5C27A

Crystal structure of syk in complex with compound 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
274
structure length
272
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c27A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c27A01
3ZDUA 4K77A 3I1AA 5CAOA 3K3IA 1V0OA 3U9CA 5BUJA 4DITA 2VX1A 5AM7A 3VUIA 4IE9A 2GQSA 4I6HA 3TZ8A 3WZEA 4YMJA 3OCTA 5HI2A 3PP1A 5H2UA 4DE4A 3QTWA 4U7ZA 3PRIA 4CSVA 2C0TA 3PRFA 1W7HA 3R7EA 3DB6A 3E88A 5BVKA 4D0WA 3DLSA 4DCEA 3C5UA 1PXLA 5JSMA 2WEIA 4YJRA 5C8MA 3RNIA 5LMBA 1HCLA 3FY2A 2V7OA 3F88A 4PMTA 2XJ1A 3C0HA 2FA2A 1XH6A 3TM0A 4H36A 4HCVA 3ZLXA 3L8SA 4L9IA 4YHJA 2QO2A 5HIEA 1Q3WA 2RIOA 2YM7A 3LLTA 5AMNA 3C4ZA 3W32A 4EQCA 3HDNA 3QFVA 1Y8GA 5HO7A 4D5KA 3IDCA 5IQGA 2OZOA 2PMNX 2WMVA 4A07A 4CFWA 3HMIA 5HU9A 3WZDA 4IBMA 2H8HA 3L9LA 4FKPA 3R9DA 4E5AX 5DRDA 4B8MA 2WQEA 4D2WA 4L44A 3H0ZA 3T8OA 2E9UA 3ZYAA 5AAFA 3SW7A 2BMCA 2YZLA 4FV0A 2PTKA 2YIYA 3R71A 3QCQA 3ALOA 4PL3A 4XBRA 3R2YA 3I6UA 4NFNA 3VS7A 3WZKA 4GU9A 3IGOA 2C6LA 4X7QA 3QZHA 3VW8A 5F20A 3ZC6A 3GT8A 4HNFA 1ZRZA 4X0MA 4CCUA 3DZOA 5AP0A 5EM6A 3DPKA 3C51A 1ZMVA 4HVSA 4YTCA 2IWIA 1JOWB 2X7FA 4WIHA 4FV7A 4NKAA 3ZUVA 1F0QA 3OUNB 2OZAA 4HVHA 4FTOA 3F82A 5JFXA 1YHWA 3SRVB 4KBKA 4MNFA 3R63A 4U6RA 4APCA 2CHLA 2R64A 4CRSA 4Z7HA 3R0TA 2YIQA 2W5AA 4RIYB 4KAOA 1ZZLA 3OCGA 3CC6A 3Q53A 1L3RE 1Q8WA 5IA5A 4G6OA 4TYJA 2AC3A 4AN2A 4A4XA 4JNWA 4BBFA 5JGBA 4BB4A 3EMGA 4FOCA 4MQ2A 2V62A 3HRFA 2X39A 3OF0A 4KS7A 4IWPA 1XH4A 5I9XA 2UVXA 3MS9A 4RWLA 4E93A 5KMOA 2XK8A 2XNMA 1YRPA 1F3MC 3GU8A 5HBEA 4BWXA 1YOLA 4EOMA 3K5VA 3N4UA 3MY5A 4C3FA 4ONAA 3UIBA 4FKVA 2ITPA 4AGWA 2UW5A 5JQ5A 3WF5A 4O86A 4U3YA 4I23A 1S9IA 5CEIA 4BYIA 2R0UA 2WMRA 3V5WA 3FUPA 3NUYA 4UMQA 4CQGA 1REJA 5K4JA 1ZMUA 3S3IA 3V6RA 4DCAA 4XOZA 4JIAA 1PXOA 3UDBA 4RX5A 4PRJA 3ROYA 4BI1A 4AS0A 3UMXA 2VTTA 3GCSA 4F0FA 5L8LA 4AZSA 2IZSA 3QZGA 3KU2A 4QTBA 3RK9A 4TW9A 2R3HA 3KRWA 4CTBA 4DH5A 3BWFA 4M97A 3TIYA 4FNYA 3GCVA 5EYDA 3SXSA 2HZIA 4FI1A 4WHZA 5J8IA 2QO7A 3Q4ZA 2O3PA 4HW7A 4YC8A 3UMWA 5L8JA 3LXKA 4BHZA 4AZWA 3UPXA 4K1BA 4HGLA 5M4IA 3RTPA 4JDKA 5EOLA 3FLZA 2VX3A 3QF9A 3ZUTA 5BYZA 3QQGA 1JKLA 4MAOA 4BZOA 4EBVA 2CDZA 4V04A 3FMKA 2J2IB 2VTIA 3CGOA 3DK7A 2REIA 1FOTA 4ZY6A 4AZFA 3U51A 1KSWA 4XEYA 2PE1A 4IADA 4BKZA 5CEMA 4N6YA 2B52A 2RFEA 3VQUA 3IK3A 1DS5A 5EYMA 5CAUA 2O8YA 4BC6A 3KCFA 3EN9A 1JKSA 2FVDA 4D0XA 4RVKA 5IQAA 3KK8A 5GINE 1NVRA 5AV3A 4FKIA 3R9NA 1GIJA 1W98A 3A8XA 3E3PA 3QQKA 4TYIA 3BKBA 3NIEA 3OEZA 4PDOA 4UXQA 3RPVA 4I24A 1A06A 4MBJA 4IM3A 3VJNA 4J8MA 4E7WA 4P5QA 4U43A 1WBVA 4V01A 4EKKA 4O7ZA 3BWJA 4FEUA 3GP0A 1YQJA 2OWBA 4IX6A 4E26A 2C0OA 3BX5A 3QTXA 4IVBA 2E2BA 4R3PA 2OIBA 5T68A 4ERWA 3AGLA 1AD5A 1YHSA 2Q0NA 3BGQA 3I6WA 4AW1A 4CV8A 3OY3A 5HHWA 4G3CA 4M67A 4S32A 1V1KA 4ZS4A 4NWMA 2G1TA 5HU3A 4BTJA 3FMMA 1BLXA 3VUDA 5DI1A 2EWAA 1MQ4A 5IA0A 4FV5A 5J9LA 4S34A 2QLQA 4EYMA 2FGIA 4X3FA 2GHMA 4FEQA 3RAKA 1B6CB 2XP2A 3UZRA 3H4JA 3ZBXA 3BIZA 4IC7A 5IDPA 2JBPA 4CKIA 2GSFA 1ZOEA 3OWLA 4HGTA 4EJNA 5ANDA 4HVIA 5FTQA 3FLWA 3TKUA 2VNYA 3V6SA 5AV1A 4GT5A 4YJNA 2R3RA 2C6TA 3IG7A 2Z7QA 1YKRA 4QQCA 4ITHA 3JR1A 2ZMCA 5M4FA 4RVLA 5AUVA 1KE8A 4B6LA 4DEGA 3NYNA 4JBOA 1YXUA 1FVRA 3RBWA 3TG1A 4E3CA 4EQUA 1O6YA 4M15A 2YM8A 2JBOA 4X2JA 5F94A 3UOLA 2CCIA 4M69B 3V8WA 2IZRA 3JPVA 2BFXA 2EUFB 4IZYA 2W5BA 4MF1A 4ZS0A 3VW6A 4C38A 4ZZNA 3VRYA 3UZPA 2B0QA 3E8DA 4PUZA 5BVWA 3F66A 4W8DA 4IJ9A 3TEIA 5HTIA 4C4IA 3LMIA 2VTMA 4PX6A 3VC4A 1WBPA 3P7AA 2GNHA 3GC8A 4DGMA 2Z8CA 3CKXA 5GNKA 4BZNA 1DM2A 2WHBA 4W4VA 4ZSGA 3EIDA 4MX9A 3CJFA 4BCKA 3WZUA 1YOMA 1Z5MA 4GT3A 4GH2A 3OTVA 4YTIA 4I5PA 5AP5A 3G5DA 4G3DA 2W4OA 4ZXTA 2QOHA 2WQBA 2JFMA 2X2MA 3KF4A 4IDTA 2V7AA 4O0UA 4TRLA 4BTKA 3EB0A 1NY3A 3TNWA 3C4FA 4EEVA 3S00A 4XP3A 3L9NA 4RIOA 2GNLA 4UWYA 4RA4A 3FLQA 4FYOA 3KF7A 3BV3A 4DG0E 4FE2A 2R0IA 5M08A 3W2SA 1M2QA 1SM2A 3P78A 3H9OA 4F70A 5IA4A 4X6QC 2ITNA 5CQWA 5AFVA 3Q4UA 4RLLA 1OVEA 3D0EA 2RKUA 3MFRA 5CVHA 4FL3A 2PVFA 1QPCA 2YM3A 4ZTSA 3C4CA 1V0PA 2WTIA 3SX9A 5TO8A 3QYWA 4K8AA 1FPUA 2VAGA 2E9OA 5H9BA 1OPLA 2QR7A 3PA4A 2WU6A 5M57A 3SGCA 5HG9A 2GNFA 4GIHA 4MF0A 4YO6A 4PV0A 3DV3A 2ZDUA 4BDGA 5M09A 3VUHA 4C3PA 3GFWA 3QKKA 4AGUA 3IOKA 4PP9A 5KMMA 3ACJA 4WUNA 3PJCA 4RG0A 4RLKA 1NVQA 5EI2A 2A1AB 2R5TA 4QTAA 4WG3A 3W2RA 2EXEA 3R6XA 4P5ZA 3MESA 3FY0A 2PU8A 4YJUA 4DTAA 5I4NA 2QOQA 1APME 4F1OA 2UZBA 2JKOA 2OH4A 3LFAA 4CMOA 2YABA 4TT7A 5FQDC 3U55A 2C3KA 4TZRA 4IM2A 1LR4A 4OR5A 4U44A 5TF9A 5IEVA 2J9MA 5FEQA 2VTPA 5KKRB 5C1QB 3PE2A 2PUUA 1RDQE 3CCNA 3VBXA 4DC2A 3VO3A 2F2CB 3KULA 2B1PA 4IVAA 4AUAA 3PSBA 4FTIA 3F61A 4L7FA 5EQYA 1XBCA 4JQ7A 4ZSJA 3BU3A 4KIKA 2YEXA 4I21A 4IDVA 3U4UA 4JQEA 4L8MA 2VUWA 4EUTA 2DYLA 3F5UA 3HAVA 3ZM4A 3MTLA 3NYXA 5ANGA 2PWLA 1JKTA 3HV5A 4DGGA 5AV0A 3NYOA 4O82A 4Q9ZA 1SVGA 1H0WA 3OY1A 2W1HA 4ACCA 2FSMX 3B8QA 4R5YA 5TKDA 2CJMA 3OOGA 1X8BA 5LQFA 5IH4A 4ACHA 3DS6A 2EB3A 1H1RA 4NM3A 3R1YA 3CQEA 5ACKA 4H3BA 3V5LA 2GQGA 3FXZA 5AP3A 2C0IA 4FKQA 1YWRA 1H00A 3OBJA 1PY5A 4O21A 3FEGA 1BMKA 3DXNA 4EOLA 3Q96A 4MHAA 3C1XA 3W8LA 4KIPA 2XNGA 2GHGA 3OVVA 2LAVA 2BCJA 3DK3A 4QNYA 3W33A 3IONA 1TKIA 2W17A 2YIXA 3EN5A 5CNNA 3GCQA 3ZO3A 4AZEA 3FYJX 1Y6AA 5HO8A 3NAYA 4FSYA 2PMIA 5HLWA 4DFUA 3C5IA 2JKKA 4I0SA 1UU7A 3KMWA 3VS0A 5HNBA 4DBXA 3PLAE 4HNIA 4KD1A 5CS6A 4F6SA 2YDIA 2BRBA 3NWWA 3MFUA 4LL5A 2X6DA 2W1EA 3JXWA 5E8VA 2BRMA 3FMLA 5D10A 3LCKA 4JJRA 1Q62A 4R3CA 5J7BA 5L6OA 1MRVA 4ANLA 3UNKA 4CKRA 2R3OA 2XB7A 3S1HA 4OGRA 4AN3A 3AMAA 1NA7A 5AP6A 4YHTA 5I9VA 4O2ZA 5KMJA 2X4ZA 2Z7RA 2XM8A 3FPQA 3C4EA 2EB2A 4FMQA 3NNXA 2CKOA 3NR9A 1H1QA 3D83A 4KUJA 3UE4A 3DDPA 3MVMA 3VS2A 4QMTA 5JKGA 4D4YA 3EL8A 4R1VA 4EOIA 4YLLA 2XKFA 4YUQA 2WMAA 3CQWA 3ZRLA 2ZYBA 4IB1A 5AP4A 3R2BA 3BV2A 4FTMA 2W9ZB 3MH3A 4U81A 2FSTX 5D1JA 4QP3A 4LOQA 2BDFA 4HGSA 2PZYA 2ETMA 3A62A 3RNYA 3F3ZA 4ACGA 1UU3A 2YISA 4AXAA 5K0KA 2UZWE 4BI2A 4CZUA 4S2ZA 4Q5HA 5IUIA 3JVSA 2B9JA 3M11A 4AG8A 3BELA 4V0GB 4GUEA 4UY9A 3OWPA 2XS0A 3PVGA 2CN8A 4EC9A 5IQBA 5CF8A 3WF6A 1NVSA 3KREA 5C4LA 2C5OA 4G1WA 2XVDA 3LZBA 4JQ8A 5CLPA 5IUHA 4F9WA 3DTCA 2BRNA 4LFIA 4RFMA 4RT7A 3SQQA 5CI7A 3DGKA 1B39A 3LJ0A 3UOJA 4ANQA 3NNWA 4L53A 4AA5A 3NUNA 4I0RA 3AG9A 4PL4A 4Y95A 4CFVA 4DLIA 4P7EA 4QQTA 2PYWA 4PPCA 4BDDA 4XJ0A 4C59A 3G33A 3CY3A 4HVGA 5JH6A 4FV6A 4RWKA 3NAXA 3BHYA 2DWBA 2F9GA 2R2PA 4RJ6A 4BICA 2J5FA 5EM7A 4RJ3A 4F65A 4XYFA 4O84A 3POZA 4OTRA 3LMGA 4J98A 5CAQA 5LWNA 1HOWA 4QTEA 4CEGA 4IM0A 1ZMWA 5AIKA 1ZXEA 2PPQA 4M8TA 5HTBA 1LEWA 1FGIA 1Q5KA 3UIXA 3ZTXA 4O91A 2ACXA 4B9DA 3PVBA 3DQWA 1WMKA 5A9UA 5HLPA 1OL1A 5J95A 3FAAA 2HOGA 3WI6A 2R3FA 2ERKA 3O7LD 5KCVA 4R7BA 3BCEA 4RC2A 3NIZA 4G9RA 3P7CA 3GC0A 4UV0A 1XBAA 3D5VA 4C02A 2YAKA 3KB7A 4ORKA 3ANRA 2B9HA 2Z2WA 4XNEA 4NK9A 1U54B 4EZ3A 2Y4IB 4RZWA 4O0SA 1G8SA 3DDQA 3GVUA 4G16A 3IDPA 2OF4A 3OC1A 4BVUA 5AEPA 4GKHA 4B99A 5BVOA 4O0TA 3MY0A 3PG1A 4IVDA 4JS8A 4R6VA 5DR6A 1BL7A 4A9TA 5G1XA 2WTDA 3W2CA 4RIXB 4QO9A 3FL5A 4LM5A 3ZLSA 2NNWB 4IIRA 3F69A 2Y9QA 5CF5A 4EH6A 5M56A 4IB0A 3A60A 4UYNA 5DPVA 4FG7A 3Q4TA 3RAHA 4A9SA 4IANA 3QQHA 4NSTA 2I1MA 4UZHA 3D5XA 3RM7A 5KMKA 2RFSA 4U0IA 2C5VA 4YSMA 4OBOA 3QC9A 4RFZA 5GIOE 3O23A 3L9MA 5CZIA 4GK3A 3ZONA 5LMKA 5HIDA 1ZY5A 5DA3A 4Z3VA 3MSSA 1M2RA 3AC8A 2P4IA 4RJ5A 3LW0A 3E64A 2VWZA 3TDWA 4I4EA 4X6RA 4KA3A 1SVHA 4YGAA 5CEPA 3BU6A 4GK4A 4WG4A 4FSQA 5IDNA 4RC4A 5EG3A 4XG6A 4IAIA 1J91A 2UZEA 3PXRA 4QMVA 3PWYA 5HTCA 2QQ7A 5HG7A 4G5PA 3UP7A 3KXGA 3QTUA 4O81A 5FUTA 3UVPA 2WXVA 3ORMA 3RMFA 2XKEA 3U6JA 1ZWSA 1W0XC 1WBWA 4OTFA 2W4KA 3KGAA 4IX5A 4PPBA 4E8AA 3KL8A 5EI8A 2DQ7X 3ZU7A 4DGLC 1T46A 4RVMA 4EC8A 4D1XA 1YI6A 3OG7A 3BGZA 3GUBA 5I3RA 4X2FA 1H01A 4JRNA 1ZYDA 1STCE 4MXCA 2JDVA 5AR7A 4ZK5A 4D4RA 2PY3A 4D4SA 3REPA 1XH9A 5IUGA 5J87A 1OKWA 4Z7GA 4FGBA 2JIUA 1QPDA 3DAJA 3DBFA 2C3JA 4BBEA 4FSTA 5JFVA 2C47A 4XRLA 4QP1A 3HMNA 2JFLA 3QL8A 3B8RA 2WAJA 4MNEA 4JAIA 5CZHA 1JWHA 2IZUA 1BI7A 2X1NA 3TZ9A 5DGZA 3I7BA 4O7RA 2XYNA 4FYNA 4ALWA 2W1IA 3DBDA 4YBKA 5HEZA 3FJQE 4K9YA 4USDA 3S2PA 4AT5A 1R0EA 2CLQA 4EZ7A 1Q8TA 3P08A 4MVFA 3V8SA 2R7IA 2XKDA 3ENMA 3KXZA 4UB7A 4D28A 3IECA 5CU4A 4F63A 1BUHA 2VGPA 5IQEA 2JC6A 1XH5A 3QX2A 3CGFA 5IQFA 2UUEA 4HYHA 1G3NA 4KABA 2EU9A 2GTNA 2YAAA 4WNOA 3W55A 4D2VA 4HGEA 5KBQA 4F0GA 4IAKA 5E92A 3UOHA 2YCQA 4PF4A 4Y5QA 3QTZA 3E87A 2J0JA 4GS6A 3IW6A 3RZBA 4RA5A 3EKKA 3T3UA 3QU0A 4C61A 4FIHA 3IW4A 3CIKA 4ARKA 4FT3A 1WBOA 4QD6A 3PJ8A 2VX0A 3A8WA 3HYHA 4UWBA 5CY3A 3TNQB 4C4HA 4GK2A 3NNUA 3P5KA 3ZOSA 5HNGA 4BWKA 5LVOA 2H9VA 3NW5A 4EOQA 2UW7A 4GG7A 4M0YA 5BVDA 3LFCA 3K5UA 4NM7A 2QOIA 4WBBB 3VUTA 3O96A 5H8GA 2BIKB 3GC7A 4QYYA 5E91A 4HCTA 1M7NA 5IEXA 4GG5A 1JSVA 2YM6A 4M66A 4TYHA 4W9WA 3P86A 3FI8A 3D5UA 2OF2A 3MVHA 4E1ZA 3LLAA 1M14A 3E92A 3GFEA 4FV3A 5J79A 2JIIA 1E1VA 1OZ1A 4WG5A 5D7VA 2B54A 3PVUA 4U80A 1LP4A 4C2VA 4AOIA 5FGKA 3D4QA 3EZVA 5BNJA 2IVSA 2EXMA 4OTHA 4LMNA 2WMQA 3QALE 5DBXA 4U79A 5IZFA 5TE0A 4DFBA 2ITUA 3IW8A 4CFNA 3D15A 1ZOHA 5DVRA 2W7XA 4FKLA 3FC2A 5GZ9A 1IA9A 4B4LA 4PNKA 2JDOA 2ZVAA 2W96B 3KY2A 3MA6A 4QMMA 1W82A 3QTRA 3PSDA 5DLSA 3ZEWA 4YZDA 2OO8X 3BRBA 2X2KA 5L6WL 3W2QA 3HMOA 3EOCA 1RQQA 1Q8YA 5CU2A 1K9AA 1XO2B 3T9IA 3ZM9A 1FMKA 3NPCA 5ACBC 4FV8A 4FT0A 4ZAUA 3HAMA 3GEQA 1GNGA 3BYMA 1IRKA 4Q2AA 4C2WA 4D9UA 4EYJA 2VWBA 1H24A 2E9VA 4G31A 5LVPA 3JVRA 4C8BA 1P4OA 4OBPA 4IAFA 2IPXA 3LPBA 1ZY4A 3LAUA 3R00A 1GZKA 3Q5IA 4JR7A 4K11A 4XBUA 4BCQA 2BR1A 1H1WA 2BFYA 3M2WA 1KV1A 3R04A 4O7NA 3QRKA 2OZAB 3V5PA 5JRQA 2G2FA 5KX8A 4ZEGA 5L2IA 3UG2A 1YW2A 4HYUA 2ZAZA 4I5CA 4NTSA 3WE4A 4BGGA 4JAJA 4HJOA 3F3UA 1KE7A 2C5XA 4BBMA 4FSRA 4Z16A 3MFSA 3HV4A 3F6XA 3FKLA 2CN5A 2CKEA 1UU9A 3WILA 4OTPA 4NL0A 2G15A 4GJ2A 1H8FA 4ASXA 3NUSA 3TJCA 4D9TA 2XIZA 2ITXA 2B55A 3O7LB 4PNIA 3PPZA 2QG7A 2G9XA 4YJTA 1ZLTA 3ATSA 4R77A 3UJGA 3OXTA 3UC4A 4L3PA 3TIZA 3VHKA 2CGUA 2X4FA 4OTGA 4QMSA 1ZZ2A 2X7OA 4QMXA 3LFEA 3PXQA 4LGGA 1YDSE 3QKMA 4CYIA 2ITQA 4RX9A 5HD4A 4H3QA 3ZBFA 3LQ5A 5K0XA 2GNIA 4USEA 5HX8A 2BZHB 3KN6A 4ANNA 1CMKE 4YJOA 4DT8A 4J95A 4NEUA 3GQLA 4HZSA 3WYYA 4DHFA 3TDVA 2F7EE 3TZ7A 2YLEA 5C8NA 1FBNA 2YCSA 4UN0C 3EQGA 3P4KA 4DFZE 5EH0A 5JK3A 2J0LA 4M7IA 2JAMA 3DB8A 3R7GA 2IZTA 4JX3A 2QD9A 4N4SA 5EHOA 3RWPA 3PSCA 4C34A 1XH8A 3GGFA 4F7SA 5IH5A 3NUAA 2UW4A 4A9YA 3ZS5A 2XCHA 5H8BA 5M44A 3MH0A 1Q61A 1W8CA 4AGCA 3GOKA 3ODZX 4AGDA 4EZ5A 5M4CA 3LFSA 1J3HA 5FM3A 2XK6A 3W2PA 1OL7A 3M42A 3MI9A 5EDQA 2R4BA 3G0FA 4F7NA 3DT1A 1Q99A 4FIEA 4K0YA 4PDPA 5FXQA 3AXWA 5B7VA 3BQRA 4I5MA 2PVYA 4AZTA 5JFSA 2VWWA 4DG3E 2J4ZA 2C30A 3KKVA 4CZTA 2YIRA 4AAAA 4F7LA 2J0KA 3A61A 3D7TA 3P0MA 4HOKA 3FWQA 2SRCA 1MUOA 3VBVA 3ZSIA 4JBVA 3CLYA 4W4WA 4FTLA 4YR8A 1J7LA 5M55A 4F99A 2RFNA 3TTIA 5B2MA 3QA8A 3OD6X 5FDPA 4FTRA 1BYGA 4FC0A 4YZMA 4AA0A 4ZTRA 2XEZA 3QRIA 4QNAA 3BLHA 3ITZA 4C7TA 4FVPA 4OLIA 3UO5A 2A4LA 4O7TA 2GMXA 4QYGA 3ALNA 3R8VA 1FVVA 4FEXA 4QTDA 3ZFXA 5KO1A 3HDMA 3PZHA 5AADA 4A06A 4EOKA 5KHWA 2VTHA 2X2LA 5FXSA 1DAWA 3F5PA 4QQ5A 3V01A 2NP8A 1Y6BA 3SW4A 3HV6A 3DY7A 3AD5A 3QUEA 4QP7A 4IQ6A 3L8PA 2JD5A 2PVLA 2J0MB 4O0WA 5FP5A 2BILB 4IFGA 2OSCA 3AC5A 2RG5A 4RQVA 3VBQA 3F2RA 4QP2A 3RPYA 4ANSA 1P5EA 1OIRA 3F7ZA 4WBOA 3EN4A 4M68A 4D2RA 3MYGA 4TXCA 3F2NA 3RK7A 3D7ZA 3GU5A 3QD3A 5CSXA 5HCYA 3RZFA 3CPCA 3FL4A 4I94A 1PYEA 4AOJA 4TPTA 4EK8A 4FT5A 3DJ6A 3VUMA 1KOAA 4DGNA 3D2KA 3HLLA 4J99A 3LXLA 3C50A 2NRYA 4MKCA 4QMPA 4ACDA 4TKSA 3MFTA 4I1ZA 4M13A 1U5QA 3G9LX 2XK7A 3UQGA 5L2WA 4PDSA 4I20A 2WTKB 1YHVA 3LCSA 1UWHA 5BMMA 3V5JA 3ZSGA 1LUFA 2VU3A 3KRRA 3UODA 2VTQA 5DN3A 4TN6A 3LJ1A 4ZTHA 4APPA 2VTAA 3UNZA 3R1NA 2UZTA 5M07A 1MRYA 4IMYA 3SHEA 4KKHA 3VS3A 4FG8A 1R0PA 2YWPA 5LCKA 3GXLA 4IFCA 4ENXA 2GS2A 4CVAA 3HX4A 4O7SA 2BHEA 2IN6A 4JL9A 4PTEA 2BAKA 4BDKA 4GMYA 2QOOA 2ITVA 4I5HA 1JBPE 4ZTNA 5TT7A 4AQCA 2ZM4A 4E6QA 5CENA 5LWMA 4DTBA 3VF8A 2B4SB 2CGWA 5CXZA 5B0XA 4BYJA 1G5SA 3QTQA 4BDFA 3RAIA 2PVJA 4LL0A 2Y4IC 2X81A 2X8DA 3F5GA 3QA0A 4U9AA 3RINA 3ROCA 5GZ8A 2CNVA 4FIFA 4S30A 3WF7A 3OBGA 4F9BA 1SVEA 3OW3A 4JRVA 4DFXE 3AT3A 2V22A 3BYOA 3DJ5A 3HNGA 2BTRA 5BYYA 3SA0A 3U6HA 4IX4A 2YM5A 5I0BA 1P14A 4CMTA 4BI0A 2XZSA 4J52A 2QR8A 4JT3A 1VYZA 5FTOA 5DT4A 4NCTC 3HGKA 4FSUA 2X9FA 4JDIA 4WOVA 2HZ0A 4O0XA 4ZJJA 4CV9A 5K5XA 2IJMA 5JZJA 4TYGA 3BQCA 4I4FA 4DGOA 2ZOQA 3AGMA 2W99B 5J1VA 3DFAA 5AX3A 3UIMA 4F64A 3BU5A 3QQFA 1PXNA 4QMOA 2ITWA 4TNDA 2XCKA 5IEYA 4O7WA 3GI3A 2HZ4A 3V5QA 3OHTA 4J96A 2CGXA 3CTJA 4UALA 3HRCA 2QODA 5HE0A 1IASA 1REKA 3II5A 4FV4A 3TL8A 4QMNA 4H05A 2PZRA 3FZTA 4GUBA 4CMUA 5DWRA 4ZP5A 1BI8A 2GDOA 5IF1A 4KSQA 4PQNA 4MD9E 4D1ZA 4OTQA 5KE0A 1H26A 4WNKA 4FZDB 5HGIA 4F0IA 5CANA 4GFMA 3P23A 1XWSA 3QWKA 4J1RA 3ZRKA 2UZDA 4KB8A 4J7BA 4BCPA 4B8LA 2GPHA 3IGGA 2X8EA 2ETKA 2ZDTA 3R1QA 4U40A 2CKPA 1TQIA 2F7ZE 4CTCA 2BUJA 4YTHA 3LCDA 4IAAA 3I0QA 4LGDA 3OROA 3L8XA 2BZKB 3Q9ZA 2VTOA 4YJPA 2JEDA 3FHIA 4U45A 3RI1A 3W2OA 1JSUA 4G3EA 4YSJA 3DXQA 5ETFA 1WVXA 2XH5A 4KRDA 4C4JA 4GRBA 3SAYA 3BHUA 5E8ZA 3ULZA 3KULB 3PJ2A 5IA2A 3HL7A 4LMUA 4QP4A 4N70A 4W9XA 3VUKA 5HVYA 5AAEA 1P4FA 4HPTE 4GSBA 4YPSA 5AP7A 3FMDA 5BX0A 4XOYA 3KEXA 5EM5A 2B9IA 5DEYA 4HZRA 2PVKA 4D4VA 2VO0A 1RW8A 4QQJA 3ZFMA 4EK6A 4PMSA 3D94A 4O1PA 2R9SA 2C5NA 3QUDA 4AE6A 1PKGA 1H25A 2E9PA 5CT7A 5KMLA 2ITZA 3CP9A 5AWMA 2OJFE 5HKMA 2WPAA 4O6LA 4RIWA 3W1FA 3D14A 3FQHA 1PXIA 3HUCA 4IAZA 1H07A 3ORNA 4XX9A 4I93A 5KUPA 3R8ZA 2O65A 3OUKA 2WELA 4GCJA 1Q8UA 3FMJA 3HEGA 5FBNC 4FUYA 3RCDA 3E93A 2QOFA 3I79A 2YACA 4UMUA 1GZ8A 4O0VA 2PULA 4XLVA 2Y4PA 2X7GA 2YERA 2DS1A 5I9YA 5KMNA 2WTJA 3QD0A 2CGVA 2VZ6A 3C13A 2ESMA 3Q9XA 5IQDA 3ZO2A 2VNWA 2OJIA 1I44A 4WA9A 5J5TA 1K2PA 3ODYX 2FH9A 5EK7A 4NFMA 3DKCA 4C35A 2F49A 3FZ1A 3G2FA 2WO6A 1WCCA 2W9FB 4FKWA 4RJ7A 5BPYA 3EQBA 3G6GA 1FINA 4XG7A 4XS2A 5BUIA 3DK6A 3BBWA 3CD3A 4R1YA 4AFJA 1BL6A 4U3ZA 3VVHA 3E7VA 1H28A 1FVTA 4ANOA 4YPDA 3FKNA 2GNGA 4H39A 5CSVA 4EBWA 2QC6A 4TYEA 3A7IA 4EOJA 4NIFA 3QC4A 4UMPA 3EL7A 3FI2A 1YVJA 2B7AA 1VR2A 3FQEA 3PE1A 4WNPA 3TNPC 1CKPA 3ORTA 4L7SA 3UO4A 3ZLWA 3NVKI 1IAJA 4MBIA 4FIGA 1OECA 2C6OA 2QONA 2YCRA 3R30A 2BALA 2G2HA 4GFGA 4L01A 3T9TA 2HW7A 3C4WA 3OFMA 3P79A 3TNHA 3A4OX 3Q6UA 2PZPA 1E9HA 4XHKB 4CXAA 4RX7A 5IG1A 2YDKA 3FSKA 3ZXZA 4PMPA 4QMYA 1UV5A 3A7FA 4DBNA 2PVRA 2W1GA 4GIIA 5J9ZA 4OTWA 5BQ0A 1PJKA 4FODA 4Z55A 3VS4A 1MQBA 2XNNA 3DFCB 3TV6A 3ULIA 3R9HA 2XIYA 4PWNA 4RJ4A 5A54A 3R8UA 5D12A 3HRBA 4A4LA 3PJ3A 5HG5A 1YDTE 3FZOA 3Q9YA 4YZCA 2I6LA 3PXZA 3QRJA 3I60A 3C9WA 1DI8A 2X6EA 4AT3A 4Y72A 2ITOA 1QCFA 4QRCA 3LCTA 4XP0A 3LOKA 5GJDA 4CFUA 4C4GA 4BDAA 3EFJA 4E6AA 3ZFYA 4L43A 3UOKA 4YP8A 1GZOA 4O0RA 5CXHA 3IKAA 4QYFA 2HK5A 5D11A 4XG4A 2BRGA 3C4XA 4L45A 4FEVA 3FKOA 2QOCA 4MH7A 1Q3DA 5A46A 5CAVA 4L3LA 4FF8A 3COMA 1PMUA 2UW0A 2IW9A 4O2PA 5CEKA 4DH8A 4NZWB 4X2KA 2WIPA 3I0OA 4FZ7A 3PIZA 4P4CA 2OK1A 5AAGA 5M51A 4R78A 1ATPE 2GFCA 4QYEA 2UVZA 5D7AA 3UG1A 2C6KA 3DAKA 2A19B 3NW6A 1WZYA 2BZIB 2GS6A 3FDNA 2QU6A 3TJDA 1PMNA 4LRMA 4PP7A 5LCJA 5M06A 2PVNA 4BWPA 2JDRA 4KBCA 1OM1A 3G90X 2PE0A 5DT3A 3HA8A 1UA2A 5CF4A 2J50A 4CG8A 2OI4X 2R3LA 3OT8A 3DNDA 5IMEA 4FEWA 4EHEA 4AW2A 2XNOA 3KA0A 4NW6A 1TQMA 4I6FA 1UNLA 1UNHA 2J6MA 2P0CA 4KKGA 2KULA 3ERKA 5HCXA 5HCZA 1OPKA 1YDRE 3JS2A 4XV1A 4DYMA 4BCIA 3JUHA 3NUUA 3QQLA 1LEZA 4LUDA 3FLYA 4BTMA 1Q41A 4EUUA 4EH4A 5ANOA 3PDTA 4XG2A 3FLNC 4ZZOA 3RHXA 3POOA 3WIGA 3AD6A 3PXYA 4CRLA 3D2IA 3EKNA 4EHZA 4WRGA 1U46A 4IAYA 4YLKA 3VRZA 4YZBA 2B9FA 2JDSA 3MBLA 3Q4CA 4O6EA 5JGAA 3LVPA 2QOLA 2VWXA 3F5XA 2YA9A 4BFMA 1UVRA 3SD0A 3VUGA 3NEWA 5EOBA 4ZJIA 3A2CA 3R7IA 3MY1A 4RJ8A 2PUNA 2HIWA 3G15A 1GY3A 1ZYSA 4NU1A 4NH1A 5KZ0A 4ZJVA 5IPJA 1SYKA 2PMLX 2YDJA 1KWPA 2JGZA 1UNGA 4S31A 3ZO1A 5E8SA 4FKJA 5FD2A 4LRJA 5HD7A 1BKXA 4KS8A 3VF9A 5DIAA 3UBDA 4Y5HA 2HCKA 5GJGA 4I6QA 3ZXTA 5LOHA 4NYEA 2W0JA 1J1CA 1VJYA 4YLJA 2OIDA 4RGJA 4HVDA 4BF2A 3DA6A 4JG8A 2FSOX 3I7CA 4H3PA 4IJPA 4XV9A 1FGKA 2OGVA 3MTFA 4GT4A 3TWJA 3M1SA 4OAUC 3MPMA 4U8ZA 3PA5A 1F5QA 4A9UA 4HYIA 4O22A 2GS7A 4FIIA 3V3VA 2XMYA 5IMXA 2R3IA 3RJCA 2XKCA 4L00A 4V05A 2ZM3A 4YC6A 4FL1A 2C3LA 2NO3A 3DKGA 4LOPA 2PVMA 4EQMA 2XIXA 3QXOA 5DHJA 3QLFA 5HESA 1JLUE 2VO7A 4X2GA 5C9CA 4IWQA 4J8NA 4CZYB 4FGRA 3EN7A 5ANKA 4DT9A 2YIWA 2Z7LA 1PKDA 3SC1A 5ETIA 1YXXA 2QG5A 5C26A 3IPHA 3DBEA 5CVFA 4N0SA 1QPEA 5FDXA 2O63A 3HV3A 1PXMA 1ZYCA 3SKCA 1ZYLA 2G01A 5AUUA 1R78A 3BEAA 2QI8A 4AT4A 1Q97A 3GBZA 4RIXA 4MNEB 4BDBA 3F3TA 3PP0A 1O9UA 2VTJA 2PL0A 3AT2A 2H96A 3H9FA 3IS5A 3DBQA 5CTPA 4BDCA 4EH5A 2V55A 2WTKC 2CNUA 5JZNA 2PMOX 3OS3A 4XG9A 3KFAA 1XH7A 4KINA 3G51A 2WTVA 2JITA 4G9CA 4YTFA 4DEAA 3JYAA 2UZUE 3EQHA 3HUBA 2W1ZA 4E4NA 3EFLA 3Q32A 5TR6A 3AT4A 3TXOA 4FTAA 2ONLC 3PXKA 2HAKA 2I7QA 3FE3A 3KCKA 2XRUA 3DZQA 3G9NA 3ORPA 1ZYJA 3PY1A 4JVGA 4QT1A 4EL9A 1J7IA 3QBNA 3I5ZA 2C69A 3Q52A 4L3JA 3ZSHA 2WNTA 4CLJA 3OCSA 3UIUA 2YITA 2OFUA 4XV2A 5DH3A 5A4LA 1SNUA 4ASZA 3MA3A 4QMWA 4QPMA 2OJJA 3IOPA 2C1BA 4Q5EA 3QWJA 4FKSA 3ZLYA 4W4YA 3S95A 3QRUA 4FV1A 4MWIA 4QOXA 3UP2A 4GEOA 2CLXA 3R83A 5K9IA 1FQ1B 2P3GX 3L1SA 2A0CX 2W1FA 2WMTA 2ZB0A 5I5ZA 2UZOA 4JG6A 4TYHB 1BX6A 4KNBA 2UZLA 3CD8A 3MN3A 2PSQA 3KXHA 4MCVA 4F7JA 4DFNA 4U41A 4RWJA 3QCXA 4C3RA 5JT2A 3R02A 5IISA 5HVKA 4TTHB 1KE9A 4MWHA 1RJBA 3R9OA 2XNEA 4A9RA 2JLDA 4UBAA 3QUPA 4BDIA 1B38A 1R39A 3CR0A 3PJ1A 3CJGA 4IACA 1CSNA 2QKRA 3TN8A 3MVLA 3O8UA 5AR8A 4CFMA 5AV4A 2HY0A 4DINA 2ZM1A 4FZAB 5H3QA 5K5NA 4UXLA 4OT5A 5AX9A 5CI6A 5EYCA 2KTYA 3PY0A 3WIKA 2NRUA 3QZIA 4CT2A 3COHA 5IKWA 4B7TA 2WU7A 1Q4LA 2AYPA 1YI4A 4G17A 2VN9A 4IWOA 1I09A 3QLGA 4BL1A 2GU8A 3MPTA 4ZTLA 3AOXA 4FUXA 5ETAA 5AR3A 4PTCA 2WOUA 3FPMA 1XR1A 3BE2A 3MPAA 3Q9WA 4FKRA 2OXYA 3GCUA 4DH1A 2BKZA 2X8IA 5CEQA 3IDBA 5B2KA 4CQEA 5A6OA 1KOBA 3RVGA 2BAJA 3WYXA 2UZVA 3Q2MA 5ANJA 2YCFA 4C4EA 4HYSA 3MGYA 2HZNA 4G34A 1TQPA 3QQJA 3COIA 4FTKA 5DNRA 5LVMA 4ZZMA 1TVOA 4BDJA 2WMWA 3DQXA 1AGWA 3DTWA 5HORA 4UX9A 4FICA 4LRKA 3LFNA 2XK4A 5DR9A 4B0GA 1WVWA 5CASA 5AA8A 4I3ZA 5AUXA 3CTQA 4QP9A 3S0OA 3H10A 4FSWA 4W4XA 4P90A 4O96A 4AW5A 3RKBA 4C57A 4DTKA 1ERKA 4QPSA 4FA2A 3EYGA 5KBRA 4DG2E 2WEVA 2C68A 3ZDIA 2CPKE 2WMXA 5CU3A 3R7YA 2J0IA 5AUTA 3TUCA 3GQIA 1P2AA 4ASEA 3EFKA 3ORLA 1V0BA 1WBSA 4ZY5A 1H1SA 3UO6A 4PY1A 5J7HA 3KMUA 4R5SA 4DA5A 4IW0A 1T45A 3SDJA 3R01A 2LGCA 4IVCA 4M14A 4M12A 4IEBA 4BKYA 3NMUF 3FI3A 5FP6A 5EM8A 3LHJA 5FG8A 2QKWB 1MRUA 2BZJA 4FTTA 4JBPA 4K18A 1DI9A 2F57A 4MD8E 4YZNA 5KKRC 2Z02A 3ZC5A 4QTCA 4U5JA 4ITIA 3E8NA 4XLIA 2YHVA 1IA8A 4OTDA 3OT3A 4UWCA 5HO6A 4CCBA 4ANMA 3PY3A 1QL6A 5M53A 1KUTA 1M52A 4FT9A 5DR2A 2ITTA 3E62A 1GJOA 5E1EA 3PZEA 5IH6A 3MIAA 5DOSA 3P1AA 3IW5A 3MIYA 2XBJA 2UW8A 3UYSA 2AC5A 3SXRA 3KC3A 2VTNA 4OBQA 3VWAA 1SMHA 3TUDA 1OUYA 4ZIMA 3GENA 3AC1A 5D41A 3WOWA 3B2TA 4DEDA 5F4NA 3QXPA 2NPQA 3MW1A 3EZRA 3NZ0A 4UMTA 3VHEA 4MTAA 2FYSA 5M4UA 4MEDA 2O64A 5HE2A 2HELA 2E9NA 3ZZWA 4L68A 3FZSA 2CNQA 3UYTA 4ANBA 4ZLZA 3Q5ZA 3FBVA 4X2NA 5E8WA 4FK3A 4IC8A 2YZAA 5HX6A 4O7YA 4CFXA 3TZMA 4D58A 4WSYA 2WIHA 4NJDA 3OXIA 3ZH8A 4EHGA 1VEBA 1XBBA 3EJ1A 2V5QA 3D7TB 2HENA 3NS9A 5AR4A 4NKSA 5EW8A 4BIDA 1Q8ZA 4ALVA 2YWVA 4ZY4A 3FZRA 1JAMA 3H30A 4OT6A 4OUCA 3O51A 3U8WA 3EHAA 4PTGA 3PG3A 1OIQA 4IZ7A 5GHVA 4F4PA 2PUIA 1EH4A 3FLSA 1XKKA 4JBQA 1U5RA 3PPJA 4CGAA 3WARA 5I9WA 3NDMA 4EH7A 4CKJA 3DBCA 1UWJA 1YXTA 1PF8A 4D55A 4OW8A 5JN2A 1U4DA 3UVRA 4FKTA 1Q24A 3SRVA 4C58A 4O7VA 3A7JA 5EFQA 2FB8A 3CEKA 4BCMA 4RIYA 4XG3A 3FC1X 3UVQA 2H6DA 1QPJA 3ET7A 3F3WA 3U9NA 3VBWA 4WKQA 3FSFA 4RSSA 5DEWA 4YU2A 2OJGA 4CYJA 4FTUA 4EOPA 2HW6A 4UMRA 4FG9A 4RWIA 5CF6A 5CNOA 4O83A 2JDTA 4KKEA 4E5BA 3R8MA 4F6UA 3CBLA 5E9EA 2XK9A 4K2RA 2ZJWA 3EQFA 5IA3A 1A9UA 3G6HA 3GC9A 1OL2A 3V04A 2RFDA 2JAVA 3R21A 2VGOA 4YNEA 2H34A 2WOTA 2I40A 3E8EA 2VWYA 5EHLA 1GIIA 1OGUA 2OH0E 1UKIA 4IWDA 4WO5A 4AOTA 5ITAA 2HY81 4TWOA 3QX4A 1ZOGA 4I41A 3V5TA 1ND4A 2OLCA 3BE9A 3QD2B 4GV1A 5FBOA 3RCJA 4DF3A 3OTUA 4N57A 5JRSA 4MXOA 1SNXA 4BRXA 2QOKA 2WD1A 4ENYA 2XJ0A 3MDYA 4J53A 5HG8A 2IVTA 2UW9A 3MJ1A 4LYNA 5DRBA 4X3FB 4AE9A 5T6KA 3AMYA 5CEOA 3W18A 2YLFA 2XF0A 1H4LA 2B53A 4JI9A 2UW6A 1HCKA 2X9EA 3L9PA 4FNZA 5ETCA 4DEBA 5E8UA 4D2SA 4IB5A 4ITJA 4G6LA 3JY9A 5EDRA 2GQRA 1RE8A 2WB8A 5DMZA 1O6LA 3FQSA 3O71A 3C0IA 2R3KA 2I0EA 3PA3A 2W1DA 4EK3A 2WMBA 4GVAA 3R22A 3HMMA 5L2SA 2VD5A 3TV4A 3HZTA 4J97A 4S33A 3MH1A 4FK6A 3ZZEA 2C4GA 1CM8A 3ENHA 4MXZA 5A4CA 4FL2A 1WBTA 3P7BA 5CWZA 2Y6OA 2YFXA 2GFSA 3Q04A 5FM2A 3VNTA 2R3GA 3OZ6A 5EW3A 4XV3A 3OWJA 3DJ7A 3NCGA 4R7HA 4RRVA 4II5A 5FRIA 3W8QA 2QHMA 2XA4A 5JEBA 3SG9A 3E8CA 4YJVA 3WF9A 2R7BA 5FWKK 4EI4A 3R8PA 5BUEA 3L8VA 4FVQA 4BTFA 5HNIX 1OMWA 5IQCA 1PHKA 3AQVA 3EQIA 4KIQA 4MBLA 4LOOA 1R3CA 3LFQA 2IW6A 3HVCA 4PDYA 2VWIA 3B2WA 3IW7A 5AM6A 2BPMA 5HBHA 4AN9A 4C36A 1YI3A 2C5YA 3SV0A 5K4IA 4KSPA 3A4PA 4W8EA 3F3VA 3R73A 3TI1A 2QNJA 3BZ3A 3H3CA 3TT0A 4BHNA 4Y85A 4FX3A 3O50A 5LXMA 5LMKC 5HICA 2CSNA 1MP8A 1URCA 3AC4A 4ZOGA 2OU7A 2WMUA 2YM4A 3HA6A 4FR4A 3TUBA 3IQ7A 2W4JA 4P2KA 3WZJA 3BHVA 2QHNA 4ZSEA 4GJ3A 1OKVA 4MXXA 4QMLA 5CQUA 4BZDA 4I6BA 4BDHA 3VN9A 3BYSA 4G2FA 3HP2A 4JXFA 3U4WA 3R28A 3OCBA 4CNHA 4JOAA 1CTPE 3CS9A 5A3XA 2IW8A 3FMNA 3LM0A 4U97A 2X0GA 3FV8A 3LE6A 5E7RA 2ONLA 4XCUA 3ORZA 1KV2A 4GYIA 1NXKA 1PMEA 5L8KA 4BIBA 3C7QA 1OUKA 2WQNA 5E90A 4QMQA 2G2IA 4FV9A 5E8TA 3KQ7A 2WTWA 1K3AA 4JDJA 1E1XA 4I22A 3U54A 1OBDA 3KN5A 4L52A 5AP2A 4JX7A 4Y46A 1U59A 4PL5A 4FTJA 4M69A 5I3OA 1PMVA 3WE8A 4O0YA 1S9JA 4F9CA 4FT7A 3FI4A 4BCFA 5AUYA 2VO3A 3N4TA 3KXNA 3ZRMA 3VS6A 3BGPA 4LV5A 5A4EA 5GZAA 3PTGA 5IA1A 4NM5A 2VO6A 4BCHA 2ETRA 4M3QA 5HBJA 2BDWA 1OI9A 2JKQA 3GB2A 3NW7A 2P55A 2AUHA 4I92A 5EKOA 4ZTQA 2GHLA 4AW0A 3ZCLA 3WF8A 4ASDA 2O2UA 3ELJA 4EKLA 3DOGA 5BVFA 5ANIA 3CPBA 3EQCA 3KRJA 5J9YA 3SLSA 2QLUA 4FKUA 4G3GA 4RIWB 4RMZA 5CSPA 4QP8A 4E73A 3SXFA 1JNKA 3ID6C 4AZVA 3T3VA 5CSHA 3RALA 1WVYA 4KIKB 4BCOA 2QOBA 2ZV7A 3AC3A 1CDKA 5HLNA 3ORKA 2VTRA 5C8KA 4PPAA 4L42A 1AQ1A 3QTSA 1M17A 1YXVA 4LUEA 4NT4A 4NW5A 5FEEA 2WQOA 5A4TA 2YN8A 3WBLA 5AR2A 4EOSA 1DAYA 2VV9A 4DEEA 2FSLX 2J7TA 3PWDA 4QMZA 5FLFA 4FSNA 3GU6A 3OXZA 3ORIA 5HE3A 4E5WA 2A2AA 3THBA 4FTQA 3AD4A 3G0EA 3NCZA 3MJ2A 2XUUA 5CVGA 3RM6A 4RZVA 2OXXA 2Y8OA 2YJSA 3MVJA 4GYGA 4PMMA 4ZSLA 2O5KA 4F09A 5F9EA 2ZB1A 3ZEPA 3FMEA 4JR3A 3W10A 3LFFA 4A7CA 2VWUA 1YXSA 1OL6A 4ZMFA 4ZMEA 5GIPE 1URWA 4GU6A 3LQ8A 5FXRA 3GU4A 4DN5A 3VS1A 3BEGA 3I4BA 2WZJA 2BDJA 1PRYA 2OXDA 1PXPA 4DH3A 4RX8A 4DH7A 5AA9A 1ZARA 3O0GA 5ANEA 3E3BX 1OITA 4YHFA 4NJ3A 5AP1A 4FSZA 3ZUUA 4A4OA 3ACKA 4ZLYA 4TY1A 4TL0A 3KK9A 4G5JA 2WFYA 3QGWA 4L46A 4N6ZA 3QAME 4NIFB 3A7GA 1PW2A 3NX8A 2XM9A 3GNIB 2IVVA 3LQ3A 2PVHA 2RL5A 2OICA 5AV2A 3RPSA 3UC3A 5E4HA 3KRLA 5CYIA 4GKIA 3D9VA 2R3PA 2RG6A 4NUSA 2ZV8A 5AIRA 4E6DA 2QCSA 2EVAA 4Z9LA 5DE2A 4U42A 4MYGA 3LJ2A 4MK0A 3ZHPC 3PUPA 5JGDA 3E7OA 2R3NA 4IXPA 4C37A 4F9AA 1KE6A 3RWQA 3AC2A 4RVTA 4YJSA 4Y8DA 5IQIA 4KRCA 4XH6A 2J51A 3FMHA 2BIYA 4RC3A 3RPOA 4BGQA 5J1WA 3R1SA 3CE3A 3FYKX 4O38A 5CALA 1H08A 3JY0A 3N4VA 4BCNA 5EHYA 4AFEA 4ERKA 2C1AA 3F2AA 3QRTA 2QVSE 5EI6A 2PZ5A 3QZFA 4CLIA 1O6KA 4IHPA 3R7OA 4C33A 4BGHA 4F1MA 3KXMA 4UYAA 2UW3A 2C6MA 3VJOA 1IR3A 3K54A 4NTTA 5HVJA 2WKMA 3ZO4A 4J71A 5KZIA 4D2TA 5EQEA 1Y91A 3QTIA 4OAVB 3BI6A 3MB7A 3PXFA 4E6CA 3K3JA 2OKRA 2UVYA 2VWVA 3EWHA 5ICPA 3I5NA 4BIEA 3EFWA 4IH8A 4BCGA 2V0DA 5AJQA 3LFDA 4D2PA 4EH8A 1XHAA 2XEYA 5KMIA 1UU8A 2GCDA 5AUWA 4YO4A 1NT2A 3RPRA 1PXJA 1YWVA 3OMVA 4XG8A 1WFCA 3DNEA 3TACA 4JIKA 4RQKA 4FNXA 3R7UA 3O8TA 5KHXA 3ZMMA 4EWQA 1JKKA 3QCSA 4XP2A 2Z60A 5L4QA 2R3QA 3MWUA 5BVEA 1OIYA 2W5HA 3PLSA 1J1BA 4ZLOA 2C6EA 4UZDA 1M2PA 3BYVA 4H58A 3PVWA 4F9YA 1NW1A 4RFYA 4BN1A 5LVLA 3UZTA 2BHHA 2OG8A 3GU7A 4EWHA 3FXWA 4F6WA 4IB3A 5EQPA 4R8QA 4WNMA 2R3MA 4EOOA 3CXWA 1H1PA 2CMWA 5C01A 3SVVA 1J7UA 3EQRA 4QP6A 5EYKA 4FTNA 3FXXA 5I9ZA 3LFBA 4X21A 4O27B 3HECA 3TKHA 3TKIA 3Q2JA 3W16A 4F08A 5L2TA 1WBNA 1OPJA 4GVJA 4DEIA 2Q0BA 5E8YA 3U87A 2ZMDA 3VAPA 4AACA 3DKOA 4C4FA 2UZNA 4TWNA 5F95A 5DFPA 5LARA 1IAHA 1G8AA 2UV2A 1JPAA 5FEDA 5A4QA 4KBAA 1JVPP 1W84A 3H9RA 4ID7A 4LI5A 5JFWA 2O0UA 4JLCA 5E8XA 5AR5A 3QD4A 3UNJA 4AP7A 2JKMA 5DYJA 2HXQA 3EN6A 1YWNA 3C0GA 4O7LA 2BAQA 2XIRA 3UPZA 2CCHA 3F7WA 1WAKA 2XNBA 4G6NA 4V0GA 1PXKA 3DAEA 3KRXA 4HCUA 1OKYA 2F4JA 2XNPA 5A6NA 2W1CA 1OL5A 3QHRA 4FKGA 4MQ1A 3NVMB 4FSMA 1SZMA 3VS5A 4AF3A 5DG5A 3SOAA 1GAGA 2GTMA 4IX3A 4BDEA 3NNVA 5KNJA 4EORA 3EQDA 3F9NA 3FHRA 4FKOA 4EH2A 3I81A 3DU8A 1JSTA 4WUAA 2BROA 3V51A 3MB6A 5C27A 4BKJA 4CT1A 4DAWA 4L6QA 4R3RA 5C03A 4AWIA 1GIHA 4EH3A 4E4XA 3AMBA 3TTJA 1OKZA 2P33A 3NSZA 4DFLA 4BR3A 5L6PA 3ETAA 2HYYA 5K3YA 3OWKA 3PIXA 3VQHA 1ZAOA 4M84A 4X3JA 2Z7SA 1YOJA 3D5WA 3EH9A 4FNWA 5F1ZA 2F2UA 2DUVA 3ORXA 4RBLA 4YC3A 2I0YA 4QYHA 2XJ2A 3LIJA 2YJRA 4TNBA 5I9UA 4KIOA 2EXCX 4EH9A 4F1TA 1M7QA 3DKFA 4DEHA 2QU5A 4Y83A 3CTHA 2FO0A 1JQHA 4AU8A 2Y7JA 2PZIA 3HMPA 2OFVA 3KVXA 3SG8A 5EKNA 3OP5A 5BYLA 1KE5A 2HWPA 2OBJA 3BHTA 3HV7A 3KMMA 2OIQA 4GL9A 4ALUA 2PE2A 4K6ZA 4MXAA 3H0YA 3E5AA 3NRMA 3N51A 3V8TA 4EK4A 1GZNA 3VBTA 2OJ9A 4USFA 2A27A 5G6VA 2ZV2A 4G3FA 2HWOA 2IG7A 4EONA 2P2IA 5CSWA 5E1SA 3VULA 4WT6A 3GCPA 5TOZA 4M0ZA 5HZNA 3RGFA 1U54A 5HQ0A 4QPAA 4L67A 2WMSA 2XK3A 4WRSA 5H8EA 4X3FC 1XJDA 3QKLA 5HOAA 4ACMA 2Q83A 3FZPA 3UTOA 2XIKA 3CQUA 4DLJA 5L3AA 3R9RA 3UQFA 3BYUA 5JMSA 5DT0A 1L8TA 4FOBA 1Y8YA 2WGJA 4HPUE 1OIUA 3MV5A 2C3IB 2VTSA 3LMHA 4FIJA 5CU6A 4CG9A 1LPUA 2ERZE 3ATTA 2PHKA 4H1JA 3VIDA 4NCTA 1Y57A 1A48A 2BKKA 4JG7A 5HE1A 4K33A 1UKHA 2VTLA 2XRWA 3LM5A 3TV7A 5CAPA 4IZAA 5IQHA 2I0HA 3R7VA 4C62A 4C0TA 3PPKA 1H0VA 4Y73A 3DXPA 4FV2A 4YURA 3UQCA 5LVNA 3EYHA 2IO6A 2VRXA 3RP9A 4CFFA 4NM0A 4EK5A 2OW3A 4GFOA 5JQ8A 3KXXA 1W83A 3HP5A 2BVAA 3EQPA 4WSQA 2PUPA 2J5EA 1OBGA 3K2LA 1GOLA 3OOMA 4FZFB 4LV8A 3Q3BA 4H1MA 4AX8A 1QMZA 5CU0A 3COKA 5LJJA 4LGHA 2P2HA 2FUMA 2HXLA 3ANQA 3CKWA 3E63A 3P9JA 3GOPA 4XRJA 5T3QA 2IVUA 4ZTMA 4ZSAA 4XUFA 3LXNA 1VZOA 1Z57A 2RSVA 2WQMA 4YZ9A 4D1SA 4E4MA 3CSVA 4CD0A 3OW4A 3QCYA 3NYVA 2JIVA 4DFYA 4XMOA 3LXPA 4LG4A 2GNJA 3N9XA 3NGAA 3SOCA 3QYZA 3PYYA 1CKJA 1IG1A 2QO9A 2BTSA 4IZ5A 2W05A 5LMAA 3R8LA 3O17A 1FMOE 5FTGA 3U6IA 4YNOA 3Q6WA 5CT0A 2J90A 1PYXA 2RF9A 2Y6MA 3QQUA 3BBTB 4MXYA 4O1OA 4RPVA 4BCJA 4E4LA 4YBJA 5B2LA 1CKIA 4FBXA 2CKQA 1XQZA 3Q60A 4YJQA 4TWCA 2R3JA 2ZV9A 3IO7A 3KVWA 5L2QA 5BVNA 2QURA 1R1WA 3LCOA 3HKOA 1OB3A 4E20A 3DCVA 5GJFA 3MH2A 3RAWA 1H27A 4GW8A 4FZ6A 3QGYA 3A99A 1VYWA 2PK9A 2BRHA 5D9HA 5C4KA 5AUZA 4UEUA 3BHHA 5A14A 2C6IA 3S4QA 3UGCA 4MD7E 4Q9SA 4D5HA 3CY2A 2WTCA 5BMSA 5EW9A 3VBYA 4QMUA 5EDPA 3OEFX 3PFQA 5HIBA 3TCPA 2I0VA 3DLZA 4OTIA 5J5SA 4WD5A 2C6DA 3O8PA 3BLQA 5CX9A 3PIYA 2RGPA 3NUXA 4FVRA 4LQMA 3BPRA 2XBAA 4FTCA 4EJ7A 3QHWA 4JDHA 4TWPA 2Y0AA 3NLBA 3RK5A 4I0TA 3O2MA 4AA4A 5IU2A 2F7XE 3BLRA 4R7IA 1IEPA 2W06A 3A7HA 3RHKA 2XYUA 3NUPA 4KWPA 4EHVA 2ITYA 1Z9XA 3TNIA 4BY9E 3LKMA
chains in the Genus database with same CATH superfamily
3ZDUA 4K77A 3I1AA 5CAOA 3K3IA 1V0OA 3U9CA 5BUJA 4DITA 2VX1A 5AM7A 3VUIA 4IE9A 2GQSA 4I6HA 3TZ8A 3WZEA 4YMJA 3OCTA 5HI2A 3PP1A 5H2UA 4DE4A 3QTWA 4U7ZA 3PRIA 4CSVA 2C0TA 3PRFA 1W7HA 3R7EA 3DB6A 3E88A 5BVKA 4D0WA 3DLSA 4DCEA 3C5UA 1PXLA 5JSMA 2WEIA 4YJRA 5C8MA 3RNIA 5LMBA 1HCLA 3FY2A 2V7OA 3F88A 3W0PA 4PMTA 2XJ1A 3C0HA 2FA2A 1XH6A 3TM0A 4H36A 4HCVA 3ZLXA 3L8SA 4L9IA 4YHJA 2QO2A 5HIEA 1Q3WA 2RIOA 2YM7A 3LLTA 5AMNA 3C4ZA 3W32A 4EQCA 3HDNA 3QFVA 1Y8GA 5HO7A 4D5KA 3IDCA 5IQGA 2OZOA 2PMNX 2WMVA 4A07A 4CFWA 3HMIA 5HU9A 3WZDA 4IBMA 2H8HA 3L9LA 4FKPA 3R9DA 4E5AX 5DRDA 4B8MA 2WQEA 4D2WA 4L44A 3H0ZA 3T8OA 2E9UA 3ZYAA 5AAFA 3SW7A 2BMCA 2YZLA 4FV0A 2PTKA 2YIYA 3R71A 3QCQA 3ALOA 4PL3A 4XBRA 3R2YA 3I6UA 4NFNA 3VS7A 3WZKA 4GU9A 3IGOA 2C6LA 4X7QA 3QZHA 3VW8A 5F20A 3ZC6A 3GT8A 2NYAA 4HNFA 1ZRZA 4X0MA 4CCUA 3DZOA 5AP0A 5EM6A 3DPKA 3C51A 1ZMVA 4HVSA 4YTCA 2IWIA 1JOWB 2X7FA 4WIHA 4FV7A 4NKAA 3ZUVA 1F0QA 3OUNB 2OZAA 4HVHA 4FTOA 3F82A 5JFXA 1YHWA 3SRVB 4KBKA 4MNFA 3R63A 4U6RA 4APCA 2CHLA 2R64A 4CRSA 4Z7HA 3R0TA 2YIQA 2W5AA 4RIYB 4KAOA 1ZZLA 3OCGA 3CC6A 3Q53A 1L3RE 1Q8WA 5IA5A 4G6OA 4TYJA 2AC3A 4AN2A 4A4XA 4JNWA 4BBFA 5JGBA 4BB4A 3EMGA 4FOCA 4MQ2A 2V62A 3HRFA 2X39A 3OF0A 4KS7A 4IWPA 1XH4A 5I9XA 2UVXA 3MS9A 4RWLA 4E93A 5KMOA 2XK8A 2XNMA 1YRPA 1F3MC 3GU8A 5HBEA 4BWXA 1YOLA 4EOMA 3K5VA 3N4UA 3MY5A 4C3FA 4ONAA 3UIBA 4FKVA 2A98A 2ITPA 4AGWA 2UW5A 5JQ5A 3WF5A 4O86A 4U3YA 4I23A 1S9IA 5CEIA 4BYIA 2R0UA 2WMRA 3V5WA 3FUPA 3NUYA 4UMQA 4CQGA 1REJA 5K4JA 1ZMUA 3S3IA 3V6RA 4DCAA 4XOZA 4JIAA 1PXOA 3UDBA 4RX5A 4PRJA 3ROYA 4BI1A 4AS0A 3UMXA 2VTTA 4DHIB 3GCSA 4F0FA 5L8LA 4AZSA 2IZSA 3QZGA 3KU2A 4QTBA 3RK9A 4TW9A 2R3HA 3KRWA 4CTBA 4DH5A 3BWFA 4M97A 3TIYA 4FNYA 3GCVA 5EYDA 3SXSA 2HZIA 4FI1A 4WHZA 5J8IA 2QO7A 3Q4ZA 2O3PA 4HW7A 4YC8A 3UMWA 5L8JA 3LXKA 4BHZA 4AZWA 3UPXA 4K1BA 4HGLA 4DHJA 5M4IA 3RTPA 4JDKA 5EOLA 3FLZA 2VX3A 3QF9A 3ZUTA 5BYZA 3QQGA 1JKLA 4MAOA 4BZOA 4EBVA 2CDZA 4V04A 3FMKA 2J2IB 2VTIA 3CGOA 3DK7A 2REIA 1FOTA 4ZY6A 4AZFA 3U51A 1KSWA 4XEYA 2PE1A 4IADA 4BKZA 5CEMA 4N6YA 2B52A 2RFEA 3VQUA 3IK3A 1DS5A 5EYMA 5CAUA 2O8YA 4BC6A 3KCFA 3EN9A 1JKSA 2FVDA 4D0XA 4RVKA 5IQAA 3KK8A 5GINE 1NVRA 5AV3A 4FKIA 3R9NA 1GIJA 1W98A 3A8XA 3E3PA 3QQKA 4TYIA 3BKBA 3NIEA 3OEZA 4PDOA 4UXQA 3RPVA 4I24A 1A06A 4MBJA 4IM3A 3VJNA 4J8MA 4E7WA 4P5QA 4U43A 1WBVA 4V01A 4EKKA 1TFFA 4O7ZA 3BWJA 4FEUA 3GP0A 1YQJA 2OWBA 4IX6A 4E26A 2C0OA 3BX5A 3QTXA 4IVBA 2E2BA 4R3PA 2OIBA 5T68A 4ERWA 3AGLA 1AD5A 1YHSA 2Q0NA 3BGQA 3I6WA 4AW1A 4CV8A 3OY3A 5HHWA 4G3CA 4M67A 4S32A 1V1KA 4ZS4A 4NWMA 2G1TA 5HU3A 4BTJA 3FMMA 1BLXA 3VUDA 5DI1A 2EWAA 1MQ4A 5IA0A 4FV5A 5J9LA 4S34A 2QLQA 4EYMA 2FGIA 4X3FA 2GHMA 4FEQA 3RAKA 1B6CB 2XP2A 3UZRA 3H4JA 3ZBXA 3BIZA 4IC7A 5IDPA 2JBPA 4CKIA 2GSFA 1ZOEA 3OWLA 4HGTA 4EJNA 5ANDA 4HVIA 5FTQA 3FLWA 3TKUA 2VNYA 3V6SA 5AV1A 4GT5A 4YJNA 2R3RA 2C6TA 3IG7A 2Z7QA 1YKRA 4QQCA 4ITHA 3JR1A 2ZMCA 5M4FA 4RVLA 5AUVA 1KE8A 4B6LA 4DEGA 3NYNA 4JBOA 1YXUA 1FVRA 3RBWA 3TG1A 4E3CA 4EQUA 1O6YA 4M15A 2YM8A 2JBOA 4X2JA 5F94A 3UOLA 2CCIA 4M69B 3V8WA 2IZRA 3JPVA 2BFXA 2EUFB 4IZYA 2W5BA 4MF1A 4ZS0A 3VW6A 4C38A 4ZZNA 3VRYA 3UZPA 2B0QA 3E8DA 4PUZA 5BVWA 3F66A 4W8DA 4IJ9A 3TEIA 5HTIA 4C4IA 3LMIA 2VTMA 4AAYA 4PX6A 3VC4A 1WBPA 3P7AA 2GNHA 3GC8A 4DGMA 2Z8CA 3CKXA 5GNKA 4BZNA 1DM2A 2WHBA 4W4VA 4ZSGA 3NFGB 3EIDA 4MX9A 3CJFA 4BCKA 3WZUA 1YOMA 1Z5MA 4GT3A 4GH2A 3OTVA 4YTIA 4I5PA 5AP5A 3G5DA 1ST4A 4G3DA 2W4OA 4ZXTA 2QOHA 2WQBA 2JFMA 2X2MA 3KF4A 4IDTA 2V7AA 4O0UA 4TRLA 4BTKA 3EB0A 1NY3A 3TNWA 3C4FA 4EEVA 3S00A 4XP3A 3L9NA 4RIOA 2GNLA 4UWYA 4RA4A 3FLQA 4FYOA 3KF7A 3BV3A 4DG0E 4FE2A 2R0IA 5M08A 3W2SA 1M2QA 1SM2A 3P78A 3H9OA 4F70A 5IA4A 4X6QC 2ITNA 5CQWA 5AFVA 3Q4UA 4RLLA 1OVEA 3D0EA 2RKUA 3MFRA 5CVHA 4FL3A 2PVFA 1QPCA 2YM3A 4ZTSA 3C4CA 1V0PA 2WTIA 3SX9A 5TO8A 3QYWA 4K8AA 1FPUA 2VAGA 2E9OA 5H9BA 1OPLA 2QR7A 3PA4A 2WU6A 5M57A 3SGCA 5HG9A 2GNFA 4GIHA 4MF0A 4YO6A 4PV0A 3DV3A 2ZDUA 4BDGA 5M09A 3VUHA 4C3PA 3GFWA 3QKKA 4AGUA 3IOKA 4PP9A 3AKKA 5KMMA 3ACJA 4WUNA 3PJCA 4RG0A 4RLKA 1NVQA 5EI2A 2A1AB 2R5TA 4QTAA 4WG3A 3W2RA 2EXEA 3R6XA 4P5ZA 3MESA 3FY0A 2PU8A 4YJUA 4DTAA 5I4NA 2QOQA 1APME 3UDSA 4F1OA 2XAMA 2UZBA 2JKOA 2OH4A 3LFAA 4CMOA 2YABA 4TT7A 5FQDC 3U55A 2C3KA 4TZRA 4IM2A 1LR4A 4OR5A 4U44A 5TF9A 5IEVA 2J9MA 5FEQA 2VTPA 5KKRB 5C1QB 3PE2A 2PUUA 1RDQE 3CCNA 3VBXA 4DC2A 3VO3A 2F2CB 3KULA 2B1PA 4IVAA 4AUAA 3PSBA 4FTIA 3F61A 4L7FA 5EQYA 1XBCA 4JQ7A 4ZSJA 3BU3A 4KIKA 2YEXA 4I21A 4IDVA 3U4UA 4JQEA 4L8MA 2VUWA 4EUTA 2DYLA 3F5UA 3HAVA 3ZM4A 3MTLA 3NYXA 5ANGA 2PWLA 1JKTA 1TZDA 3HV5A 4DGGA 5AV0A 3NYOA 4O82A 4Q9ZA 1SVGA 1H0WA 3OY1A 2W1HA 4ACCA 2FSMX 3B8QA 4R5YA 5TKDA 2CJMA 1ST0A 3OOGA 1X8BA 5LQFA 5IH4A 4ACHA 3DS6A 2EB3A 1H1RA 4NM3A 3R1YA 3CQEA 5ACKA 4H3BA 3V5LA 2GQGA 3FXZA 5AP3A 4O4CA 2C0IA 4FKQA 1YWRA 1H00A 3OBJA 1PY5A 4O21A 3FEGA 1BMKA 3DXNA 4EOLA 3Q96A 4MHAA 3C1XA 3W8LA 4KIPA 2XNGA 2GHGA 3OVVA 2LAVA 2BCJA 3DK3A 4QNYA 3W33A 3IONA 1TKIA 2W17A 2YIXA 3EN5A 5CNNA 3GCQA 3ZO3A 4AZEA 3FYJX 1Y6AA 5HO8A 3NAYA 4FSYA 2PMIA 5HLWA 4DFUA 3C5IA 2JKKA 4I0SA 1UU7A 3KMWA 3VS0A 5HNBA 4DBXA 3PLAE 4HNIA 4KD1A 5CS6A 4F6SA 2YDIA 2BRBA 3NWWA 3MFUA 4LL5A 2X6DA 2W1EA 3JXWA 5E8VA 2BRMA 3FMLA 5D10A 3LCKA 4JJRA 1Q62A 4R3CA 5J7BA 5L6OA 1MRVA 4ANLA 3UNKA 4CKRA 2R3OA 2XB7A 3W0SA 3S1HA 4OGRA 4AN3A 3AMAA 1NA7A 5AP6A 4YHTA 5I9VA 4O2ZA 5KMJA 2X4ZA 2Z7RA 2XM8A 3FPQA 3C4EA 2EB2A 4FMQA 3NNXA 2CKOA 3NR9A 1H1QA 3D83A 4KUJA 3UE4A 3DDPA 3MVMA 3VS2A 4QMTA 5JKGA 4D4YA 3EL8A 4R1VA 4EOIA 4YLLA 2XKFA 4YUQA 2WMAA 3CQWA 3ZRLA 2ZYBA 4IB1A 5AP4A 3R2BA 3BV2A 4FTMA 2W9ZB 3MH3A 4U81A 2FSTX 5D1JA 4QP3A 4LOQA 2BDFA 4HGSA 2PZYA 2ETMA 3A62A 3RNYA 3F3ZA 4ACGA 1UU3A 1XMMA 2YISA 4AXAA 5K0KA 2UZWE 4BI2A 4CZUA 4S2ZA 4Q5HA 5IUIA 3JVSA 2B9JA 3M11A 4AG8A 3BELA 4V0GB 4GUEA 4UY9A 3OWPA 2XS0A 3PVGA 2CN8A 4EC9A 5IQBA 5CF8A 3WF6A 1NVSA 3KREA 2AEGA 5C4LA 2C5OA 4G1WA 2XVDA 3LZBA 4JQ8A 5CLPA 5IUHA 4F9WA 3DTCA 2BRNA 4LFIA 4RFMA 4RT7A 3SQQA 5CI7A 3DGKA 1B39A 3LJ0A 3UOJA 4ANQA 3NNWA 4L53A 4AA5A 3NUNA 4I0RA 3AG9A 4PL4A 4Y95A 4CFVA 4DLIA 4P7EA 4QQTA 2PYWA 4PPCA 4BDDA 4XJ0A 4C59A 3G33A 3CY3A 4HVGA 5JH6A 4FV6A 4RWKA 3NAXA 3BHYA 2DWBA 2F9GA 2R2PA 4RJ6A 4BICA 2J5FA 5EM7A 4RJ3A 4F65A 4XYFA 4O84A 3POZA 4OTRA 3LMGA 4J98A 5CAQA 4O4BB 5LWNA 1HOWA 4QTEA 4CEGA 4IM0A 1ZMWA 5AIKA 1ZXEA 2PPQA 4M8TA 5HTBA 1LEWA 1G8KA 1FGIA 1Q5KA 3UIXA 3ZTXA 4O91A 1G8JA 2ACXA 4B9DA 3PVBA 3DQWA 1WMKA 5A9UA 5HLPA 1OL1A 5J95A 3FAAA 2HOGA 3WI6A 2R3FA 2ERKA 3O7LD 5KCVA 4R7BA 3BCEA 4RC2A 3NIZA 4G9RA 3P7CA 3GC0A 4UV0A 1XBAA 3D5VA 4C02A 2YAKA 3KB7A 4ORKA 3ANRA 2B9HA 2Z2WA 4XNEA 4NK9A 1U54B 4EZ3A 2Y4IB 4RZWA 4O0SA 1G8SA 3DDQA 3GVUA 4G16A 3IDPA 2OF4A 3OC1A 4BVUA 5AEPA 4GKHA 4B99A 5BVOA 4O0TA 3MY0A 3PG1A 4IVDA 4JS8A 4R6VA 5DR6A 1BL7A 4A9TA 5G1XA 2WTDA 3W2CA 4RIXB 4QO9A 3FL5A 4LM5A 3ZLSA 2NNWB 4IIRA 3F69A 2Y9QA 5CF5A 4EH6A 5M56A 4IB0A 3A60A 4UYNA 5DPVA 4FG7A 3Q4TA 3RAHA 4A9SA 4IANA 3QQHA 4NSTA 2I1MA 4UZHA 3D5XA 3RM7A 5KMKA 2RFSA 4U0IA 2C5VA 4YSMA 4OBOA 3QC9A 4RFZA 5GIOE 3O23A 3L9MA 5CZIA 4GK3A 3ZONA 5LMKA 5HIDA 1ZY5A 5DA3A 4Z3VA 3MSSA 1M2RA 3AC8A 2P4IA 4RJ5A 3LW0A 3E64A 2VWZA 3TDWA 4I4EA 4X6RA 4KA3A 1SVHA 4YGAA 5CEPA 3BU6A 4GK4A 4WG4A 4FSQA 5IDNA 4RC4A 5EG3A 4XG6A 4IAIA 1J91A 2UZEA 3PXRA 4QMVA 3PWYA 5HTCA 2QQ7A 5HG7A 4G5PA 3UP7A 3KXGA 3QTUA 4O81A 5FUTA 3UVPA 2WXVA 3ORMA 3RMFA 2XKEA 3U6JA 1ZWSA 1W0XC 1WBWA 4OTFA 2W4KA 3KGAA 4IX5A 4PPBA 4E8AA 3KL8A 5EI8A 2DQ7X 3ZU7A 4DGLC 1T46A 4RVMA 4EC8A 4D1XA 1YI6A 3OG7A 3BGZA 3GUBA 5I3RA 4X2FA 1H01A 4JRNA 1ZYDA 1STCE 4MXCA 2JDVA 5AR7A 4ZK5A 4D4RA 2PY3A 4D4SA 3REPA 1XH9A 5IUGA 5J87A 1OKWA 4Z7GA 4FGBA 2JIUA 1QPDA 3DAJA 3DBFA 2C3JA 4BBEA 4FSTA 5JFVA 2C47A 4XRLA 4QP1A 3HMNA 2JFLA 3QL8A 3B8RA 2WAJA 4MNEA 4JAIA 5CZHA 1JWHA 2IZUA 1BI7A 2X1NA 3TZ9A 5DGZA 3I7BA 4O7RA 2IF8A 2XYNA 4FYNA 4ALWA 2W1IA 3DBDA 4YBKA 5HEZA 3FJQE 4K9YA 4USDA 3S2PA 4AT5A 1R0EA 2CLQA 4EZ7A 1Q8TA 3P08A 4MVFA 3V8SA 2R7IA 2XKDA 3ENMA 3KXZA 4UB7A 4D28A 3IECA 3UDTA 5CU4A 4F63A 1BUHA 2VGPA 5IQEA 2JC6A 1XH5A 3QX2A 3CGFA 5IQFA 2UUEA 4HYHA 1G3NA 4KABA 2EU9A 2GTNA 2YAAA 4WNOA 3W55A 4D2VA 4HGEA 5KBQA 4F0GA 4IAKA 5E92A 3UOHA 2YCQA 4PF4A 4Y5QA 3QTZA 3E87A 2J0JA 4GS6A 3IW6A 3RZBA 4RA5A 3EKKA 3T3UA 3QU0A 4C61A 4FIHA 3IW4A 3CIKA 4ARKA 4FT3A 3BL9A 1WBOA 4QD6A 3PJ8A 2VX0A 3A8WA 3HYHA 4UWBA 5CY3A 3TNQB 4C4HA 4GK2A 3NNUA 3P5KA 3ZOSA 5HNGA 4BWKA 5LVOA 2H9VA 3NW5A 4EOQA 2UW7A 4GG7A 4M0YA 5BVDA 3LFCA 3K5UA 4NM7A 2QOIA 4WBBB 3VUTA 3O96A 5H8GA 2BIKB 3GC7A 4QYYA 5E91A 4HCTA 1M7NA 5IEXA 4GG5A 1JSVA 2YM6A 4M66A 4TYHA 4W9WA 3P86A 3FI8A 3D5UA 2OF2A 3MVHA 4E1ZA 3LLAA 1M14A 3E92A 3GFEA 4FV3A 5J79A 3W0RA 2JIIA 1E1VA 1OZ1A 4WG5A 4JMQA 5D7VA 2B54A 3PVUA 4U80A 1LP4A 4C2VA 4AOIA 5FGKA 3D4QA 3EZVA 5BNJA 2IVSA 2EXMA 4OTHA 4LMNA 2WMQA 3QALE 5DBXA 4U79A 2XALA 5IZFA 5TE0A 4DFBA 2ITUA 3IW8A 4CFNA 3D15A 1ZOHA 5DVRA 2W7XA 4FKLA 3FC2A 5GZ9A 1IA9A 4B4LA 4PNKA 2JDOA 2ZVAA 2W96B 3KY2A 3MA6A 4QMMA 1W82A 3QTRA 3PSDA 5DLSA 3ZEWA 4YZDA 2OO8X 3BRBA 2X2KA 5L6WL 3W2QA 4QEBA 3HMOA 3EOCA 1RQQA 1Q8YA 5CU2A 1K9AA 1XO2B 3T9IA 3ZM9A 1FMKA 3NPCA 5ACBC 4FV8A 4FT0A 4ZAUA 3HAMA 3GEQA 1GNGA 3BYMA 1IRKA 4Q2AA 4C2WA 4D9UA 4EYJA 2VWBA 1H24A 2E9VA 4G31A 5LVPA 3JVRA 4C8BA 1P4OA 4OBPA 4IAFA 2IPXA 3LPBA 1ZY4A 3LAUA 3R00A 1GZKA 3Q5IA 4JR7A 4K11A 4XBUA 4BCQA 2BR1A 1H1WA 2BFYA 3M2WA 1KV1A 3R04A 4O7NA 3QRKA 2OZAB 3V5PA 5JRQA 2G2FA 5KX8A 4ZEGA 5L2IA 3UG2A 1YW2A 4HYUA 2ZAZA 4I5CA 4NTSA 3WE4A 4BGGA 4JAJA 4HJOA 3F3UA 1KE7A 2C5XA 4BBMA 4FSRA 4Z16A 3MFSA 3HV4A 3F6XA 3FKLA 2CN5A 2CKEA 1UU9A 3WILA 4OTPA 4NL0A 2G15A 4GJ2A 1H8FA 4ASXA 3NUSA 3TJCA 4D9TA 2XIZA 2ITXA 2B55A 3O7LB 4PNIA 3PPZA 2QG7A 2G9XA 4YJTA 1ZLTA 3ATSA 4R77A 3UJGA 3OXTA 3UC4A 4L3PA 3TIZA 3VHKA 2CGUA 2X4FA 4OTGA 4QMSA 1ZZ2A 2X7OA 4QMXA 3LFEA 3PXQA 4LGGA 1YDSE 3QKMA 4CYIA 2ITQA 4RX9A 5HD4A 4H3QA 3ZBFA 3LQ5A 5K0XA 2GNIA 4USEA 5HX8A 2BZHB 3KN6A 4ANNA 1CMKE 4YJOA 4DT8A 4J95A 4NEUA 3GQLA 4HZSA 3WYYA 4DHFA 3TDVA 2F7EE 3TZ7A 2YLEA 5C8NA 1FBNA 2YCSA 4UN0C 3EQGA 3P4KA 4DFZE 5EH0A 5JK3A 2J0LA 4M7IA 2JAMA 3DB8A 3R7GA 2IZTA 4JX3A 2QD9A 4N4SA 5EHOA 3RWPA 3PSCA 4C34A 1XH8A 3GGFA 4F7SA 5IH5A 3NUAA 2UW4A 4A9YA 3ZS5A 2XCHA 5H8BA 5M44A 3MH0A 1Q61A 1W8CA 1W2CA 4AGCA 3GOKA 3ODZX 4AGDA 4EZ5A 5M4CA 3LFSA 1J3HA 5FM3A 2XK6A 3W2PA 1OL7A 3M42A 3MI9A 5EDQA 2R4BA 3G0FA 4F7NA 3DT1A 1Q99A 4FIEA 4K0YA 4PDPA 5FXQA 3AXWA 5B7VA 3BQRA 4I5MA 2PVYA 4AZTA 5JFSA 2VWWA 4DG3E 2J4ZA 2C30A 3KKVA 4CZTA 2YIRA 4AAAA 4F7LA 2J0KA 3A61A 3D7TA 3P0MA 4HOKA 3FWQA 2SRCA 1MUOA 3VBVA 3ZSIA 4JBVA 3CLYA 4W4WA 4FTLA 4YR8A 1J7LA 5M55A 4F99A 2RFNA 3TTIA 5B2MA 3QA8A 3OD6X 5FDPA 4FTRA 1BYGA 4FC0A 4YZMA 4AA0A 4ZTRA 2XEZA 3QRIA 4QNAA 3BLHA 3ITZA 4C7TA 4FVPA 4OLIA 3UO5A 2A4LA 4O7TA 2GMXA 4QYGA 2X0PA 3ALNA 3R8VA 1FVVA 4FEXA 4QTDA 3ZFXA 5KO1A 3HDMA 3PZHA 5AADA 4A06A 4EOKA 5KHWA 2VTHA 2X2LA 5FXSA 1DAWA 3F5PA 4QQ5A 3V01A 2NP8A 4AXCA 1Y6BA 3SW4A 3HV6A 3DY7A 3AD5A 3QUEA 4QP7A 4IQ6A 3L8PA 2JD5A 2PVLA 2J0MB 4O0WA 5FP5A 2BILB 4IFGA 2OSCA 3AC5A 2RG5A 4RQVA 3VBQA 3F2RA 4QP2A 3RPYA 4ANSA 1P5EA 1OIRA 3F7ZA 4WBOA 3EN4A 4M68A 4D2RA 3MYGA 4TXCA 3F2NA 3RK7A 3D7ZA 3GU5A 2X0QA 3QD3A 5CSXA 5HCYA 3RZFA 3CPCA 3FL4A 4I94A 1PYEA 4AOJA 4TPTA 4EK8A 4FT5A 3DJ6A 3VUMA 1KOAA 4DGNA 3D2KA 3HLLA 4J99A 3LXLA 3C50A 2NRYA 4MKCA 4QMPA 4ACDA 4TKSA 3MFTA 4I1ZA 4M13A 1U5QA 3G9LX 2XK7A 3UQGA 5L2WA 4PDSA 4I20A 2WTKB 1YHVA 3LCSA 1UWHA 5BMMA 3V5JA 3ZSGA 1LUFA 2VU3A 3KRRA 3UODA 2VTQA 5DN3A 4BJJA 3PFYA 4TN6A 3LJ1A 4ZTHA 4APPA 2VTAA 3UNZA 3R1NA 2UZTA 5M07A 1MRYA 4IMYA 3SHEA 4KKHA 3VS3A 4FG8A 1R0PA 2YWPA 5LCKA 3GXLA 4IFCA 3O5AA 4ENXA 2GS2A 4CVAA 3HX4A 4O7SA 2BHEA 2IN6A 4JL9A 4PTEA 2BAKA 4BDKA 4GMYA 2QOOA 2ITVA 4I5HA 1JBPE 4ZTNA 5TT7A 4AQCA 2ZM4A 4E6QA 5CENA 5LWMA 2XAOA 4DTBA 3VF8A 2B4SB 2CGWA 5CXZA 5B0XA 4BYJA 1G5SA 3QTQA 4BDFA 3RAIA 2PVJA 4LL0A 2Y4IC 2X81A 2X8DA 3F5GA 3QA0A 4U9AA 3RINA 3ROCA 5GZ8A 2CNVA 4FIFA 4S30A 3WF7A 3OBGA 4F9BA 1SVEA 3OW3A 4JRVA 4DFXE 3AT3A 2V22A 3BYOA 3DJ5A 4I6LA 3HNGA 2BTRA 5BYYA 3SA0A 3U6HA 4IX4A 2YM5A 5I0BA 1P14A 4CMTA 4BI0A 2XZSA 4J52A 2QR8A 4JT3A 1VYZA 5FTOA 5DT4A 4NCTC 3HGKA 4FSUA 2X9FA 4JDIA 4WOVA 2HZ0A 4O0XA 4ZJJA 4CV9A 5K5XA 2IJMA 5JZJA 4TYGA 3BQCA 4I4FA 4DGOA 2ZOQA 3AGMA 2W99B 5J1VA 3DFAA 5AX3A 3UIMA 4F64A 3BU5A 3QQFA 1PXNA 4QMOA 2ITWA 4TNDA 2XCKA 5IEYA 4O7WA 3GI3A 2HZ4A 3V5QA 3OHTA 4J96A 2CGXA 3CTJA 4UALA 3HRCA 2QODA 5HE0A 1IASA 1REKA 3II5A 4FV4A 3TL8A 4QMNA 4H05A 2PZRA 3FZTA 4GUBA 4CMUA 5DWRA 4ZP5A 1BI8A 2GDOA 5IF1A 4KSQA 4PQNA 4MD9E 4D1ZA 4OTQA 5KE0A 1H26A 4WNKA 4FZDB 5HGIA 4F0IA 5CANA 4GFMA 3P23A 1XWSA 3QWKA 4J1RA 3ZRKA 2UZDA 4KB8A 4J7BA 4BCPA 4B8LA 2GPHA 3IGGA 2X8EA 2ETKA 2ZDTA 3R1QA 4U40A 2CKPA 1TQIA 2F7ZE 4CTCA 2BUJA 4YTHA 3LCDA 4IAAA 3I0QA 4LGDA 3OROA 3L8XA 2BZKB 3Q9ZA 2VTOA 4YJPA 2JEDA 3FHIA 4U45A 3RI1A 3W2OA 1JSUA 4G3EA 4YSJA 3DXQA 5ETFA 1WVXA 2XH5A 4KRDA 4C4JA 4GRBA 3SAYA 3BHUA 5E8ZA 3ULZA 3KULB 3PJ2A 5IA2A 3HL7A 4LMUA 4QP4A 4N70A 4W9XA 3VUKA 5HVYA 5AAEA 1P4FA 4HPTE 4GSBA 4YPSA 5AP7A 3FMDA 5BX0A 4XOYA 3KEXA 5EM5A 2B9IA 5DEYA 4HZRA 2PVKA 4D4VA 2VO0A 1RW8A 4QQJA 3ZFMA 4EK6A 4PMSA 3D94A 4O1PA 2R9SA 2C5NA 3QUDA 4AE6A 1PKGA 1H25A 2E9PA 5CT7A 5KMLA 2ITZA 3CP9A 5AWMA 2OJFE 5HKMA 2WPAA 4O6LA 4RIWA 3W1FA 3D14A 3FQHA 1PXIA 3HUCA 4IAZA 1H07A 3ORNA 4XX9A 4I93A 5KUPA 3R8ZA 2O65A 3OUKA 2WELA 4GCJA 1Q8UA 3FMJA 3HEGA 5FBNC 4FUYA 3RCDA 3E93A 2QOFA 3I79A 2YACA 4UMUA 1GZ8A 4O0VA 2PULA 4XLVA 2Y4PA 2X7GA 2YERA 2DS1A 5I9YA 5KMNA 2WTJA 3QD0A 2CGVA 2VZ6A 3C13A 2ESMA 3Q9XA 5IQDA 3ZO2A 2VNWA 2OJIA 1I44A 4WA9A 5J5TA 1K2PA 3ODYX 2FH9A 5EK7A 4NFMA 3DKCA 4C35A 2F49A 3FZ1A 3G2FA 2WO6A 1WCCA 2W9FB 4FKWA 4RJ7A 5BPYA 3EQBA 3G6GA 1FINA 4XG7A 4XS2A 5BUIA 3DK6A 3BBWA 3CD3A 4R1YA 4AFJA 1BL6A 4U3ZA 3VVHA 3E7VA 1H28A 1FVTA 4ANOA 4YPDA 3FKNA 2GNGA 4H39A 5CSVA