4O27B

Crystal structure of mst3-mo25 complex with wif motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
281
structure length
281
Chain Sequence
MADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNEFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords Calcium-binding protein 39
publication title Structural insights into regulatory mechanisms of MO25-mediated kinase activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 281
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o27B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o27B01
2X81A 2E9PA 2X0GA 3RNIA 5L6PA 3HMOA 3EFKA 3W2CA 3M2WA 1FMKA 4FT3A 4KIOA 2VWXA 4CCUA 3UPZA 4QMQA 2OJ9A 5CNOA 3G9NA 4FTRA 4AU8A 5IH5A 3MFSA 1IAHA 4BR3A 2PVJA 2WTIA 3RPSA 3QCYA 3TTIA 4K11A 2B1PA 3LXPA 5HX6A 3E64A 1P4FA 4HOKA 2UW8A 2W5HA 4PX6A 3DGKA 1R1WA 2VO0A 3PY3A 4G3FA 4JT3A 4JL9A 3MN3A 3RI1A 4DTKA 5BQ0A 4CKRA 3WE4A 3TZ7A 2REIA 2XIYA 4XG8A 1RJBA 5LJJA 4FUYA 3Q5IA 4U80A 3BCEA 2XK4A 3R7VA 2H9VA 1J91A 2A1AB 4YUQA 2CDZA 3WF6A 4GT5A 4AW5A 4E4NA 5D12A 2ITXA 5IMEA 5HCZA 3KRWA 2WTCA 2VWIA 4QTEA 3D15A 3ZM9A 3THBA 2HXQA 2C6KA 5IDPA 4MWHA 4R78A 1GAGA 3VBYA 4DEGA 4M0ZA 1NVSA 3QTWA 3TKIA 3HVCA 1ZOGA 2JIVA 3EQCA 2Z8CA 4UZDA 4YJSA 2BTSA 5AP6A 4R7HA 5LVLA 4ZJVA 4ALUA 1TQMA 3B8QA 4U8ZA 4CZUA 5I5ZA 3TL8A 3DJ6A 4D5HA 3FZSA 3PSCA 2VWWA 1OKYA 3KN5A 3R9NA 2JKQA 2QOKA 2FGIA 4CMUA 1Q8UA 4PP9A 2HXLA 5B2LA 3IDPA 3DK7A 3MIYA 4OT6A 4O7YA 1JSUA 3O0GA 1IASA 1V0BA 2XB7A 4YHFA 5I9VA 4CYJA 4YTFA 3I1AA 3E8EA 3IW4A 3MTLA 4QNYA 3ACKA 4CVAA 3D2IA 3EFWA 3NYXA 4DFYA 5EKNA 2RFEA 2YAAA 2OXXA 5A4LA 4G9RA 5I9WA 4L8MA 3RINA 3PIZA 3Q9WA 4FSQA 4HCUA 1PXPA 4JXFA 4X2KA 4YP8A 4BI2A 1LEWA 3AC4A 3VUDA 1FGIA 5EM6A 1H00A 5LCJA 1SVGA 5LMKC 2HCKA 3B8RA 1GZKA 3HKOA 4FL2A 5TE0A 3SC1A 3KXXA 2OH0E 4G3GA 4ZIMA 4MVFA 4BDEA 2ITPA 3UOKA 4G31A 1PF8A 5F20A 3DA6A 4KAOA 3RZBA 2PU8A 3F6XA 4K6ZA 3BQCA 1PXIA 2WFYA 3F3VA 2C4GA 3R0TA 1YOJA 2WKMA 3VS0A 5A54A 2VTLA 3BIZA 2LAVA 3IG7A 5FDPA 4IWDA 1WZYA 4TYHB 4DEEA 3PE2A 5HIBA 1YOMA 5HCYA 3L1SA 2W9ZB 2WEIA 5KZ0A 4WOVA 2VTOA 2ZM3A 5AAFA 4L46A 2AC3A 4XP2A 4ZY4A 1UNLA 5AP3A 5HNGA 5IQAA 4I93A 4D2PA 3F5GA 1H1PA 3PVUA 5EOBA 3W2OA 3EL7A 5J1VA 3OXZA 1BL6A 4O0VA 2XVDA 5E7RA 5HI2A 1NVQA 4TTHB 2R3HA 4TNDA 4BDFA 2CN8A 5AP4A 3FKNA 1XBBA 2CHLA 2UZUE 2GTNA 2Y6MA 4XRJA 3VHEA 2E9OA 2O8YA 4DBXA 5HO6A 5TT7A 2NRYA 4ORKA 3UP2A 2VX1A 3ANRA 4C4HA 5DA3A 5M09A 1MP8A 4X7QA 3V6SA 3ZRMA 2B54A 4FSNA 3C4ZA 4NKSA 4YO6A 3UZPA 5J7HA 5AIRA 1UNGA 3VS5A 2W1HA 4GW8A 3QWJA 3PIYA 1KE6A 2XEYA 4G5PA 4X0MA 3IKAA 4S34A 3PRFA 4ZSLA 1FQ1B 2HW7A 2PMIA 4O38A 3QQJA 3EWHA 4DBNA 4TY1A 3OTVA 4AOIA 3P1AA 2ZOQA 3QQKA 4I92A 3I6WA 4KB8A 5A6OA 3MV5A 3PXKA 3U4WA 2QLQA 4FV9A 3MJ2A 4Q9SA 4RIWA 2QHMA 3TTJA 4B4LA 3TEIA 4EOPA 4L00A 4YLKA 5JEBA 3QHRA 2ITUA 3A8XA 4Q2AA 5AR4A 4FTCA 3SA0A 4FX3A 3TZ8A 3QUPA 3ROYA 5KMMA 3SKCA 3QX4A 4V05A 4CV9A 4K18A 4EZ7A 4WD5A 4QQCA 3LCSA 1PMVA 4XV9A 2CCIA 1XJDA 3EIDA 4FKIA 3ODYX 4FVQA 1WBWA 4BRXA 4D1XA 2V5QA 4DH1A 4YJPA 4NL0A 1H01A 1W83A 2XIZA 4XCUA 2CPKE 5EYDA 4AW0A 3HAVA 4IADA 4RIXB 5J8IA 1I09A 4GMYA 2ZAZA 1OECA 4BCNA 3CTJA 2WTJA 1Q99A 5AMNA 4AT5A 4PNIA 4FEWA 4LOOA 4X6QC 4K1BA 4IXPA 4FSYA 1JVPP 3C0GA 2Y4PA 4NTTA 1TKIA 4OW8A 5C03A 5AAEA 3BGPA 4GUBA 5CXHA 2CGUA 4F9WA 3A2CA 4ITIA 2QR7A 2ZVAA 3VULA 2QQ7A 3CJGA 3VW6A 4HGTA 1OIUA 2PVHA 3CXWA 3QALE 3TM0A 4IQ6A 3LFSA 1KE7A 3PZHA 1Y6AA 4HYHA 4MYGA 4N6YA 1XH5A 4NEUA 3SW4A 2B53A 4UMRA 3QD4A 3PA3A 3HMMA 3QUDA 4ANQA 4LOQA 2W5BA 1UU3A 4ZSEA 2YCFA 3H10A 3OCBA 4FV3A 4NZWB 4LI5A 2HK5A 4XNEA 4BCMA 2B4SB 2IZSA 3C0IA 3U9NA 3ULIA 4WIHA 3PVGA 4IB0A 2VX3A 4V0GB 3SDJA 4YTCA 1PKGA 1OZ1A 4U79A 4CFXA 2GNJA 4AFEA 4C62A 3TIZA 3W8QA 3PYYA 3S2PA 5HTCA 4L7FA 4TPTA 1P2AA 1IG1A 4D1SA 4GFGA 5AV4A 5E4HA 3GOKA 1H24A 3ERKA 2XNPA 3NCGA 4UX9A 2WMTA 2H34A 2I6LA 5CT7A 3DPKA 4RWIA 2VWUA 4OTQA 5C26A 3BV3A 3AMBA 4ACDA 4R7BA 2CCHA 2G9XA 4ANMA 3CQWA 5IEVA 4L3JA 4DLJA 3QYZA 2WELA 4WT6A 3MY0A 4X2FA 1ZYSA 1ZRZA 1KOAA 3A7FA 3POOA 3RBWA 5BMSA 3JVRA 4AGCA 1IRKA 3BYOA 3EQHA 4WBBB 3AT2A 2DUVA 5F1ZA 4E20A 3ZUVA 4FVRA 4QYGA 4X6RA 4CXAA 2CMWA 3LKMA 4FSMA 4E73A 3A61A 3AD5A 2PUNA 3BI6A 2GQRA 5JT2A 1G3NA 4USDA 5EW3A 4XOYA 3KMMA 5KMKA 2R3QA 1KSWA 2R4BA 1OB3A 3R1YA 4YZMA 3V8TA 3U8WA 3NVKI 3FZRA 1PRYA 3T9IA 2YLEA 2C69A 3CLYA 4H3QA 2X9EA 3Q4UA 2BALA 4MBIA 4O86A 5IA2A 2XCHA 4CNHA 2PVRA 4GK2A 3LJ2A 4ANNA 3R02A 1F5QA 5B2MA 1OPLA 4RJ6A 3FI2A 2UVXA 3LM5A 5ANGA 4AW1A 4RZWA 5DT3A 2W1CA 4BICA 5HZNA 1WVXA 4HPUE 4EHZA 3E88A 2QG5A 4YR8A 5HBHA 3QRTA 3R7EA 2I0VA 3A7JA 4H3PA 4KS8A 3S4QA 3WOWA 3GCPA 1YDTE 3ZFYA 2VTRA 4RJ3A 4MWIA 2RKUA 2PMOX 4QMPA 5E91A 3DAJA 4APPA 3UQCA 2YDKA 3RZFA 2BZJA 3MDYA 4O0WA 2VGOA 4R3PA 4BDGA 5IH4A 3SHEA 2P0CA 3HRBA 2OGVA 2V7OA 4GEOA 4FE2A 5BX0A 3C4WA 1YXXA 4C61A 4CQGA 2Y9QA 2A27A 3PVWA 2X8EA 4XMOA 4YJNA 3TNWA 5EW9A 1QPCA 4ZJJA 1U4DA 3LMGA 4JQEA 1H1WA 3I60A 5GZ8A 2BRHA 4FNYA 4M69A 4ASDA 4ZMFA 4C3PA 5K4IA 3SXSA 3CBLA 3U51A 4JR7A 3F88A 5BVOA 2HENA 3FXZA 5M57A 4H39A 3QRJA 3LXNA 5EM8A 4KIQA 5CF5A 4ZLOA 5M56A 3LAUA 3R8LA 2R3JA 4ZTHA 1A06A 1KOBA 3T3VA 1JAMA 2JKOA 3DFCB 4LMNA 3DFAA 4D28A 3W33A 2WU7A 2Y0AA 4ZOGA 5BYLA 2GS7A 3PXFA 2HZIA 4L01A 4PL4A 4MXOA 3EOCA 2BDWA 4FZDB 2J7TA 2WMAA 3SW7A 2CKQA 2CGVA 4HVGA 4EH4A 2BR1A 3QLFA 3WI6A 3BGZA 3BE2A 2UZEA 3KXNA 4G6LA 4YNEA 4I5HA 4IACA 3UE4A 4FIGA 5FTGA 5HNBA 2YDJA 3JVSA 3OCGA 3QA0A 3D0EA 5ANIA 2ONLC 5LWNA 5B0XA 3R8ZA 4EQUA 1WBNA 3I0QA 2PZPA 3KEXA 2WMXA 4UMUA 4EQMA 1ZZLA 2GNFA 5GINE 4CG8A 2QONA 5JRSA 2HYYA 4F1TA 2IG7A 2CNVA 4QO9A 2UVYA 4HCVA 1DAWA 4OBPA 4E7WA 4EKKA 4RJ7A 2JAVA 3NX8A 5M06A 4DN5A 3F2RA 5DH3A 4FKSA 2PK9A 2JDRA 3DCVA 3HDNA 4E93A 3FV8A 4EH7A 2W4OA 4NTSA 3AT3A 4UALA 5IEXA 4KABA 5AAGA 2YHVA 3PTGA 3SAYA 2I0EA 1LEZA 3L8PA 3TKUA 4YTHA 1Q5KA 4GT4A 3VS3A 4IZ7A 5JH6A 3G6HA 1X8BA 2GU8A 3FI8A 2XRWA 3ZYAA 5D11A 2EB3A 1WAKA 2PZYA 3O71A 4FZAB 2FSTX 3UVQA 1YXTA 3QTRA 5AX3A 3UNZA 2WPAA 3DKCA 3GBZA 4GFMA 3ZXZA 3CC6A 5DG5A 3OOGA 3ZLXA 4C37A 5DWRA 1Q41A 4Y46A 4ZZMA 3F2AA 3MFTA 3NAXA 1BMKA 2Z2WA 4L45A 3ZO2A 4IHPA 1O6LA 3CGOA 5AR8A 3QRIA 1K3AA 2FB8A 1XBCA 2YIQA 3DAKA 3FWQA 3BE9A 3QGWA 4IFCA 5FRIA 3VWAA 3ZFXA 5AIKA 4ALVA 5J9LA 3DXPA 1V0PA 3PZEA 1XBAA 4FKJA 4A9SA 3D7ZA 4FOBA 4YC3A 5HEZA 2W1DA 4DG2E 5BNJA 4AWIA 5DNRA 1KWPA 2PHKA 2QURA 3TKHA 2QOQA 3SG8A 2ESMA 3C1XA 4D2RA 3QTXA 1FOTA 1R39A 3U9CA 4NUSA 4A06A 3F82A 3GOPA 1H1QA 4RA5A 2WQNA 3BPRA 3IW8A 2YIXA 1Y8YA 4E4MA 4J99A 5JKGA 3O7LB 1HOWA 5L8LA 3TNIA 1PHKA 5CF6A 3SG9A 3O8TA 4FC0A 2XNMA 3KXMA 4XYFA 1FVVA 4O6LA 4MNEA 4XRLA 3R7YA 3L8VA 3OBJA 1QMZA 3WZKA 3G6GA 4IJPA 3G15A 3MVJA 2ZYBA 4LV5A 5IPJA 3WZDA 4FEVA 1Y6BA 2FSOX 4UBAA 4GG7A 4EK3A 4D55A 3HV4A 3C51A 5DYJA 4XJ0A 3VS2A 4M12A 4X21A 4I3ZA 5CEIA 2PVLA 3KXGA 5CNNA 3VJNA 5JMSA 1M2QA 4TW9A 2X7OA 2J2IB 5AR5A 5DOSA 3LXKA 5EKOA 3COHA 4IAYA 4L68A 2QLUA 3CS9A 2R3RA 4AOTA 4AACA 4Q9ZA 3A7HA 4FEQA 3HECA 3NUPA 3TXOA 2GFCA 1JQHA 3CJFA 5M53A 2EB2A 3MH0A 3FKOA 2ZDTA 4L9IA 5CU3A 3DLZA 4BCOA 3C9WA 5AR7A 3R8UA 4FK3A 1CM8A 3O7LD 3A60A 5DLSA 4RVTA 4PDSA 4YC6A 4ZY5A 3V3VA 2Y8OA 3OZ6A 3CY2A 1XWSA 1UWHA 4DFZE 4EWHA 4CLJA 4NT4A 4UYAA 5BVNA 1ZYCA 4FSRA 4L6QA 1M7NA 2OJFE 4ACGA 4F6WA 3F3WA 5IKWA 5IQFA 5IQCA 2XIKA 2HY81 5HE3A 2XNNA 3DBFA 4Y5HA 2UW9A 2CNUA 3Q6WA 4O7WA 5IQIA 5CVFA 3T3UA 2ITOA 3N51A 3HMPA 3GCQA 3ZDIA 3SOAA 4FSWA 4E6DA 4W9WA 5AFVA 4E4LA 3ALNA 4G6NA 4XG3A 3UDBA 3EH9A 1NT2A 4O21A 4WO5A 4I4FA 4R8QA 3E5AA 2CGXA 5FWKK 3VQHA 2ITQA 2XIRA 4C8BA 4CEGA 5IISA 4WNPA 1ZLTA 4B8MA 1T45A 3DZOA 5AJQA 3CSVA 3QAME 2R2PA 1SZMA 2C47A 2P4IA 2OG8A 5B2KA 1HCKA 3RHXA 2H8HA 3FSKA 3RAKA 2CLXA 5EQYA 4BDCA 1PXOA 4FIIA 4W4WA 4EKLA 2XKCA 5JN2A 2IWIA 4O22A 3R83A 3JR1A 4OAUC 3OVVA 3S00A 3F9NA 3V8WA 2XM8A 4ENYA 2O0UA 4GIHA 4M68A 3RNYA 4RIWB 4FV0A 3MI9A 4OR5A 4CCBA 4PQNA 3QXPA 3EKKA 1PJKA 3HA6A 4AZFA 2XP2A 4X2JA 2CKOA 4E5WA 4N57A 3D14A 3NNVA 2CKPA 1JWHA 4BL1A 2ITNA 2VWVA 2XNEA 5HLWA 4XBRA 4K0YA 3P86A 5KMLA 5AP0A 4W4XA 3W18A 3EQPA 4MXYA 5AUXA 2X6DA 4BCPA 4U7ZA 4AGWA 5E9EA 3ZO4A 5HLPA 5L2IA 1VYWA 5LVMA 4DEDA 3CGFA 2XK6A 2YDIA 5J5SA 1MUOA 2XYUA 4C36A 3IDBA 3Q04A 3GCUA 2XKDA 2C6TA 1J1BA 2FO0A 2RG6A 3CD3A 3ROCA 4AXAA 4NIFA 3HP5A 3LMIA 3TJCA 3HYHA 4FKWA 3WZUA 1L8TA 3R1NA 4HW7A 3E3BX 4JRNA 3WF7A 3F5PA 3KXHA 4FL1A 3PJCA 2E9NA 5EM7A 5KBRA 4IW0A 2YM8A 4BBFA 4KUJA 4I6QA 1VJYA 1ZMVA 3FC2A 4XV2A 3EN6A 4QMUA 2Y4IB 4KKHA 2VTJA 5E8YA 3IW6A 4BWPA 1W84A 2XMYA 4USEA 4I6HA 4APCA 1ZWSA 3UG1A 2XNBA 2JIIA 3KRJA 4MKCA 5CALA 4IIRA 3FMDA 3P79A 2XEZA 5AV0A 5KKRB 3FMHA 3BGQA 3S0OA 3KVWA 4ZS0A 3VUMA 3UMXA 4O0TA 3BU5A 1WBVA 3ORTA 2C6DA 3UODA 4LGHA 3FL4A 3D7TA 4ZLYA 4I6FA 5HKMA 3MH1A 3DJ7A 3EFLA 5CAOA 3BZ3A 2R3OA 1JLUE 4ITJA 4R5SA 5H8BA 3FC1X 4IAAA 4XLVA 4O81A 3Q52A 4N70A 2YERA 1QPEA 3AGLA 3FQEA 5KKRC 4BC6A 2PUIA 4C58A 4DGOA 5M44A 3BELA 4YJUA 4KA3A 4EOMA 4ZTRA 4PV0A 4D0WA 4IWQA 4BKZA 3RK7A 3UOLA 2BRMA 2R3PA 3KRXA 3QUEA 3TZ9A 4ZSAA 2WXVA 4G6OA 3NUNA 2CSNA 3C0HA 2PVYA 4BCGA 3MIAA 3HEGA 4EZ5A 4V01A 3UIMA 2HAKA 3OXIA 2DYLA 4WRGA 5ANEA 4QMYA 2GQSA 5KMJA 5CAPA 4C4FA 3PJ2A 1PKDA 4JS8A 4FTOA 1OL1A 4QMWA 5E8XA 5E8WA 3TT0A 4F64A 3R73A 4TNBA 5A4EA 1E1VA 3LE6A 4XX9A 3WF5A 1Q62A 3UC3A 3R28A 2W1ZA 2VU3A 3HUBA 1UU7A 3IDCA 4J95A 3MS9A 4RZVA 3UPXA 1OKWA 1U46A 4NSTA 1OL6A 2GHGA 3ENMA 2EWAA 3QQGA 3HP2A 2LGCA 3W2SA 4FKGA 3R71A 4AA0A 3GGFA 4UEUA 1REKA 5DR2A 4F9CA 2C3KA 4CYIA 5IA5A 4UV0A 5E1EA 5FM2A 2O5KA 1V0OA 2R7BA 2G1TA 4ERWA 3WIGA 4EOLA 4YJQA 3ZBFA 3VF9A 5AUWA 5CF8A 4BVUA 3H9FA 1YDRE 4QP1A 3KKVA 4AE9A 3P5KA 5BVFA 3PA5A 4M97A 3UYSA 2J5EA 5ACKA 1REJA 4PDYA 3MB6A 3BYUA 4YPDA 3ZLYA 3VBWA 2WTWA 4J71A 4E8AA 1XH7A 1ATPE 2IVTA 4IE9A 4P5QA 1FVTA 2QODA 3W2PA 4CV8A 3VHKA 1H1SA 1OVEA 3KMUA 3PXYA 3EHAA 3LCDA 5CTPA 4LUEA 4UZHA 5J5TA 3COKA 4D4VA 1NA7A 5CZIA 4R3CA 3Q4ZA 2VTNA 1Q4LA 4C3FA 5K5XA 3EKNA 5ACBC 1M2RA 2YEXA 3COIA 4D2WA 4ZMEA 3RWQA 4Y95A 4O0SA 3OC1A 2R3FA 4EH6A 5D7AA 5DEWA 5H2UA 3VS7A 4F6UA 3NNXA 5EI8A 4YU2A 3MPTA 4J8NA 2WAJA 3HRCA 1OL5A 5G6VA 2I1MA 1SMHA 3KULA 2OO8X 5T3QA 4FI1A 3S95A 3MJ1A 4EHGA 2PZIA 4HYUA 4KS7A 5CVHA 3QZHA 4NM3A 4XBUA 1BX6A 5HHWA 3TV6A 3QKMA 5T6KA 2E9VA 5L2SA 5JGDA 3ACJA 4Z55A 2IN6A 2W4JA 3ITZA 4IVDA 3RK9A 5I9ZA 4G3EA 2XKEA 4C4IA 2C5YA 1QCFA 1XO2B 1BUHA 3DDQA 5DT4A 2C0IA 4FT9A 3GP0A 2OZOA 2YFXA 3G2FA 3MY5A 3QU0A 3R63A 5D9HA 1XHAA 4NYEA 4YHTA 3IK3A 1YI3A 2XIXA 2YCQA 3GCSA 2J0JA 4EZ3A 5AX9A 3E92A 4DGGA 1MRVA 5KCVA 4PWNA 1H1RA 1H0VA 4FKUA 5LWMA 3CD8A 1PW2A 2UZDA 3P7AA 4G9CA 1EH4A 4TN6A 4AOJA 4C4EA 1GIIA 3A4OX 3FQHA 5HICA 1R3CA 2HY0A 3TZMA 2E2BA 4HVDA 3SVVA 3LFEA 3DZQA 4FEUA 2X6EA 2PYWA 3AC8A 3R7OA 1UKIA 2ITYA 2WMVA 4HCTA 4NJ3A 3O8UA 3ALOA 3ANQA 4FKVA 5AWMA 1OIYA 1ZOEA 3U54A 5BUIA 3EQFA 3MWUA 4J96A 1XKKA 3MB7A 2ZM1A 4TWPA 3KF4A 2PMLX 3D5XA 5GJDA 5TR6A 2BRBA 3D5WA 2ITVA 3P08A 3C4EA 3R22A 2JKKA 4JG7A 2JKMA 5C27A 3KQ7A 3LOKA 2P3GX 3IW5A 4WBOA 3RCJA 1RQQA 3GFEA 3G51A 3POZA 4RVKA 4HYSA 4IDVA 5ETAA 3KMWA 4MCVA 4U0IA 4O84A 4WRSA 1ZAOA 3BHUA 3NMUF 4IVCA 2QKRA 5I9XA 3D5UA 2IW8A 3KCKA 3RK5A 2YA9A 4ZTMA 3LFBA 4F4PA 3OROA 5A3XA 3R21A 4A9YA 2QO9A 2W1GA 2EU9A 2V22A 4YURA 1IR3A 3R9RA 3Q3BA 3K2LA 3PPZA 3Q2MA 4BCJA 4XLIA 5IZFA 1WBOA 2O63A 4OTHA 2Z7RA 1UVRA 3PXRA 3V5WA 4GRBA 1PYEA 4FTQA 3SXRA 4DITA 4DTAA 3WYXA 2C3IB 3FLZA 2VO7A 4W4VA 5IA4A 3Q6UA 1B38A 2JDOA 5DT0A 3UTOA 4DTBA 2DQ7X 2G15A 4GL9A 3QC9A 2PZRA 3CP9A 3NWWA 4QP4A 2W17A 1ERKA 2X8IA 4LQMA 4U43A 4AZEA 5AUYA 3U6HA 4DFXE 2Z60A 4QTAA 2PE0A 4X3FA 3UOJA 4LOPA 4FTMA 4ZAUA 3OTUA 4KRCA 3LVPA 1W98A 4IZ5A 3B2TA 3KU2A 5DR6A 1YKRA 4LG4A 2WMRA 1PXMA 3NZ0A 1Q3DA 1L3RE 2OJIA 3GI3A 4GU9A 5A4CA 4A4OA 3DNEA 3R9DA 1DM2A 3C5UA 3WIKA 4GKIA 3KREA 4MH7A 3OW3A 1OBDA 3F7WA 2AUHA 4D9UA 4PDPA 4X2NA 5CEQA 5HBJA 4G5JA 3DXQA 1URWA 4CFNA 4WNKA 5CSPA 1G5SA 3BBTB 4AT4A 5CQWA 5FXQA 3FZPA 1WVWA 5HTBA 3TIYA 3ZSGA 3ORNA 4AS0A 3ORIA 2GHLA 4RA4A 5EM5A 4QTCA 3GU7A 4D1ZA 3H9OA 4XG9A 4XP0A 3Q2JA 5CX9A 3OD6X 5KE0A 2VTTA 4MXCA 1GZNA 3RTPA 4BHNA 4ZTLA 4D4RA 1U54A 5CZHA 3ET7A 3IPHA 1CMKE 4EOKA 2YAKA 4BTMA 3IO7A 5TOZA 1STCE 3RGFA 5K0XA 5ANKA 4DH7A 4JX7A 2WTDA 3AD6A 3EN4A 4FUXA 4DCAA 1Q8YA 1YQJA 3AQVA 3FLSA 3QTUA 5HOAA 5IQDA 1OKVA 4P5ZA 5DI1A 3NNUA 3QTQA 4J1RA 3UQGA 4O1OA 3AGMA 5EI6A 4GYGA 3UZTA 4B6LA 2I0YA 5HG9A 1ND4A 1WBTA 4E5BA 4EH8A 4A9RA 4FSZA 2XRUA 2QNJA 2VN9A 3SQQA 3ZLSA 4QYEA 4AW2A 3FJQE 3EN7A 4EOJA 4HVSA 3LLAA 4EYJA 3QKKA 4BGQA 3PLSA 1PMUA 1NY3A 3PXQA 1JSTA 3AC2A 1H27A 3H3CA 2GNHA 2C1BA 1AGWA 2J0IA 3PA4A 3PPKA 2QOFA 4U9AA 5FXSA 2JFMA 5HGIA 3FY0A 5IQGA 2BRNA 4OTGA 4QMNA 3Q9XA 4FNWA 3EQBA 2YZLA 1DI9A 2UZWE 3KY2A 4RVMA 4D0XA 4Z9LA 1FVRA 1OKZA 3E93A 3IW7A 4DG3E 2J9MA 4FKLA 3QZGA 2YISA 5IH6A 3D2KA 4I20A 4NW5A 4MXZA 4IC8A 3IQ7A 3FPMA 3RP9A 3L8XA 3OEFX 3C50A 4D2SA 3VBXA 3VW8A 4OTWA 4MEDA 1ZOHA 4OTRA 4F7JA 3S1HA 4UN0C 2ETMA 1SYKA 4CMTA 5CSWA 5C01A 1GIHA 3GUBA 4DINA 4NIFB 5CAVA 3I5NA 2OWBA 1DS5A 2PY3A 3V51A 2B52A 4JAIA 4TL0A 5HU3A 5HQ0A 4C7TA 3NUSA 2Z02A 3K5VA 4E1ZA 5J7BA 3V5TA 4FV6A 4IZYA 4X2GA 2PPQA 2CN5A 3NAYA 1OM1A 2CLQA 4LUDA 4NCTC 3AOXA 3DU8A 3HMIA 2FYSA 3I5ZA 2ITZA 2Z7QA 1K9AA 1U59A 3GB2A 4ZZOA 4RBLA 2P2HA 4P4CA 3L9PA 3LQ5A 4EBVA 2BKKA 1YHSA 4J98A 4U45A 2QC6A 2UV2A 5A14A 1MQBA 4FGRA 4P90A 3JXWA 4U44A 3MESA 4BY9E 2HZ4A 2PUUA 3QD3A 5ICPA 2R3NA 3P78A 4KINA 4GS6A 5C8KA 5AUTA 4LL5A 4EOSA 4YBJA 2W0JA 4E6QA 1BI8A 4ZTNA 4EOOA 4BCFA 3ATSA 1ZMWA 5AA8A 4R3RA 3D7TB 4XG4A 3TG1A 4JDIA 1NVRA 5KMOA 4DH3A 5AV1A 4BIDA 3VS1A 4UMQA 4MF0A 3RAWA 5JK3A 3QC4A 3RALA 4J97A 5DN3A 5JZJA 5K5NA 4CKIA 4Z7GA 2Y6OA 1GOLA 2B9JA 4I1ZA 4L42A 3FMLA 2C3LA 2IVVA 4NM7A 3PJ3A 4R77A 2X4ZA 5I9UA 3UIXA 3KF7A 4QYHA 5CU6A 2UZOA 3NVMB 4KKEA 5M08A 3ZXTA 3S3IA 2C6OA 4GJ3A 2OI4X 1WMKA 2UW7A 2HWOA 4PMMA 2PVMA 4R5YA 3O2MA 3Q4TA 4QQTA 2ZM4A 4JG8A 1R0PA 4WG3A 3F5XA 5C4KA 3PUPA 4BGHA 4GSBA 3H4JA 4K9YA 5CXZA 3I81A 2WGJA 5CI7A 4UYNA 1QL6A 3KK8A 1VEBA 4YJRA 5EOLA 4FKRA 1JNKA 3QQUA 4I5PA 4BYJA 5A46A 3C4XA 3HL7A 4D2VA 3G90X 4B99A 3HZTA 4ZK5A 4GK4A 3ZONA 3QD2B 4JQ8A 3V6RA 3DT1A 2ZJWA 5JZNA 5EQEA 2SRCA 3BHTA 4A4LA 2O3PA 3NW7A 1CDKA 3Q53A 2EVAA 3E8NA 3OFMA 4TYGA 2RFDA 4MD9E 4U3YA 2I0HA 5JQ5A 2VRXA 3TDVA 3GCVA 5L6OA 5GIOE 2PVFA 3R00A 4PP7A 2C0OA 4G2FA 5B7VA 3WE8A 1H08A 3EN9A 4FVPA 4EHEA 3GU6A 2R7IA 2BZIB 4TKSA 2F7ZE 4U97A 4IX3A 4BCKA 2YM5A 4BGGA 4XP3A 2G2HA 4DGLC 4CG9A 4ZSJA 3MFRA 3MW1A 3WF9A 4AZSA 3CTHA 4RWLA 2GSFA 2UVZA 2FSLX 4FOCA 4FNZA 4H1JA 3W2RA 4BDAA 5E8VA 1F0QA 3VVHA 4RX9A 3ORPA 4RIYA 4IX4A 3NIZA 2GNIA 4I4EA 3ZS5A 2FSMX 3RM6A 4ENXA 1PXJA 4MQ2A 4JDHA 4BTKA 1PXLA 3NYNA 4MBLA 3QX2A 4A9UA 2NNWB 4C38A 5C1QB 5HVKA 3CR0A 4JDJA 2VTIA 5EHYA 2YCRA 4U5JA 1A9UA 1YDSE 3ULZA 1JOWB 1R0EA 3R1SA 4I94A 4ZS4A 4B8LA 3RPYA 2XK7A 3R6XA 4IFGA 4OAVB 1TQIA 4BI0A 4GCJA 4CFMA 4JLCA 1IA9A 2JD5A 2ZB1A 3GC8A 3PRIA 4ONAA 5L4QA 2VV9A 5FGKA 3R8VA 5L3AA 4FZFB 4F1OA 1OBGA 2J90A 3R7UA 5IQBA 3ZTXA 4HZRA 4TWCA 2QOHA 2R3KA 3DY7A 2RGPA 4FL3A 4ZP5A 3COMA 3BV2A 4OUCA 5M55A 2WQBA 5HORA 4D2TA 1RE8A 3KULB 4GG5A 5CS6A 3LFDA 3C5IA 2Q0NA 2F2CB 2ITWA 5HESA 4BF2A 4FZ7A 5HD7A 3G0EA 3SLSA 3ZM4A 4EBWA 2RSVA 4QPSA 3CPBA 3C13A 5J9ZA 2GNGA 4DF3A 4WSYA 3FKLA 5KHWA 5LVOA 4H36A 3OY1A 2UZBA 3PFQA 5ETFA 2OKRA 2C0TA 4IH8A 2QOCA 3DDPA 3TNHA 1YXUA 2R3IA 4M0YA 4IZAA 1YWVA 3FLWA 5LVPA 4BIBA 3FI4A 4RX8A 5CU2A 1KE8A 3DBDA 1W82A 3QQFA 4GUEA 4IX5A 5AP1A 5K0KA 2C68A 2OICA 2PL0A 2VX0A 2OH4A 2UW4A 5H8GA 4O7LA 2W99B 5HBEA 2R9SA 4RC2A 2B9FA 2UW3A 3EQGA 4KD1A 2B9HA 2A4LA 5EYCA 3DBQA 5G1XA 3UVRA 1H0WA 1MRYA 1J7LA 2HOGA 4FBXA 2QG7A 2B7AA 1Q8ZA 3A62A 4Y72A 3ZH8A 4PMTA 4UB7A 2KULA 2X2KA 5M07A 4I5CA 2W05A 3T9TA 4WNMA 2WMQA 3KK9A 4UWCA 3UMWA 5IA0A 4KRDA 5A9UA 4DG0E 1YOLA 5HG8A 3Q9YA 3LMHA 3OW4A 1M17A 3PWYA 1AQ1A 3FMJA 2QR8A 2BZHB 5AR2A 4QNAA 2VAGA 3NUAA 4E4XA 2QU6A 4PTCA 2VTAA 4C2WA 2UZVA 4C02A 2P55A 4QMSA 2AYPA 2IZRA 3V5JA 3CKWA 5FD2A 3WYYA 3P4KA 4NWMA 4YO4A 1ZYDA 1HCLA 3ORZA 4FIFA 4QD6A 4TRLA 3M11A 1H28A 3FZTA 5AP2A 4JNWA 3ZCLA 2GNLA 4PUZA 5JFWA 3FEGA 1BI7A 5FQDC 4CSVA 4RRVA 5K9IA 1T46A 3VBQA 2OF4A 3EMGA 3H30A 3BU3A 3G0FA 2WOTA 3IONA 4FIHA 5CU4A 3W1FA 5I9YA 3U6JA 2IVSA 4BCHA 5CYIA 4XOZA 3N4UA 3L9MA 4EH9A 3FL5A 3D4QA 4CMOA 4F9AA 5IMXA 2UW0A 2WD1A 1Q97A 1WBPA 3HV6A 5I0BA 3JY0A 5LQFA 4KIPA 4PL3A 4PRJA 4Y8DA 2J0LA 2BDFA 4AE6A 1H8FA 4AQCA 2IW6A 4AZWA 2HWPA 4DFLA 2QOOA 3ZUTA 4MX9A 1Z57A 1ZYLA 5FLFA 5LOHA 1LP4A 3G33A 4G3CA 4WNOA 2RG5A 5HVJA 4YTIA 2OXYA 1GZOA 5LVNA 1APME 4FSTA 1ZXEA 4QMMA 3RPOA 4IAIA 2VTQA 3NGAA 4O2PA 3DV3A 1PXNA 2YJSA 4JBOA 4IDTA 3OEZA 2W4KA 4E3CA 3ORMA 4PNKA 5JFSA 4JR3A 3NYOA 2YM4A 2XZSA 3QCSA 3R8PA 3UO5A 3BYVA 1JPAA 4FMQA 3RHKA 1YWRA 3TCPA 5FTQA 3DK3A 4QMXA 2R3MA 2XCKA 1H25A 2OIBA 3PDTA 4FKQA 4X3FC 3AG9A 3SD0A 1CKJA 3HLLA 5FUTA 3O50A 4NCTA 3SRVA 4RVLA 2OFVA 1OPKA 3ZHPC 5EYMA 5DRDA 3GFWA 2JDTA 1YRPA 2ZV8A 3TNQB 4HNFA 3PXZA 4TZRA 3TV7A 1O6YA 4ZJIA 3VQUA 4CRLA 4PMPA 2P33A 4U40A 3NIEA 5J95A 2XNOA 5DVRA 1U54B 3GQLA 3GT8A 2C5NA 4U42A 4JX3A 1WBSA 1YVJA 2YIWA 4HNIA 4O7NA 4IVBA 2BROA 1R78A 3ELJA 4L3LA 2HZNA 4CZTA 5CY3A 3QCQA 2XK9A 4M13A 5CSXA 2BFXA 5DE2A 4AUAA 2VWYA 4QP7A 3VAPA 3EYGA 2VNYA 2CJMA 4LMUA 3WZEA 3WBLA 4C3RA 3SX9A 4HVIA 4PL5A 3D5VA 3O8PA 5IUGA 3OF0A 3EFJA 1ZYJA 4QP6A 2BCJA 5M51A 3EL8A 3KRRA 2RFSA 2BHHA 3F69A 3P0MA 4FV2A 5C8MA 3QTZA 4LM5A 2V55A 4OBOA 4J7BA 3LJ1A 3LQ8A 4CTBA 1JKSA 1Y8GA 5CQUA 2FH9A 1XH4A 2WIHA 3UZRA 2BUJA 4I0RA 2OSCA 3UNJA 1G8AA 4HZSA 3N4VA 3OCTA 3FHIA 3VUGA 5E1SA 4CFUA 5JFXA 3R2BA 4F9YA 5J1WA 5GJFA 4DT9A 1PMNA 4FKTA 5H9BA 1H4LA 2BAJA 4F1MA 3VIDA 4BDHA 4G34A 2BHEA 2XJ2A 4QQ5A 3EJ1A 4ACCA 2GTMA 2YIRA 4XUFA 5AP7A 2ZV9A 4GJ2A 4RQVA 4D9TA 3V8SA 4O27B 1J1CA 1XH8A 4DEHA 5IA1A 1O9UA 3BHVA 5BMMA 3RPRA 3E8DA 5IQHA 3PP0A 1MRUA 5CAQA 3N9XA 1W8CA 3G5DA 4L52A 4F70A 3FMKA 3W8LA 4EONA 2VD5A 3ODZX 3ZU7A 3HX4A 1OIRA 3GQIA 2QO2A 1IEPA 4R6VA 3QRKA 2ETKA 4Y5QA 3QGYA 4PTEA 2QOBA 4EH3A 4JBQA 3TDWA 4GVAA 4NFMA 5C8NA 5DIAA 1PY5A 2OXDA 1SNUA 3K3IA 3IS5A 4FK6A 2PUPA 3I6UA 3OWPA 5HLNA 1PXKA 4FV8A 3HAMA 3CEKA 2PMNX 4QPMA 4LYNA 4RC4A 5HVYA 3V01A 4S33A 1SVHA 2H96A 3MA6A 3ATTA 3RCDA 5CT0A 3FZOA 1YHVA 4ZTSA 4W8EA 3OUKA 4GV1A 4BTJA 5M4IA 5LMBA 4CT2A 4TT7A 3EQRA 4OTFA 3OT3A 4TYJA 4JBVA 4ANSA 5EDPA 3QKLA 4Y73A 4DEAA 2YM6A 2VTMA 4Y85A 3E8CA 3TJDA 2FA2A 5DRBA 4BCIA 4BDIA 3NW6A 3SXFA 3DNDA 4O0XA 4RJ5A 3REPA 4II5A 5IUHA 5FBNC 4GVJA 4F09A 5F9EA 4QMOA 5HD4A 3U4UA 4O6EA 3KGAA 4EK5A 3O51A 3VO3A 3A8WA 1Q3WA 2XF0A 3FYJX 3ZC6A 3GC0A 4ID7A 3FDNA 4O0UA 2WOUA 1W0XC 1IA8A 3RWPA 5CSVA 4TWOA 4M69B 1Q8WA 3CE3A 2JBOA 3R9HA 4GU6A 1M14A 3HGKA 2J51A 4ERKA 4KWPA 3LFQA 5CENA 4WSQA 4IM3A 2GCDA 4M67A 5BUEA 3HMNA 2BIKB 3R30A 2F57A 4ANBA 4GK3A 3UVPA 3RAIA 4CT1A 3LCKA 4FIEA 5HE0A 3R9OA 3UIUA 4J8MA 3H0ZA 4PDOA 4DLIA 4IB5A 4DFUA 1B6CB 1YI4A 2XH5A 4G16A 1FINA 4EH2A 4Y83A 2GQGA 4JJRA 4EEVA 4F99A 5DMZA 5M4FA 2ZMCA 4IB3A 4GH2A 4XG6A 3TACA 3ZO3A 4O7ZA 4GFOA 3IECA 4RLLA 5A4QA 3DKFA 3PVBA 3DKGA 2HZ0A 3EYHA 3MH3A 4KSPA 4HJOA 4XV3A 3WZJA 2UZTA 4O0RA 4ITHA 4YBKA 3UIBA 3DBEA 2J0MB 5AUVA 1QPDA 5KO1A 3U6IA 4L44A 4M8TA 3WF8A 4FV4A 3QXOA 2OZAA 4RIOA 4YJTA 4ZY6A 3LQ3A 4KBCA 2E9UA 4UY9A 2XM9A 1PYXA 5HX8A 4UXLA 3UO6A 4E6AA 4EUTA 2WQEA 4RFZA 3NS9A 1GZ8A 2QU5A 1FPUA 4L43A 3NYVA 5GNKA 5E8UA 4C34A 4EK4A 4AP7A 2EUFB 4JOAA 4M14A 3RVGA 3OMVA 3VUHA 2GPHA 2PVNA 3ZBXA 2O64A 3ZRKA 5JGBA 4TWNA 5I4NA 1UU8A 3NUYA 2GS2A 1E9HA 4RC3A 2J6MA 4YGAA 3UYTA 5HCXA 4USFA 4P7EA 4UXQA 5ITAA 3F5UA 5K4JA 1IAJA 1M7QA 3NCZA 3L8SA 2WMBA 4RIYB 2VZ6A 4BTFA 1LR4A 3Q32A 3I7CA 3ZLWA 3KXZA 2F9GA 4A4XA 3LFAA 3ZFMA 2JAMA 3LM0A 4RX5A 2XK3A 4NK9A 3QL8A 2BIYA 1JKKA 4JQ7A 4BKYA 3BLQA 4BZNA 4D58A 5AV2A 3OCSA 3UGCA 3NR9A 5K3YA 1NW1A 4L3PA 4M7IA 4CKJA 3PJ1A 5J79A 4EUUA 5BUJA 1O6KA 3O23A 1LPUA 3DAEA 3ZRLA 3KA0A 2QI8A 4EL9A 5KNJA 4E6CA 2VNWA 4O7TA 4WKQA 4AAAA 3KC3A 3QTIA 2QHNA 4QQJA 5E8ZA 4AN3A 4EYMA 2BKZA 2UZLA 2C6LA 3R8MA 3AC3A 4BZOA 1OMWA 1RW8A 3DTCA 5CASA 3KB7A 3BEGA 4K2RA 4O7VA 4KBAA 1UNHA 2BAQA 1OUYA 1GNGA 3VRZA 4YPSA 5JQ8A 4C4JA 3I79A 2JLDA 4YZBA 5JSMA 3EQIA 1BKXA 4KBKA 4L53A 1DAYA 3BRBA 4FTTA 2WMSA 3EZRA 4MK0A 2OJGA 4NFNA 1U5RA 2EXMA 4ZTQA 4JIAA 4IMYA 3HRFA 4MQ1A 4UWBA 3VUTA 3RMFA 3AD4A 1RDQE 2XBAA 4FICA 2WMWA 5FXRA 2J50A 3PSDA 4DYMA 4N0SA 1M52A 4RG0A 3VS6A 5C4LA 2OIQA 5A6NA 5AA9A 3HNGA 1OIQA 4MNEB 2X4FA 1CKIA 3OY3A 3ZUUA 3GEQA 3UC4A 2XS0A 3V04A 2JIUA 4MD7E 4D4YA 2C5VA 1OITA 5L2TA 4AF3A 1WVYA 4QP3A 5DR9A 1SVEA 4PTGA 5L8KA 4AZTA 2YM7A 3FXXA 5IU2A 1YWNA 4I6BA 3W55A 1OUKA 5J87A 3MVMA 4RSSA 5DGZA 3TI1A 1DI8A 2C6IA 4IB1A 4F7SA 3UBDA 1CSNA 1A48A 4CGAA 2F2UA 3CPCA 4FR4A 3A4PA 2W9FB 3FSFA 4FTUA 4PMSA 4YZCA 4YLJA 4YHJA 2WQMA 4BFMA 4NU1A 1Q61A 4HVHA 3LFCA 3QHWA 3UOHA 3MPAA 4FV1A 4BYIA 4DE4A 4RJ8A 3DKOA 1OPJA 2FVDA 5CU0A 4XS2A 3ID6C 3R2YA 5EI2A 2PWLA 3AMYA 4OBQA 4O83A 3E62A 2G2IA 1H07A 3G9LX 4ARKA 4QMVA 4BDKA 1OI9A 2JBPA 1PMEA 2X9FA 4MXXA 1GJOA 3TWJA 3AXWA 2B55A 3C4CA 3FY2A 3O96A 3ORKA 4RX7A 4JRVA 2IO6A 3CTQA 3FI3A 2XBJA 2NPQA 1F3MC 2VGPA 2WTKB 5FTOA 2EXCX 1URCA 3E63A 4FYOA 3F66A 3QZIA 2V62A 4IWPA 5GZ9A 4CTCA 4EQCA 2WHBA 3UQFA 2C5OA 5CEMA 3HV5A 2BILB 3QFVA 3VC4A 4A7CA 3BHHA 4IAKA 1MQ4A 2JGZA 4JBPA 3IGGA 4PY1A 4DH5A 3E7VA 3OUNB 4CFWA 2BRGA 2C6MA 2ZV2A 4RPVA 3F3UA 3PIXA 3I7BA 3LHJA 5JRQA 3Q9ZA 4IAZA 2O2UA 4EJNA 5EHOA 2J5FA 2WTKC 3WARA 5EDRA 3MVHA 2NRUA 4IX6A 5EW8A 4CFFA 5L2WA 4QYYA 3W32A 2ITTA 3OBGA 3SOCA 2DWBA 2RF9A 4LL0A 3FAAA 4W4YA 3F2NA 4U41A 3F3TA 3ZSIA 4RFMA 2R0UA 4FF8A 4G1WA 3P7BA 3FE3A 4MNFA 2PE1A 4G17A 2IPXA 2QOIA 3QA8A 5CI6A 4PPAA 5AP5A 2RFNA 4AGDA 5L2QA 3C4FA 3V5LA 4U81A 2BVAA 5FP5A 2R0IA 5FEQA 4DC2A 4CQEA 3P23A 3WILA 4FODA 4PF4A 3HV3A 4EOIA 2W06A 3KL8A 5FP6A 4CFVA 2X2MA 3BLRA 3SRVB 4JIKA 5JGAA 3DB8A 3JYAA 5EG3A 4DFBA 3FXWA 2HELA 3H9RA 5CWZA 4RGJA 2UW6A 1CKPA 4MBJA 3JUHA 2X1NA 2XK8A 4QP2A 5CSHA 4Z3VA 5GZAA 1YHWA 2W1IA 4AN2A 2C30A 4EC9A 3GENA 1UU9A 4QMLA 4BBEA 3IOPA 1ZARA 3LXLA 4YZ9A 1I44A 4OTDA 4S31A 2RL5A 3LIJA 5E90A 2BAKA 2YABA 4FGBA 5D41A 1YXVA 2W96B 2GMXA 3F3ZA 3FZ1A 5KMIA 4NJDA 4FT0A 4S30A 2OK1A 3PG3A 3SV0A 4N6ZA 4H1MA 3AC5A 5ETCA 3NRMA 5DBXA 4BHZA 4MD8E 4TXCA 4IJ9A 4AA4A 4GIIA 3I0OA 4PPCA 4QP9A 4LFIA 3W16A 5BVWA 2YZAA 5D7VA 5LCKA 4KIKA 2RIOA 4BB4A 4QOXA 4JDKA 5HG5A 4IC7A 1WCCA 5F95A 4HPTE 5CEOA 5LMAA 4C4GA 4U3ZA 3KVXA 2Q83A 2BMCA 4QTBA 2KTYA 2NO3A 5IUIA 3Q5ZA 4K8AA 4KSQA 2XUUA 1KE9A 4OGRA 4QT1A 5HO7A 4I5MA 5HTIA 3MVLA 4FIJA 3DK6A 2YLFA 2A2AA 2GDOA 4W8DA 3AMAA 4WUNA 3LJ0A 5IDNA 1G8SA 4ASZA 4DEBA 3PJ8A 5C9CA 4I22A 5E92A 3BQRA 3MBLA 2GFSA 1Z9XA 4JAJA 4YJOA 2F7EE 4NM5A 3NLBA 5EDQA 5DHJA 3P9JA 2OIDA 4OT5A 3DS6A 5IA3A 4AFJA 2ERZE 2OFUA 4A07A 4FG9A 3CCNA 3HV7A 5ANDA 4LRMA 2JDSA 4B9DA 2P2IA 2OW3A 1Y57A 3K3JA 4N4SA 3M1SA 1FGKA 3D83A 2VUWA 4C33A 4EH5A 1XH6A 2A0CX 5CANA 4ZLZA 1Z5MA 4LRJA 3ZO1A 2C6EA 3FMMA 4LGGA 5HE1A 3EN5A 3A7GA 5FEDA 3FHRA 3BU6A 4WHZA 4Z7HA 2FUMA 3F61A 3ORLA 3ETAA 2IVUA 3KRLA 3OWLA 2XYNA 4YNOA 2WZJA 4R1YA 5EQPA 5CEKA 4V04A 5KX8A 2BFYA 3GC7A 4CLIA 3TUBA 2OLCA 3BYSA 4O2ZA 4BCQA 4XH6A 2QO7A 4HYIA 3ZOSA 2NP8A 4XG7A 1B39A 3PWDA 4GT3A 1CTPE 1KV2A 5L8JA 3O17A 4L7SA 3ZC5A 3MTFA 3QQLA 5GJGA 5EYKA 3Q96A 4RWKA 3QD0A 4F63A 4YC8A 3BLHA 3DJ5A 5LXMA 2V7AA 3AC1A 5LMKA 3W2QA 4H3BA 5HU9A 4JI9A 2JFLA 3MA3A 3IOKA 4DAWA 3ZDUA 2VO3A 4P2KA 3QYWA 3ZEWA 3LLTA 5F94A 4ZSGA 3PP1A 4ASEA 1V1KA 4K33A 4YLLA 5F4NA 2R5TA 4R7IA 3CQEA 4OLIA 4FV7A 4IBMA 1FBNA 1Y91A 5BVKA 3PLAE 2XNGA 2F49A 1JSVA 5HIEA 4J52A 4I24A 5TKDA 4MHAA 3CY3A 3LFNA 4IVAA 4FTNA 4IM2A 2W5AA 5AR3A 1TQPA 4I41A 5DPVA 4B7TA 2WO6A 4EK6A 4TYIA 3ZZWA 4YZNA 3RM7A 4CZYB 4DH8A 4DEIA 5J9YA 4S32A 4FTIA 3EB0A 3I4BA 4EJ7A 1BL7A 4TYHA 4MXAA 3R01A 1KE5A 3RKBA 3T8OA 4ANLA 1ZY4A 3FLNC 3NUXA 4WUAA 5HNIX 2XJ1A 4G3DA 4DCEA 3OP5A 5FBOA 2PVKA 2UUEA 4QPAA 3D9VA 4FTLA 4YSMA 1P14A 3DTWA 3QRUA 4FKOA 1M2PA 5TO8A 4ACMA 4I0TA 4RJ4A 3RAHA 2ZMDA 2YACA 4U6RA 4QTDA 2VTHA 3TNPC 4F0IA 2OZAB 3MFUA 1K2PA 3QF9A 3FMEA 4RMZA 1OGUA 4NH1A 5L6WL 4CD0A 3KCFA 2QOLA 4Q5HA 5CF4A 4LGDA 1VZOA 5D1JA 4KKGA 4ZZNA 4ANOA 3HDMA 3CIKA 4BDDA 3TUDA 3U87A 2IZUA 3PY1A 3FUPA 4O91A 4W9XA 5FDXA 2BDJA 4O96A 5IQEA 3QQHA 4YZDA 5FG8A 2YWVA 4C0TA 3D94A 4H05A 5EHLA 3BYMA 4FG7A 2QCSA 4J53A 3VBTA 3F7ZA 3RPVA 4F7NA 2UW5A 3EQDA 2B9IA 1JBPE 2PE2A 4YJVA 1S9JA 4Z16A 2F4JA 2W1EA 3Q60A 2JC6A 2Y7JA 3QWKA 2V0DA 3R04A 5FEEA 3W10A 5GIPE 3CKXA 4GYIA 3JPVA 3VNTA 5BYYA 3VUKA 2R3LA 1Q24A 2Z7SA 4A9TA 2R64A 5H8EA 1KUTA 5CAUA 4ZEGA 4E26A 4F08A 4AZVA 2A19B 3GU4A 2J4ZA 4K77A 4AG8A 3JS2A 1TVOA 4EOQA 4NW6A 5AADA 3NDMA 1FMOE 4JVGA 1VR2A 2PULA 2OF2A 2YITA 1ZMUA 2OU7A 3DOGA 4RIXA 2G2FA 4H58A 4EK8A 3OS3A 4O7RA 2G01A 4FSUA 3A99A 5KHXA 2WQOA 4DA5A 4IWOA 2YJRA 3U55A 4F0FA 2PSQA 3MYGA 1P4OA 4C2VA 5A4TA 3B2WA 4XG2A 4BZDA 2VO6A 3UNKA 3DXNA 4IAFA 2W1FA 2Z7LA 2QKWB 5BPYA 2ETRA 1J7IA 2X8DA 4PPBA 4BDBA 3DQXA 1UWJA 4XHKB 2YCSA 3FLYA 4IANA 3L9NA 5FM3A 3QTSA 3EZVA 1QPJA 2QVSE 2XKFA 5TF9A 1XQZA 3ZZEA 2XA4A 1XR1A 4I21A 3CQUA 2HIWA 3GC9A 5BVEA 4IM0A 4FT5A 1SNXA 4XV1A 4O7SA 3FYKX 3L9LA 3OT8A 3VN9A 1GY3A 4HGSA 2IZTA 3DBCA 3FMNA 4LRKA 2ERKA 3LFFA 2VTPA 3E7OA 3R7GA 4M15A 4RT7A 4FTJA 4UMTA 4WA9A 4ALWA 4C59A 3LCOA 2X7GA 2ZV7A 3OWJA 3MSSA 4F9BA 5D10A 3VRYA 4Q5EA 4X3FB 4HGLA 1W7HA 4V0GA 2CGWA 5AM6A 3BX5A 2OBJA 4DGMA 3OHTA 3E3PA 4M3QA 4OTPA 4HGEA 2PTKA 3V5QA 2DS1A 4FT7A 4M84A 3PSBA 2O65A 5T68A 3OXTA 1OL7A 3JY9A 2H6DA 2BTRA 3IGOA 1BYGA 3KN6A 5AUZA 4MAOA 4QYFA 5M4CA 5AV3A 3GVUA 1ZY5A 3QCXA 5DEYA 3BHYA 1BLXA 3E87A 3M42A 3ZEPA 3FBVA 2CNQA 4RQKA 2XJ0A 5EFQA 3VUIA 5EH0A 3PPJA 3R1QA 4DT8A 3P7CA 4FTAA 3PG1A 4FV5A 4O0YA 3LW0A 4IEBA 4QMZA 2WB8A 4F0GA 5AEPA 3C7QA 4ZXTA 2VWBA 3NPCA 2JDVA 2OJJA 3FPQA 2B0QA 5IG1A 2VTSA 3ENHA 4FTKA 5ANJA 4ASXA 4XEYA 2IJMA 3ZSHA 4R1VA 1J7UA 2YIYA 3A7IA 3MH2A 3HUCA 5CLPA 3RJCA 3K5UA 3TV4A 4FKPA 4L67A 2WMUA 3AT4A 4AX8A 1JKTA 3ZMMA 4BI1A 4D5KA 3GXLA 3II5A 3KFAA 5IEYA 1NXKA 4AA5A 4AGUA 2Q0BA 4JG6A 2BZKB 1P5EA 1OL2A 2VWZA 3NNWA 3NUUA 4C35A 3SGCA 2AC5A 3MGYA 2CKEA 4NM0A 2I7QA 3VBVA 5LARA 2QD9A 4E5AX 1UV5A 5M4UA 2GHMA 5I3OA 2F7XE 2PZ5A 3DLSA 3OG7A 2C5XA 4BKJA 5CVGA 4FA2A 2R3GA 3V5PA 2UZNA 4QP8A 5DFPA 1GIJA 3LZBA 5KZIA 4BWKA 3NEWA 3NSZA 2ACXA 2J0KA 4WG4A 2C1AA 4M66A 2YN8A 2ZDUA 4F65A 3VS4A 5EK7A 4ACHA 4FG8A 2YWPA 5I3RA 4FYNA 5BVDA 3BEAA 3GU5A 3LPBA 3NW5A 3QLGA 4X3JA 5HO8A 4BN1A 1S9IA 3TUCA 3PE1A 1ZZ2A 5KMNA 2BPMA 2Y4IC 3OWKA 4BIEA 4DHFA 3R7IA 4BDJA 3UO4A 5AM7A 4EC8A 5BYZA 4CRSA 3BWJA 4GKHA 1YXSA 4FNXA 4I0SA 1AD5A 4WG5A 3BWFA 3QZFA 4LV8A 3PY0A 3BBWA 4O1PA 5HG7A 4YSJA 5ANOA 1LUFA 2JITA 1U5QA 2C3JA 1JKLA 3QBNA 4DGNA 2X2LA 3HA8A 2WU6A 3ORXA 5AUUA 5CEPA 1XH9A 4YMJA 4DFNA 3UJGA 4UMPA 3N4TA 4EHVA 5HIDA 2YM3A 2X7FA 4I23A 2W7XA 4UWYA 3VF8A 4MTAA 4NKAA 1SM2A 1H26A 3DQWA 4RFYA 4AT3A 1KV1A 4EWQA 1WFCA 4MF1A 2WIPA 4D4SA 3GNIB 4RLKA 1VYZA 4B0GA 4RWJA 4EI4A 4F6SA 2ONLA 2I40A 5HE2A 3VJOA 3BKBA 4TYEA 3MPMA 2JEDA 2WEVA 4EORA 5E8TA 2EXEA 2GS6A 2WTVA 1UA2A 1YI6A 2WNTA 4FZ6A 1YW2A 3K54A 1UKHA 5E8SA 4F7LA 3TN8A 4OTIA 4QRCA 2IW9A 4AN9A 1Q8TA 3DB6A 5GHVA 5KUPA 4FEXA 3UP7A 2ZB0A 3FQSA 4S2ZA 2X39A 3OOMA 4C57A 5H3QA 4BBMA 3FLQA 3MY1A 3UG2A 4BWXA 3H0YA 4KNBA 3LCTA 1E1XA 4QMTA 5JFVA 4KIKB 2HW6A 5KBQA 4O82A 5ETIA 3Q4CA 5IF1A 3GU8A 1J3HA
chains in the Genus database with same CATH superfamily
2X81A 2E9PA 2X0GA 3RNIA 5L6PA 3HMOA 3EFKA 3W2CA 3M2WA 1FMKA 4FT3A 4KIOA 2VWXA 4CCUA 3UPZA 4QMQA 2OJ9A 5CNOA 3G9NA 4FTRA 4AU8A 5IH5A 3MFSA 1IAHA 4BR3A 2PVJA 2WTIA 3RPSA 3QCYA 3TTIA 4K11A 2B1PA 3LXPA 5HX6A 3E64A 1P4FA 4HOKA 2UW8A 2W5HA 4PX6A 3DGKA 1R1WA 2VO0A 3PY3A 4G3FA 4JT3A 4JL9A 3MN3A 3RI1A 4DTKA 5BQ0A 4CKRA 3WE4A 3TZ7A 2REIA 2XIYA 4XG8A 1RJBA 5LJJA 4FUYA 3Q5IA 4U80A 3BCEA 2XK4A 3R7VA 2H9VA 1J91A 2A1AB 4YUQA 2CDZA 3WF6A 4GT5A 4AW5A 4E4NA 5D12A 2ITXA 5IMEA 5HCZA 3KRWA 2WTCA 2VWIA 4QTEA 3D15A 3ZM9A 2AQXA 3THBA 2HXQA 2C6KA 5IDPA 4MWHA 4R78A 1GAGA 3VBYA 4DEGA 4M0ZA 1NVSA 3QTWA 3TKIA 3HVCA 1ZOGA 2JIVA 3EQCA 2Z8CA 4UZDA 4YJSA 2BTSA 5AP6A 4R7HA 5LVLA 4ZJVA 4ALUA 1TQMA 3B8QA 4U8ZA 4CZUA 5I5ZA 3TL8A 3DJ6A 4D5HA 3FZSA 3PSCA 2VWWA 1OKYA 3KN5A 3UDTA 3R9NA 2JKQA 2QOKA 4DHIB 2FGIA 4CMUA 1Q8UA 4PP9A 2HXLA 5B2LA 3IDPA 3DK7A 3MIYA 4OT6A 4O7YA 1JSUA 3O0GA 1IASA 1V0BA 2XB7A 4O4BB 4YHFA 5I9VA 4CYJA 4YTFA 3I1AA 3E8EA 3IW4A 3MTLA 4QNYA 3ACKA 4CVAA 3D2IA 3EFWA 3NYXA 4DFYA 5EKNA 2RFEA 2YAAA 2OXXA 5A4LA 4G9RA 5I9WA 4L8MA 3RINA 3PIZA 3Q9WA 4FSQA 4HCUA 1PXPA 4JXFA 4X2KA 4YP8A 4BI2A 1LEWA 3AC4A 3VUDA 1FGIA 5EM6A 1H00A 5LCJA 1SVGA 5LMKC 2HCKA 3B8RA 1GZKA 3HKOA 4FL2A 5TE0A 3SC1A 3KXXA 2OH0E 4G3GA 4ZIMA 4MVFA 4BDEA 2ITPA 3UOKA 4G31A 1PF8A 5F20A 3DA6A 4KAOA 3RZBA 2PU8A 3F6XA 4K6ZA 4F78A 3BQCA 1PXIA 2WFYA 3F3VA 2C4GA 3R0TA 1YOJA 2WKMA 3VS0A 5A54A 2VTLA 3BIZA 2LAVA 3IG7A 5FDPA 4IWDA 1WZYA 4TYHB 4DEEA 3PE2A 5HIBA 1YOMA 5HCYA 3L1SA 2W9ZB 2WEIA 3AKLA 5KZ0A 4WOVA 2VTOA 2ZM3A 5AAFA 4L46A 2AC3A 4XP2A 4ZY4A 1UNLA 5AP3A 5HNGA 5IQAA 4I93A 4D2PA 3F5GA 1H1PA 3PVUA 5EOBA 3W2OA 3EL7A 5J1VA 3OXZA 1BL6A 4O0VA 2XVDA 5E7RA 5HI2A 1NVQA 4TTHB 2R3HA 4TNDA 4BDFA 2CN8A 5AP4A 3FKNA 1XBBA 2CHLA 2UZUE 2GTNA 2Y6MA 4XRJA 3VHEA 2E9OA 2O8YA 4DBXA 5HO6A 5TT7A 2NRYA 4ORKA 3UP2A 2VX1A 3ANRA 4C4HA 5DA3A 5M09A 1MP8A 4X7QA 3V6SA 3ZRMA 2B54A 4FSNA 3C4ZA 4NKSA 4YO6A 3UZPA 5J7HA 5AIRA 1UNGA 3VS5A 2W1HA 4GW8A 3QWJA 3PIYA 1KE6A 2XEYA 4G5PA 4X0MA 3IKAA 4S34A 3PRFA 4ZSLA 1FQ1B 2HW7A 2PMIA 4O38A 3QQJA 3EWHA 4DBNA 4TY1A 3OTVA 4AOIA 3P1AA 2ZOQA 3QQKA 4I92A 3I6WA 4KB8A 5A6OA 3MV5A 3PXKA 3U4WA 2QLQA 4FV9A 3MJ2A 4Q9SA 4RIWA 2QHMA 3TTJA 4B4LA 3TEIA 4EOPA 4L00A 4YLKA 5JEBA 3QHRA 2ITUA 3A8XA 4Q2AA 5AR4A 4FTCA 3SA0A 4FX3A 3TZ8A 3QUPA 3ROYA 5KMMA 3SKCA 3QX4A 4V05A 4CV9A 4K18A 4EZ7A 4WD5A 4QQCA 3LCSA 1PMVA 4XV9A 2CCIA 1XJDA 3EIDA 4FKIA 3ODYX 4FVQA 1WBWA 4BRXA 4D1XA 2V5QA 4DH1A 4YJPA 4NL0A 1H01A 1W83A 2XIZA 4XCUA 2CPKE 5EYDA 4AW0A 3HAVA 4IADA 4RIXB 5J8IA 1I09A 4GMYA 2ZAZA 1OECA 4BCNA 3CTJA 2WTJA 1Q99A 5AMNA 4AT5A 4PNIA 4FEWA 4LOOA 4X6QC 4K1BA 3UDSA 4IXPA 2X0OA 4FSYA 1JVPP 3C0GA 3BL7A 2Y4PA 4NTTA 1TKIA 4OW8A 5C03A 5AAEA 3BGPA 4GUBA 5CXHA 2CGUA 4F9WA 3A2CA 4ITIA 2QR7A 2ZVAA 3VULA 2QQ7A 3CJGA 3VW6A 4HGTA 1OIUA 2PVHA 3CXWA 3QALE 3TM0A 4IQ6A 3LFSA 1KE7A 3PZHA 1Y6AA 4HYHA 4MYGA 4N6YA 1XH5A 4NEUA 3SW4A 2B53A 4UMRA 3QD4A 3PA3A 3HMMA 3QUDA 4ANQA 4LOQA 2W5BA 1UU3A 4ZSEA 2YCFA 3H10A 3OCBA 4FV3A 4NZWB 4LI5A 2HK5A 4XNEA 4BCMA 2B4SB 2IZSA 3C0IA 3U9NA 3ULIA 4WIHA 3PVGA 4IB0A 2VX3A 4V0GB 3SDJA 4YTCA 1PKGA 1OZ1A 4U79A 4CFXA 2GNJA 4AFEA 4C62A 3TIZA 3W8QA 4AAYA 3PYYA 3S2PA 5HTCA 4L7FA 4TPTA 1P2AA 1IG1A 4D1SA 4GFGA 5AV4A 5E4HA 3GOKA 1H24A 3ERKA 2XNPA 3NCGA 4UX9A 2WMTA 2H34A 2I6LA 5CT7A 3DPKA 4RWIA 2VWUA 4OTQA 5C26A 3BV3A 3AMBA 4ACDA 4R7BA 2CCHA 2G9XA 4ANMA 3CQWA 5IEVA 4L3JA 4DLJA 3QYZA 2WELA 4WT6A 3MY0A 4X2FA 1ZYSA 1ZRZA 1KOAA 3A7FA 3POOA 3RBWA 5BMSA 3JVRA 4AGCA 1IRKA 3BYOA 3EQHA 4WBBB 3AT2A 2DUVA 5F1ZA 4E20A 3ZUVA 4FVRA 4QYGA 4X6RA 4CXAA 2CMWA 3LKMA 4FSMA 4E73A 3A61A 3AD5A 2PUNA 3BI6A 2GQRA 5JT2A 1G3NA 4USDA 5EW3A 4XOYA 3KMMA 5KMKA 2R3QA 1KSWA 2R4BA 1OB3A 3R1YA 4YZMA 3V8TA 3U8WA 3NVKI 3FZRA 1PRYA 3T9IA 2YLEA 2C69A 3CLYA 4H3QA 2X9EA 3Q4UA 2BALA 4MBIA 4O86A 5IA2A 2XCHA 4CNHA 2PVRA 4GK2A 3LJ2A 4ANNA 3R02A 1F5QA 5B2MA 1OPLA 4RJ6A 3FI2A 2UVXA 3LM5A 5ANGA 4AW1A 4RZWA 5DT3A 2W1CA 4AXDA 4BICA 5HZNA 1WVXA 4HPUE 4EHZA 3E88A 2QG5A 4YR8A 5HBHA 3QRTA 3R7EA 2I0VA 3A7JA 4H3PA 4KS8A 3S4QA 3WOWA 3GCPA 1YDTE 3ZFYA 2VTRA 4RJ3A 4MWIA 2RKUA 2PMOX 4QMPA 5E91A 3DAJA 4APPA 3UQCA 2YDKA 3RZFA 2BZJA 3MDYA 4O0WA 2VGOA 4R3PA 4BDGA 5IH4A 3SHEA 2P0CA 3HRBA 2OGVA 2V7OA 4GEOA 4FE2A 5BX0A 3C4WA 1YXXA 4C61A 4CQGA 2Y9QA 2A27A 3PVWA 2X8EA 4XMOA 4YJNA 3TNWA 5EW9A 1QPCA 4ZJJA 1U4DA 3LMGA 4JQEA 1H1WA 3I60A 5GZ8A 2BRHA 4FNYA 4M69A 4ASDA 4ZMFA 4C3PA 5K4IA 3SXSA 3CBLA 3U51A 4JR7A 3F88A 5BVOA 2HENA 3FXZA 5M57A 4H39A 3QRJA 3LXNA 5EM8A 4KIQA 5CF5A 4ZLOA 5M56A 3LAUA 3R8LA 2R3JA 4ZTHA 1A06A 1KOBA 3T3VA 1JAMA 2JKOA 3DFCB 4LMNA 3DFAA 4D28A 3W33A 2WU7A 2Y0AA 4ZOGA 5BYLA 2GS7A 3PXFA 2HZIA 4L01A 4PL4A 4MXOA 3EOCA 2BDWA 4FZDB 2J7TA 2WMAA 3SW7A 2CKQA 2CGVA 4HVGA 4EH4A 2BR1A 3QLFA 3WI6A 3BGZA 3BE2A 2UZEA 3KXNA 4G6LA 4YNEA 4I5HA 4IACA 3UE4A 4FIGA 5FTGA 5HNBA 2YDJA 3JVSA 3OCGA 3QA0A 3D0EA 5ANIA 2ONLC 5LWNA 5B0XA 3R8ZA 4EQUA 1WBNA 3I0QA 2PZPA 3KEXA 2WMXA 4UMUA 4EQMA 1ZZLA 2GNFA 5GINE 4CG8A 2QONA 5JRSA 1ST4A 2HYYA 4F1TA 2IG7A 2CNVA 4QO9A 2UVYA 4HCVA 1DAWA 4OBPA 4E7WA 4EKKA 4RJ7A 2JAVA 3NX8A 5M06A 4DN5A 3F2RA 5DH3A 4FKSA 2PK9A 3KIOC 2JDRA 3DCVA 3HDNA 4E93A 3FV8A 4EH7A 2W4OA 4NTSA 3AT3A 4UALA 5IEXA 4KABA 5AAGA 2YHVA 3PTGA 3SAYA 2I0EA 1LEZA 3L8PA 3TKUA 4YTHA 1Q5KA 4GT4A 3VS3A 4IZ7A 5JH6A 3G6HA 1X8BA 2GU8A 3FI8A 2XRWA 3ZYAA 5D11A 2EB3A 1WAKA 2PZYA 3O71A 4FZAB 2FSTX 3UVQA 1YXTA 3QTRA 5AX3A 3UNZA 2WPAA 3DKCA 3GBZA 4GFMA 3ZXZA 3CC6A 5DG5A 3OOGA 3ZLXA 4C37A 5DWRA 1Q41A 4Y46A 4ZZMA 3F2AA 3MFTA 3NAXA 1BMKA 2Z2WA 4L45A 3ZO2A 4IHPA 1O6LA 3CGOA 5AR8A 3QRIA 1K3AA 2FB8A 1XBCA 2YIQA 3DAKA 3FWQA 3BE9A 3QGWA 4IFCA 5FRIA 3VWAA 3ZFXA 5AIKA 4ALVA 5J9LA 3DXPA 1V0PA 3PZEA 1XBAA 4FKJA 4A9SA 3D7ZA 4FOBA 4YC3A 5HEZA 2W1DA 4DG2E 5BNJA 4AWIA 5DNRA 1KWPA 2PHKA 2QURA 3TKHA 2QOQA 3SG8A 2ESMA 3C1XA 4D2RA 3QTXA 1FOTA 1R39A 3U9CA 4NUSA 4A06A 3F82A 3GOPA 1H1QA 4RA5A 3O5AA 2WQNA 3BPRA 3IW8A 2YIXA 1Y8YA 4E4MA 4J99A 5JKGA 3O7LB 1HOWA 5L8LA 3TNIA 1PHKA 5CF6A 3SG9A 3O8TA 4FC0A 2XNMA 3KXMA 4XYFA 1FVVA 4O6LA 4MNEA 4XRLA 3R7YA 3L8VA 3OBJA 4AQKA 1QMZA 3WZKA 3G6GA 4IJPA 1VLRA 3G15A 3MVJA 2ZYBA 4LV5A 5IPJA 3WZDA 4FEVA 1Y6BA 2FSOX 4UBAA 4GG7A 4EK3A 4D55A 3HV4A 3C51A 5DYJA 4XJ0A 3VS2A 4M12A 4X21A 4LDTA 4I3ZA 5CEIA 2PVLA 3KXGA 5CNNA 3VJNA 5JMSA 1M2QA 4TW9A 2X7OA 2J2IB 5AR5A 5DOSA 3LXKA 5EKOA 3COHA 4IAYA 4L68A 2QLUA 3CS9A 2R3RA 3W0NA 4AOTA 4AACA 4Q9ZA 3A7HA 4FEQA 3HECA 3NUPA 3TXOA 2GFCA 1JQHA 3CJFA 5M53A 2EB2A 3MH0A 3FKOA 2ZDTA 4L9IA 5CU3A 3DLZA 4BCOA 3C9WA 5AR7A 3R8UA 4FK3A 1CM8A 3O7LD 3A60A 5DLSA 4RVTA 4PDSA 4YC6A 4ZY5A 3V3VA 2Y8OA 3OZ6A 3CY2A 1XWSA 1UWHA 4DFZE 4EWHA 4CLJA 4NT4A 4UYAA 5BVNA 1ZYCA 4FSRA 4L6QA 1M7NA 2OJFE 4ACGA 4F6WA 3F3WA 5IKWA 5IQFA 5IQCA 2XIKA 2HY81 5HE3A 2XNNA 3DBFA 4Y5HA 2UW9A 2CNUA 3Q6WA 4O7WA 5IQIA 5CVFA 3T3UA 2ITOA 3N51A 3HMPA 3GCQA 3ZDIA 3SOAA 4FSWA 4E6DA 4W9WA 5AFVA 4E4LA 3ALNA 3TMOA 4G6NA 4XG3A 3UDBA 3EH9A 1NT2A 4O21A 4WO5A 4I4FA 4R8QA 3E5AA 2CGXA 5FWKK 3VQHA 2ITQA 2XIRA 4C8BA 4CEGA 5IISA 4WNPA 1ZLTA 4B8MA 1T45A 3DZOA 5AJQA 3CSVA 3QAME 2R2PA 1SZMA 2C47A 2P4IA 2OG8A 5B2KA 1HCKA 3RHXA 2H8HA 3FSKA 3RAKA 2CLXA 5EQYA 4BDCA 1PXOA 4FIIA 4W4WA 4EKLA 2XKCA 5JN2A 2IWIA 4O22A 3R83A 3JR1A 4DDIA 4OAUC 3OVVA 3S00A 3F9NA 3V8WA 2XM8A 4ENYA 2O0UA 4GIHA 4M68A 3RNYA 4RIWB 4FV0A 3MI9A 4OR5A 4CCBA 4PQNA 3QXPA 3EKKA 1PJKA 3HA6A 4BJJA 4AZFA 2XP2A 4X2JA 2CKOA 4E5WA 4N57A 3D14A 3NNVA 2CKPA 1JWHA 4BL1A 2ITNA 2VWVA 2XNEA 5HLWA 4XBRA 4K0YA 3P86A 5KMLA 5AP0A 4W4XA 3W18A 3EQPA 4MXYA 5AUXA 2X6DA 4BCPA 4U7ZA 4AGWA 5E9EA 3ZO4A 5HLPA 5L2IA 1VYWA 5LVMA 4DEDA 3CGFA 2XK6A 2YDIA 5J5SA 1MUOA 2XYUA 4C36A 3IDBA 3Q04A 3GCUA 2XKDA 2C6TA 1J1BA 2FO0A 2RG6A 3CD3A 3ROCA 4AXAA 4NIFA 3HP5A 3LMIA 3TJCA 3HYHA 4FKWA 3WZUA 1L8TA 3R1NA 4HW7A 3E3BX 4JRNA 3WF7A 3F5PA 3KXHA 4FL1A 3PJCA 2E9NA 5EM7A 5KBRA 4IW0A 2YM8A 4BBFA 4KUJA 4I6QA 1VJYA 1ZMVA 3FC2A 4XV2A 3EN6A 4QMUA 2Y4IB 4KKHA 2VTJA 5E8YA 3IW6A 4BWPA 1W84A 2XMYA 4USEA 4I6HA 4APCA 1ZWSA 3UG1A 2XNBA 2JIIA 3KRJA 4MKCA 5CALA 4IIRA 3FMDA 3P79A 2XEZA 1XMMA 5AV0A 5KKRB 3FMHA 3BGQA 3S0OA 3KVWA 4ZS0A 3VUMA 3UMXA 4O0TA 3BU5A 1WBVA 3ORTA 2C6DA 3UODA 3AKJA 4LGHA 3FL4A 3D7TA 4ZLYA 4I6FA 5HKMA 3MH1A 3DJ7A 3EFLA 5CAOA 3BZ3A 2R3OA 1JLUE 4ITJA 4R5SA 5H8BA 3FC1X 4IAAA 4XLVA 4O81A 3Q52A 4N70A 3W0OA 2YERA 1QPEA 3AGLA 3FQEA 5KKRC 4BC6A 2PUIA 4C58A 4DGOA 5M44A 3BELA 4YJUA 4KA3A 4EOMA 4ZTRA 4PV0A 4D0WA 4IWQA 4BKZA 3RK7A 3UOLA 2BRMA 2R3PA 3KRXA 3QUEA 3TZ9A 4ZSAA 2WXVA 4G6OA 3NUNA 2CSNA 3C0HA 2PVYA 4BCGA 3MIAA 3HEGA 4EZ5A 4V01A 3UIMA 2HAKA 3OXIA 2DYLA 4WRGA 5ANEA 4QMYA 2GQSA 5KMJA 5CAPA 4C4FA 3PJ2A 1PKDA 4JS8A 4FTOA 1OL1A 4QMWA 5E8XA 5E8WA 3TT0A 4F64A 3R73A 4TNBA 5A4EA 1E1VA 3LE6A 4XX9A 3WF5A 1Q62A 3UC3A 3R28A 2W1ZA 2VU3A 3HUBA 1UU7A 3IDCA 4J95A 3MS9A 4RZVA 3UPXA 1OKWA 1U46A 4NSTA 1OL6A 2GHGA 3ENMA 2EWAA 3QQGA 3HP2A 2LGCA 3W2SA 4FKGA 3R71A 4AA0A 3GGFA 4UEUA 1REKA 5DR2A 4F9CA 2C3KA 4CYIA 5IA5A 4UV0A 5E1EA 5FM2A 2O5KA 1V0OA 2R7BA 2G1TA 4ERWA 3WIGA 3W0MA 4EOLA 4YJQA 3ZBFA 3VF9A 5AUWA 5CF8A 4BVUA 3H9FA 1YDRE 4QP1A 3KKVA 4AE9A 3P5KA 5BVFA 3PA5A 4M97A 3UYSA 2J5EA 1W2CA 1REJA 5ACKA 4PDYA 3MB6A 3BYUA 4YPDA 3ZLYA 3VBWA 2WTWA 4J71A 4E8AA 1XH7A 1ATPE 2IVTA 4IE9A 4P5QA 1FVTA 2QODA 3W2PA 4CV8A 3VHKA 1H1SA 1OVEA 3KMUA 3PXYA 3EHAA 3LCDA 5CTPA 4LUEA 4UZHA 5J5TA 3COKA 4D4VA 1NA7A 5CZIA 4R3CA 3Q4ZA 2VTNA 1Q4LA 1TFFA 4C3FA 5K5XA 3EKNA 5ACBC 1M2RA 2YEXA 3COIA 4D2WA 4ZMEA 3RWQA 4Y95A 4O0SA 3OC1A 4AXEA 2R3FA 4EH6A 5D7AA 5DEWA 5H2UA 3VS7A 4F6UA 3NNXA 5EI8A 4YU2A 3MPTA 4J8NA 2WAJA 3HRCA 1OL5A 5G6VA 2I1MA 1SMHA 3KULA 2OO8X 5T3QA 4FI1A 3S95A 3MJ1A 4EHGA 2PZIA 4HYUA 4KS7A 5CVHA 3QZHA 4NM3A 4XBUA 1BX6A 5HHWA 3TV6A 3QKMA 5T6KA 2E9VA 5L2SA 5JGDA 3ACJA 4Z55A 2IN6A 2W4JA 3ITZA 4IVDA 3RK9A 5I9ZA 4G3EA 2XKEA 4C4IA 2C5YA 1QCFA 1XO2B 1BUHA 3DDQA 5DT4A 2C0IA 4FT9A 3GP0A 2OZOA 2YFXA 3G2FA 3MY5A 3QU0A 3R63A 5D9HA 1XHAA 4NYEA 4YHTA 3IK3A 1YI3A 2XIXA 2YCQA 3GCSA 2J0JA 4EZ3A 5AX9A 3E92A 4DGGA 1MRVA 5KCVA 4PWNA 1H1RA 1H0VA 4FKUA 5LWMA 3CD8A 1PW2A 2UZDA 3P7AA 4G9CA 1EH4A 3FEGA 4TN6A 4AOJA 4C4EA 1GIIA 3A4OX 3FQHA 5HICA 1R3CA 2HY0A 3TZMA 2E2BA 4HVDA 3SVVA 2XANA 3LFEA 3DZQA 4FEUA 2X6EA 2PYWA 3AC8A 3R7OA 1UKIA 2ITYA 2WMVA 4HCTA 4NJ3A 3O8UA 3ALOA 3ANQA 4FKVA 5AWMA 1OIYA 1ZOEA 3U54A 5BUIA 3EQFA 3MWUA 4J96A 1XKKA 3MB7A 2ZM1A 4TWPA 3KF4A 2PMLX 3D5XA 5GJDA 5TR6A 2BRBA 3D5WA 2ITVA 3P08A 3C4EA 3R22A 2JKKA 4JG7A 2JKMA 5C27A 3KQ7A 3LOKA 2P3GX 3IW5A 4WBOA 3RCJA 1RQQA 3GFEA 3G51A 3POZA 4RVKA 4QEBA 4HYSA 4IDVA 5ETAA 3KMWA 4MCVA 4U0IA 4O84A 4WRSA 1ZAOA 3BHUA 3NMUF 4IVCA 2QKRA 5I9XA 3D5UA 2IW8A 3KCKA 3RK5A 2YA9A 4ZTMA 3LFBA 4F4PA 3OROA 5A3XA 3R21A 4A9YA 2QO9A 2W1GA 2EU9A 2V22A 4YURA 1IR3A 3R9RA 3Q3BA 3K2LA 3PPZA 3Q2MA 4BCJA 4XLIA 5IZFA 1WBOA 2O63A 4OTHA 2Z7RA 1UVRA 3PXRA 3V5WA 4GRBA 1PYEA 4FTQA 3SXRA 4DITA 4DTAA 3WYXA 2C3IB 3FLZA 2VO7A 4W4VA 5IA4A 3Q6UA 1B38A 2JDOA 5DT0A 3UTOA 4DTBA 2DQ7X 2G15A 4GL9A 3QC9A 2PZRA 3CP9A 3NWWA 4QP4A 2W17A 1ERKA 2X8IA 4LQMA 4U43A 4AZEA 5AUYA 3U6HA 4DFXE 2Z60A 4QTAA 2PE0A 4X3FA 3UOJA 4LOPA 4FTMA 4ZAUA 3OTUA 4KRCA 3LVPA 1W98A 4IZ5A 3B2TA 3KU2A 5DR6A 1YKRA 4LG4A 2WMRA 1PXMA 3NZ0A 1Q3DA 1L3RE 2OJIA 3GI3A 4GU9A 5A4CA 4A4OA 3DNEA 3R9DA 1DM2A 3C5UA 3WIKA 4GKIA 3KREA 4MH7A 3OW3A 1OBDA 3F7WA 2AUHA 4D9UA 4PDPA 4X2NA 5CEQA 5HBJA 4G5JA 3DXQA 1URWA 4CFNA 4WNKA 5CSPA 1G5SA 3BBTB 4AT4A 5CQWA 5FXQA 3FZPA 1WVWA 5HTBA 3TIYA 3ZSGA 3ORNA 4AS0A 3ORIA 2GHLA 4RA4A 5EM5A 4QTCA 3GU7A 4D1ZA 4LV7A 3H9OA 4XG9A 4XP0A 3Q2JA 5CX9A 3OD6X 5KE0A 2VTTA 4MXCA 1GZNA 3RTPA 4BHNA 4ZTLA 4D4RA 1U54A 5CZHA 3ET7A 3IPHA 1CMKE 4EOKA 2YAKA 4BTMA 3IO7A 5TOZA 1STCE 3RGFA 5K0XA 5ANKA 4DH7A 4JX7A 2WTDA 3AD6A 3EN4A 4FUXA 4DCAA 1Q8YA 1YQJA 3AQVA 3FLSA 3QTUA 5HOAA 5IQDA 1OKVA 4P5ZA 5DI1A 3NNUA 3QTQA 4J1RA 3UQGA 4O1OA 3AGMA 5EI6A 4GYGA 3UZTA 4B6LA 2I0YA 5HG9A 1ND4A 1WBTA 4E5BA 4EH8A 4A9RA 4FSZA 2XRUA 4DDGA 2QNJA 2VN9A 3SQQA 3ZLSA 4QYEA 4AW2A 3FJQE 3EN7A 4EOJA 4HVSA 3LLAA 4EYJA 3QKKA 4BGQA 3PLSA 1PMUA 1NY3A 3PXQA 1JSTA 3AC2A 1H27A 3H3CA 2GNHA 2C1BA 1AGWA 2J0IA 3PA4A 3PPKA 2QOFA 4U9AA 5FXSA 2JFMA 5HGIA 3FY0A 5IQGA 2BRNA 4OTGA 4QMNA 3NFFB 3Q9XA 4FNWA 3EQBA 2YZLA 1DI9A 2UZWE 3KY2A 4RVMA 4D0XA 4Z9LA 1FVRA 1OKZA 3E93A 3IW7A 4DG3E 2J9MA 4FKLA 3QZGA 2YISA 5IH6A 3D2KA 4I20A 4NW5A 4MXZA 4IC8A 3IQ7A 3FPMA 3RP9A 3L8XA 3OEFX 3C50A 4D2SA 3VBXA 3VW8A 4OTWA 4MEDA 1ZOHA 4OTRA 4F7JA 3S1HA 4UN0C 2ETMA 1SYKA 4CMTA 5CSWA 5C01A 1GIHA 3GUBA 4DINA 4NIFB 5CAVA 3I5NA 2OWBA 1DS5A 2PY3A 3V51A 2B52A 4JAIA 4TL0A 5HU3A 5HQ0A 4C7TA 3NUSA 2Z02A 3K5VA 4E1ZA 5J7BA 3V5TA 4FV6A 4IZYA 4X2GA 2PPQA 2CN5A 3NAYA 1OM1A 2CLQA 4LUDA 4NCTC 3AOXA 3DU8A 3HMIA 2FYSA 3I5ZA 2ITZA 2Z7QA 1K9AA 1U59A 3GB2A 4ZZOA 4RBLA 2P2HA 4P4CA 3L9PA 3LQ5A 4EBVA 2BKKA 1YHSA 4J98A 4U45A 2QC6A 2UV2A 5A14A 1MQBA 4FGRA 4P90A 3JXWA 4U44A 3MESA 4BY9E 2HZ4A 2PUUA 3QD3A 5ICPA 2R3NA 3P78A 4KINA 4GS6A 5C8KA 5AUTA 4LL5A 4EOSA 4YBJA 2W0JA 4E6QA 1BI8A 4ZTNA 4EOOA 4BCFA 3ATSA 1ZMWA 5AA8A 4R3RA 3D7TB 4XG4A 3TG1A 4JDIA 1NVRA 5KMOA 4DH3A 5AV1A 4BIDA 3VS1A 4UMQA 4MF0A 3RAWA 5JK3A 3QC4A 3RALA 4J97A 5DN3A 5JZJA 5K5NA 4CKIA 4Z7GA 2Y6OA 1GOLA 2B9JA 1W2FA 4I1ZA 4L42A 3FMLA 2C3LA 2IVVA 4NM7A 3PJ3A 4R77A 2X4ZA 5I9UA 3UIXA 3KF7A 4QYHA 5CU6A 2UZOA 3NVMB 4KKEA 5M08A 3ZXTA 3S3IA 2C6OA 4GJ3A 2OI4X 1WMKA 2UW7A 2HWOA 4PMMA 2PVMA 4R5YA 3O2MA 3Q4TA 4QQTA 2ZM4A 4JG8A 1R0PA 4WG3A 3F5XA 5C4KA 3PUPA 4BGHA 4GSBA 3H4JA 4K9YA 5CXZA 3I81A 2WGJA 5CI7A 4UYNA 1QL6A 3KK8A 1VEBA 4YJRA 5EOLA 4FKRA 1JNKA 3QQUA 4I5PA 4BYJA 5A46A 3C4XA 3HL7A 4D2VA 3G90X 4B99A 3HZTA 4ZK5A 4GK4A 3ZONA 3QD2B 4JQ8A 3V6RA 3DT1A 2ZJWA 5JZNA 5EQEA 2SRCA 3BHTA 4A4LA 2O3PA 3NW7A 1CDKA 3Q53A 2EVAA 3E8NA 3OFMA 4TYGA 2RFDA 4MD9E 4U3YA 2I0HA 5JQ5A 2VRXA