRA 4ZY6A 3SVVA 2O64A 4I6BA 5AV2A 1UNGA 4NW5A 4RJ4A 4UEUA 4ZJIA 4B0GA 3LFEA 1KE5A 2QR8A 3QTQA 2XP2A 3DBQA 2VTJA 4QMYA 4O0RA 3V5WA 2X2LA 3PVWA 4IX4A 1JSVA 3R8MA 4IBMA 3PXQA 3VRZA 1H1QA 2JAVA 2VO3A 4LRKA 4RIWA 2OXYA 3KRRA 1PMVA 4QQJA 3KXGA 3TCPA 3UG2A 2W06A 3MVMA 2P2IA 3QXPA 2FSTX 3UO6A 4X3FA 4XG4A 4XV1A 2ZJWA 3R01A 3RCDA 3RZFA 4GK2A 4E6DA 3DJ5A 2R2PA 3PVGA 4LV8A 4U43A 2HYYA 5L6OA 5EFQA 2YIXA 3FBVA 2J9MA 5J1WA 3F88A 3SHEA 1U5RA 1W0XC 1FMKA 2WIPA 3FLQA 4I4FA 5DMZA 4D2VA 4E1ZA 4ZSAA 2ZDUA 5HLNA 4LGGA 3MESA 4G2FA 4CXAA 1OKZA 3EFLA 4OT5A 3ZZEA 2C6MA 2W5HA 3R02A 3FLYA 2X4ZA 4V04A 5BVFA 4S32A 4XLVA 4R1VA 4O6EA 2VWZA 4QNAA 3QQJA 2UZEA 4L67A 3TTJA 5C1QB 4U5JA 5EM5A 2BTSA 4HGSA 4HPTE 2OG8A 2WMUA 4H3PA 2WB8A 4FNWA 4L8MA 4QYGA 3QLGA 4K77A 4AAAA 3MWUA 3FMMA 1MRUA 3DDPA 3UDBA 5AR3A 4IWQA 3MB7A 3JY9A 3EL8A 3MIYA 2IVVA 1BI8A 3SGCA 3R1NA 5B2MA 3HAMA 2J0MB 2WD1A 5TO8A 2ZM3A 1RJBA 2GQGA 3OS3A 4BCJA 4E6QA 5IQIA 4AE9A 2OFVA 2JBPA 2OZAA 4OBQA 3HVCA 3FPMA 3G2FA 4G17A 4U45A 4H1MA 4MXOA 4FX3A 3LMIA 3OROA 4BKZA 3I79A 4I93A 3RPVA 4GS6A 2E9NA 3Q5ZA 4USFA 5J7BA 1B38A 4FK3A 5M4IA 2B9FA 4KIOA 5BVNA 4HOKA 3LXNA 3VO3A 2W1CA 1U4DA 5D11A 4AU8A 4C2VA 1ZYCA 2HWOA 3CIKA 5JGAA 3PPJA 3NUNA 5K5NA 5L6WL 4FIFA 3W32A 4APPA 2ITYA 3EZVA 5L2TA 5I9UA 3KA0A 4F9WA 2BRGA 4UMUA 5L8LA 2VWYA 3KVXA 1B6CB 4QP6A 3IW5A 5JFSA 3OUNB 2IZUA 5DIAA 4HPUE 4QMUA 2WMQA 3PP0A 5EOBA 2R3KA 4U80A 2QVSE 1H8FA 3ZDUA 2XH5A 2BDJA 3PIXA 4DA5A 3Q9XA 4XEYA 3CGOA 3FZOA 4F1OA 5HU9A 2UZDA 4E4MA 3QHWA 2RKUA 4P5ZA 2CCIA 3A61A 1P5EA 4EK3A 5M4FA 4JQ7A 3LFSA 3PIZA 3T9TA 3MPTA 4EQMA 3NW7A 1FQ1B 4G6LA 4EOKA 3Q52A 1JSTA 2DQ7X 1SMHA 3WE8A 2GNFA 3MH3A 5CEPA 3UJGA 4L3PA 2WOUA 4AN9A 5C27A 1E1XA 3HV5A 3PY3A 4K6ZA 4PY1A 4CRSA 4CNHA 2UW7A 1PXMA 3GNIB 4TWCA 3GOKA 4FVRA 3ZO3A 4AACA 1EH4A 2XEZA 4MNFA 4ID7A 5HTBA 4AW2A 2VV9A 4AGDA 3CEKA 2PVYA 3CR0A 5FXSA 2XJ2A 4AUAA 2XK9A 1GIJA 3MJ2A 3RCJA 3ZONA 4C2WA 4XUFA 4YO6A 2PL0A 3NW5A 4AG8A 4D9TA 4YNEA 3FDNA 3EQPA 4EI4A 3PLSA 1CKJA 4NYEA 3GU5A 3MA6A 3MTLA 1CSNA 3EFKA 3MH2A 3NNWA 4L00A 3QCSA 4S34A 5AAFA 3FKLA 3Q9YA 3R7UA 3MFTA 3WZDA 2O0UA 4QP4A 1FBNA 3MJ1A 4EHVA 2PVJA 4NSTA 4FZ6A 4IHPA 4ZTRA 4DN5A 3OCGA 4X3FC 3B2WA 4R3PA 2QOBA 3TNHA 3NAXA 4W4XA 3ZLWA 3AD4A 2C5VA 2WQNA 5C01A 2HZNA 4WO5A 3MBLA 4FUXA 4U40A 4IVCA 4UWCA 4BTKA 5KX8A 3CPBA 4DITA 4EORA 4DEBA 3MFUA 3MPMA 3OHTA 4CMOA 2X7OA 1YXXA 5EW3A 4TPTA 1M17A 5J95A 3E8DA 3ULZA 5TE0A 3WF7A 4EONA 4L7FA 4F9BA 4FSWA 2HXLA 4AN3A 5AV4A 3NYNA 5BQ0A 5M4UA 2B1PA 4AW0A 4CQEA 5JQ5A 3W16A 4ARKA 4LOPA 3MVHA 2BZJA 1ZWSA 4DT8A 3OT3A 4Z55A 4CD0A 4O7ZA 3TUCA 2W1ZA 4FR4A 5CSVA 4I5HA 4HNIA 1UU7A 4G3GA 4GL9A 2ETRA 2Z7RA 1STCE 3D7TA 4O1OA 3ZLXA 2VTOA 2IJMA 3C4ZA 1BX6A 4FV2A 2GCDA 3MVJA 2V0DA 3ZC6A 4AP7A 3K3JA 2YFXA 3RPSA 2YJSA 4XRLA 3Q6UA 1FPUA 2F7ZE 2QOOA 4CKIA 4CFUA 4ANNA 4PRJA 4D9UA 1ZZLA 4IB0A 2OJFE 2YIYA 3BBWA 1JKTA 3KEXA 4EKLA 4F70A 4FYNA 2WHBA 3IECA 3G51A 4WUAA 4EOQA 5IQGA 1OL2A 3FI2A 3NMUF 4LL5A 2VTTA 4LRJA 4E73A 1JKKA 2EU9A 2GNGA 3VNTA 4BCNA 4CMTA 4FKOA 4FOCA 5CU2A 2J5EA 4MBLA 4MXYA 3FI4A 4FL3A 2YIQA 2DYLA 2WTKB 2F7XE 4C3RA 5AMNA 1F5QA 3LM5A 3HRFA 4J95A 1U59A 3ULIA 3PA3A 1REKA 3A7GA 4PL3A 2Z7QA 4C4EA 4BVUA 3ZU7A 4E6AA 3Q4ZA 4AT4A 5M06A 4IM3A 5CSHA 5I5ZA 3HNGA 4BYIA 3AMBA 5DLSA 3VS6A 4K0YA 4BDBA 3DGKA 4YPDA 1XH9A 3ZFYA 3ATTA 5K5XA 5I3OA 2V55A 3Q4CA 4JQ8A 4MBJA 4CTBA 4PV0A 3PWYA 2WXVA 3W55A 2WNTA 2R5TA 4RJ3A 1SVEA 2XIKA 3AGMA 4LV5A 3D2IA 2WELA 4BCMA 3RM6A 3FWQA 3DLZA 2WMRA 2AUHA 4A4OA 2J6MA 1S9JA 3IS5A 3FMHA 2E9UA 5EKOA 2C3JA 4L68A 5KMNA 3PSBA 5LQFA 5AFVA 3L8SA 2Y6OA 2PE2A 5LCKA 5A46A 4AA0A 3KK9A 4FV0A 4AS0A 4FSMA 4EHEA 4BN1A 5HVJA 5CT0A 3KC3A 5HESA 4O7RA 1YW2A 2UZTA 3F3UA 3WI6A 5I9XA 2QCSA 4BHZA 5K9IA 1H25A 4WHZA 5G1XA 5CEKA 3NLBA 4YJRA 3IDBA 4XV2A 4IAZA 4KABA 5C03A 3SRVB 2PHKA 4TZRA 4IM0A 4EZ5A 2QLQA 2YLEA 2W5BA 4RFMA 2VGPA 3ZXTA 2OIBA 4QMXA 4KIQA 1ZAOA 1DI9A 4DLIA 1Z5MA 4QMZA 2Y4IB 3FV8A 3SX9A 3LW0A 2YACA 3HUBA 4KS8A 5BUIA 2G15A 3QUDA 4NJDA 5FQDC 2HELA 5J7HA 3PG3A 2X7FA 2WKMA 4PL5A 2HY0A 3FZ1A 4J97A 3UTOA 3FI8A 4NU1A 3AG9A 3BZ3A 4G31A 3AC8A 4YJSA 3DY7A 4G3DA 3UOLA 3UIXA 3BQCA 4RWJA 3C4XA 2ZV7A 3R9DA 2VWXA 1J7IA 3LJ0A 5J8IA 4FTJA 4FUYA 3DAJA 4C4HA 5LOHA 4B99A 3PFQA 4XBUA 3UIUA 1YRPA 4JQEA 1OL6A 1WVWA 4UV0A 4FKJA 4M3QA 5AV1A 5A54A 3DXPA 4U3YA 3OEZA 3F5UA 4RIXA 4ZOGA 4D1XA 3VVHA 4FTLA 4RRVA 3HDNA 4UBAA 3T9IA 5AUUA 5HKMA 5C4LA 5FEDA 2PUPA 4L3LA 3EJ1A 3ID6C 3WIGA 1WVXA 2C5YA 4NM7A 3D5UA 3DTWA 4H3BA 5AWMA 4GUEA 3COIA 3D14A 4EWHA 3F5PA 5GZAA 2JFLA 5HTIA 1IAHA 3R21A 3UZRA 4F63A 4F7LA 4FG7A 4JDKA 4QQTA 4MXXA 3KRWA 2BR1A 2W05A 3ERKA 2B55A 2QG5A 4R5YA 3DBDA 4TXCA 4ZZNA 4PPCA 4YJPA 4AWIA 2XK4A 2PSQA 2P4IA 3DKOA 4UYNA 5CQUA 4ONAA 3E92A 3NCZA 3FC2A 3OW4A 4O22A 3IOPA 3NVKI 3VS0A 3MI9A 1JQHA 3CQUA 3QCXA 4YJVA 2X7GA 2XVDA 3GUBA 4W9WA 4I4EA 4U7ZA 5L8KA 2J0KA 4IJ9A 5DWRA 5CWZA 4E4XA 2C6EA 3Q9ZA 3OD6X 4MKCA 3BGQA 3H0YA 3QRKA 3U55A 2X9FA 2J5FA 4CFFA 4OTQA 3K54A 4O86A 3OEFX 3S4QA 1XJDA 3PVUA 2JDSA 4KBKA 3ZM9A 3IGOA 4IIRA 4BCOA 3UIBA 4I0SA 3TKUA 2WQOA 4XV3A 3V5QA 4IB1A 4BDCA 4G3EA 4XG9A 3UC4A 4CFWA 3HRBA 3H9RA 5I0BA 4MD7E 3ALOA 4LM5A 2WMTA 4ANLA 3UZPA 4FKPA 1FGKA 3ORNA 2VTIA 2HWPA 1NT2A 4ANOA 2PZPA 3EQRA 4WKQA 2I0HA 3KQ7A 3EHAA 5TF9A 4B8MA 1WBVA 4D4RA 3BYOA 4ZEGA 3BHHA 5AP2A 5LVLA 3TUBA 4TTHB 1RE8A 1ZYJA 1NVSA 3QC4A 3T8OA 4DEGA 4FEQA 3DZQA 4PDOA 3CQEA 3QZGA 3W2PA 5ANJA 4JBQA 2YM3A 4D2RA 3POOA 1YI4A 4RVKA 4GIHA 2YCFA 3UP2A 2F49A 2XK8A 2WQMA 4RA5A 3V01A 2CLXA 4AF3A 4DH7A 3KK8A 1M14A 2V7OA 2OI4X 2JDVA 2QLUA 3O96A 4Q9SA 3O17A 4UXQA 4QMPA 4U97A 3D4QA 4CV8A 2OF2A 4E3CA 4IJPA 2YA9A 3O23A 3PVBA 4FV1A 3O2MA 2R3NA 4H3QA 3V5TA 4FIHA 5AAEA 2GDOA 5JKGA 3PXKA 2BPMA 1O6LA 3CE3A 3F2RA 2E9OA 3Q6WA 4DH1A 4BL1A 5J9ZA 5DHJA 4J53A 3CJFA 5AUVA 4II5A 5LMAA 2VWBA 3D83A 4GJ3A 4UMQA 3DK3A 2CHLA 5E90A 3IG7A 4FZ7A 3K5VA 3QRJA 2WGJA 2YM8A 4B9DA 1MQBA 4DTBA 4FKTA 3EN5A 3REPA 2NRYA 5IA5A 3HX4A 3NAYA 4FKVA 1CKPA 4IDTA 3ACKA 1ZYDA 1KE6A 3BX5A 1KE8A 1NY3A 5D12A 2HZIA 1H27A 2OW3A 3PTGA 3DK6A 3LFQA 4NFNA 3ZRMA 4F64A 4FSQA 3NCGA 4J52A 3D9VA 3AMAA 4FTMA 4C57A 1AGWA 4QMSA 2WMSA 4WUNA 1IRKA 2VX1A 4OR5A 2OIQA 5CU4A 5A3XA 2PMOX 2G01A 4R7IA 3VUIA 4NM3A 4BIBA 5IQAA 5CU6A 4BWPA 4PTCA 3HMIA 5DFPA 2W17A 2WMAA 5F95A 4ALVA 3E87A 1VR2A 1Q4LA 4MQ1A 4UALA 4D5HA 4JG7A 5FXQA 5F94A 3TKIA 4FTIA 3G0EA 1YDRE 3F5GA 3DOGA 2Y4PA 2E2BA 4FOBA 2YM4A 2ZB0A 4EOIA 4EUUA 3JXWA 3TEIA 3DQXA 5IEYA 4U44A 5HBJA 4JBVA 2BALA 3NYXA 2W1GA 4C4IA 2X2KA 1H01A 4RX9A 3FMJA 5IEVA 3OWLA 5BVDA 3U54A 3JR1A 2XJ0A 3VBWA 3BLRA 5EG3A 4GU9A 3R8PA 4BZOA 5IH6A 3O7LD 4XBRA 1NVQA 1H0WA 3P23A 3TV7A 3QKKA 4HVIA 4FV9A 3EMGA 3IK3A 5FTGA 4RLLA 4S33A 4J8NA 4KA3A 3UMXA 4NK9A 3ZH8A 4IZ7A 4C38A 5HEZA 1OUKA 2UV2A 4FZAB 3UO5A 3NR9A 5ETCA 5DBXA 3RI1A 2G9XA 4XYFA 3GCQA 4D55A 4RWLA 5JSMA 2JIVA 2FO0A 3DV3A 5E8YA 2VX0A 2VTPA 1PMEA 3FZPA 4OBOA 4QTAA 4BFMA 2F2CB 5BX0A 3T3UA 5K4JA 3HMNA 2G2HA 3CS9A 5E1EA 2CKPA 3VBVA 2ZAZA 3EIDA 3I6UA 2XNMA 4FTNA 4HCUA 4MEDA 4OTRA 4WRSA 3RHKA 4FL2A 2P0CA 1DS5A 2JKOA 3FMNA 2R3FA 3E8EA 4G3CA 4QTCA 4XV9A 5K0KA 1OPKA 3I7BA 3KF7A 3PJ1A 4IADA 3V3VA 3DLSA 3H3CA 3W8QA 3W2CA 4WSQA 5GNKA 4I21A 4PP7A 2CGXA 3B8QA 1LUFA 4BICA 5ETIA 2QC6A 3QZFA 5M55A 4IANA 1RW8A 3BHTA 2UVYA 3PJ3A 3PJCA 3GU4A 3MYGA 2IW9A 4JAIA 2IZTA 4CRLA 2UZVA 4JJRA 4N6YA 1I09A 1OKYA 5BVWA 5A6OA 2QU6A 2R3PA 2JKKA 4BBEA 4FSYA 1ZMVA 4BBFA 2XNGA 3EQGA 3T3VA 2Y9QA 3UYTA 3QZHA 1E1VA 2GFSA 4OTHA 4P7EA 3PY0A 5J5SA 1K3AA 2XKCA 2R4BA 4F4PA 5HX6A 4E4LA 3LXLA 3C50A 1DAWA 3WF8A 5EM7A 5E7RA 4FICA 4JX7A 4YSMA 5D10A 2IO6A 3KXNA 3VUGA 4CT1A 1IA9A 3VS2A 2NP8A 2C0TA 2W5AA 3HMMA 3KULA 3EQIA 3FAAA 3FQEA 4FSZA 4TKSA 3RWPA 2B0QA 3R28A 4EOMA 5L2IA 2O65A 3Q04A 4I92A 4U9AA 3OCBA 5BNJA 4XOZA 3SKCA 4PMMA 4EEVA 2W1FA 3E7OA 3I7CA 4RJ5A 1FOTA 2WU7A 3F66A 5CEQA 4R3CA 4EZ3A 3VS5A 1M2RA 2J7TA 5JMSA 2VWUA 4RA4A 4O0UA 1PKDA 2ETMA 2PMLX 4MHAA 4MNEB 2WAJA 3W18A 2EXEA 3PXYA 4ANMA 4L52A 2OSCA 4KIKB 3EKNA 5EI2A 5HG8A 2B7AA 4EH8A 4L46A 2CKEA 4IFCA 2Y6MA 3ROCA 1QPJA 3JPVA 4TRLA 1SVHA 2BRBA 4FMQA 4MNEA 3Q60A 4S2ZA 3QA0A 2OGVA 4O83A 3THBA 4KIPA 4R1YA 3P5KA 4O7SA 5ANKA 4G6OA 1QMZA 4RGJA 2I6LA 4BRXA 3PXZA 5KBRA 2ZV2A 1UWHA 3WOWA 2QONA 3PUPA 3AC4A 4HZRA 1U46A 2XYNA 2O5KA 2BILB 4DFBA 4AX8A 4XG3A 3MH0A 4CZTA 5E8UA 1NXKA 2X6DA 4GG7A 2C69A 3IKAA 3NDMA 4FIGA 5B7VA 4O7NA 3BU3A 3G90X 3H4JA 4FKSA 4ZTNA 5A6NA 1H26A 4GW8A 2XBAA 4IH8A 5HIBA 4C4JA 4YURA 5DVRA 3LFBA 3LJ2A 3KRJA 3VW8A 4E4NA 3D94A 4BBMA 3OXTA 5KKRC 1PXLA 3QHRA 4QYYA 2QO2A 2XF0A 4M12A 4RIWB 4CCBA 4U79A 2BHEA 4BDKA 1TQPA 5KCVA 5D1JA 3ZMMA 3ALNA 3AT3A 4FV5A 4M15A 3UE4A 3DKCA 2QOCA 4JI9A 2FSLX 1OIQA 2ACXA 5E92A 4X3FB 5DH3A 3Q4TA 5JRQA 5KBQA 4DFLA 3EL7A 3ZDIA 1DM2A 4X21A 5FP5A 2EXMA 2W1HA 3C9WA 3ZO1A 3ZTXA 3UIMA 4Z3VA 4AZFA 4FT7A 3ZLSA 3TN8A 5BUEA 1OMWA 2WMXA 1SYKA 4IZ5A 4LQMA 2BMCA 5E8ZA 4GH2A 1WBTA 4F7SA 4DE4A 3QKLA 4H36A 1VYWA 4OGRA 3UGCA 5JGBA 5IQHA 4PMPA 3DFAA 3PIYA 3R8LA 2QOKA 2RGPA 4R8QA 3RPYA 1Q62A 4YR8A 1AD5A 2PUIA 3ODZX 3VHEA 1IR3A 1XQZA 3TV4A 3LLAA 3OG7A 3RKBA 4ANSA 5CANA 2RFNA 2PE0A 3PJ8A 5CLPA 4DEIA 5L3AA 3BV2A 3F3VA 5BUJA 3ACJA 3L8PA 2R3OA 3OBJA 1Q8UA 4WA9A 4E8AA 3RAWA 3FQSA 2YDKA 5AX9A 4PUZA 4CLJA 4GKHA 2QKWB 4DG3E 2GTMA 2HZ0A 3GP0A 5IZFA 4RLKA 2EXCX 4YJOA 3JVSA 4TYEA 4C62A 3ATSA 3TG1A 5HICA 1PYXA 4WSYA 4ZMFA 2XKFA 3KMMA 2PVLA 3GU6A 2ZDTA 3PJ2A 4N0SA 1SNXA 5FDPA 5CF6A 3EKKA 3HV6A 4MQ2A 5DR2A 4F09A 4GT4A 3W2RA 4ZTMA 5H3QA 4EYJA 2CJMA 4DEAA 2OZAB 2CKQA 4YBKA 4MWHA 3VW6A 3MY0A 4A9TA 3LCKA 4XG8A 3L1SA 3AMYA 5FD2A 5HO7A 4KUJA 5EW8A 3UC3A 2VTRA 2PVNA 4TW9A 4QP2A 4FTAA 3QD3A 3AOXA 4EBVA 5GIOE 3FLSA 3E5AA 1OUYA 2OF4A 3OY1A 4XX9A 1MRVA 4BC6A 4DEEA 3HL7A 3R7VA 2PWLA 4KKHA 2CLQA 2HW6A 3MVLA 3KY2A 4EL9A 2BTRA 2I0YA 4TYHA 1RDQE 4KRDA 4EBWA 3ZRKA 3F2NA 3V8SA 4Y5QA 4M66A 3ENHA 3O0GA 5IQCA 3R73A 3LJ1A 4QYFA 4N4SA 2P3GX 2PVFA 3TNIA 3MA3A 4DHFA 4I41A 2PULA 3RK5A 3WBLA 4FKWA 2BVAA 1VYZA 1X8BA 3BYSA 3RZBA 5JT2A 3KMWA 4TY1A 4KNBA 3BELA 2PUUA 2Q0NA 5AUYA 2UVZA 4OBPA 2UW3A 2FH9A 2JDOA 4TYGA 3KXHA 3U87A 4BI0A 2QG7A 2XNPA 4EH5A 4ZTQA 3MY5A 5C9CA 4JG8A 3P4KA 1UU8A 2OJGA 3I4BA 3FPQA 3ZM4A 2XJ1A 3F3ZA 1Z57A 4RZWA 3OVVA 3FUPA 3NW6A 4TNBA 3E63A 3QX2A 1UV5A 4IXPA 3M2WA 1IG1A 4O0SA 1JKLA 2IZRA 4DINA 4Z7GA 5IDPA 3TI1A 3QYZA 4FT9A 2OO8X 3HA8A 2HAKA 3Q2JA 3QXOA 3VS3A 3HA6A 5CU0A 4ITJA 4BKJA 5TKDA 2J0LA 4UMTA 2R3RA 5ACBC 1ERKA 1Y6BA 1G3NA 3C5UA 5IA2A 5M07A 3SAYA 3SW4A 3QC9A 1UNHA 3NPCA 1REJA 4FIEA 5AJQA 4NM0A 4Y46A 2GSFA 1YKRA 3ORTA 4D4SA 1P14A 3DZOA 3LFFA 4ZMEA 1OZ1A 4JIAA 5EQPA 3JS2A 4U8ZA 2VWIA 1YWNA 3GC8A 4V01A 3U6HA 4LG4A 3DT1A 1OI9A 1YOLA 1M7QA 4RX5A 3N4UA 2ITQA 3L9PA 4GK3A 2OKRA 3SDJA 5HX8A 4AGWA 1S9IA 2ITWA 4E93A 4Z7HA 5B2LA 4L44A 3A7JA 3DAEA 1NW1A 1GZ8A 4F9YA 3A4OX 5CT7A 3AC2A 5CY3A 3VS4A 3TACA 1T45A 5KMMA 4DLJA 3N9XA 3AC5A 3BCEA 3CGFA 2GFCA 2JC6A 3FXZA 2XRUA 1J1BA 2JD5A 4EH2A 5HBEA 3ZOSA 4UB7A 2R3JA 3LMGA 2F4JA 2XEYA 4QMVA 4UZHA 2R7IA 5ANEA 4D0XA 4E5BA 4AZVA 5EI8A 4BGGA 3U6IA 1MUOA 5F1ZA 4GT3A 5FUTA 3MV5A 3ANQA 3R04A 2BROA 3E88A 3LCTA 3VS7A 5FXRA 4J7BA 4PP9A 4W8EA 2R3GA 3BU5A 4UYAA 5AUWA 3RNYA 3TKHA 3TDWA 3GC7A 4NUSA 4H39A 4U6RA 4HCTA 4A9RA 5KNJA 3E8NA 2WEVA 2PZ5A 4FT3A 4Q2AA 3D7TB 3KGAA 4CFXA 4FF8A 4G5JA 4V05A 4BGQA 3KKVA 2YEXA 4BIEA 2X8EA 4APCA 4R3RA 3RNIA 3CTJA 1XH8A 3QCYA 3LIJA 2BDWA 5DNRA 5EM6A 4S31A 2F7EE 4QMQA 4YP8A 4K1BA 5EH0A 2LAVA 4F0FA 5EDQA 5HG9A 3EOCA 4LRMA 1FVTA 3O8UA 1UU9A 4N70A 4X3JA 3FMKA 4IDVA 3ROYA 2PZIA 4WNMA 4AFEA 1OVEA 2C6TA 3A7HA 4QMMA 3BLQA 3CJGA 4YZ9A 3V6SA 2UW4A 2C47A 3DCVA 4FE2A 4RIOA 2OJJA 2UZOA 5CSXA 1IA8A 3CD3A 5ACKA 5EQEA 3WILA 4AZSA 3BGPA 4RJ8A 4U3ZA 2R3HA 3VUDA 4NH1A 2C3IB 4V0GA 2XIXA 5L8JA 2CGWA 2XMYA 2C68A 2BZHB 4Z9LA 2GHLA 5I9YA 5A4QA 1ZZ2A 3HP5A 5AX3A 4WNPA 4M14A 3SG8A 5KHWA 5DYJA 5HVYA 4YZCA 5A4CA 1HCKA 5JRSA 4ALWA 4DF3A 2ZM1A 5EW9A 1YI6A 4HVDA 2XKDA 5JH6A 3HMPA 1QPEA 4JX3A 3BKBA 3P7BA 4W8DA 2B9IA 3OMVA 3PP1A 4GVJA 5LVMA 3E3PA 4J8MA 3P86A 5H8GA 4YTFA 2G1TA 3A8XA 3MW1A 3HKOA 1XHAA 3GQIA 4ZTLA 4PX6A 4KRCA 4NJ3A 3R2BA 5B2KA 4F65A 5JZJA 2C5XA 3QTWA 4QTBA 4BDAA 4L7SA 3VULA 3O8PA 4GEOA 3VRYA 2Z2WA 3BPRA 3ELJA 1YI3A 2PMNX 5H9BA 3PZHA 1H1WA 4I5PA 4W4YA 5I4NA 1OBGA 4IMYA 5BYLA 3OTUA 4A9SA 3MTFA 4K33A 4RQVA 3DXQA 3UNZA 3S95A 1K2PA 4MCVA 3C4CA 3ORLA 4DYMA 3FHIA 2CGVA 4X2JA 5CU3A 1PXOA 3GXLA 4ENXA 4QTEA 4CGAA 4RJ7A 5E9EA 2EVAA 3ZYAA 4JBOA 2OIDA 2J51A 1V0PA 4C4GA 1ZY5A 4CLIA 2ZVAA 4EC8A 1IASA 1W84A 2RSVA 4RQKA 1GNGA 5BVKA 4B4LA 3N4TA 5HIEA 1V1KA 4GJ2A 2PPQA 3F3TA 4X0MA 4LOOA 5HLPA 4TWOA 3KVWA 4GUBA 4O0XA 4ASEA 3LFAA 4ZSJA 3HV4A 3U9CA 1AQ1A 4QQ5A 4JG6A 3MDYA 2CKOA 2XCHA 4DBNA 2GHGA 3FMEA 3Q9WA 3LXKA 2FVDA 3F82A 3FEGA 4ZS0A 4AT3A 4EK5A 1URWA 5KZIA 5ANOA 3HZTA 3MPAA 5FLFA 2ITTA 3D5WA 3QRIA 3V6RA 3COHA 3PLAE 3QTSA 3ZCLA 4ZLZA 4DG2E 2DWBA 3BI6A 4AE6A 4CG9A 5CVHA 2VWVA 5HE1A 5JFXA 3IQ7A 2QOQA 5DT3A 1R0EA 3WZUA 5I3RA 4NFMA 5L2SA 3S00A 5KMLA 5IQBA 3BHVA 2J90A 4BHNA 2Y8OA 4XJ0A 3GFWA 4RIXB 3EQDA 2GHMA 3UP7A 2XBJA 5CAQA 5LMKC 2ITUA 3Q53A 5CEOA 4HZSA 4J71A 3IOKA 1Q8ZA 5A4TA 2ITOA 4U0IA 4FSTA 4L42A 3MFRA 3KREA 2WTDA 3CY2A 4J99A 3QALE 4IM2A 4QNYA 2AC5A 4ZP5A 1DAYA 2X8DA 4OTWA 2GNHA 2PE1A 2XUUA 4BWXA 4IFGA 2FUMA 4RFYA 3QD4A 3DBFA 3QBNA 3IW6A 4I3ZA 4PDYA 2YWVA 3KF4A 4RFZA 3ORKA 2VO0A 2QO7A 4R7BA 4DBXA 4TYIA 3ZSGA 3A8WA 3UZTA 2QOHA 3KL8A 5AM7A 3FYKX 3CD8A 4I23A 4I94A 1MP8A 3DBEA 4Y8DA 5HIDA 4YU2A 3FL4A 3GEQA 2UZUE 2NRUA 3DJ7A 3A60A 3QF9A 5JFWA 4AN2A 3RWQA 5JZNA 4LFIA 3UOKA 1GZOA 5DEYA 5CEMA 5IMEA 3U4WA 3AD6A 2RFSA 2CN8A 4QTDA 2W0JA 3W33A 4RIYA 4EK8A 1ZARA 1JAMA 5L6PA 1XR1A 5DA3A 4JL9A 4BDGA 4EZ7A 4AOJA 5CNOA 5FTQA 3FKNA 1XBAA 2X2MA 2C1BA 5E8TA 4BTFA 2QODA 4JRNA 4DEHA 4JDJA 3TDVA 1H00A 2BZKB 4JR3A 3SOCA 2UZBA 5HO6A 5IA0A 1GAGA 3LZBA 2R0IA 4B8LA 1SNUA 3W2OA 4BDIA 2HIWA 3SXRA 5JGDA 4D0WA 4RVLA 3B2TA 1H1RA 2O63A 4G6NA 1UKIA 4GCJA 5FTOA 4ANBA 2P33A 3B8RA 1MQ4A 3P7AA 3R30A 2YITA 4PDSA 4EOJA 5FDXA 1TQIA 4O6LA 3SQQA 3IDPA 1UVRA 2PZRA 4P2KA 5EM8A 4NEUA 3C4FA 4M68A 2P55A 1OITA 2WTWA 2C6KA 4MXZA 3TZMA 1E9HA 3BV3A 2P2HA 4KAOA 3DK7A 1GJOA 5D9HA 4C8BA 2XS0A 4KKGA 4GV1A 4D1SA 4M7IA 2IZSA 3OXZA 4C0TA 1GOLA 5EHYA 4O2ZA 4AA5A 1Q8TA 2F2UA 4DEDA 4PNKA 2A4LA 4KSQA 3V04A 4AZTA 4IWDA 2JIIA 2ITXA 1I44A 5KE0A 3LQ5A 3R63A 3HMOA 2PY3A 3DQWA 3F69A 1A06A 3PSCA 4FG9A 2OFUA 4QPMA 4FYOA 4XLIA 1APME 1V0BA 2IVSA 3P08A 2BRHA 2V7AA 2VZ6A 4MF1A 3SA0A 5ETFA 3QD2B 2A27A 3QQLA 3E93A 3H30A 4AFJA 1URCA 3R8VA 4EQUA 2Z7SA 2YAKA 3MH1A 4WD5A 4HGEA 3TZ9A 4EH9A 3TIYA 1TKIA 4HYSA 4LUEA 1DI8A 4UXLA 4DH3A 3BYMA 1Q8YA 3PE2A 4KS7A 4O27B 4RWIA 4ZJVA 3VBQA 3UOJA 4OTDA 1OECA 4IQ6A 3C0HA 1ZMWA 2X4FA 4HGTA 3GVUA 2FGIA 4YUQA 1BYGA 5CALA 1H07A 3RJCA 2PVKA 1YQJA 3TM0A 4L45A 4W9XA 5DPVA 2UUEA 3P0MA 3H9FA 3L9MA 3OY3A 4L53A 3V51A 3QTIA 4FVPA 4BDHA 4UMRA 4JT3A 2YZAA 3EQBA 4A4LA 1PRYA 2ONLC 3NIEA 1ZXEA 3EN9A 2EWAA 4OLIA 3VQUA 5J9YA 3JY0A 2JIUA 1OKWA 2W1EA 3NRMA 4IX6A 1R0PA 4K18A 4PTEA 4ZLYA 3KU2A 5KUPA 3JVRA 1LEWA 2ITZA 3QTUA 1R39A 2B4SB 2IVTA 2GNJA 4QOXA 5AP4A 2G2FA 4FKGA 4KSPA 3NSZA 3R8UA 1KE9A 3F6XA 3KXZA 1IEPA 2WMBA 3QAME 3SOAA 3TZ8A 2JITA 4FL1A 5T6KA 4EH6A 1WZYA 3SG9A 2B9JA 2IVUA 4F6WA 4MYGA 1W82A 2H96A 3OBGA 4O81A 3QZIA 3IO7A 2OXDA 1OBDA 3C5IA 3VS1A 5AR2A 4CVAA 4ZSEA 3ZBFA 4CFNA 3WF9A 4YJTA 2IPXA 1PJKA 5CSPA 2UW8A 4M0YA 2IW6A 4EOPA 3C0IA 4PTGA 5HG5A 1YXSA 1LEZA 2XK6A 3N51A 3V5LA 4D2TA 5EHOA 4FTOA 2VTLA 3P78A 4KWPA 4R5SA 4YO4A 2W96B 4YLLA 3HYHA 2XNBA
chains in the Genus database with same CATH superfamily
2BFXA 3A99A 2XNEA 5HD4A 2VGOA 5BVEA 5K0XA 5M56A 4YC3A 3FHRA 3RALA 2RG6A 3LCSA 5EKNA 2WTCA 3QL8A 2YM7A 3QQFA 3DNDA 4IC7A 3G33A 3BYVA 1CTPE 4IAYA 4L01A 4F9CA 2W1IA 4XNEA 2CNUA 4FT5A 4DGGA 1PMUA 4FV8A 1KWPA 3MY1A 5IQEA 3PXRA 2C5NA 3QRUA 1P4OA 3QTXA 2I40A 5HD7A 4GRBA 3P1AA 2ZYBA 5IMXA 3F61A 5IA3A 5CF4A 3ZSIA 4W4VA 4QP1A 3OWJA 3NYOA 3RPRA 4A06A 5M51A 4D4YA 1OIUA 4ACGA 2BFYA 2A0CX 5J79A 2F9GA 4ORKA 4P90A 2HENA 4DH8A 2C3LA 5GHVA 4I6HA 4EHGA 2E9VA 5EQYA 2I1MA 4K9YA 2VAGA 2OJIA 5E8SA 5LWMA 1WAKA 2VTQA 2YM6A 4XH6A 1QL6A 1W2CA 2PVHA 3EQCA 3FLZA 2RIOA 3P9JA 2OH4A 2QHMA 2OBJA 4O2PA 4C59A 3POZA 4FTUA 5CAPA 3PDTA 5M08A 1XH5A 1LP4A 4YZNA 1TVOA 3IDCA 3DU8A 1A48A 4KKEA 3MN3A 1MRYA 4OW8A 4LL0A 3LCOA 2GNIA 4FIIA 4YGAA 5AV0A 4D1ZA 5EDPA 2ITNA 3OUKA 3RBWA 5JEBA 5GZ8A 4N6ZA 1CMKE 3EQFA 4NKAA 1U54A 3E62A 4OTGA 1Q8WA 4WT6A 3KXMA 1L3RE 2GNLA 4G9RA 2HW7A 4XRJA 5M57A 4FT0A 3MFSA 2WIHA 3FLNC 4AGCA 4BF2A 3F3WA 3KULB 4FTTA 5FGKA 1PXKA 3I81A 1OL1A 4RMZA 2W99B 4ZSLA 3R9NA 3ZSHA 5ANDA 4M8TA 2XKEA 4QYHA 1W2DA 4BI1A 3OTVA 5BV3A 4O38A 3V5PA 4CFMA 1T46A 2YAAA 3GCPA 3QQGA 3CLYA 3EZRA 3HLLA 3QTRA 5KMJA 3CCNA 2WQBA 5FM3A 3FMLA 4IVAA 2C0IA 3NUUA 3VBTA 3V5JA 1JPAA 2A2AA 3E8CA 2XRWA 3Q32A 5AP3A 5T3QA 3RINA 4X2KA 2JBOA 4QQCA 3ZC5A 1OIYA 5FG8A 4ZZOA 3D7ZA 2ZV8A 4IB3A 5M09A 5HVKA 4MAOA 1ATPE 5ICPA 5HCYA 2QO9A 4NIFA 3ZUVA 4GFGA 4MWIA 2OWBA 2A19B 5H8BA 2GQSA 3L8XA 5CXZA 2QHNA 3UNKA 3CSVA 4TL0A 2X6EA 4HGLA 5E8WA 5CSWA 2WZJA 1ZYLA 3DJ6A 4G16A 2YABA 3RAHA 4RVMA 5CTPA 3ZUUA 4EH7A 4F1TA 4ZK5A 4YJNA 3QKMA 2VTMA 3H9OA 2Y7JA 4C58A 4PPAA 2YCRA 3NX8A 4NW6A 2GQRA 3QTZA 1PY5A 3PFYA 4OUCA 2OH0E 2VWWA 1JNKA 4GT5A 4JR7A 2BIYA 2HCKA 4IAFA 1YXVA 1JLUE 3Q5IA 4F9AA 5HU3A 2YLFA 4C33A 2J0IA 3Q4UA 2VO7A 4F7NA 4IVDA 4ITHA 3U6JA 2ZFYA 4BI2A 4CCUA 4IX5A 3ZLYA 3A2CA 4O84A 3VC4A 4QP3A 4P5QA 2SRCA 3PXFA 4I24A 4BB4A 4A9UA 4EQCA 4IC8A 2V22A 4E7WA 1K9AA 4JDIA 2E9PA 3KN5A 4JLCA 4ZZMA 2QOIA 1CM8A 3BU6A 2BKZA 3LFDA 3L9NA 2JDTA 5F20A 5HTCA 3UDSA 1H1PA 2WMVA 2J4ZA 1V0OA 2QNJA 4O0YA 4NT4A 2QU5A 4F0IA 1J1CA 4FG8A 4D4VA 3CBLA 3ZEPA 2QOLA 5AUXA 4H05A 3BEAA 2UW9A 2QOFA 4YJQA 2Q0BA 4M67A 3FSKA 4G9CA 4USEA 4USDA 4O7WA 1G5SA 4XP3A 5HNIX 4E6CA 4EOOA 2CDZA 4IACA 3WZEA 1H4LA 3P7CA 3EN6A 2DS1A 2BHHA 2RL5A 3PE1A 4RC3A 4UY9A 2JKQA 4LUDA 5C26A 4OT6A 4C34A 4ACDA 5AP5A 3NGAA 4FKIA 4WIHA 2GPHA 3NEWA 5HG7A 1M2QA 5CF8A 1GY3A 4MXAA 1SZMA 3G0FA 3DDQA 4QYEA 4BYJA 3ZO2A 4YBJA 5BYYA 4Y83A 2FB8A 2O2UA 2R3MA 3QA8A 2XM8A 5EK7A 4BCHA 5M4CA 5AEPA 3QRTA 4F7JA 1WBPA 4FRFA 2UVXA 4E5AX 2OK1A 3COMA 4GFMA 4F0GA 4XMOA 4QMNA 4OTPA 2ITPA 1W98A 4RWKA 2FA2A 2XIYA 5IUIA 5LXMA 3ZXZA 4FKLA 3S3IA 3DAKA 2J0JA 4BTMA 2VNYA 1G8KA 3CPCA 2NYAA 3VBXA 1Y8GA 3AT4A 1IAJA 4QRCA 3FC1X 3KFAA 1OL7A 1KUTA 2ESMA 2H6DA 4YSJA 1YVJA 3ORPA 3VUKA 4C7TA 2VTAA 4FV7A 3SW7A 3ZRLA 1FINA 2HXQA 3KMUA 1R3CA 4E20A 5KMOA 4FKRA 3G9NA 3ZHPC 2C1AA 2H34A 3DB6A 3HUCA 3I0OA 5FBOA 3R9RA 3S1HA 4X2NA 4TYHB 4PWNA 4DFNA 1UWJA 1JWHA 5DE2A 1W7HA 2PVRA 5T68A 5IH5A 3FI3A 2BAJA 2AQXA 2V5QA 3OZ6A 2OICA 3UQFA 3KRXA 4JS8A 1WVYA 2XK7A 2BKKA 3OFMA 3BLHA 1OGUA 2I7QA 4NCTC 1JVPP 4FK6A 3SV0A 3TZ7A 3SD0A 3ZEWA 3GBZA 3R7EA 5ITAA 5L4QA 2XCKA 3AKKA 4XCUA 4PMTA 4JRVA 4OAUC 2R9SA 3KXXA 2XNOA 1HCLA 5J5TA 5CVFA 5ANIA 3FQHA 1JBPE 5IG1A 2R64A 2UZLA 2WOTA 3OWPA 3VF8A 3BHYA 4M97A 3TYKA 1H1SA 4K2RA 3R8ZA 4FI1A 5IA1A 3TNWA 2CMWA 1RQQA 1L8TA 5DEWA 5CENA 4I6QA 1M52A 4C36A 3FZTA 2CNVA 2I0VA 4Q5EA 3P5JC 2Y0AA 2XM9A 2WO6A 1XWSA 4JNWA 3Q96A 5AAGA 3AD5A 4CZYB 4FTQA 3LXPA 1QPCA 3DS6A 4DFUA 4MD9E 4LMUA 2GS7A 3BQRA 2IW8A 5LJJA 4EJ7A 1BKXA 3GCVA 2X0GA 1LR4A 4BCPA 4GU6A 5TR6A 4AOIA 3SC1A 5DOSA 5ETAA 4CV9A 4TN6A 5DRDA 3BHUA 4I6FA 4DAWA 2OZOA 5HZNA 3Q2MA 1UA2A 3QWKA 3GFEA 4JIKA 1PF8A 2FSOX 1Q3DA 1R78A 2YISA 3VF9A 1YDSE 3NYVA 4M84A 3QFVA 4FKUA 3DFCB 5HO8A 4YNOA 3ORIA 3SXSA 4BKYA 2YERA 5F4NA 5GJFA 3NUYA 5HQ0A 3WIKA 1Q61A 3AXWA 2BRMA 3TNPC 5A9UA 4M0ZA 1UKHA 1UNLA 3D0EA 4G5PA 4FSNA 5DG5A 2BAKA 1XBCA 5KMIA 1ZOGA 2B53A 4H58A 3CTQA 3E7VA 3EQHA 3QLFA 4FV6A 1OIRA 5AR4A 4AW5A 2IEWA 2WMWA 4O1PA 4G3FA 4EWQA 4IAIA 4CSVA 4LI5A 5LWNA 3KCFA 2YHVA 1M2PA 2VTNA 4O0WA 4FZFB 3WF6A 3NZ0A 1XH4A 4CYIA 5KMKA 2YIWA 3E64A 5IISA 5KO1A 4QMLA 2YWPA 4NZWB 5HBHA 3UBDA 1A9UA 1O6KA 1OPLA 1YHWA 1OM1A 2PVMA 2ZOQA 3ZO4A 4FODA 4DGOA 3DBCA 5LMKA 2R3LA 3HP2A 3LQ8A 3F7WA 4I0TA 5AA8A 2WEIA 3PZEA 3R00A 2GS6A 2XB7A 5FWKK 3ODYX 5JN2A 1F3MC 3UPXA 2GMXA 3PA4A 3AQVA 5CZIA 5DT0A 3FXXA 4ERWA 3QD0A 5CF5A 3GQLA 5IUHA 4HYIA 5F9EA 2PTKA 1PXIA 2X81A 3ZFXA 1YXTA 4GK4A 4U81A 5G6VA 3RAIA 4NL0A 3R1QA 5JK3A 4FGBA 2KTYA 3F2AA 3MIAA 1P4FA 2V62A 3C4EA 4BDDA 3IW7A 4YTIA 1PYEA 3ORMA 3OWKA 3UPZA 3HECA 3LFNA 1YHSA 3FY2A 3Q3BA 4DFYA 1OKVA 2NNWB 2PYWA 1SVGA 3PUFC 1YOJA 3JUHA 2XK3A 4O0VA 4AQCA 5KHXA 4GG5A 3I60A 3C7QA 2VU3A 3EN7A 3UVQA 2WU6A 5IDNA 2IN6A 4Y72A 3G15A 4TWNA 4XG7A 2UW5A 4V0GB 3UMWA 2QQ7A 2QR7A 1G8SA 3O71A 4ZSGA 4TNDA 3QX4A 3NIZA 3E3BX 2EUFB 4CMUA 4ACHA 5JFVA 4F08A 4HVHA 4D28A 5TOZA 1VJYA 5I9ZA 4ASZA 3HAVA 3G5DA 4O4DA 4AW1A 4BCFA 4BTJA 4DT9A 2BZIB 4L6QA 4FV4A 2W9ZB 4QD6A 3DKFA 4GSBA 5IA4A 2VX3A 4J98A 2W7XA 4A7CA 4R78A 4WRGA 5L2WA 1CKIA 4F1MA 5H2UA 3GC0A 5A4EA 4HNFA 3VAPA 3TL8A 4JVGA 4EC9A 2UW0A 3CKXA 1NA7A 3GOPA 4ANQA 2C6LA 3ORXA 4O7YA 2ITVA 3FKOA 4L3JA 3O51A 1FVRA 3LPBA 4YC6A 4HJOA 4FNYA 4IWPA 4JXFA 2PMIA 2BIKB 3JYAA 2C30A 2OU7A 2XA4A 4MTAA 3RMFA 4IEBA 4EH4A 4AOTA 1ST0A 4DCAA 2A1AB 4BCIA 4BCGA 1UU3A 4WG3A 4YLJA 3W0MA 5LVOA 3VWAA 2YM5A 3GU8A 5CVGA 4OAVB 4FNZA 5IQDA 1WFCA 4DTAA 3R1YA 1BL6A 3ZS5A 3D5VA 1ZOHA 3AT2A 3OCTA 3QQKA 2WTVA 3OCSA 5HNBA 4MH7A 3V8TA 3W8LA 2PU8A 4O7VA 3I5NA 3GGFA 1KOAA 5FEQA 2X39A 4D2SA 3L9LA 2BAQA 2AYPA 3OT8A 3ZZWA 2Q83A 3FMDA 4CYJA 4EK4A 5C8MA 2C6OA 3UVPA 4Y95A 3GT8A 3QQUA 5EHLA 5AADA 5HGIA 1YDTE 3BEGA 3NUSA 4CKJA 4GYGA 4KBCA 4LOQA 1Y91A 3TUDA 4WNOA 3VJOA 4BZNA 3AKLA 4I5MA 4EHZA 1FGIA 4PL4A 5ANGA 4C4FA 4O96A 2VTHA 3DA6A 3LM0A 4QP9A 5CEIA 2ONLA 4D2PA 5BPYA 5C8KA 2CN5A 2ZB1A 1Y6AA 4R6VA 3SLSA 3DXNA 5FRIA 4G1WA 4J1RA 5K4IA 3KN6A 4Y73A 2B52A 3ZBXA 3N4VA 4FEXA 2WTJA 5AIKA 3BYUA 4Y85A 3QCQA 4N57A 4GIIA 4PNIA 4PF4A 3NUPA 3GI3A 5H8EA 4EOSA 3RGFA 3TXOA 4E5WA 3NUAA 1XO2B 4ZJJA 3M42A 4DFXE 4JMQA 1VEBA 4O7LA 4X2GA 2ZMCA 3II5A 1OL5A 2JEDA 4RSSA 3CTHA 5HHWA 2C3KA 3SRVA 1ND4A 4BY9E 1YOMA 3BWJA 3R6XA 2HY81 4FC0A 3R7OA 3FZSA 2OXXA 3NNVA 3VN9A 3LHJA 1J3HA 5HNGA 5I9WA 1G8AA 4U41A 3GCUA 5EI6A 4FV3A 3KB7A 5E8XA 4ZTHA 4ZTSA 3LAUA 5KZ0A 4D58A 1J7LA 4FEVA 2CSNA 3RM7A 5FM2A 3RK7A 4QPSA 2Z60A 3VBYA 4WBOA 2C4GA 2Z7LA 3DTCA 4BZDA 5AUZA 3PRIA 5D41A 4CT2A 4YHJA 3R9OA 3W2QA 3UYSA 4OTFA 4IAAA 3VUTA 3O8TA 4BDEA 2W1DA 4EK6A 5LMBA 1Q99A 4QMWA 4IVBA 4YHTA 4LV7A 4RIYB 2REIA 2YZLA 2XYUA 3S0OA 2XIRA 2RG5A 2W4KA 5CI6A 3K5UA 3UNJA 4C61A 1HOWA 3A7IA 4C37A 3F5XA 4JOAA 3AKJA 1JSUA 4B6LA 4R77A 4HYUA 5AA9A 2RF9A 2FYSA 2XNNA 5EYMA 4RC4A 4I1ZA 5HE3A 4CTCA 4FA2A 5C8NA 3UQCA 5IKWA 1J7UA 4DH5A 3LMHA 3LFCA 3C51A 1FVVA 5GINE 4MX9A 4X7QA 1FMOE 2NO3A 4WBBB 3RVGA 3BE9A 5CNNA 4TYJA 3R7IA 3RAKA 2RFEA 2F57A 5LARA 3A7FA 3R22A 3C1XA 3RP9A 1H08A 4DGMA 5AP1A 3NVMB 1QCFA 3DKGA 3COKA 3DPKA 1J91A 4IX3A 2BUJA 2JKMA 4KINA 4PQNA 5AR8A 2VTSA 2JGZA 4ITIA 4KD1A 5DRBA 5AP7A 3I0QA 5HE0A 4K11A 1B39A 4I22A 3TJCA 5M53A 1WBOA 3WF5A 5BVOA 2EB3A 3W0RA 4O91A 2XIZA 5AV3A 3TIZA 1XH6A 2JFMA 3BRBA 3C4WA 3ETAA 4A07A 3LOKA 4LGDA 5HI2A 5IEXA 3OW3A 3UVRA 4CG8A 1ZMUA 4WG5A 3L8VA 1PW2A 3R83A 3NWWA 4R7HA 4ENYA 3QQHA 2WTIA 5L2QA 4FZDB 5CYIA 4Y5HA 3EFWA 3BL7A 4MBIA 1BUHA 1XH7A 4EUTA 4O7TA 4KB8A 3UOHA 3RHXA 2XALA 3OOMA 4UMPA 2YCQA 1Y8YA 4FSUA 2YDJA 2UZNA 4AXAA 1NVRA 3EB0A 4IAKA 4ZY4A 4QT1A 4ZS4A 3VJNA 3W0PA 2VRXA 4AGUA 3WYYA 3FJQE 2IF8A 3V8WA 4YHFA 3W1FA 2PZYA 5I9VA 2QD9A 2QKRA 2WTKC 4M69B 4O4EA 4FEWA 5JQ8A 3DB8A 4GFOA 5GJDA 4NWMA 3AGLA 4K8AA 3IW8A 4PDPA 4YMJA 4YLKA 2DUVA 1BMKA 1XKKA 3R1SA 4X2FA 5IU2A 3ENMA 4ACMA 1WMKA 3RTPA 5EOLA 2ZV9A 5LVPA 4LYNA 4LMNA 4M69A 4ASXA 1TFFA 3SXFA 1YWVA 3CQWA 3EN4A 4FKQA 4M13A 4O0TA 4XP2A 5A14A 3HV3A 5IH4A 4UZDA 3BIZA 5GZ9A 4YTCA 4W4WA 3I5ZA 1H24A 1Q41A 2PK9A 3GENA 3KRLA 3PRFA 3PY1A 4Q9ZA 1JKSA 4P4CA 4CEGA 4RC2A 2WFYA 4NM5A 1ZRZA 1PXJA 3TNQB 3WZJA 4YC8A 3C0GA 5DR9A 5CAUA 1O6YA 2HOGA 5J87A 3W10A 4RZVA 2PUNA 1ZY4A 4ALUA 4GKIA 3ORZA 3R7GA 3UO4A 3VUHA 3PG1A 3WYXA 3QWJA 4JDHA 4MD8E 5CS6A 4JBPA 5IUGA 4A9YA 5EYDA 2RFDA 5CASA 3W0NA 4GYIA 2OLCA 3G6GA 3OOGA 5D7AA 4XS2A 1TQMA 5BMMA 5CAOA 4FEUA 5AR7A 1Y57A 2UW6A 2VUWA 3D2KA 5EYKA 3EYHA 5DR6A 3AC3A 4B7TA 1XBBA 3EH9A 3HGKA 4EH3A 5E8VA 3FZRA 3QUEA 1Q97A 1R1WA 4UWBA 5FP6A 4UX9A 2VNWA 3O7LB 4F99A 1YWRA 4NKSA 1ZYSA 3I1AA 2CNQA 3FYJX 1PKGA 3IW4A 2OJ9A 5HLWA 5IQFA 2YN8A 1KSWA 3R71A 5KKRB 3M11A 1GIIA 2QURA 2Y4IC 2ETKA 4YZDA 5J9LA 5TT7A 2ZM4A 4AZWA 2GTNA 4TWPA 3NNUA 4GVAA 4FNXA 4WNKA 1CDKA 4ACCA 4DG0E 3VUMA 4ASDA 3GCSA 4FBXA 4XG6A 5DI1A 4ZAUA 4DFZE 5BMSA 5AR5A 4ZIMA 2H8HA 3LE6A 4RX8A 5CZHA 3TV6A 3D5XA 3ZFMA 4O82A 5E1SA 1QPDA 1M7NA 5DN3A 4J96A 1PXPA 4HVGA 5E91A 5AM6A 3IPHA 2NPQA 4CFVA 4RPVA 2KULA 3FSFA 3S2PA 4XOYA 4D5KA 4GMYA 3PSDA 3ZUTA 3K3IA 1OPJA 4IWOA 4HW7A 1W8CA 3MSSA 4MVFA 2W4JA 5FEEA 5AIRA 5M44A 3VONA 4MF0A 1BL7A 2JDRA 4RX7A 5BYZA 4NTTA 4BDJA 4IZYA 5DT4A 2EB2A 2J2IB 2G2IA 3FE3A 4FTKA 4QO9A 3R0TA 4RT7A 5AP6A 1JOWB 2B54A 2BRNA 4EYMA 4HVSA 4Z16A 3ITZA 2YIRA 3HEGA 3NUXA 1Q24A 3F9NA 5CI7A 3TTIA 4D2WA 3ET7A 2JAMA 3G6HA 1ZLTA 5HORA 3EFJA 1LPUA 3R7YA 3BGZA 1VLRA 4F6SA 2I0EA 2Z8CA 3AC1A 4I0RA 3VQHA 3PWDA 5CXHA 5HCZA 2QI8A 4QPAA 5B0XA 3F7ZA 3IGGA 4F78A 3QYWA 4RJ6A 4RG0A 5IPJA 4BCKA 4C02A 2C0OA 4IW0A 2AC3A 4ERKA 3MS9A 5LCJA 5E4HA 1U54B 3CY3A 4I20A 1KV2A 3G9LX 4FTCA 4BDFA 3UG1A 1ZOEA 3O50A 3NS9A 1GZNA 1Z9XA 3K2LA 4RVTA 4FTRA 4QMOA 3RPOA 1O9UA 1Q3WA 4I5CA 4JAJA 3M1SA 3MB6A 4PPBA 3WARA 3PPKA 2FSMX 3CXWA 4DGNA 2HK5A 3D15A 1YHVA 2VO6A 4X6QC 4EOLA 5A4LA 4UWYA 1YXUA 3A4PA 3GC9A 2O8YA 3FL5A 5CQWA 2ERKA 4H1JA 4AT5A 1OB3A 1WBWA 2CCHA 3QU0A 3P79A 3MGYA 3OC1A 2HZ4A 3FY0A 2W9FB 4FIJA 3FLWA 4ZXTA 3TJDA 4XHKB 4IB5A 3HV7A 4IZAA 4EJNA 5HE2A 4NCTA 2X9EA 4TT7A 4L9IA 3R9HA 2XZSA 4MXCA 4DGLC 4YPSA 4BIDA 4DCEA 3W2SA 4RBLA 4ZLOA 4NIFB 3KCKA 4LGHA 3TT0A 4FGRA 1SM2A 1P2AA 1W83A 3C13A 3LQ3A 5C4KA 1BLXA 2ZMDA 3H10A 3LCDA 3EYGA 3CKWA 4HYHA 3PPZA 2C6IA 4YZBA 5FBNC 3NNXA 4C35A 4QMTA 4DC2A 4PMSA 3U8WA 1GZKA 4A4XA 2X1NA 3BE2A 2GS2A 3U9NA 3U51A 4FSRA 4BCQA 4S30A 4G34A 3BBTB 5EYCA 3UQGA 2C5OA 3LVPA 5K3YA 2IWIA 5J1VA 3HRCA 4Q5HA 4YZMA 5HCXA 3GU7A 4FVQA 1KV1A 3WE4A 3BWFA 5GIPE 2XAMA 2Z02A 5IF1A 5DGZA 2JLDA 2LGCA 4DTKA 3FXWA 2R7BA 3QGWA 4O4BB 4CKRA 2YJRA 4ZY5A 2R0UA 2VD5A 2H9VA 1PMNA 3CP9A 1H28A 3H0ZA 4OTIA 2X8IA 4NTSA 1PXNA 3UODA 4EKKA 4UN0C 3R2YA 2BCJA 1KOBA 1WBSA 4X6RA 1BI7A 3IONA 4QP8A 2UZWE 5CX9A 4L43A 3WZKA 4BGHA 2W4OA 4BWKA 1PHKA 3ANRA 4F6UA 1WCCA 1VZOA 5LVNA 4YTHA 3LKMA 3HDMA 4KBAA 4CZUA 1GIHA 3PYYA 2O3PA 3PA5A 2C6DA 4KIKA 4QP7A 5HOAA 2R3QA 4O21A 3OXIA 4C3FA 2WQEA 2IG7A 4AA4A 4MUQA 2YCSA 3TWJA 2B9HA 4CQGA 1H0VA 4C3PA 2WPAA 2CGUA 3LLTA 4WG4A 3VIDA 5AP0A 1KE7A 4XG2A 4AZEA 5D7VA 1Q5KA 3OP5A 2ERZE 4IE9A 4WOVA 4BR3A 2YDIA 3GB2A 2BDFA 2VN9A 4E26A 5GJGA 3QUPA 3CC6A 3I6WA 1U5QA 3DNEA 3RK9A 4U42A 4XP0A 3A62A 3OF0A 4YJUA 3EWHA 3U4UA 1WBNA 3QGYA 5CAVA 4MK0A 1F0QA 4HCVA 2CPKE 2J50A 5AUTA 3VHKA 2R3IA 2GU8A 5EDRA 4ZY6A 3SVVA 2O64A 4I6BA 5AV2A 1UNGA 4NW5A 4RJ4A 4UEUA 4ZJIA 4B0GA 3LFEA 1KE5A 2QR8A 3QTQA 2XP2A 3DBQA 2VTJA 4QMYA 4O0RA 3V5WA 2X2LA 3PVWA 4IX4A 1JSVA 3R8MA 4IBMA 3PXQA 3VRZA 1H1QA 2JAVA 2VO3A 4LRKA 4RIWA 2OXYA 3KRRA 1PMVA 4QQJA 3KXGA 3TCPA 3UG2A 2W06A 3MVMA 2P2IA 3QXPA 2FSTX 3UO6A 4X3FA 4XG4A 4XV1A 2ZJWA 3R01A 3RCDA 3RZFA 4GK2A 4E6DA 3DJ5A 2R2PA 3PVGA 4LV8A 4U43A 2HYYA 5L6OA 5EFQA 2YIXA 3FBVA 2J9MA 5J1WA 3F88A 3SHEA 1U5RA 1W0XC 1FMKA 2WIPA 3FLQA 4I4FA 5DMZA 4D2VA 4E1ZA 4ZSAA 2ZDUA 5HLNA 4LGGA 3MESA 4G2FA 4CXAA 1OKZA 3EFLA 4OT5A 3ZZEA 2C6MA 2W5HA 3R02A 3FLYA 2X4ZA 4V04A 5BVFA 4S32A 4XLVA 4R1VA 4O6EA 2VWZA 4QNAA 3QQJA 2UZEA 4L67A 3TTJA 5C1QB 4U5JA 5EM5A 2BTSA 4HGSA 4HPTE 2OG8A 2WMUA 4H3PA 2WB8A 4FNWA 4L8MA 4QYGA 3QLGA 4K77A 4AAAA 3MWUA 3FMMA 1MRUA 3DDPA 3UDBA 5AR3A 4IWQA 3MB7A 3JY9A 3EL8A 3MIYA 2IVVA 1BI8A 3SGCA 3R1NA 5B2MA 3HAMA 2J0MB 2WD1A 5TO8A 2ZM3A 1RJBA 2GQGA 3OS3A 4BCJA 4E6QA 5IQIA 4AE9A 2OFVA 2JBPA 2OZAA 4OBQA 3HVCA 3FPMA 3G2FA 4G17A 4U45A 4H1MA 4MXOA 4FX3A 3LMIA 3OROA 4BKZA 3I79A 4I93A 3RPVA 4GS6A 2E9NA 3Q5ZA 4USFA 5J7BA 1B38A 4FK3A 5M4IA 3BL9A 2B9FA 4KIOA 5BVNA 4HOKA 3LXNA 3VO3A 2W1CA 1U4DA 5D11A 4AU8A 4C2VA 1ZYCA 2HWOA 3CIKA 5JGAA 3PPJA 3NUNA 5K5NA 5L6WL 4FIFA 3W32A 4APPA 2ITYA 3EZVA 5L2TA 5I9UA 3KA0A 4F9WA 2BRGA 4UMUA 5L8LA 2VWYA 3KVXA 1B6CB 4QP6A 3IW5A 5JFSA 3OUNB 2IZUA 5DIAA 4HPUE 4QMUA 2WMQA 3PP0A 5EOBA 2R3KA 4U80A 2QVSE 1H8FA 3ZDUA 2XH5A 2BDJA 3PIXA 4DA5A 3Q9XA 4XEYA 3CGOA 3FZOA 4F1OA 5HU9A 2UZDA 4E4MA 3QHWA 2RKUA 4P5ZA 2CCIA 3A61A 1P5EA 4EK3A 5M4FA 4JQ7A 3LFSA 3PIZA 2AEGA 3T9TA 3MPTA 4EQMA 3NW7A 1FQ1B 4G6LA 4EOKA 3Q52A 1JSTA 2DQ7X 1SMHA 3WE8A 2GNFA 3MH3A 5CEPA 2X0OA 4L3PA 3UJGA 2WOUA 4AN9A 5C27A 1E1XA 3HV5A 3PY3A 4K6ZA 4PY1A 4CRSA 4CNHA 2UW7A 1PXMA 3GNIB 4TWCA 3GOKA 4FVRA 3ZO3A 4AACA 1EH4A 2XEZA 4MNFA 4ID7A 5HTBA 4AW2A 2VV9A 4AGDA 3CEKA 2PVYA 3CR0A 5FXSA 2XJ2A 4AUAA 2XK9A 1GIJA 3MJ2A 3RCJA 3ZONA 4C2WA 4XUFA 4YO6A 2PL0A 3NW5A 4AG8A 4D9TA 4YNEA 3FDNA 3EQPA 4EI4A 3PLSA 1CKJA 4NYEA 3GU5A 4DHIB 3MA6A 3MTLA 1CSNA 3EFKA 3MH2A 3NNWA 4L00A 3QCSA 4S34A 5AAFA 3FKLA 3Q9YA 3R7UA 3MFTA 3WZDA 2O0UA 4QP4A 1FBNA 3MJ1A 4EHVA 2PVJA 4NSTA 4FZ6A 4IHPA 4ZTRA 4DN5A 3OCGA 4X3FC 3B2WA 4R3PA 2QOBA 3TNHA 3NAXA 4W4XA 3ZLWA 3AD4A 2C5VA 2WQNA 5C01A 2HZNA 4WO5A 3MBLA 4FUXA 4U40A 4IVCA 4UWCA 4BTKA 5KX8A 3CPBA 4DITA 4EORA 4DEBA 3MFUA 3MPMA 3OHTA 4CMOA 2X7OA 1YXXA 5EW3A 4TPTA 1M17A 5J95A 3E8DA 3ULZA 5TE0A 3WF7A 4EONA 4L7FA 4F9BA 4FSWA 2HXLA 4AN3A 5AV4A 3NYNA 5BQ0A 5M4UA 2B1PA 4AW0A 4CQEA 5JQ5A 3W16A 4ARKA 4LOPA 3MVHA 2BZJA