4O27B

Crystal structure of mst3-mo25 complex with wif motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
281
structure length
281
Chain Sequence
MADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNEFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 39
publication title Structural insights into regulatory mechanisms of MO25-mediated kinase activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase activator/transferase
total genus 70
structure length 281
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o27B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o27B01
4H1MA 4EOJA 2LGCA 5HZNA 4IZAA 2V55A 5AV0A 3EQHA 3G15A 1OIRA 5H2UA 3RHXA 5KMIA 3R71A 4O7ZA 4IANA 2XEZA 3GB2A 1YOJA 5FM3A 5A9UA 2ZB1A 5E8YA 5HICA 4FKTA 4CD0A 2ITZA 4FI1A 1OM1A 3Q5IA 4EUTA 5JSMA 2QNJA 2GQGA 4YPSA 1JLUE 1SVHA 4AP7A 2VTPA 4IM0A 4RC4A 4WO5A 2JKQA 5HLWA 3MTFA 3JY9A 5H9BA 5BMSA 5L8LA 3QGWA 1W0XC 5DI1A 3VS3A 4C4FA 5BUJA 4JBPA 1YXVA 4ENYA 3ODZX 2YCQA 4IX5A 3DNDA 2YDJA 3OEFX 4P5ZA 5LMAA 4LMNA 3U4UA 2WU6A 4O84A 4CKIA 2PSQA 2XP2A 4N0SA 5FEEA 5CASA 1PJKA 4IX4A 5AADA 1TVOA 4FV9A 5LVLA 3H0YA 3ATSA 5E90A 3QCYA 5AAFA 2NPQA 5D12A 5E92A 1ZMUA 1YXSA 4D1SA 4RLKA 5H8BA 4O0WA 4I5MA 4F70A 4XV9A 3MJ2A 4BYJA 3ROCA 4FV6A 3Q53A 2EB3A 4ZOGA 5DBXA 2HY0A 4FV0A 1YHSA 3CTHA 2WKMA 3NDMA 3ZUUA 4BI1A 1R78A 4MNEB 3Q04A 4FL3A 4AZEA 4DEEA 4R7IA 4CG9A 4JL9A 3IGOA 3BEGA 2C6KA 4C3RA 2I0EA 3SOAA 3TZ8A 3R7UA 4CYIA 4FKJA 2GMXA 3EZRA 3Q52A 3VBTA 3OXIA 3NX8A 4FKLA 3ZOSA 4CYJA 2WTDA 2XNNA 4JJRA 4D2RA 4F64A 1RQQA 2QKRA 4GT3A 3UIXA 4C62A 5M07A 5AP3A 4XV1A 3HECA 5KMLA 4IB5A 4O0UA 1VJYA 4J95A 5I3RA 5KMMA 4V04A 4DEGA 3R7GA 4WG3A 2PHKA 4U0IA 1OECA 4U3YA 4RIOA 2J0MB 4TYJA 3HYHA 2P3GX 3EL7A 4ZY5A 2I40A 4EYMA 4J52A 1NVRA 4TYGA 3UG2A 4H3PA 2BCJA 2WTKC 4C2WA 3IS5A 4YSJA 3AG9A 3MN3A 4FKIA 5CU2A 3U4WA 3VF9A 3QALE 1FOTA 1BKXA 3PVBA 5GZ9A 3MBLA 1YDSE 2ITPA 5EW3A 3TKIA 4RC2A 4PDPA 4F9BA 5LMKA 3HMIA 3LZBA 4MXOA 2J0KA 3MVHA 4E6CA 1QL6A 3I79A 4DT9A 4XNEA 3RNIA 4AA5A 3CQUA 4AACA 2GDOA 3F6XA 4E6DA 4N6YA 4DGMA 4ZSEA 3COMA 3NGAA 5C03A 4IJ9A 1ZYDA 3HUBA 3G9LX 3LJ1A 3VO3A 2JD5A 4WA9A 5EI2A 3FLNC 4QPAA 2BFYA 3O7LD 4GU6A 5EM5A 2WMRA 1NVQA 4KWPA 3QD3A 1Z57A 3CJFA 4LRJA 3BHUA 5AR7A 3ZO2A 2UV2A 3TKUA 3KRLA 4FTJA 3NLBA 2P2IA 4FG9A 4LGHA 4BBFA 4BCFA 3B2WA 4O0SA 4C7TA 2HCKA 3VS0A 4HZRA 4UYAA 4YJRA 4DEIA 4U40A 4PRJA 3RAKA 4F9WA 4PDOA 3P79A 1V1KA 4QO9A 5DNRA 1JSUA 2GS2A 4ANNA 3AC3A 3T3UA 4DCAA 2OFVA 3AD5A 4AE9A 1UU9A 2PUPA 5A4TA 3QQJA 4I3ZA 1OGUA 2VWXA 5H8GA 4EH7A 4EH8A 2OO8X 3EN6A 4FUXA 5JKGA 2PVRA 4YSMA 2GNHA 3TNHA 5CAUA 2UZOA 4AE6A 3UC4A 3W1FA 4R5YA 3R00A 2W96B 5LCJA 2B9HA 4JG7A 2WMSA 3QUEA 2DUVA 3ORIA 4IAIA 4MF0A 3UOLA 4Y5HA 4DEDA 5KMKA 3DK3A 4PTEA 2WTJA 4Y85A 4AGUA 2X8EA 2C5OA 4O91A 3O8TA 2BALA 3EN5A 2QO9A 4FKRA 2VAGA 5CZIA 2YAAA 1U59A 3KRXA 5BYYA 5L2WA 2H34A 4GV1A 2RG6A 3HMMA 3KQ7A 4XG4A 4EORA 2PULA 4JX3A 3UQCA 2VTAA 4O1PA 5AP0A 3GU7A 1EH4A 1YW2A 3VUGA 3C1XA 5HD7A 5HLNA 1GIIA 3G90X 1FBNA 5CS6A 2H96A 4TWCA 3E3BX 4U5JA 4ZSJA 4MXXA 5T68A 3QRKA 3BU6A 4LGGA 3DKFA 3H9FA 3RNYA 3QCSA 3R1SA 1CKPA 3O51A 5ACBC 1Y6BA 4CMOA 4MXYA 2PE0A 3NSZA 4C4IA 4KAOA 3BLRA 3HGKA 4YLLA 3RK5A 4JT3A 3SG9A 1HCKA 1Q97A 2ERKA 3FKOA 5IQBA 5FXRA 4AX8A 4FTTA 2XBAA 2VTOA 1JQHA 3ZZWA 5A54A 4GSBA 1NT2A 4FTUA 4AOJA 3QKKA 3PVGA 3Q32A 5EHYA 4M67A 3D15A 4QNYA 2YCSA 5J9ZA 3U55A 2O65A 1FMOE 3ET7A 2WQNA 4QMYA 4OW8A 4D4YA 1VEBA 4Z3VA 3TIZA 5K5XA 3EJ1A 4O22A 3CY3A 4FKUA 3RALA 3HNGA 3EB0A 4MVFA 3ZLWA 4BTJA 3EZVA 4EONA 4FICA 4IADA 5AR8A 4DH1A 4EHZA 4XG6A 3NUUA 3ORMA 3VC4A 3N4VA 1GJOA 4AGDA 4FYOA 1V0BA 4RQKA 4FSYA 3ZRKA 2IO6A 3NVMB 4E4XA 4ENXA 5KZ0A 3O96A 4IAKA 4AZSA 3TUCA 1M52A 3F5XA 3IDCA 4G5JA 5LCKA 5CEIA 2CGWA 4QMPA 5HVJA 1MQBA 4FVRA 2LAVA 4DTAA 5IH6A 2UZNA 3A7HA 3C4EA 4QTDA 5CQWA 3UYTA 1J1BA 4X2KA 3BELA 2QOHA 4IHPA 2WMQA 2PVJA 2BAKA 3JS2A 3R22A 4L42A 3EOCA 3GU5A 1FVRA 3FXWA 3PG3A 4PP9A 2XYUA 5EH0A 3IW8A 3COHA 2ZV9A 3F7WA 5HG9A 3RWQA 2HW7A 4S2ZA 4BVUA 2RFNA 2XIXA 2BAJA 4PL4A 2O3PA 4HGTA 4O27B 4BCHA 5L2SA 3EH9A 4L67A 2OBJA 2PY3A 3EYHA 3A4PA 5GIOE 5JFVA 3HP2A 4CCBA 3VS7A 2YWPA 5CNNA 2A19B 2F2UA 4C4EA 2VNWA 3PFQA 2R4BA 3EFWA 1P14A 4NJDA 3UVQA 4BFMA 4DE4A 4W4VA 5JFSA 3UIMA 4ERWA 4LL5A 3R1NA 1GAGA 2R3OA 4KBKA 1F3MC 2YIWA 3MH1A 4NSTA 3RZFA 1S9JA 3QLFA 4PWNA 4G3GA 4YC8A 4RIWB 4BKJA 4DGNA 3S1HA 2H9VA 3N4UA 3G0EA 4I21A 2AYPA 2C5VA 3TM0A 4RPVA 3W10A 5EQEA 2J90A 1W98A 3NR9A 3QQLA 2QOCA 3KXZA 4RJ5A 4M0YA 3UP7A 5CF4A 4GW8A 2CCIA 3B8RA 3G9NA 1OL2A 5TO8A 1U54A 4I0SA 2HAKA 5ANGA 4AGCA 3R9RA 5JK3A 1JSTA 3IPHA 4X3FA 2OH0E 3LXNA 4KIPA 5ETAA 2AUHA 4ANOA 5D11A 1ZZLA 4K1BA 4FMQA 1W82A 2NP8A 4X2NA 5LMKC 3NYVA 4O0TA 4ACCA 4BWPA 3F2NA 4CFVA 3PA4A 5C8KA 3MY0A 3PZHA 4PY1A 4EQCA 2HW6A 4QT1A 2IZTA 1GIHA 1JVPP 2VO0A 3H9RA 4FNWA 1KE9A 1KOAA 2IZSA 4QYGA 2IW9A 3HAMA 4F6SA 4FNZA 3ZO4A 1JOWB 3NVKI 4U80A 3CD3A 3OXZA 2A1AB 4XEYA 2XRWA 3OTVA 4E26A 5ANIA 1MP8A 5D1JA 4ARKA 2ZJWA 1A06A 3ORKA 3VS6A 5FGKA 4GG7A 3I4BA 2VTLA 2W7XA 4DG0E 5EKNA 5IPJA 4AW2A 3ALNA 3SDJA 4X21A 2X9FA 2FYSA 3O8UA 3FPQA 5M4CA 4HYHA 3IOKA 3I0QA 3E8EA 3RCJA 3CKWA 3AXWA 3Q4ZA 3E5AA 2GCDA 5L6PA 3JXWA 3KREA 5DRDA 4FSQA 3REPA 4ZLOA 4RVKA 3R8LA 1Y6AA 3E8DA 2UZBA 2UZUE 1OPJA 1RDQE 3QRTA 4CFNA 3D7ZA 5HO8A 3W2RA 3GCVA 3C4ZA 2ITQA 4ZTHA 4JRNA 3UYSA 3OY3A 3A62A 3P86A 3PTGA 5AUZA 5K9IA 3VNTA 1U5QA 3VUHA 5HBJA 3GCUA 4TY1A 5J5TA 4UMUA 1P4OA 4AF3A 3FMLA 2OGVA 1J1CA 5IA3A 2W1CA 3KKVA 4XV3A 3OWPA 2WOUA 2NNWB 4HYUA 3RAWA 1MQ4A 4MBLA 3ZYAA 4UN0C 2BDFA 5BMMA 3BCEA 4CNHA 1IAHA 3G0FA 5CT0A 4EK5A 5FEQA 4NFNA 5M56A 2ETKA 5AAEA 2YCFA 2IZRA 2R3FA 3QX2A 4FG8A 3IQ7A 1OVEA 3K5VA 3QZFA 1V0OA 1R1WA 3KMWA 4UXQA 2BDWA 4DFYA 4DITA 5EQPA 5HU9A 2OZAA 4YLJA 3FZRA 5CSVA 5KKRC 1R0PA 1I44A 3BE9A 1R0EA 2XVDA 4HVHA 1H1WA 4RSSA 4YU2A 4R7BA 5KNJA 2UW8A 1Q3WA 3NAXA 5F95A 3TJDA 2CLQA 2KTYA 5GJDA 4IZ5A 4FT5A 3PYYA 3H4JA 3NZ0A 3PDTA 4YJSA 1I09A 2WMTA 1OUYA 1GZKA 5HCZA 3QC4A 3TZ7A 2JIIA 3HMNA 4FIGA 4OR5A 3HMOA 3ZSIA 4EH4A 3AC5A 4KIKB 4EZ3A 1OL6A 3GOKA 2Z60A 4ALVA 2REIA 4C61A 1TKIA 4D4SA 2AC3A 3NAYA 4JQEA 4FIIA 3W2QA 4YTHA 4DH3A 1X8BA 5CT7A 4A9RA 5KX8A 2C69A 2EVAA 2WFYA 4ZMEA 1O6KA 3HUCA 3ORXA 2F9GA 1QPEA 2R3KA 1DS5A 5DE2A 4ZSLA 2VWIA 4RWLA 3QCXA 4I92A 2PZIA 4G6OA 1S9IA 3PWYA 4F65A 4F7LA 4QMQA 4J8MA 1R3CA 3OG7A 3D4QA 2EXCX 4QMWA 5BVWA 2X9EA 3LCOA 4AT4A 1UNLA 2HXQA 2CGXA 4WNPA 3CC6A 1M14A 3DK7A 3MY5A 1Q24A 2X6DA 4UMTA 3JVSA 4ZTMA 2PPQA 3SW4A 5A6NA 4Q9ZA 4YTIA 3DNEA 3TNPC 4PPAA 2FA2A 3LCSA 4CFMA 2R0UA 4BHZA 2WOTA 4D28A 1GZ8A 4IVAA 3C4XA 2W4OA 5I9UA 2IVSA 4UALA 4KNBA 4LQMA 4C59A 5EDRA 4YZNA 1OKZA 3VS2A 2OXDA 2R3MA 2W17A 5HVKA 4WHZA 1PXMA 4U79A 3FLWA 5EYKA 3FMJA 3EHAA 3T8OA 2B1PA 3TTJA 4AN2A 4BCJA 4CTBA 1GZNA 1PXIA 4OT5A 5IUHA 5BUIA 4YZBA 3VUKA 3MFTA 4IBMA 4M15A 4MAOA 2JKOA 4QPSA 2P4IA 3VJOA 2C5NA 3HAVA 3P7AA 2IZUA 4H58A 4RX9A 4RX5A 3I1AA 4L53A 3F7ZA 5DEYA 4D0WA 5L3AA 4D2VA 5HBHA 4FV4A 4DLIA 3SKCA 4EC9A 1Q8TA 1CM8A 5J7BA 3SXSA 5BVOA 2FGIA 2X39A 2PWLA 3KULA 4PMSA 1OMWA 1PXNA 2FSMX 2CCHA 4L46A 1PHKA 1B6CB 2C4GA 3QTRA 3RK7A 4BDHA 3GI3A 4BCKA 1A48A 4IX3A 5EM7A 4QP8A 4FF8A 2WAJA 5DWRA 4C2VA 3GC7A 4PP7A 4UV0A 3DKOA 4CRLA 3UE4A 4V0GA 4EH3A 1PYXA 5ANOA 4YLKA 4B4LA 5BNJA 1FGIA 3DB6A 3SV0A 3CPCA 3W8QA 4NU1A 1PXOA 3FAAA 4XYFA 4E1ZA 2HELA 3F2AA 3L9PA 4ZIMA 4A07A 3LFQA 4UB7A 4K18A 4QMLA 4YJNA 4PPBA 4X3FC 4DH5A 4I0TA 3LCKA 5M08A 3LXKA 2B4SB 4H3BA 3EL8A 2W1EA 3ZTXA 5CEPA 1QPJA 3HP5A 5CF6A 2GSFA 4BGHA 3KC3A 1FQ1B 4BCGA 2QURA 4XJ0A 5BYZA 2JC6A 3QZIA 4I94A 5HI2A 3TNQB 4BDDA 4NM0A 4C37A 2VO7A 2ITXA 1GIJA 3A99A 3DXNA 4IZ7A 2GQSA 2YZLA 1H00A 4BR3A 1YHVA 5EHOA 2I1MA 4H3QA 4U8ZA 5K0XA 4GU9A 4RBLA 4C58A 2YISA 3CEKA 4NIFA 5D7AA 3MSSA 3MV5A 3Q2MA 2QONA 2R3JA 5CI7A 4AU8A 2W5HA 3PSBA 2XNGA 4C4HA 1OL1A 4C0TA 4C4GA 3SOCA 3DXQA 3L8SA 2GNIA 3R9NA 4D2SA 1JKKA 2BTRA 3JY0A 4KIOA 4J53A 4EKLA 2JEDA 1SM2A 3LMGA 3FHIA 3ORLA 4JBQA 1BL7A 2OJIA 4O7WA 2JIVA 3KFAA 4DGLC 2DWBA 4B8MA 4CGAA 3R9DA 3TACA 2W1ZA 4DH7A 1M2RA 5IEYA 5EKOA 4PL5A 2YITA 5CTPA 4AZWA 5L4QA 2R3IA 4JR3A 3W2CA 3PA5A 4GRBA 4I20A 3CP9A 2XNBA 2ITYA 3GCPA 1URCA 2P55A 2Y4IC 2X0GA 3PXKA 1H25A 2WD1A 4HCUA 4L7SA 4ID7A 4RIXB 4KSPA 4E8AA 4I6HA 4FZ7A 4ZS0A 1J7UA 2WEVA 5TT7A 4MD9E 4QQCA 5E8SA 3HRCA 2XUUA 4NM5A 4LL0A 2Y0AA 3NUYA 3VBQA 2IW8A 3VHEA 1BYGA 3G6GA 2NO3A 3CTJA 3M42A 2X4FA 2Z2WA 3ZDUA 5CAOA 4I6FA 1QPCA 2YIYA 3LM5A 3PIZA 2WMAA 4AFJA 3VW6A 3HMPA 2FB8A 4FEWA 3DBDA 3V01A 4ITJA 2CKQA 4FV7A 5DT3A 3DBQA 4LFIA 4IE9A 4AG8A 4XG3A 3FI4A 4OTGA 3ZEPA 5CAVA 4O86A 2Z7RA 4QP4A 2W4JA 3QAME 1YKRA 3MPMA 3UGCA 4C4JA 4GK2A 5CXHA 4V01A 4CZTA 2YA9A 3ZO1A 4EUUA 4E4NA 1BI8A 1NA7A 2H8HA 5CSHA 4OTDA 4A9UA 4EH5A 3V51A 5C01A 2C6MA 2W4KA 3NYXA 4FBXA 2QOIA 5HNBA 1P5EA 3WF8A 1APME 4NZWB 5BX0A 2RGPA 2KULA 3VBVA 2BRBA 3Q9WA 5CEOA 4RLLA 4GYIA 3R73A 4FZAB 3PPJA 5B0XA 4AXAA 2JBOA 3UJGA 3M2WA 4KA3A 1SZMA 4XRLA 3F3UA 2EWAA 4RVMA 3QUPA 3D5UA 4ZK5A 5DYJA 4DEHA 4M8TA 3E87A 4UWYA 5CU0A 2C1AA 3ZDIA 4BKYA 2QOOA 1O6YA 2WIHA 3P7BA 1Q5KA 4FSTA 2R3GA 3FUPA 2R0IA 3OBGA 4XS2A 5AA9A 5E7RA 1T45A 5FG8A 3ACJA 3MYGA 3PE1A 4CVAA 3HDNA 3EQDA 3FQHA 2B9FA 2BR1A 3PP0A 4NYEA 4BICA 1M2PA 4IIRA 2WMXA 3SHEA 3T9TA 4OUCA 2QD9A 4ACMA 4BGQA 3DY7A 2UVYA 4E6QA 3MH3A 4DLJA 4FV3A 3ID6C 3R9HA 4DFUA 4CT1A 2YFXA 3GCSA 4IFCA 4G6LA 1JSVA 3CTQA 3W16A 4PF4A 2PVYA 4ZXTA 1RJBA 4YHFA 5AR4A 5DMZA 4L44A 2HZIA 5K5NA 3COKA 2OLCA 2Y7JA 4DBXA 4XLVA 5AJQA 4FUYA 4YC3A 4FTLA 4EOIA 1K2PA 3OOGA 3WZJA 3FLQA 3AT2A 5ETIA 5HG5A 4D1ZA 1XH7A 3Q96A 4F6WA 5LWNA 2JIUA 4GS6A 5E91A 3QTWA 4XG2A 3VULA 4II5A 4YHTA 3T3VA 5KO1A 4K11A 4U7ZA 2PE2A 1PXPA 4TT7A 4HZSA 2YJSA 1G8SA 1H0WA 2W05A 3GEQA 4QMMA 3ZZEA 4LMUA 5I9YA 3NNUA 4YJTA 1OKYA 3KB7A 5LVMA 2C3LA 2VX1A 4GMYA 1PMEA 2VTSA 4ACHA 2GFSA 4ACGA 3CCNA 3R0TA 3ULIA 5L8JA 2W1IA 3SX9A 3IG7A 3VUMA 5K4IA 4AW0A 2UVXA 1OZ1A 2C3IB 2X2MA 3KF7A 4XLIA 1SNUA 2W1HA 2YIQA 3ODYX 2AC5A 4AAAA 2GNGA 4USDA 4ZLYA 5IQGA 2YLFA 1XJDA 5I0BA 2XM9A 3KVWA 4TWPA 3AC1A 3E93A 4ANSA 5C27A 2ZV7A 3ZHPC 3QTQA 3ATTA 4NTSA 3UQGA 5D7VA 4EQMA 5KMNA 4P2KA 5A4QA 3QD0A 4IEBA 3TN8A 4FTAA 3MY1A 2WTVA 3OCTA 4BCMA 4QD6A 3Q2JA 2YN8A 3RWPA 3NRMA 4M13A 4MD7E 1RE8A 2V22A 5D41A 4D9UA 5HNIX 4BZNA 3FPMA 4FOCA 4G34A 4UX9A 2HOGA 2VTIA 4FZFB 3E62A 1FGKA 3ZU7A 2XCHA 4RVTA 3SW7A 1Z5MA 3JYAA 3V8WA 1WAKA 4EOMA 1BMKA 3BGQA 5CLPA 4O7SA 3D5VA 1H08A 3A7FA 3QYZA 4I5PA 1BX6A 4EZ5A 2ZM4A 3ZC5A 2VV9A 4RFZA 3R21A 3FSKA 2CGUA 4I0RA 4AS0A 4JRVA 2WTWA 3ROYA 3PIXA 1WBSA 2CHLA 1ZYLA 5ETCA 3ZUTA 4NL0A 4FIHA 3D7TB 1Q99A 5IH4A 4G9RA 5DT0A 5F9EA 4OGRA 1XH5A 5CU3A 4D4VA 5IQHA 4ONAA 3S95A 3COIA 4E3CA 4D4RA 1MRVA 2PMIA 2XK4A 4JS8A 3F61A 3U6HA 2J2IB 4M84A 4AOTA 4X6RA 5AR3A 4R77A 4IB1A 3KCKA 3ZFYA 5CENA 3PPKA 5FTOA 5E1SA 5CI6A 5G1XA 3C13A 3RZBA 2GPHA 3RGFA 3HA8A 4M0ZA 4WIHA 2UZWE 3LFBA 3PXQA 3W55A 4ZY4A 4YNOA 3JVRA 3BGZA 3IO7A 1ZAOA 2DQ7X 3FZ1A 4F1OA 2BRGA 3PWDA 2RKUA 5L6OA 5M44A 4UZDA 4HVGA 3L9LA 4O81A 1ZYCA 4O6LA 3ZM9A 2F4JA 1YXTA 1U5RA 4R1YA 3FEGA 1ZYJA 2CKPA 2XIYA 1FVTA 2C6OA 3VS4A 5AP7A 3BYUA 4CLJA 2QQ7A 4BKZA 4FZDB 5ANKA 5AV4A 4CV8A 3KU2A 3UOHA 3KVXA 4PMTA 4IWDA 2J5EA 4I5CA 4A06A 2BDJA 4U42A 4GUEA 1PF8A 3I81A 3QHRA 4L3JA 4MQ1A 3VRYA 4ZLZA 5EDQA 5EI6A 3W18A 1XHAA 1F5QA 2F7EE 3HX4A 3NUXA 4GJ2A 4I22A 4EHEA 3I7BA 4RJ3A 4OBOA 3DTWA 1DM2A 3QTIA 5K4JA 4G3CA 3V6SA 1JKTA 1QMZA 4UYNA 4DC2A 1UKIA 4MNFA 1ZLTA 2Z7QA 2UZTA 3LFDA 4AOIA 5T3QA 3BEAA 4C02A 5DOSA 3I5ZA 2C6TA 4FSWA 4A4XA 5IMEA 4IACA 2ERZE 3NCGA 3QGYA 4C3PA 3E7OA 3FYJX 4RX8A 4YJQA 5HBEA 4X2GA 4G2FA 4XV2A 3V5TA 3POZA 2RFDA 2F7ZE 5KE0A 2XKFA 2XJ2A 5A4CA 1Q62A 1NVSA 1OL7A 2JKKA 3QQUA 4HNIA 2XH5A 4QRCA 5JFXA 1W83A 3OW4A 5DPVA 5J87A 3HEGA 4ZJIA 4AW1A 1XKKA 5KBRA 3TG1A 5AFVA 3PA3A 3QXOA 5D9HA 4B8LA 3MDYA 3C4CA 3V5PA 5AR5A 1SVEA 3ANRA 2WTKB 4MF1A 2UW7A 4EHVA 5BQ0A 3N4TA 5KUPA 1PRYA 1XH8A 2B9IA 4FSNA 4BBEA 5HQ0A 3S0OA 4QNAA 3QWKA 3ZLYA 2RSVA 4CXAA 3H10A 4FTOA 3RBWA 2PZ5A 3W32A 4TYHA 5CX9A 4I4FA 5E8VA 2V0DA 1L8TA 2PZPA 5BVDA 4APCA 4CFUA 3G5DA 3LFNA 1GOLA 5A6OA 2BAQA 3A7IA 4QMZA 4QTCA 2GFCA 5B2MA 4FG7A 4JBOA 4MBJA 3KF4A 1Y91A 2VWYA 4IC7A 4WKQA 5AV1A 2FSOX 2XB7A 1R39A 4WBOA 4DA5A 2QOBA 4FKVA 2PMOX 3RM6A 4K6ZA 5JN2A 2XKCA 3UOJA 2B0QA 5JQ5A 2ZDUA 2XCKA 1ZRZA 3L8XA 1WCCA 4FKWA 2X4ZA 3FY0A 3DBFA 3KRRA 4N70A 3O8PA 4R1VA 2R3RA 3QC9A 3DZOA 4IJPA 2HWOA 3A2CA 3CY2A 3KL8A 4KABA 4DFNA 5CSPA 3AD6A 2FSTX 2QLQA 3QWJA 4S34A 3EQGA 3HRFA 4IAYA 4BIEA 3OUKA 1DAWA 3LPBA 5E8XA 3D94A 1HCLA 3VS5A 3FI2A 2ITWA 4EBWA 3DQWA 3UDBA 5DLSA 1TQIA 1WMKA 3DJ5A 3PLSA 3PPZA 4Y8DA 4EOKA 3KMMA 3LLTA 3LIJA 4HVIA 4RA4A 1H01A 4MEDA 2QODA 2ONLA 1LR4A 2QHMA 4R7HA 1B39A 3BBWA 3HV7A 3PJCA 3B8QA 5DEWA 4CG8A 4BCIA 2A4LA 3ZLSA 4IVDA 1OKWA 4JQ7A 3LW0A 3R1QA 4FEXA 3OROA 4CKRA 4I24A 1Y8GA 1KOBA 3AT4A 5AP2A 1GY3A 3BX5A 3VRZA 4WSQA 1IAJA 3W2PA 5J1VA 1GNGA 4IC8A 3BBTB 3JUHA 5EOLA 4IB3A 3TV6A 3ZS5A 4ALUA 3O17A 3O7LB 1M7QA 3EQIA 2F57A 4PTGA 4ANMA 3GC8A 5E8WA 3DZQA 4FTKA 1ZMWA 2OW3A 5CEKA 4AT3A 3N51A 3ALOA 5M55A 3IW7A 2X2KA 1WBWA 4ZSAA 3U6JA 4NCTA 2I7QA 2XM8A 4F7NA 3FXXA 4YURA 4OAUC 3LAUA 2HY81 4DG2E 2GHLA 1GZOA 4JDKA 5HE0A 4UMRA 2VWVA 3LVPA 4ALWA 2VTHA 4NKSA 4AZFA 4OTQA 2O64A 4DFBA 1E9HA 4FX3A 3R9OA 2JDOA 3LJ0A 4AUAA 4RIYB 2PVMA 3A8XA 5E8ZA 3FE3A 4M3QA 1YDTE 3HDMA 3TZ9A 4GK4A 4K2RA 2IVVA 4FIJA 2I0VA 3MESA 3UVPA 4FT9A 4HVDA 3TWJA 4BCPA 3I5NA 3RPRA 4FYNA 4GG5A 5EDPA 5C9CA 5HIBA 4P90A 4V05A 5E8UA 3BHHA 3AGMA 4G17A 5ETFA 4QQ5A 3D9VA 3OD6X 1IA8A 2G2FA 3FXZA 4UWBA 2O8YA 4R3CA 2C1BA 4QP3A 5EW9A 3FZTA 4JX7A 5AUXA 3TI1A 4EOLA 3MIAA 4IAFA 5JH6A 4D58A 2OFUA 2YJRA 2UZDA 4XHKB 3F5PA 1PKGA 3FZOA 3LFAA 4BI2A 3UVRA 5L2IA 3UNKA 3TDWA 1FMKA 2E9VA 4K33A 3QL8A 4M12A 3ENHA 4I6QA 4G1WA 2V7AA 2ZB0A 4XMOA 4YTCA 3CSVA 3LQ3A 2BMCA 3L1SA 2JAVA 5IF1A 1BL6A 2X6EA 3ERKA 1H0VA 3F66A 4MD8E 5DVRA 4TRLA 3P78A 2PYWA 4H39A 2BTSA 2YEXA 2QR8A 3PRFA 2OF2A 3GQLA 4U43A 5HEZA 3ZC6A 2FVDA 4U41A 3O71A 3QQKA 2WMUA 3U87A 4O7VA 2G1TA 2X7OA 2B53A 5I4NA 2I6LA 4JLCA 2ZV2A 3Q6UA 4FEQA 1JKLA 1H27A 3PY1A 3LXPA 3DAEA 3R8ZA 4BTMA 5JQ8A 1UNGA 4BDEA 5M53A 1XBCA 1XO2B 4XUFA 2CSNA 3OUNB 1IEPA 3PXYA 1JKSA 5IUGA 3R2BA 2GS7A 4MHAA 1AGWA 5A46A 2BILB 5A14A 3KK8A 4RG0A 3MVJA 5I3OA 2IJMA 4IVBA 4FIEA 2WMVA 5A4EA 4S32A 4XCUA 5BVEA 2DS1A 4Y83A 4RA5A 5GNKA 4HNFA 4XOZA 5EK7A 3A60A 2W1GA 4BDGA 2YM8A 4FGRA 3GNIB 5TE0A 3GQIA 5HIDA 3L9NA 1ERKA 3E92A 2PVLA 3GC0A 2JBPA 4DG3E 1OPKA 2VO3A 3OTUA 4JI9A 2UW4A 3UNJA 1WBNA 4N6ZA 4YBJA 4EEVA 1J7IA 5C4LA 2HZ0A 3CGOA 3KN5A 4DH8A 2F7XE 4ASZA 4EL9A 3VW8A 1WFCA 3OP5A 4EJ7A 3FKNA 3M1SA 3FZPA 4BY9E 3NW7A 2PUNA 3VUTA 4KRDA 5EW8A 5AX3A 4RGJA 4FODA 5IQAA 4JIAA 5B2LA 3LLAA 4HPTE 4F1TA 2C0TA 4QMNA 2Q83A 3LOKA 4UXLA 4AWIA 4QQTA 1CTPE 3P9JA 3T9IA 5IZFA 2VTTA 3E64A 3ZO3A 4PQNA 2BHHA 4QMUA 3THBA 4GVAA 2ZV8A 3TNIA 3C4FA 3UIBA 4LV8A 3MPAA 5FD2A 1P2AA 3IK3A 2O63A 2XK6A 4FV1A 4FV2A 4EJNA 3FV8A 1O6LA 4APPA 4J98A 4DFXE 4WSYA 3QD4A 4D0XA 3TXOA 3DQXA 4DGOA 4ASXA 4QP7A 3OFMA 4RJ7A 4BTFA 4FSRA 4RJ6A 3QA8A 3UPZA 4FKOA 3E8CA 3POOA 3DS6A 1NY3A 2PVHA 3QRUA 3LQ8A 5I5ZA 3MIYA 2WQMA 5FXQA 4RX7A 5FDXA 4X6QC 4UMQA 2XKDA 3QZGA 3OWLA 2J6MA 2BIKB 4MNEA 3E88A 1REJA 4IX6A 4EYJA 4FL1A 3QBNA 2X7GA 3I7CA 3K2LA 4YJVA 3TV7A 2PVFA 3VVHA 5E9EA 4FK6A 4CRSA 5IG1A 1G8AA 1KE5A 2FSLX 3BI6A 3FL5A 3I60A 4FSUA 3ORZA 4L6QA 3NW6A 3PZEA 4LUDA 2J4ZA 3WILA 5GZAA 5M09A 3UMXA 4QTEA 3OS3A 4TL0A 4RWKA 3GOPA 2PK9A 4ZJJA 4PDSA 5L2TA 4G9CA 1XWSA 3ACKA 3KXXA 5ANEA 2ZM1A 5DIAA 3QKMA 2XIKA 5HG8A 3BWFA 4YC6A 3VHKA 3AC8A 5EFQA 2XNMA 5DA3A 4XRJA 3UMWA 3EKNA 2BZHB 2CGVA 1SNXA 3EFKA 4NH1A 3QKLA 4CFWA 5HESA 3VN9A 4EKKA 3UNZA 4FGBA 1W8CA 4O7YA 3PY3A 4C35A 3GENA 2OSCA 4G5PA 4J1RA 2EB2A 3EQBA 4O0XA 3LMIA 1XBBA 2R7IA 3DB8A 3QX4A 5FUTA 3F3TA 4DTKA 2GQRA 2IPXA 4ASDA 4FK3A 5CEQA 4HW7A 5IUIA 4ACDA 5CVGA 3F82A 4R3RA 4IMYA 3D7TA 4FE2A 2JFMA 3V5LA 5IKWA 2Z02A 3WF6A 5KKRB 1CKIA 1Q3DA 4DN5A 4NCTC 4NM7A 2J9MA 4EWQA 1KE6A 4E4MA 3UG1A 2VWUA 1WBTA 1TQMA 3IDPA 4XP3A 1H4LA 2VGOA 5CANA 5IA0A 3QQGA 4RQVA 3WOWA 4PX6A 2Z8CA 2WU7A 4GK3A 1H1SA 1ZWSA 4UWCA 3ULZA 3QXPA 4EK8A 4KSQA 5EM8A 1UU8A 3A8WA 3SVVA 2VTRA 5T6KA 5AP4A 3TEIA 3FMNA 3H0ZA 4L3PA 4JVGA 2YM3A 2ACXA 5KCVA 3HL7A 3JR1A 3FLSA 3KGAA 5HX6A 3FJQE 5DGZA 1SMHA 4EI4A 5IDPA 2J0JA 4XH6A 4MXCA 3BU3A 3R8MA 2VWZA 2O5KA 3DFAA 4HGSA 3IONA 4JBVA 3C50A 5J9YA 3F2RA 4EC8A 2G9XA 1Q8YA 5CSXA 4KBCA 4TTHB 3E7VA 5CVHA 3TL8A 5IMXA 4NEUA 2OWBA 2V5QA 1W7HA 4JXFA 5C26A 5FM2A 3A4OX 3D5WA 4HOKA 2XS0A 3QTXA 4JQ8A 4LOQA 5DRBA 3EKKA 5I9WA 4IAZA 3LKMA 5FTGA 4GKIA 3RP9A 1J3HA 3RM7A 1PXJA 2F2CB 2W99B 4YPDA 3RINA 5DFPA 4E5WA 1F0QA 3M11A 1WBOA 2YM4A 5CF5A 5LQFA 2JDSA 3DAJA 3VJNA 4QMVA 5JFWA 3OXTA 4BDCA 2I0HA 4IVCA 4MYGA 3PSCA 4F9CA 3H9OA 2XF0A 3BLHA 3FWQA 5A3XA 3TTIA 1FVVA 5CNOA 2CDZA 4QMOA 4NTTA 4XBUA 3DA6A 3FC1X 3P7CA 3PRIA 3CGFA 5JZNA 1CSNA 4ZP5A 2QOKA 3TIYA 4UZHA 3Q9YA 5CAPA 4P7EA 4W4WA 1MRYA 2XNPA 2QHNA 3G6HA 4FT3A 3FY2A 5L8KA 1YI4A 2QG5A 4RJ8A 4CLIA 5LXMA 1YOMA 4BZDA 4BYIA 4KB8A 2P2HA 3FQSA 3ITZA 3F5GA 3G51A 3QTZA 3RCDA 1PW2A 4GFGA 2W06A 3C4WA 5HE1A 1ZARA 4HYSA 3ZONA 5I9XA 5IDNA 4J7BA 5BUEA 2SRCA 3QFVA 3E8NA 4RWJA 5I9ZA 4Q9SA 4J97A 5GINE 3R7OA 4BI0A 1DAYA 4NK9A 4PMMA 1H26A 3V04A 4TW9A 4FTCA 2XK3A 3Q9XA 4IXPA 1YXUA 3CKXA 4O21A 5FBOA 2YERA 4YO6A 3ZXTA 4BIDA 3PJ8A 5BVNA 4ORKA 2ITTA 5HG7A 3NNXA 1A9UA 4J99A 2ZDTA 2G2HA 2Y4PA 3ZXZA 3CQWA 2PL0A 3BE2A 1PY5A 3NYNA 4FTQA 2WTIA 3Q9ZA 2ETRA 4RFMA 2IG7A 4NW6A 4YUQA 4JAJA 5DR9A 2C47A 5H3QA 4CMUA 5AR2A 4QMXA 1H28A 3P4KA 5CALA 3OF0A 4FTIA 5B2KA 5K3YA 1IR3A 4X3FB 4FT7A 3DJ7A 2FH9A 5DH3A 5AP5A 3FMKA 5FP5A 2WO6A 3R8PA 3WF9A 3WE4A 2XIRA 3EN4A 4GL9A 4M7IA 3CIKA 3ELJA 2YHVA 5AUTA 4I23A 3R7IA 3P08A 3OVVA 1DI8A 4QP2A 2PVKA 4FIFA 4M69B 4FV5A 1M7NA 4RJ4A 5FP6A 3D5XA 2QVSE 4IAAA 4L7FA 4WD5A 4D55A 4BDAA 5JGBA 2YM6A 3V5QA 4IQ6A 4S33A 2UVZA 4DFLA 2QOQA 2Z7LA 3DV3A 3MTLA 3TJCA 3QQHA 2ESMA 4AT5A 4F0FA 5KBQA 2OIQA 4OT6A 2XIZA 4NM3A 4XG8A 3RAHA 5HORA 2R64A 5HKMA 3K3JA 2GHGA 5F20A 4BL1A 5HGIA 3DU8A 3V3VA 2CKOA 4TYIA 5HCXA 4ANLA 3LFFA 4N4SA 1ZZ2A 5IH5A 2C6EA 3MFSA 3OCGA 4Q2AA 5L2QA 4M97A 5LMBA 3R02A 4O2ZA 4FR4A 2QO2A 2BPMA 4OTWA 4K8AA 5FWKK 4O38A 4DEBA 1ZOGA 4LGDA 4UMPA 2ZMCA 1M2QA 1PMUA 4WUAA 2VTNA 3CPBA 1UU7A 5CVFA 1LUFA 3QZHA 4AW5A 2O2UA 4IZYA 2QOLA 5HIEA 5TR6A 4RRVA 5EM6A 3AT3A 2VU3A 5GIPE 3BYSA 2WHBA 2XMYA 4H36A 2Y4IB 2J7TA 3PJ1A 4DGGA 4RVLA 5EHLA 1OIUA 2B52A 2C3KA 3MB6A 4BF2A 3UTOA 4ZAUA 3LMHA 2JAMA 2Z7SA 4M68A 4WNOA 4BZOA 4R6VA 4L00A 4UY9A 5BYLA 3Q6WA 2J50A 4WT6A 4O0YA 2QI8A 4I1ZA 4TPTA 4ZMFA 5EYCA 3UOKA 4GIIA 3OCSA 3W8LA 4ANQA 4OTFA 4RIYA 4RIWA 3VBYA 4E93A 2HYYA 5FRIA 2HIWA 3GP0A 3QQFA 3QYWA 3HV3A 2R3NA 4XG7A 3RPOA 2JDRA 4G16A 4XX9A 3RAIA 4BDBA 3VBXA 5EI8A 1XH4A 2OZAB 2UW0A 2VN9A 3PP1A 4GH2A 4F09A 1H1RA 4L52A 3WARA 3QU0A 4BB4A 1LPUA 1REKA 3KXGA 5HE2A 3DKCA 3GGFA 2YIRA 4O7RA 2Y6MA 4WOVA 3PY0A 4W9WA 1H1QA 5HE3A 3ZUVA 4O96A 5CSWA 1OL5A 1YDRE 3IW5A 4IH8A 4C8BA 3DLZA 3BGPA 5AAGA 3BRBA 3EIDA 3Q4CA 3DKGA 2BVAA 3DOGA 2WXVA 1OB3A 5LARA 4BGGA 4ZZOA 4O7NA 3CBLA 3Q3BA 4IB0A 3SAYA 2W9FB 2R3QA 4BC6A 2C6LA 5AA8A 4H05A 2IVTA 5M4FA 4F99A 4NT4A 4Y95A 1CDKA 1PXKA 2JLDA 1UA2A 4WRSA 4DYMA 4U3ZA 1TQPA 2YLEA 3DBEA 2E9OA 2UW3A 2BZKB 1JPAA 4AA0A 2CNVA 1H07A 5C4KA 4LM5A 1PMVA 4KKGA 1KV1A 4FL2A 4EQUA 5IQEA 5HCYA 3ZBFA 2OZOA 4I93A 3LM0A 5K0KA 1LP4A 5CAQA 2VO6A 2JDVA 3WZDA 2C0IA 3DLSA 1IRKA 3G33A 2WMWA 1YRPA 2GTMA 3MWUA 4FVQA 4MCVA 2WEIA 4ZZNA 3GCQA 2XRUA 4JDJA 4Y5QA 4MWIA 1H8FA 1ZYSA 3CS9A 3C7QA 3ZM4A 3BYMA 5HO7A 2HXLA 2RF9A 4R8QA 2OI4X 3GU6A 3BV3A 4BDFA 5GZ8A 4K77A 4MBIA 5FTQA 3LFEA 1UWHA 5EYDA 5HNGA 4BWKA 3OBJA 5I9VA 3ZMMA 4DHFA 3AQVA 3I6UA 3MH0A 2Q0NA 1XQZA 2B9JA 3LXLA 1UKHA 4QQJA 2XZSA 2C5XA 1FPUA 4L3LA 5AV2A 3UC3A 3FI8A 4YJOA 5AUUA 4GFMA 4PNIA 1ZY5A 3U54A 2OK1A 3ETAA 4F6UA 4FEVA 3KK9A 4DAWA 4HCVA 4LUEA 3O23A 1G3NA 1IG1A 5IQDA 1LEZA 3UQFA 3S3IA 3LE6A 1UV5A 1YI6A 2GHMA 2GNFA 3HRBA 3ENMA 5J1WA 2E9PA 3F88A 3KULB 1E1VA 4CQGA 2VGPA 3EN7A 3U8WA 4AZVA 4EH9A 3MB7A 1U46A 3ZEWA 3QA0A 4IWPA 3C0IA 3MPTA 3EMGA 5FDPA 3LCTA 1B38A 2X8IA 4LOPA 3EQCA 4ITHA 4KIKA 3WBLA 5M51A 3QRIA 4FZ6A 2XJ1A 2ZAZA 1BI7A 4GYGA 5DN3A 5HO6A 4EOOA 2CNQA 4E73A 4RC3A 4V0GB 3UIUA 2PMNX 4W8EA 4TZRA 2YAKA 4O2PA 5AUWA 5IEVA 3F3ZA 4QOXA 3BV2A 5IQCA 2RL5A 3C5UA 4TKSA 5GJFA 3IW6A 1Y8YA 2E2BA 3NUNA 1H24A 3AMYA 4K9YA 4CCUA 4ZSGA 3ZFMA 4RZWA 4F7SA 3UZTA 1YHWA 3EQPA 3TUDA 4ITIA 2E9UA 3L8VA 3R8UA 5JT2A 5LOHA 2YIXA 2ITNA 3R30A 3RK9A 5IA4A 3MVMA 4D2TA 1WVXA 5B7VA 4EOPA 4Z9LA 4O7LA 4NWMA 3LFSA 3PVWA 4U44A 4PDYA 5CU6A 5M06A 4USEA 4CZYB 2Y8OA 1AQ1A 5TKDA 3DJ6A 3C9WA 4FTMA 1XH6A 5JRQA 1OKVA 1ZY4A 4Q5HA 1XH9A 4FA2A 4CV9A 4NIFB 5JEBA 5JGAA 1YOLA 3NWWA 1QPDA 2C6IA 3FMEA 2CNUA 2VX3A 4IWOA 3GT8A 5IQFA 2C30A 2PVNA 2QU5A 3NIZA 1KWPA 1UU3A 3FC2A 4CQEA 3FLYA 2VTJA 3L8PA 2VZ6A 3DDPA 4FVPA 3NS9A 4Y72A 4A4OA 3FQEA 4HVSA 3SXFA 2O0UA 1OI9A 2OJJA 3GU4A 2X2LA 4WBBB 2R9SA 2WTCA 3BKBA 3BQCA 4PNKA 5J79A 2PMLX 1T46A 3BYVA 3U9NA 3UO5A 4XG9A 3K3IA 4GJ3A 3IOPA 3WIGA 4RFYA 1L3RE 3UZRA 3VF8A 2W1FA 4QP6A 4C36A 5TOZA 1XBAA 3MA6A 4D5HA 5IEXA 3AMBA 4EOSA 4QMTA 3JPVA 4NKAA 3VBWA 4RWIA 4WUNA 2GTNA 1H1PA 3EQFA 3QLGA 4UBAA 5HD4A 1ZOEA 4RT7A 2OIDA 1SYKA 3GVUA 3S2PA 3WIKA 5LVOA 4BN1A 3EQRA 4DINA 4FSMA 4J71A 3A61A 3RTPA 2YCRA 3QHWA 3TDVA 2R2PA 3ANQA 4JR7A 5L6WL 4QMSA 2PUIA 3CLYA 3VWAA 4NW5A 1UNHA 2ITOA 2FO0A 4B9DA 3BWJA 3HV5A 3FKLA 3AC2A 4ZTRA 3SRVB 2WZJA 5JGDA 3U9CA 4FT0A 3A7JA 3MFUA 3W33A 2RIOA 3Q4UA 2W5BA 2A0CX 4WRGA 3H3CA 3W2OA 4N57A 3FHRA 4QP1A 3ZLXA 2C68A 4JIKA 3N9XA 3BHTA 5E4HA 5J7HA 3HZTA 1M17A 3Q5ZA 3SXRA 2C6DA 1BUHA 2E9NA 3GC9A 3MVLA 3B2TA 3PSDA 4WNMA 4EBVA 4EH2A 5HTIA 2PTKA 5IU2A 4JDHA 4PL3A 4QYYA 1VZOA 2P0CA 4TWOA 3DK6A 3GFEA 5DG5A 2PE1A 5DHJA 2CPKE 5KZIA 3VQUA 1VR2A 4FOBA 4NUSA 1K3AA 3UODA 3VAPA 4FEUA 2G01A 5KHXA 5IA1A 4LRKA 4YGAA 4IWQA 2UW6A 5M57A 2OXYA 2IWIA 1ZMVA 3RKBA 1KV2A 3DTCA 2VNYA 4LG4A 2BZJA 3KN6A 5J9LA 4TN6A 5AIKA 5BVKA 2W9ZB 4YBKA 4ZEGA 4OLIA 4HYIA 2QLUA 5HTBA 2X7FA 5C8NA 2W5AA 4S30A 3V6RA 1YWRA 5AP6A 2WQBA 1WBVA 3CXWA 2XA4A 4CMTA 1KUTA 3BIZA 4L45A 2YZAA 2WPAA 4BCNA 4RMZA 3SD0A 2BIYA 4ANBA 3NW5A 2V7OA 4CSVA 2EU9A 4L9IA 3C5IA 2GNLA 2GU8A 2OIBA 3DGKA 5FEDA 1MRUA 1LEWA 4YJPA 5TF9A 2EXMA 4RIXA 3D2KA 4MTAA 5EYMA 1NW1A 1J7LA 1WBPA 1J91A 2WGJA 4TNDA 2C0OA 4EOQA 4F9YA 4TXCA 3CD8A 1JBPE 4U45A 2XEYA 2P33A 4FC0A 3ZSHA 4YMJA 4B7TA 2UUEA 3MFRA 2JITA 2VWBA 3RI1A 3W2SA 3R1YA 4MXZA 3DAKA 4B0GA 4EH6A 3FMDA 3KA0A 4X2JA 1OIYA 3MGYA 4FKSA 4I41A 2CN5A 3IW4A 4QYHA 4OBQA 1WVWA 4EK6A 3BHYA 4C33A 2B55A 4OTIA 3EWHA 5FLFA 3LHJA 5AIRA 3SGCA 3OCBA 2UW9A 2XK7A 3QCQA 4PPCA 5F4NA 3ZCLA 3WF5A 4BWXA 3UO6A 4AFEA 2VRXA 2OJ9A 2YDKA 3FZSA 3LJ2A 4F08A 1KE8A 3BYOA 4NJ3A 4YZMA 1K9AA 2VX0A 3DT1A 3PIYA 4BIBA 2X1NA 4GIHA 5LWMA 5CF8A 3QUDA 2C3JA 4ZTSA 4LI5A 4F7JA 3KXNA 2BRHA 3AOXA 2BHEA 2HENA 3PJ2A 5F94A 5CY3A 3R8VA 2QOFA 4BBMA 4M69A 4DEAA 4CKJA 5JZJA 3Q4TA 5J8IA 2XBJA 2VD5A 3FSFA 3BZ3A 1PYEA 1RW8A 2BRNA 3D0EA 3PVUA 3OZ6A 5AM6A 4GUBA 4KRCA 1ZXEA 2DYLA 3KRWA 3PUPA 4K0YA 3R2YA 3K54A 3QF9A 3V5WA 4BCOA 2EXEA 3CQEA 3DBCA 4HGLA 4QTBA 4A9YA 1URWA 4A4LA 2J0LA 2FUMA 4ZTQA 2EUFB 4YJUA 1STCE 4IM3A 5JMSA 4JOAA 2BUJA 4DCEA 4QTAA 1G5SA 4H1JA 2CKEA 4GVJA 4YR8A 4FTNA 4OAVB 4W9XA 2VUWA 2YWVA 3KXMA 5HOAA 3O50A 4R3PA 5HHWA 5A4LA 3BU5A 4PTCA 2YABA 3C0GA 5AP1A 3TZMA 4JAIA 3OT8A 4U81A 4MKCA 1JAMA 2R3LA 4YTFA 3PLAE 2XNOA 3FL4A 4MX9A 1UWJA 4F0IA 5HLPA 2Y6OA 2JGZA 3UPXA 4USFA 3UP2A 3FI3A 4XP2A 3E3PA 4ZY6A 3RVGA 5ITAA 3I0OA 1SVGA 2HWPA 1Q8UA 4KBAA 3MA3A 5M4IA 2Q0BA 3R7YA 4AZTA 2UZEA 4O0VA 5C1QB 4D9TA 3QD2B 3DCVA 4KKEA 4M66A 2JKMA 2GNJA 4A7CA 1ATPE 3OEZA 3WYYA 3WI6A 5AWMA 4B99A 4O7TA 3ORPA 1UVRA 5C8MA 4GEOA 3NEWA 1ND4A 3EN9A 3GXLA 4RZVA 1Q41A 1Q8ZA 3OY1A 4OTHA 2RG5A 3R63A 4CTCA 4F1MA 4G3FA 5KHWA 2BKKA 4YZDA 3F3VA 4X7QA 3OWKA 2J5FA 4FTRA 3RJCA 4YO4A 2X81A 3QTSA 3NYOA 5KMOA 3EFLA 2XK8A 3VUIA 4G31A 4HGEA 3OWJA 1YWNA 4X0MA 4Y73A 5E1EA 3DPKA 5AEPA 2W1DA 4TNBA 4LOOA 4WG4A 4C38A 1YI3A 4JDIA 3ZH8A 4BDJA 3NIEA 3NUSA 1PKDA 4ZTLA 3LQ5A 5G6VA 3CJGA 5CU4A 4ERKA 3KCFA 4G6NA 2QO7A 3I6WA 3OOMA 3IECA 4IW0A 2BKZA 3R83A 3R7VA 1MUOA 1YVJA 3H30A 2HZ4A 2RFSA 3MW1A 2BRMA 1JWHA 4MQ2A 3FMMA 4E5AX 3KXHA 3P23A 4F63A 3BPRA 3F5UA 5ICPA 5EQYA 2BFXA 2PU8A 4GFOA 4FSZA 3FDNA 3TCPA 4EZ7A 4CT2A 3R28A 4G3DA 5AV3A 4CFXA 2ONLC 2HK5A 2UZLA 3HKOA 3MI9A 1OUKA 3GUBA 4L68A 3TT0A 4J96A 3KRJA 3GU8A 3ZSGA 4TWNA 2PZRA 1W84A 3FBVA 4L43A 4C57A 4F4PA 3WZUA 2XYNA 2XKEA 1WVYA 3PE2A 4PUZA 4QYFA 4U6RA 3NUPA 3R7EA 3KEXA 4E6AA 5HU3A 4KUJA 3G2FA 2WNTA 4FKGA 4ZZMA 1XR1A 2WQOA 5BPYA 2VTQA 4EHGA 3TUBA 5FQDC 5M4UA 2QG7A 2YM5A 3IKAA 3SC1A 3C0HA 3Q60A 4MK0A 4BDIA 2B7AA 2WIPA 3II5A 3HV4A 4FNYA 4J8NA 1Q4LA 3ORTA 1Q61A 3R04A 4X3JA 5GJGA 4MWHA 4BHNA 5AUYA 3RPVA 1VYZA 3AD4A 2H6DA 1CKJA 3A7GA 4O1OA 5CEMA 1YQJA 3NUAA 2G2IA 3IDBA 4IDVA 4D2PA 4Z16A 3OW3A 2YM7A 3U6IA 2J51A 3PXZA 3BLQA 3UBDA 4M14A 4TYHB 4QPMA 5IISA 3LCDA 4DFZE 4UEUA 3UO4A 1E1XA 5ANJA 4WG5A 4ZTNA 5LVNA 4EK3A 3VS1A 4LYNA 3PG1A 3OC1A 3P5KA 4HCTA 3D83A 5CZHA 1OITA 4E4LA 2CLXA 3ZRMA 2QCSA 3HA6A 4BDKA 5J5SA 4L01A 5HX8A 5J95A 3AC4A 3ZRLA 2WQEA 2CJMA 1JNKA 4KS7A 2JDTA 3ZBXA 3C51A 5E8TA 1OBDA 4P5QA 5HVYA 3V5JA 5FBNC 1VYWA 5ANDA 1QCFA 4U9AA 3F9NA 5IA2A 3HLLA 1FINA 2OG8A 1O9UA 4O6EA 2BZIB 4E20A 4YP8A 2XK9A 2F49A 1AD5A 3IGGA 4MH7A 5AM7A 4XP0A 2J0IA 2CN8A 4LV5A 4EWHA 2UZVA 2CMWA 1DI9A 4YNEA 3VQHA 3BHVA 5EG3A 3V8TA 4GKHA 2XNEA 3DFCB 3SG8A 5BVFA 2ZM3A 2WELA 4FNXA 2QC6A 3SLSA 4F0GA 5GHVA 2PZYA 4I5HA 3O2MA 4CZUA 3CR0A 3FMHA 2IVUA 5LVPA 3MJ1A 2X8DA 4C3FA 4F9AA 1WZYA 2ITUA 4OTPA 5LJJA 4DT8A 2ZYBA 3K5UA 1YWVA 3EYGA 4YHJA 4NFMA 5DR2A 4Z7GA 4OTRA 4ZJVA 3DXPA 3QRJA 3HVCA 3NPCA 4QYEA 4HJOA 4E7WA 4P4CA 3QTUA 3NMUF 4CFFA 5IA5A 4R78A 2GS6A 3HV6A 4TYEA 4JG8A 3MH2A 4HPUE 4PV0A 4R5SA 4Q5EA 3WZEA 3D14A 4G3EA 4IFGA 4IM2A 5KMJA 3NNWA 4JNWA 3P1AA 2VWWA 4A9SA 4I4EA 4D2WA 4O83A 5ACKA 3UZPA 3WZKA 2OXXA 4FKQA 2HZNA 4W8DA 3O0GA 2ETMA 4MXAA 2VTMA 3F3WA 4QP9A 4A9TA 5EOBA 4C34A 3FYKX 2UW5A 3NCZA 2YDIA 4Z55A 1IA9A 3DDQA 2NRUA 2V62A 4PMPA 2OJGA 2ZMDA 3TV4A 4GT5A 2IW6A 3R6XA 1NXKA 1Q8WA 2ZOQA 4W4YA 5CYIA 1ZOHA 2QKWB 1U54B 2G15A 3S4QA 3EFJA 3LFCA 5CXZA 1V0PA 2R3HA 5DR6A 1YXXA 2OJFE 5FXSA 4AA4A 4O82A 4AN9A 4JG6A 2OKRA 2OU7A 2R3PA 5JRSA 3ZFXA 2RFEA 4ASEA 4KS8A 1BLXA 1U4DA 2A27A 4XOYA 3SRVA 4U97A 4GT4A 5CWZA 3D2IA 4I6BA 3PJ3A 3VIDA 3BQRA 3OT3A 5AMNA 2R5TA 3MS9A 2OICA 2WB8A 4LRMA 4W4XA 1OPLA 5HTCA 3TKHA 2PUUA 2R7BA 1KSWA 2OF4A 2Y9QA 4S31A 4XBRA 3CE3A 3SA0A 4B6LA 4CEGA 2ITVA 3RPSA 1P4FA 3FLZA 4BCQA 4EK4A 3RMFA 3SQQA 1Z9XA 5DT4A 2YACA 4L8MA 4OBPA 3U51A 4E5BA 3E63A 1IASA 2NRYA 4D5KA 3KY2A 3RHKA 4DF3A 5D10A 2WMBA 4IDTA 3V8SA 3F69A 3RPYA 3P0MA 5CQUA 4YZ9A 4FV8A 3WYXA 4BRXA 4WNKA 3GFWA 3AMAA 2C5YA 1OBGA 5H8EA 4AQCA 4Y46A 3VUDA 4AN3A 1CMKE 3GBZA 1PXLA 4BTKA 4DBNA 2ZVAA 2W0JA 5IQIA 1KE7A 4FKPA 3ORNA 2QR7A 2OH4A 2QU6A 2BROA 2JFLA 3WE8A 3WF7A 4Z7HA 4ZS4A 1HOWA 1OIQA 2B54A 3L9MA 3OHTA 4X2FA 2IN6A 5AX9A 3R01A 1Y57A 3PXFA 4O0RA 3OMVA 5AUVA 5F1ZA 2A2AA 2I0YA 3KMUA 4GCJA 4KD1A 4DTBA 1PMNA 3NNVA 4KINA 3TNWA 4D1XA 3S00A 4YZCA 4KKHA 4KIQA 2XJ0A 3PXRA 4AGWA 3AGLA
chains in the Genus database with same CATH superfamily
4H1MA 4O4CA 4EOJA 2LGCA 5HZNA 4IZAA 2V55A 5AV0A 3EQHA 3G15A 1OIRA 5H2UA 3RHXA 5KMIA 3R71A 4O7ZA 4IANA 2XEZA 3GB2A 1YOJA 5FM3A 5A9UA 2ZB1A 5E8YA 5HICA 4FKTA 4CD0A 2ITZA 4FI1A 1OM1A 3Q5IA 4EUTA 5JSMA 2QNJA 2GQGA 4YPSA 1JLUE 1SVHA 4AP7A 2VTPA 4IM0A 4RC4A 4WO5A 2JKQA 5HLWA 3MTFA 3JY9A 5H9BA 5BMSA 5L8LA 3QGWA 1W0XC 5DI1A 3VS3A 4C4FA 5BUJA 4JBPA 1YXVA 4ENYA 3ODZX 2YCQA 4IX5A 3DNDA 2A98A 2YDJA 3OEFX 4P5ZA 5LMAA 4LMNA 3U4UA 2WU6A 4O84A 4CKIA 2PSQA 2XP2A 4N0SA 5FEEA 5CASA 1PJKA 4IX4A 5AADA 1TVOA 4FV9A 5LVLA 3H0YA 3ATSA 5E90A 3QCYA 5AAFA 2NPQA 5D12A 5E92A 1ZMUA 1YXSA 4D1SA 4RLKA 5H8BA 4O0WA 4I5MA 4F70A 4XV9A 3MJ2A 4BYJA 3ROCA 4FV6A 3Q53A 2EB3A 4ZOGA 5DBXA 2HY0A 4FV0A 1YHSA 3CTHA 2WKMA 3NDMA 3ZUUA 4BI1A 1R78A 4MNEB 3Q04A 4FL3A 4AZEA 4DEEA 4R7IA 4CG9A 4JL9A 3IGOA 3BEGA 2C6KA 4C3RA 2I0EA 3SOAA 3TZ8A 3R7UA 4CYIA 4FKJA 2GMXA 3EZRA 3Q52A 3VBTA 3OXIA 3NX8A 4FKLA 3ZOSA 4CYJA 2WTDA 2XNNA 4JJRA 4D2RA 4F64A 1RQQA 2QKRA 4GT3A 3UIXA 4C62A 5M07A 5AP3A 4XV1A 3HECA 5KMLA 4IB5A 4O0UA 1VJYA 4J95A 5I3RA 5KMMA 4V04A 4DEGA 3R7GA 4WG3A 2AQXA 2PHKA 4U0IA 1OECA 4U3YA 4RIOA 2J0MB 4TYJA 3HYHA 2P3GX 3EL7A 4ZY5A 2I40A 4EYMA 4J52A 1NVRA 4TYGA 3UG2A 4H3PA 2BCJA 2WTKC 4C2WA 3IS5A 4YSJA 3AG9A 3MN3A 4FKIA 5CU2A 3U4WA 3VF9A 3QALE 1FOTA 1BKXA 3PVBA 5GZ9A 3MBLA 1YDSE 2ITPA 5EW3A 3TKIA 4RC2A 4PDPA 4F9BA 5LMKA 3HMIA 3LZBA 4MXOA 2J0KA 3MVHA 4E6CA 1QL6A 1XMLA 3I79A 4DT9A 4XNEA 3RNIA 4AA5A 3CQUA 4AACA 2GDOA 3F6XA 4E6DA 4N6YA 4DGMA 4ZSEA 3COMA 3NGAA 5C03A 4IJ9A 1ZYDA 3HUBA 3G9LX 3LJ1A 3VO3A 2JD5A 4WA9A 5EI2A 3FLNC 4QPAA 2BFYA 3O7LD 4GU6A 5EM5A 2WMRA 1NVQA 4KWPA 3QD3A 4DDGA 1Z57A 3CJFA 4LRJA 3BHUA 5AR7A 3ZO2A 2UV2A 3TKUA 3KRLA 4FTJA 3NLBA 2P2IA 4FG9A 4LGHA 4BBFA 4BCFA 3B2WA 4O0SA 4C7TA 2HCKA 3VS0A 4HZRA 4UYAA 4YJRA 4DEIA 4U40A 4PRJA 3RAKA 4F9WA 4PDOA 3P79A 1V1KA 4QO9A 5DNRA 1JSUA 2GS2A 4ANNA 3AC3A 3T3UA 4DCAA 2OFVA 3AD5A 4AE9A 1UU9A 2PUPA 5A4TA 3QQJA 4I3ZA 1OGUA 2VWXA 5H8GA 4EH7A 4EH8A 2OO8X 3EN6A 4FUXA 5JKGA 2PVRA 4YSMA 2GNHA 3TNHA 5CAUA 2UZOA 4AE6A 3UC4A 3W1FA 4R5YA 3R00A 2W96B 5LCJA 2B9HA 4JG7A 2WMSA 2X0PA 3QUEA 2DUVA 3ORIA 4IAIA 4MF0A 3UOLA 4Y5HA 4DEDA 5KMKA 3DK3A 4PTEA 2WTJA 4Y85A 4AGUA 2X8EA 2C5OA 4O91A 3O8TA 2BALA 3EN5A 2QO9A 4FKRA 2VAGA 5CZIA 2YAAA 1U59A 3KRXA 5BYYA 5L2WA 2H34A 4GV1A 2RG6A 3HMMA 3KQ7A 4XG4A 4EORA 2PULA 4DHJA 4JX3A 3UQCA 2VTAA 4O1PA 5AP0A 3GU7A 1EH4A 1YW2A 3VUGA 3C1XA 5HD7A 5HLNA 1GIIA 3G90X 1FBNA 5CS6A 2H96A 4TWCA 3E3BX 4U5JA 4ZSJA 4MXXA 5T68A 3QRKA 3BU6A 3TMOA 4LGGA 3DKFA 3H9FA 3RNYA 3QCSA 3R1SA 1CKPA 3O51A 5ACBC 1Y6BA 4CMOA 4MXYA 2PE0A 3NSZA 4C4IA 4KAOA 3BLRA 3HGKA 4YLLA 3RK5A 4JT3A 3SG9A 1HCKA 1Q97A 2ERKA 3FKOA 5IQBA 5FXRA 4AX8A 4FTTA 2XBAA 2VTOA 1JQHA 3ZZWA 5A54A 4GSBA 1NT2A 4FTUA 4AOJA 3QKKA 3PVGA 3Q32A 5EHYA 4M67A 3D15A 4QNYA 2YCSA 5J9ZA 3U55A 2O65A 1FMOE 3ET7A 2WQNA 4QMYA 4OW8A 4D4YA 3PFYA 1VEBA 4Z3VA 3TIZA 5K5XA 3EJ1A 4O22A 3CY3A 4FKUA 3RALA 3HNGA 3EB0A 4MVFA 3ZLWA 4BTJA 3EZVA 4EONA 4FICA 4IADA 5AR8A 4DH1A 4EHZA 4XG6A 3NUUA 3ORMA 3VC4A 3N4VA 1GJOA 4AGDA 4FYOA 1V0BA 4RQKA 4FSYA 3ZRKA 2IO6A 3NVMB 4E4XA 4ENXA 5KZ0A 3O96A 4IAKA 4AZSA 3TUCA 4I6LA 1M52A 3F5XA 3IDCA 4G5JA 5LCKA 5CEIA 2CGWA 4QMPA 5HVJA 1MQBA 4FVRA 2LAVA 4DTAA 5IH6A 2UZNA 3A7HA 3C4EA 4QTDA 5CQWA 3UYTA 1J1BA 4X2KA 3BELA 2QOHA 4IHPA 2WMQA 2PVJA 2BAKA 3JS2A 3R22A 4L42A 3EOCA 3ML1A 3GU5A 1FVRA 3FXWA 3PG3A 4PP9A 2XYUA 5EH0A 3IW8A 3COHA 2ZV9A 3F7WA 5HG9A 3RWQA 2HW7A 4S2ZA 4BVUA 2RFNA 4AXEA 2XIXA 2BAJA 4PL4A 2O3PA 4HGTA 4O27B 4BCHA 5L2SA 3EH9A 4L67A 2OBJA 2PY3A 3EYHA 3A4PA 5GIOE 5JFVA 3HP2A 4CCBA 3VS7A 2YWPA 5CNNA 2A19B 2F2UA 4C4EA 2VNWA 3PFQA 2R4BA 3EFWA 1P14A 4NJDA 3UVQA 4BFMA 4DE4A 4W4VA 5JFSA 3UIMA 2AEGA 4ERWA 4LL5A 3R1NA 1GAGA 2R3OA 4KBKA 1F3MC 2YIWA 3MH1A 4NSTA 3RZFA 1S9JA 3QLFA 4PWNA 4G3GA 4YC8A 4RIWB 4BKJA 4DGNA 3S1HA 2H9VA 3N4UA 3G0EA 4I21A 2AYPA 2C5VA 3TM0A 4RPVA 3W10A 5EQEA 2J90A 1W98A 3NR9A 3QQLA 2QOCA 3KXZA 4RJ5A 4M0YA 3UP7A 5CF4A 4GW8A 2CCIA 3B8RA 3G9NA 1OL2A 5TO8A 1U54A 4I0SA 2HAKA 5ANGA 4AGCA 3R9RA 5JK3A 1JSTA 3IPHA 4X3FA 2OH0E 3LXNA 4KIPA 5ETAA 2AUHA 4ANOA 5D11A 1ZZLA 4K1BA 3W0SA 4FMQA 1W82A 2NP8A 4X2NA 5LMKC 3NYVA 4O0TA 4ACCA 4BWPA 3F2NA 4CFVA 3PA4A 5C8KA 3MY0A 3PZHA 4PY1A 4EQCA 2HW6A 4QT1A 2IZTA 1GIHA 1JVPP 2VO0A 3H9RA 4FNWA 1KE9A 1KOAA 2IZSA 4QYGA 2IW9A 3HAMA 4F6SA 4FNZA 3ZO4A 1JOWB 3NVKI 4U80A 3CD3A 3OXZA 2A1AB 4XEYA 2XRWA 3OTVA 4E26A 5ANIA 1MP8A 5D1JA 4ARKA 2ZJWA 1A06A 3ORKA 3VS6A 5FGKA 4GG7A 3I4BA 2VTLA 2W7XA 4DG0E 5EKNA 5IPJA 4AW2A 3ALNA 3SDJA 4X21A 2X9FA 2FYSA 3O8UA 3FPQA 5M4CA 4HYHA 3IOKA 3I0QA 3E8EA 3RCJA 3CKWA 3AXWA 3Q4ZA 3E5AA 2GCDA 5L6PA 3JXWA 3KREA 5DRDA 4FSQA 3REPA 4ZLOA 4RVKA 3R8LA 1Y6AA 3E8DA 2UZBA 2UZUE 1OPJA 1RDQE 3QRTA 4CFNA 3D7ZA 5HO8A 3W2RA 3GCVA 3C4ZA 2ITQA 4ZTHA 4JRNA 3UYSA 3OY3A 3A62A 3P86A 3PTGA 5AUZA 5K9IA 3VNTA 1U5QA 3VUHA 5HBJA 3GCUA 4TY1A 5J5TA 4UMUA 1P4OA 4AF3A 3FMLA 2OGVA 1J1CA 5IA3A 2W1CA 3KKVA 4XV3A 3OWPA 2WOUA 2NNWB 4HYUA 3RAWA 1MQ4A 4MBLA 3ZYAA 4UN0C 2BDFA 5BMMA 3BCEA 4CNHA 1IAHA 4BJJA 3G0FA 5CT0A 4EK5A 5FEQA 4NFNA 5M56A 2ETKA 5AAEA 2YCFA 2IZRA 2R3FA 3QX2A 4FG8A 3IQ7A 1OVEA 3K5VA 3QZFA 1V0OA 1R1WA 3KMWA 4UXQA 2BDWA 4DFYA 4DITA 5EQPA 5HU9A 2OZAA 4YLJA 3FZRA 5CSVA 5KKRC 1R0PA 1I44A 3BE9A 1R0EA 2XVDA 4HVHA 1H1WA 4RSSA 4YU2A 4R7BA 5KNJA 2UW8A 1Q3WA 3NAXA 5F95A 3TJDA 3TYKA 2CLQA 2KTYA 5GJDA 4IZ5A 4FT5A 3PYYA 3H4JA 3NZ0A 3PDTA 4YJSA 1I09A 2WMTA 1OUYA 1GZKA 5HCZA 3QC4A 3TZ7A 2JIIA 3HMNA 4FIGA 4OR5A 3HMOA 3ZSIA 4EH4A 3AC5A 4KIKB 4EZ3A 1OL6A 3GOKA 2Z60A 4ALVA 2REIA 4C61A 1TKIA 4D4SA 2AC3A 3NAYA 4JQEA 4FIIA 3W2QA 4YTHA 4DH3A 1X8BA 5CT7A 4A9RA 5KX8A 2C69A 2EVAA 2WFYA 4ZMEA 1O6KA 3HUCA 3ORXA 2F9GA 1QPEA 2R3KA 1DS5A 5DE2A 4ZSLA 2VWIA 4RWLA 3QCXA 4I92A 2PZIA 4G6OA 1S9IA 3PWYA 4F65A 4F7LA 4QMQA 4J8MA 1R3CA 3OG7A 3D4QA 2EXCX 4QMWA 5BVWA 2X9EA 3LCOA 4AT4A 1UNLA 2HXQA 2CGXA 4WNPA 3CC6A 1M14A 3DK7A 3MY5A 1Q24A 2X6DA 4UMTA 3JVSA 4ZTMA 2PPQA 3SW4A 5A6NA 4Q9ZA 4YTIA 3DNEA 3TNPC 4PPAA 2FA2A 3LCSA 4CFMA 2R0UA 4BHZA 2WOTA 4D28A 1GZ8A 4IVAA 3C4XA 2W4OA 5I9UA 2IVSA 4UALA 4KNBA 4LQMA 4C59A 5EDRA 4YZNA 1OKZA 3VS2A 2OXDA 2R3MA 2W17A 5HVKA 3NFGB 4WHZA 1PXMA 4U79A 3FLWA 5EYKA 3FMJA 3EHAA 3T8OA 2B1PA 3TTJA 4AN2A 4BCJA 4CTBA 1GZNA 1PXIA 4OT5A 5IUHA 5BUIA 4YZBA 3VUKA 3MFTA 4IBMA 4M15A 4MAOA 2JKOA 4QPSA 2P4IA 3VJOA 2C5NA 3HAVA 4MUQA 3P7AA 2IZUA 4H58A 4RX9A 4RX5A 3I1AA 4L53A 3F7ZA 5DEYA 4D0WA 5L3AA 4D2VA 5HBHA 4FV4A 4DLIA 3SKCA 4EC9A 1Q8TA 1CM8A 5J7BA 3SXSA 5BVOA 2FGIA 2X39A 2PWLA 3KULA 4PMSA 1OMWA 1PXNA 2FSMX 2CCHA 4L46A 4O4BB 1PHKA 1B6CB 2C4GA 3QTRA 3RK7A 4BDHA 3GI3A 4BCKA 1A48A 4IX3A 5EM7A 4QP8A 4FF8A 2WAJA 5DWRA 4C2VA 3GC7A 4PP7A 4UV0A 3DKOA 4CRLA 3UE4A 4V0GA 4EH3A 1PYXA 5ANOA 4YLKA 4B4LA 5BNJA 1FGIA 3DB6A 3SV0A 3CPCA 3W8QA 4NU1A 1PXOA 3FAAA 4XYFA 4E1ZA 2HELA 3F2AA 3L9PA 4ZIMA 4A07A 3LFQA 4UB7A 4K18A 4QMLA 4YJNA 4PPBA 4X3FC 4DH5A 4I0TA 3LCKA 5M08A 3LXKA 2B4SB 4H3BA 3EL8A 2W1EA 3ZTXA 5CEPA 1QPJA 3HP5A 5CF6A 2GSFA 4BGHA 3KC3A 1FQ1B 4BCGA 2QURA 4XJ0A 5BYZA 2JC6A 3QZIA 4I94A 5HI2A 3TNQB 4BDDA 4NM0A 4C37A 2VO7A 2ITXA 1GIJA 3A99A 3DXNA 4IZ7A 2GQSA 2YZLA 1H00A 4BR3A 1YHVA 5EHOA 2I1MA 4H3QA 4U8ZA 5K0XA 4GU9A 4RBLA 4C58A 2YISA 3CEKA 4NIFA 5D7AA 3MSSA 3MV5A 3Q2MA 2QONA 2R3JA 5CI7A 4AU8A 4AQKA 2W5HA 3PSBA 2XNGA 4C4HA 1OL1A 4C0TA 4C4GA 3SOCA 3DXQA 3L8SA 2GNIA 3R9NA 4D2SA 1JKKA 2BTRA 3JY0A 4KIOA 4J53A 4EKLA 2JEDA 1SM2A 3LMGA 3FHIA 3ORLA 4JBQA 1BL7A 2OJIA 4O7WA 2JIVA 3KFAA 4DGLC 2DWBA 4B8MA 4CGAA 3R9DA 3TACA 2W1ZA 4DH7A 1M2RA 5IEYA 5EKOA 3W0QA 4PL5A 2YITA 5CTPA 4AZWA 5L4QA 2R3IA 4JR3A 3W2CA 3PA5A 4GRBA 4I20A 3CP9A 2XNBA 2ITYA 3GCPA 1URCA 2P55A 2Y4IC 2X0GA 3PXKA 1H25A 2WD1A 4HCUA 4L7SA 4ID7A 4RIXB 4KSPA 4E8AA 4I6HA 4FZ7A 4ZS0A 1J7UA 2WEVA 5TT7A 4MD9E 4QQCA 5E8SA 3HRCA 2XUUA 4NM5A 4LL0A 2Y0AA 3NUYA 3VBQA 2IW8A 3VHEA 1BYGA 3G6GA 2NO3A 3CTJA 3M42A 2X4FA 2Z2WA 2XARA 3ZDUA 5CAOA 4I6FA 1QPCA 2YIYA 3LM5A 3PIZA 2WMAA 4AFJA 3VW6A 3HMPA 2FB8A 4FEWA 3DBDA 3V01A 4ITJA 2CKQA 4FV7A 5DT3A 3DBQA 4LFIA 4IE9A 4AG8A 4XG3A 3FI4A 4OTGA 3ZEPA 5CAVA 4O86A 2Z7RA 4QP4A 2W4JA 3QAME 1YKRA 3MPMA 3UGCA 4C4JA 4GK2A 5CXHA 4V01A 4CZTA 2YA9A 3ZO1A 4EUUA 4E4NA 1BI8A 1NA7A 2H8HA 5CSHA 4OTDA 4A9UA 4EH5A 3V51A 5C01A 2C6MA 2W4KA 3NYXA 4FBXA 2QOIA 5HNBA 1P5EA 3WF8A 1APME 4NZWB 5BX0A 2RGPA 2KULA 3VBVA 2BRBA 3Q9WA 5CEOA 4RLLA 4GYIA 3R73A 4FZAB 3PPJA 5B0XA 4AXAA 2JBOA 3UJGA 3M2WA 4KA3A 1SZMA 4XRLA 3F3UA 2EWAA 4RVMA 3QUPA 3D5UA 4ZK5A 5DYJA 4DEHA 4M8TA 3E87A 4UWYA 5CU0A 2C1AA 3ZDIA 4BKYA 2QOOA 1O6YA 2WIHA 3P7BA 3W0NA 1Q5KA 4FSTA 2R3GA 3FUPA 2R0IA 3OBGA 4XS2A 5AA9A 5E7RA 1T45A 5FG8A 3ACJA 3MYGA 3PE1A 4CVAA 3HDNA 3EQDA 3FQHA 2B9FA 2BR1A 3PP0A 4NYEA 4BICA 1M2PA 4IIRA 2WMXA 3SHEA 3T9TA 4OUCA 2QD9A 4ACMA 4BGQA 3DY7A 2UVYA 4E6QA 3MH3A 4DLJA 4FV3A 3ID6C 3R9HA 4DFUA 4CT1A 2YFXA 3GCSA 4IFCA 4G6LA 1JSVA 3CTQA 3W16A 4PF4A 2PVYA 4ZXTA 1RJBA 4YHFA 5AR4A 5DMZA 4L44A 2HZIA 5K5NA 3COKA 1XMMA 2OLCA 2Y7JA 4DBXA 4XLVA 5AJQA 4FUYA 4YC3A 4FTLA 4EOIA 1K2PA 3OOGA 3WZJA 3FLQA 3AT2A 5ETIA 5HG5A 4D1ZA 1XH7A 3Q96A 4F6WA 5LWNA 2JIUA 4GS6A 5E91A 3QTWA 4XG2A 3VULA 4II5A 4YHTA 3T3VA 5KO1A 4K11A 4U7ZA 2PE2A 1PXPA 4TT7A 4HZSA 3UDSA 2YJSA 1G8SA 1H0WA 2W05A 3GEQA 4QMMA 3ZZEA 4LMUA 5I9YA 3NNUA 4YJTA 1OKYA 3KB7A 5LVMA 2XAOA 2C3LA 2VX1A 4GMYA 1PMEA 2VTSA 4ACHA 2GFSA 4ACGA 3CCNA 3R0TA 3ULIA 5L8JA 2W1IA 3SX9A 3IG7A 3VUMA 5K4IA 4AW0A 2UVXA 1OZ1A 2C3IB 2X2MA 3KF7A 4XLIA 1SNUA 2W1HA 2YIQA 3ODYX 2AC5A 4AAAA 2GNGA 4USDA 4ZLYA 5IQGA 2YLFA 1XJDA 5I0BA 2XM9A 3KVWA 4TWPA 3AC1A 3E93A 4ANSA 5C27A 2ZV7A 3ZHPC 3QTQA 3ATTA 4NTSA 3UQGA 5D7VA 4EQMA 5KMNA 4P2KA 5A4QA 3QD0A 4IEBA 3TN8A 4FTAA 3MY1A 2WTVA 3OCTA 4BCMA 4QD6A 3Q2JA 2YN8A 3RWPA 3NRMA 4M13A 4MD7E 1RE8A 2V22A 5D41A 4D9UA 5HNIX 4BZNA 3FPMA 4FOCA 4G34A 4UX9A 2HOGA 2VTIA 4FZFB 3E62A 1FGKA 3ZU7A 2XCHA 4RVTA 3SW7A 1Z5MA 3JYAA 3V8WA 1WAKA 4EOMA 1BMKA 3BGQA 5CLPA 4O7SA 3D5VA 1H08A 3A7FA 3QYZA 4I5PA 1BX6A 4EZ5A 2ZM4A 3ZC5A 2VV9A 4RFZA 3R21A 3FSKA 2CGUA 4I0RA 4AS0A 4JRVA 2WTWA 3ROYA 3PIXA 1WBSA 2CHLA 1ZYLA 5ETCA 3ZUTA 4NL0A 4FIHA 3D7TB 1Q99A 2IF8A 5IH4A 4G9RA 5DT0A 5F9EA 4OGRA 1XH5A 5CU3A 4D4VA 5IQHA 4ONAA 3S95A 3COIA 4E3CA 4D4RA 1MRVA 2PMIA 2XK4A 4JS8A 3F61A 3U6HA 2J2IB 4M84A 4AOTA 4X6RA 5AR3A 4R77A 4IB1A 3KCKA 3ZFYA 5CENA 3PPKA 5FTOA 5E1SA 5CI6A 5G1XA 3C13A 3RZBA 2GPHA 3RGFA 3HA8A 4M0ZA 4WIHA 2UZWE 3LFBA 3PXQA 3W55A 4ZY4A 4YNOA 3JVRA 3BGZA 3IO7A 1ZAOA 2DQ7X 3FZ1A 4F1OA 2BRGA 3PWDA 2RKUA 5L6OA 5M44A 4QEBA 4UZDA 4HVGA 3L9LA 4O81A 1ZYCA 4O6LA 3ZM9A 2F4JA 1YXTA 1U5RA 4R1YA 3FEGA 1ZYJA 2CKPA 2XIYA 1FVTA 2C6OA 3VS4A 5AP7A 3BYUA 4O4DA 4CLJA 2QQ7A 4BKZA 4FZDB 5ANKA 5AV4A 4CV8A 3KU2A 3UOHA 3KVXA 4PMTA 4IWDA 2J5EA 4I5CA 4A06A 2BDJA 4U42A 4GUEA 1PF8A 3I81A 3QHRA 4L3JA 4MQ1A 3VRYA 4ZLZA 5EDQA 5EI6A 3W18A 1XHAA 1F5QA 2F7EE 3HX4A 3NUXA 1W2CA 4GJ2A 4I22A 4EHEA 3I7BA 4RJ3A 4OBOA 3DTWA 1DM2A 3QTIA 5K4JA 4G3CA 3V6SA 1JKTA 1QMZA 4UYNA 4DC2A 1UKIA 4MNFA 1ZLTA 2Z7QA 2UZTA 3LFDA 4AOIA 5T3QA 3BEAA 4C02A 5DOSA 3I5ZA 2C6TA 4FSWA 4A4XA 5IMEA 4IACA 2ERZE 3NCGA 3QGYA 4C3PA 3E7OA 3FYJX 4RX8A 4YJQA 5HBEA 4X2GA 4G2FA 4XV2A 3V5TA 3POZA 2RFDA 2F7ZE 5KE0A 2XKFA 2XJ2A 5A4CA 1Q62A 1NVSA 1OL7A 2JKKA 3QQUA 4HNIA 2XH5A 4QRCA 5JFXA 1W83A 3OW4A 5DPVA 5J87A 3HEGA 4ZJIA 4AW1A 1XKKA 5KBRA 3TG1A 5AFVA 3PA3A 3QXOA 5D9HA 4B8LA 3MDYA 3C4CA 3V5PA 5AR5A 1SVEA 3ANRA 2WTKB 4MF1A 2UW7A 4EHVA 5BQ0A 3N4TA 4AXFA 5KUPA 1PRYA 1XH8A 2B9IA 4FSNA 4BBEA 5HQ0A 3S0OA 4QNAA 3QWKA 3ZLYA 2RSVA 4CXAA 3H10A 4FTOA 3RBWA 2PZ5A 3W32A 4TYHA 5CX9A 4I4FA 5E8VA 2V0DA 1L8TA 2PZPA 5BVDA 4APCA 4CFUA 3G5DA 3LFNA 1GOLA 5A6OA 2BAQA 3A7IA 4QMZA 4QTCA 2GFCA 5B2MA 4FG7A 4JBOA 4MBJA 3KF4A 1Y91A 2VWYA 5C4LA 4IC7A 4WKQA 5AV1A 3NFFB 2FSOX 4AAYA 2XB7A 1R39A 4WBOA 4DA5A 2QOBA 4FKVA 2PMOX 3RM6A 4K6ZA 5JN2A 2XKCA 3UOJA 2B0QA 5JQ5A 2ZDUA 2XCKA 1ZRZA 3L8XA 1WCCA 4FKWA 2X4ZA 3FY0A 3DBFA 3KRRA 4N70A 3O8PA 4R1VA 2R3RA 3QC9A 3DZOA 4IJPA 2HWOA 3A2CA 3CY2A 3KL8A 4KABA 4DFNA 5CSPA 3AD6A 2FSTX 2QLQA 3QWJA 4S34A 3EQGA 3HRFA 4IAYA 4BIEA 3OUKA 1DAWA 3LPBA 5E8XA 3D94A 1HCLA 3VS5A 3FI2A 2ITWA 4EBWA 3DQWA 3UDBA 5DLSA 1TQIA 1WMKA 3DJ5A 3PLSA 3PPZA 4Y8DA 4EOKA 3KMMA 3LLTA 3LIJA 4HVIA 4RA4A 1H01A 4MEDA 2QODA 2ONLA 1LR4A 2QHMA 4R7HA 1B39A 3BBWA 3HV7A 3PJCA 3B8QA 5DEWA 4CG8A 4BCIA 2A4LA 3ZLSA 4IVDA 1OKWA 4JQ7A 3LW0A 3R1QA 4FEXA 3OROA 4CKRA 4I24A 1Y8GA 1KOBA 3AT4A 5AP2A 1GY3A 3BX5A 3VRZA 4WSQA 1IAJA 3W2PA 2XANA 5J1VA 1GNGA 4IC8A 3BBTB 3JUHA 5EOLA 4IB3A 3TV6A 3ZS5A 4ALUA 3O17A 3O7LB 1M7QA 3EQIA 2F57A 4PTGA 4ANMA 3GC8A 5E8WA 3DZQA 4FTKA 1ZMWA 2OW3A 5CEKA 4AT3A 3N51A 3ALOA 5M55A 3IW7A 2X2KA 1WBWA 4ZSAA 3U6JA 4NCTA 2I7QA 2XM8A 4F7NA 3FXXA 4YURA 4OAUC 3LAUA 2HY81 4DG2E 2GHLA 1GZOA 4JDKA 5HE0A 4UMRA 2VWVA 3LVPA 4ALWA 2VTHA 4NKSA 4AZFA 4OTQA 2O64A 4DFBA 1E9HA 4FX3A 3R9OA 2JDOA 3LJ0A 4AUAA 4RIYB 2PVMA 3A8XA 5E8ZA 3FE3A 4M3QA 1YDTE 3HDMA 3TZ9A 4GK4A 4K2RA 2IVVA 4FIJA 2I0VA 3MESA 3UVPA 4FT9A 4HVDA 3TWJA 4BCPA 3I5NA 3RPRA 4FYNA 4GG5A 5EDPA 5C9CA 5HIBA 4P90A 4V05A 5E8UA 3BHHA 3AGMA 4G17A 5ETFA 4QQ5A 3D9VA 3OD6X 1IA8A 2G2FA 3FXZA 4UWBA 2O8YA 4R3CA 2C1BA 4QP3A 5EW9A 3FZTA 4JX7A 4O4EA 5AUXA 3TI1A 3MIAA 4IAFA 4EOLA 4D58A 5JH6A 2OFUA 2YJRA 2UZDA 4XHKB 3F5PA 1PKGA 3FZOA 3LFAA 4BI2A 3UVRA 5L2IA 3UNKA 3TDWA 1FMKA 2E9VA 4K33A 3QL8A 4M12A 3ENHA 4I6QA 4G1WA 2V7AA 2ZB0A 4XMOA 4YTCA 3CSVA 3LQ3A 2BMCA 3L1SA 2JAVA 5IF1A 1BL6A 2X6EA 3ERKA 1H0VA 3F66A 4MD8E 5DVRA 4TRLA 1ST4A 3P78A 2PYWA 4H39A 2BTSA 2YEXA 2QR8A 3PRFA 2OF2A 3GQLA 4U43A 5HEZA 3ZC6A 2FVDA 4U41A 3O71A 3QQKA 2WMUA 3U87A 4O7VA 2G1TA 2X7OA 2B53A 5I4NA 2I6LA 4JLCA 2ZV2A 1G8KA 3Q6UA 4FEQA 1JKLA 1H27A 3PY1A 3LXPA 3DAEA 3R8ZA 4BTMA 5JQ8A 1UNGA 4BDEA 5M53A 1XBCA 1XO2B 4XUFA 2CSNA 3OUNB 1IEPA 3PXYA 1JKSA 5IUGA