4O27B

Crystal structure of mst3-mo25 complex with wif motif
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
281
structure length
281
Chain Sequence
MADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNEFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into regulatory mechanisms of MO25-mediated kinase activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase activator/transferase
molecule keywords Calcium-binding protein 39
total genus 70
structure length 281
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o27B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o27B01
4JLCA 2IN6A 2PMLX 3DBDA 5FXRA 4O0RA 2YACA 2I40A 3RWPA 1NVSA 3LFCA 2KULA 5G1XA 3QGWA 4L46A 4GJ3A 2CPKE 3V3VA 4YJSA 2XNGA 5AUTA 2XBAA 3NRMA 4GG5A 3FUPA 5I3OA 3UIXA 4U40A 4AW2A 4NCTA 2JIIA 1RDQE 2R64A 2XZSA 3PIYA 2C6TA 3EQRA 3F3UA 3FZOA 3AMBA 4KS8A 4KSPA 4ORKA 1LEZA 2IW6A 4PP9A 4EZ3A 4F99A 5AUXA 5LARA 4EH5A 3DFAA 3NYVA 3TNHA 4A7CA 2Y0AA 1Y57A 4QP8A 1OKWA 3ZFMA 4KIQA 2UVYA 2XJ0A 2RFDA 2WAJA 5HX8A 4FTQA 3FHRA 5A3XA 4AA0A 4KB8A 4W8DA 5AX3A 3HDNA 4ALWA 4DG0E 3U8WA 5HE1A 3ATTA 2ITVA 5GZ8A 3I79A 3QRKA 4U79A 3TIZA 3PWDA 5CF6A 4YJTA 1B38A 4YJOA 1Q3WA 3NW6A 4C0TA 5HVYA 3TACA 2C3IB 4WRSA 5IEYA 5GNKA 2EB3A 3E5AA 3NPCA 4PDSA 4I23A 2GPHA 5AAGA 5T6KA 3NYXA 1KOAA 5JRSA 1H0WA 3WIGA 4JT3A 4DFLA 1WCCA 4FT0A 4I6HA 4F1TA 4L44A 3M11A 4QTCA 2C6MA 4WBBB 3Q96A 4XUFA 4MD7E 3OBJA 2GNHA 1A9UA 3MJ2A 5TR6A 3N51A 2P2HA 2R5TA 4OGRA 3UVRA 3HMIA 4YBKA 3E62A 3F5PA 1BI8A 3Q9YA 5JEBA 3EB0A 2A19B 2XEYA 4NJDA 3DTCA 4FV2A 5CEQA 3SXSA 5AUVA 4FUXA 4IHPA 4H1MA 5AR3A 5HIDA 4RC2A 5IU2A 2WXVA 4QTDA 1H1WA 4FG9A 5EQYA 2OZAA 4O0YA 4RFYA 1JKSA 3UIUA 3OCBA 3L8SA 4AP7A 4F9AA 3PLAE 2YHVA 5ITAA 1UV5A 2NPQA 4II5A 4OTWA 4CYIA 5E8SA 3R0TA 3HV6A 5LQFA 4I0RA 2W7XA 5G6VA 3P7BA 3WZEA 4U97A 2OW3A 3AD4A 3V6RA 3GOPA 2BALA 4IWQA 3N4TA 4ZSAA 2A1AB 2PZYA 4QTAA 5KBQA 4BTKA 4RGJA 3KY2A 3FMJA 2EXEA 4QMTA 3QCQA 4YZNA 1PXOA 4WOVA 3R04A 3KULB 4FIJA 3I1AA 3SHEA 3QRTA 2PUIA 5EG3A 4OAUC 2ESMA 3CGOA 4C2WA 4FTUA 4FKWA 4M67A 4Z3VA 4E93A 3OUKA 2DS1A 2HXQA 5LCKA 3W1FA 4F6WA 4IANA 4ASXA 3CQEA 1A48A 4IEBA 3WI6A 3AG9A 5TOZA 3ZH8A 4Z16A 4BCQA 3QX4A 3TKHA 3ACKA 5CEOA 1YVJA 2HZ4A 2R7BA 4JQEA 4TYIA 5FTQA 3UYTA 4B4LA 4RIWB 3Q60A 2XK8A 4WSYA 4USEA 4F64A 4N0SA 4BDKA 5EM8A 2B52A 5FWKK 5DIAA 2FSTX 1I09A 1O6LA 1H07A 3TNWA 4X2FA 2WMBA 3L9MA 3MWUA 3R9HA 3CKWA 4CVAA 1R1WA 3OVVA 4XRLA 3R9NA 3EJ1A 2CKOA 1GZKA 2WEVA 1J91A 3KQ7A 3PE1A 2GFCA 4APPA 4C37A 1JKTA 1ZZLA 5H8EA 2WFYA 5HE0A 5LWMA 2OU7A 4LOOA 3VUDA 3OD6X 2WOUA 4DFBA 3ZRKA 3GOKA 4YO6A 3BCEA 4RIOA 4IZ7A 1PW2A 5AV1A 5JFSA 2JDTA 5IZFA 3JVRA 1YXSA 2YCQA 3I7BA 1GZNA 5EH0A 2WTCA 4D4YA 4AS0A 2G2FA 4Q9SA 4PNIA 2W4JA 3JS2A 5GHVA 5CAPA 3BGPA 4FKRA 4QQ5A 1FBNA 3U55A 5E1EA 4JBQA 3VAPA 3DKOA 4DH7A 3MPAA 3ENHA 1UVRA 4FL3A 2QO7A 2O63A 2VRXA 3KVWA 4NEUA 5D12A 4FA2A 4FSWA 5L2SA 5M44A 3CPCA 3KN5A 4GG7A 3CD8A 4FKVA 4JOAA 4OAVB 4FI1A 5DFPA 3NUPA 4QMSA 4IX4A 4QQCA 1FOTA 5HESA 3OTVA 1EH4A 4QMYA 1KSWA 3UNZA 4Q5HA 1OIUA 4EKKA 3FXXA 4ZSLA 3UOKA 3WF9A 5CSHA 4BCHA 4JQ7A 5D10A 3MBLA 3PXYA 4Z7HA 5AADA 1PJKA 1DAWA 1BKXA 1ZRZA 4GIIA 1XO2B 1QPDA 2BFXA 5C27A 4PL4A 4W4YA 3LXLA 5C03A 4EOIA 4YUQA 4BCGA 3WZUA 4HNFA 4TNBA 4GVAA 1VYWA 2EWAA 4GUEA 3KXMA 4FIHA 4O82A 4C4GA 4MBIA 1WFCA 1YDSE 1J7IA 3VHKA 5JFXA 5LCJA 3LPBA 4XS2A 2CJMA 4MXCA 3A7GA 5HVJA 4FV9A 3BRBA 3Q9XA 3HA6A 2UZOA 2B9HA 3Q04A 4OTRA 3TTJA 4AZWA 3TDWA 3F2RA 2XYUA 4ERKA 3MW1A 4G5PA 3TKUA 4I4EA 3IGOA 1UKIA 2OI4X 2FB8A 3DKCA 3E93A 4CQGA 4U7ZA 2CCIA 4GL9A 4WT6A 4O7ZA 4V04A 3VBYA 2YZLA 3R02A 5KMOA 2GHLA 2VTPA 3Q3BA 3ZSIA 2XNBA 2ZDTA 4FV5A 3JY9A 4O22A 2O64A 1JVPP 1IA8A 2O5KA 2WEIA 3DA6A 1GNGA 2Z60A 3G33A 1CDKA 5F20A 2V0DA 4D1ZA 4EH7A 5KHXA 5BYLA 1WVYA 3FKNA 1ATPE 2WTKC 2PK9A 3NW5A 3QA0A 3RM7A 1LR4A 4GKIA 1ZY5A 4FBXA 2XK3A 2UZNA 1BI7A 1SM2A 2OBJA 4PDYA 3R1NA 3EZRA 3QTXA 4RFZA 5ANGA 1ZZ2A 4EQUA 2XNNA 3KC3A 4JRNA 5A14A 3S95A 2HXLA 2UZUE 4FF8A 5TO8A 5FD2A 5IH4A 1LP4A 4TKSA 4F0FA 4TYEA 3OF0A 4BR3A 3ZTXA 4Q2AA 4BCPA 3LIJA 2BRNA 3D4QA 1H1QA 5AR5A 2XK9A 3VWAA 4LMNA 3MY0A 3EQIA 3GCUA 3SXRA 3EKKA 4C36A 3NNXA 3R22A 4XG8A 3G15A 5IEXA 5M08A 3OXIA 4ZMEA 4YZ9A 5DEYA 5HIBA 4RRVA 1O6YA 2BZIB 3KMMA 5IA0A 5M4FA 4NUSA 3AC5A 4A9RA 4RG0A 4FOCA 3A99A 4QMPA 5CAVA 4ONAA 3G0FA 1VYZA 5GZAA 2QHMA 4M15A 2CNVA 4O84A 1B39A 2PU8A 1KE7A 5DRBA 2XNPA 4HVDA 2NO3A 4O7SA 3OWJA 5CSVA 3BWJA 1OMWA 5M55A 4YJQA 2R4BA 3W2QA 4WIHA 3VUIA 2XKCA 3WF8A 5JT2A 5HCYA 4CZYB 1QCFA 3HRFA 3DQWA 4TWNA 5AWMA 5DYJA 4DE4A 2F2CB 4F65A 4F9YA 2W06A 4QP6A 4CMOA 4KUJA 2XIRA 4D2SA 5L6OA 5FLFA 4FSNA 3AGLA 3A7FA 3KFAA 3HVCA 3R6XA 5A4LA 3BYMA 2PWLA 2W1DA 4WNKA 4TNDA 4ANOA 3D94A 2UW6A 1OITA 1ZOHA 3P23A 3EYHA 3QA8A 5ANDA 1R78A 4RVTA 2QOHA 1Z57A 1IG1A 4XV3A 1U54A 3D83A 4LRMA 5FTGA 3FI4A 2UZEA 2VWXA 3SG8A 4GU6A 4CFWA 3R21A 2ZYBA 2PZPA 3QKLA 4O38A 3IECA 1GIHA 3BELA 3F9NA 5CF4A 4EI4A 1KE8A 4UALA 5LVLA 2RSVA 1OBDA 3HMPA 3VHEA 5KKRC 3I60A 5H9BA 4ZAUA 2QG5A 2Z7QA 4U5JA 3PVGA 2OIBA 2UVXA 4FSRA 4CNHA 1Q97A 5EKNA 4BIEA 4ZTQA 4I21A 4O0WA 4GT4A 4UMPA 3KEXA 3CXWA 3M42A 4GT5A 3E8CA 3SOCA 2XK4A 4I92A 4M69A 3KRWA 2R3GA 4UY9A 4BIBA 3FHIA 4BDJA 4M7IA 3UMXA 4RIYB 3VJOA 4V0GA 4TXCA 2BIYA 3WF5A 2CKQA 2YISA 2XF0A 4DGLC 2X6DA 5IQDA 4D2WA 5K5XA 2WMVA 3OHTA 4J71A 3C4EA 4QRCA 2OFVA 5DLSA 3G51A 4D58A 5GINE 3K5UA 5FEQA 5DR2A 5B7VA 3FZ1A 4D2TA 4HGTA 3GCSA 2X2KA 4MKCA 4JR7A 1FVTA 4FTIA 4F7LA 1YHSA 1UU9A 3VBWA 3CC6A 3QFVA 3LVPA 3EQFA 2JLDA 2HZ0A 2GHMA 2O8YA 1PXKA 4IZYA 5CY3A 3DAEA 4LI5A 4BCNA 2V55A 3O71A 4YPSA 4QYEA 3R7UA 1KOBA 5CSXA 4F7NA 5M4UA 2WHBA 3DCVA 1OL7A 4G16A 5FBNC 1ZYJA 3M1SA 5EDPA 4JJRA 4C4JA 2XIYA 4IE9A 2Y6OA 4WHZA 2I0HA 5A6OA 1KE6A 1PMEA 3QCSA 3SC1A 1OGUA 5JKGA 3IW5A 2BRGA 5HNGA 1Q8YA 4D28A 2JKOA 4E6DA 2UZDA 3KXXA 2VTNA 1REJA 2XRUA 5HO6A 5I9YA 4WA9A 3D7TA 1Q5KA 3I5ZA 3IPHA 2CMWA 2XK6A 5FRIA 2B1PA 3NR9A 4ALVA 4BDBA 4CT2A 1G8AA 3GGFA 4MNEB 4B6LA 3K3IA 4M97A 2W4KA 3EN9A 5E8WA 3Q4UA 3BQRA 4FTRA 4IAKA 3GC8A 2XUUA 1ZMUA 3G9LX 3MI9A 3TN8A 3WE4A 4LGDA 4CFVA 2BTRA 3ANQA 1DI9A 1OECA 4KINA 3I81A 4R6VA 3QTQA 3O17A 1ZARA 2VWUA 2IVUA 3QCYA 4FKJA 4ZLZA 5KX8A 3H4JA 3ZC5A 5F9EA 4BVUA 3F2NA 4IAYA 2VWWA 3NNWA 5A6NA 5HO7A 1KE9A 5B0XA 3FE3A 4FSUA 5A4TA 1P14A 2R3NA 4PTEA 4CFXA 4I24A 3VS7A 4TWPA 4DINA 2G15A 4U0IA 3MV5A 2B9FA 3HP5A 4C3RA 1OBGA 2CGVA 5AIKA 5BVDA 2PUNA 1KV2A 1JLUE 5JQ5A 4BDCA 2GNJA 4S30A 1KE5A 2WMQA 4O96A 3RHKA 3LLTA 2YIYA 3VULA 3SD0A 4IB3A 4OR5A 2ZM1A 4LQMA 3K54A 1U4DA 3ZZEA 5HBJA 3LFBA 2VNYA 4U42A 2Y8OA 2Z02A 4EUTA 2YCRA 3R83A 4G3DA 5B2MA 2HWPA 3OCSA 4BBEA 4F0GA 3OTUA 5HOAA 2XEZA 4YBJA 2XNOA 4MH7A 3DZOA 5E8UA 2PPQA 3F3ZA 5D1JA 3G6HA 1YWRA 1P4OA 4I5HA 2OZAB 4U80A 3OP5A 4IJPA 4L7SA 2X7OA 5I3RA 2IVVA 2VV9A 2YDKA 3FAAA 4QT1A 3V5PA 4ARKA 4EOLA 4QQTA 3COIA 4FTNA 4IQ6A 5F4NA 1JKKA 5D9HA 3ROCA 3TI1A 4UWBA 5KMLA 2C6KA 1XH4A 5LVMA 4EHVA 3NWWA 2C6DA 3C0IA 4UX9A 3QD3A 4FZ7A 4ZZNA 1F3MC 3NYNA 2W1GA 4Y85A 1QPCA 2ITXA 4R77A 1M17A 3RNYA 4BZNA 3PIXA 1CKJA 3BYUA 3HV4A 4ZIMA 3TZMA 3E8EA 4C8BA 4F08A 3UOJA 1ND4A 4EOSA 1XBBA 4FC0A 1F0QA 2JIVA 4AA4A 2JKQA 2VTQA 5IUIA 4DCAA 3D2IA 3ORTA 3QQUA 4JI9A 4KRCA 5IA5A 4PMTA 4YZMA 4IVAA 3QTUA 3UP7A 3N4UA 2XCHA 4LOQA 2YIXA 4UWCA 3MFTA 4O21A 3ORNA 3IOPA 1Y6BA 2RFEA 5EKOA 2F7XE 3MJ1A 5AP6A 1FGKA 1BLXA 2PUUA 4AGDA 3BKBA 2F7EE 3HV3A 4IAZA 4DG3E 3T9TA 4YTFA 3NUSA 3PZEA 2QO2A 5BNJA 4O7VA 5L2IA 2R7IA 3ZLXA 3UE4A 4PY1A 2J2IB 2BZJA 3QD0A 4D1XA 1LUFA 4P7EA 5M4CA 5FG8A 3WZDA 5E8XA 3CTQA 4XG4A 3L9NA 4KNBA 3RAHA 4FSTA 2YITA 4ANBA 1Q3DA 4AQCA 3P1AA 4EK8A 4HVGA 1XHAA 2WPAA 3JY0A 4L68A 5AR2A 3UODA 3KB7A 4DC2A 4EYJA 1UU3A 3DY7A 2QU5A 4GYGA 4KD1A 4C38A 2DQ7X 5M07A 5EYCA 2BCJA 2R3FA 2X4ZA 5CVGA 5HE2A 3TUBA 3HGKA 1Q61A 4RJ7A 3W10A 2ONLA 2XMYA 5KBRA 4EK5A 4J97A 5I0BA 2WTVA 3Q9ZA 3AQVA 4X7QA 2GDOA 4O91A 5HBEA 3U51A 4P5QA 2QC6A 4FE2A 1H25A 4MWHA 1PXIA 3QU0A 4EONA 4K9YA 4XMOA 4C34A 2X9FA 3ZONA 5LVOA 5IEVA 3MDYA 3ORZA 3ZEPA 4DN5A 5AAEA 5EW9A 3C4CA 4LG4A 3DBQA 3PP1A 4CKJA 4H36A 1H28A 3GU4A 2ITWA 4HYSA 2RIOA 4XG2A 3VUTA 4DLJA 2VX0A 4I6FA 4ANQA 2GNLA 2UZWE 1H0VA 3D5XA 5CU4A 4YJVA 5DR6A 3NNVA 3OWPA 4TYHB 2ZDUA 2R3HA 5DNRA 3RAWA 3EFJA 1Q8TA 4MXXA 2XA4A 2NNWB 4DG2E 4HW7A 4FKUA 1K3AA 1VEBA 2JAVA 3LFNA 3LFEA 4XRJA 4QP3A 2BAKA 3BGQA 1Q62A 4YZCA 3TJDA 5ETIA 4EH3A 4DTAA 4YTIA 3O23A 4L8MA 1FPUA 3NMUF 3OOGA 2ZM3A 4HZRA 4ACCA 2X4FA 4MX9A 4R8QA 3ROYA 4C61A 4GK4A 4M13A 5K5NA 3LHJA 5CU3A 3R7EA 5EQPA 3NIEA 1FMOE 4CQEA 3LCTA 4E3CA 4FX3A 3EH9A 4EZ7A 4N6YA 3MH0A 3P86A 4FSYA 2B54A 3AC4A 3HV7A 4X3FC 3FXZA 5HU3A 3TUCA 3KXZA 4IH8A 3E3PA 2W1HA 3MGYA 3OG7A 3Q32A 5E7RA 3PXQA 3SGCA 2WTIA 4GUBA 4A9UA 1HOWA 1SNUA 4FGRA 5GIOE 1LEWA 5T3QA 2FO0A 3O96A 3E63A 2XIZA 3C7QA 4FKGA 2VTJA 4OTFA 4AU8A 4D0XA 1PY5A 1CMKE 4I0SA 2ITQA 5HG5A 4IB5A 2BKKA 1OL5A 5CENA 2WMWA 2WTKB 3Q5ZA 1ZMVA 4FKPA 5EHOA 3W2CA 4AWIA 1CSNA 1RJBA 3BLQA 3F5XA 4H3PA 4YC3A 4EOQA 3K2LA 2ERZE 4IDTA 4L3JA 4WRGA 4RC3A 3DGKA 2J0MB 4QP4A 2A27A 4TYHA 5L6PA 3ZZWA 3ZSHA 4J53A 1YHWA 4QMUA 4NCTC 1TQPA 3HECA 3OT8A 3FLZA 1WBSA 4NSTA 3UOHA 2GTNA 3ID6C 4L67A 4FNWA 1FMKA 4LGHA 2PVMA 4GK2A 2IPXA 4EH6A 3DBEA 2X1NA 3UQGA 3OWKA 5ANEA 2JD5A 4F9CA 2ZMCA 4L01A 4DT9A 3HMNA 4O0UA 3QGYA 4HYIA 2YM6A 3C0GA 4F9BA 4DEDA 5AV2A 1OI9A 4TPTA 1AQ1A 1YRPA 5K3YA 4FIIA 2F7ZE 3HMOA 3KCFA 2YN8A 3GT8A 4IX6A 4I6QA 4JBPA 3Q6UA 4JG7A 5AUZA 2W1CA 4BCJA 4D9TA 3P7CA 5CNNA 3NUUA 4XP0A 3BU6A 5GJFA 4KA3A 4U9AA 3QHWA 4EBVA 5IQGA 2YM3A 4NT4A 2BHHA 1DAYA 4RX9A 3HAMA 3WIKA 4F70A 2QLUA 5T68A 4USDA 4IW0A 4E6AA 1L3RE 3MESA 4FIFA 5CT0A 2W0JA 4J8MA 3LAUA 3CY2A 4FTKA 3DK7A 4DT8A 2R3IA 2LAVA 2G2IA 3ZEWA 2QCSA 4QP9A 5DG5A 4NTTA 3PXKA 5TKDA 4I4FA 2EB2A 5ETAA 2OXXA 1OB3A 5AP4A 3DZQA 4JNWA 1J3HA 3QD2B 1Q41A 2W9ZB 5AFVA 3HNGA 4E4MA 3VS5A 3QRIA 4BKJA 5CZHA 3UP2A 2VO7A 2O3PA 3MPTA 5HIEA 3RM6A 2WQMA 4KIKB 5J5TA 2J0LA 2BDJA 2WKMA 4ZXTA 2C1AA 4U3YA 2CGXA 3GFEA 3FLYA 3AOXA 4H39A 4OBOA 5HTIA 5IA1A 2JKKA 4M0ZA 3GP0A 4BDHA 4S34A 2W17A 5M51A 5CLPA 3GEQA 3N4VA 3UGCA 3LXPA 5HG9A 2OJFE 5HI2A 5L6WL 3W2OA 4BCFA 4DITA 5EI8A 3R8LA 4JAJA 2UW8A 2ETRA 2FA2A 3UZRA 1YOLA 2UW9A 3VO3A 3E8NA 5AR7A 4FTLA 2VTHA 3OY1A 1R0PA 2ZV2A 3VBXA 3UZPA 4AN3A 4QYYA 5KMMA 4ID7A 2OK1A 4LFIA 3LFFA 5DE2A 3CKXA 4F1OA 4W4XA 5BVWA 3TV4A 4QMVA 4K77A 5AA8A 4EORA 4FEWA 3QQLA 3A4PA 2VO0A 1NVRA 1Q24A 2XRWA 3ET7A 3TL8A 2C4GA 4O81A 3CLYA 4FGBA 4A9SA 2B7AA 2VX1A 2R3RA 1H1PA 5E1SA 3H0ZA 3V6SA 4ANLA 1PYEA 4CG8A 4E73A 4IM3A 4MWIA 4WG4A 4QMQA 3ENMA 1YDTE 2J90A 2Y7JA 5GZ9A 4W9WA 3SW4A 3VBVA 3MB6A 5A4QA 2UUEA 3R8ZA 2ZB1A 2ZB0A 3FJQE 2OLCA 4XG9A 4PQNA 4BDGA 5HEZA 2C0IA 3MIYA 3JXWA 3CQUA 2JBPA 3MA3A 1BL7A 3GNIB 3ELJA 4J7BA 3ZDIA 5EDRA 4O0TA 3FMLA 2F57A 2Y9QA 3SRVB 1O9UA 5F1ZA 4G3FA 4AAAA 3LCOA 5H8BA 2YM5A 5IISA 3SKCA 3ULZA 5ETFA 2FVDA 4C3PA 3B2TA 3GENA 4X2JA 5CI6A 5GIPE 2OJ9A 2XVDA 5CAUA 4WO5A 4C58A 4CSVA 3EQHA 1PXNA 2CGUA 4DTBA 2PL0A 2ERKA 1SVGA 3FDNA 3I7CA 3B2WA 3RHXA 3EQPA 4GCJA 4DHFA 3HEGA 1XKKA 1HCLA 3HX4A 4BCIA 4OTPA 3KA0A 2ZM4A 3QX2A 4HVSA 5HTBA 3R28A 2YIRA 4WG5A 4WG3A 1OKVA 4PPCA 3ZC6A 1STCE 1UWJA 3IK3A 4GH2A 3ETAA 3LE6A 5DPVA 4MNEA 3QUEA 3DXPA 1CM8A 1M52A 4XBUA 4BB4A 5JGDA 5FP6A 5CXZA 3Q4CA 4A4LA 3DBFA 5EYDA 1XBCA 2J5EA 2IVTA 3MN3A 1J7LA 4LV8A 5C4LA 4JIAA 2AYPA 3BV2A 4GW8A 1H4LA 3L9LA 3ORIA 4RVKA 5IQEA 1XBAA 5KZIA 5KE0A 4ANNA 4RSSA 2XIKA 4FKQA 3KULA 3WILA 1ZYLA 3KK9A 3FPMA 4FV0A 4X3JA 3NUNA 2J0KA 3EL8A 3ZO1A 2ZV9A 2WQNA 1FGIA 4YGAA 3W33A 4AE6A 4QMMA 4ZY6A 5IMXA 4IC7A 1JNKA 2VWZA 4F7SA 3OCGA 5A46A 4EH2A 5EYMA 3CIKA 5HE3A 3BE2A 2R0UA 2FSOX 3EL7A 3ZRMA 2BAQA 3O8TA 4AN9A 4C4HA 3RAIA 3DNEA 4YJRA 3HKOA 4ZJIA 2WU6A 3FKLA 1REKA 2G1TA 3UQCA 3A61A 3DS6A 3KF7A 3VBTA 4NTSA 1MP8A 1SMHA 2C5XA 1YOMA 1MRVA 3BBTB 4HVHA 1UNHA 4EOMA 1CTPE 4CFUA 3P0MA 2PVRA 4ZTRA 3R2BA 1FVVA 5IQAA 1PXLA 1YWNA 2IZTA 2BVAA 4GEOA 4IVBA 4JBOA 4YURA 2VTLA 5E8VA 5AV0A 2PE1A 3PVWA 3BGZA 5JRQA 2WO6A 4HZSA 5DH3A 5DHJA 3R7VA 2BDFA 4BDIA 3AC3A 5JK3A 2A0CX 1XH5A 2GMXA 3C5IA 5CSPA 1NVQA 3ULIA 4A9YA 2B9JA 2Z7LA 3A8WA 3FYKX 3FZPA 3LCDA 3MFRA 4IADA 4MXAA 5J8IA 3WF7A 4C02A 2HOGA 3ZO3A 4D4VA 5EQEA 3R1QA 2VU3A 3LQ3A 2C6LA 1ZXEA 2DWBA 4FIEA 1I44A 2QR7A 4JR3A 2BUJA 4K33A 1R3CA 3UIMA 3QBNA 4TWCA 5CVHA 5DA3A 5TT7A 3P79A 3ZFXA 1DS5A 4IB0A 2VGPA 2J0JA 2X8DA 3I4BA 4YJUA 4HNIA 4FL1A 4L9IA 3EOCA 4BYJA 3II5A 2QOLA 3SQQA 4CD0A 4CV9A 4H05A 4JDIA 1R39A 3VBQA 4R7BA 4GYIA 2GNIA 4LGGA 2YJSA 4FL2A 4M3QA 4MEDA 2R3MA 1JOWB 3DB6A 4F9WA 2XS0A 1ZYCA 1J1CA 1S9JA 1H08A 5E8TA 3RJCA 1GZOA 2OZOA 5EFQA 2H96A 3FY2A 3RAKA 4DBNA 2B0QA 4G34A 4Z9LA 1PRYA 1H26A 3ZLSA 2JAMA 3FZTA 2QOKA 4TRLA 1UNGA 3BYOA 4XCUA 4DLIA 5C8NA 1UA2A 3IW6A 3CTHA 2ETMA 1SVEA 1YI4A 2I0VA 1H1RA 3QC4A 4MF1A 4BL1A 2I7QA 2CDZA 4CLJA 3NYOA 3PPZA 3SXFA 3T3UA 4N4SA 5AM6A 4RX8A 2BMCA 5AP1A 3QYWA 2J9MA 2UZVA 3FMEA 3U87A 4TYGA 3R9RA 5CQWA 3PSBA 3FMHA 3LMGA 4AF3A 5AIRA 4I94A 4GT3A 4ANSA 2C47A 2YAAA 2EXMA 2XB7A 3RP9A 2C3JA 5DT3A 4AZFA 4AN2A 2HY0A 3SA0A 4YR8A 3ATSA 3DTWA 3DK6A 3PXFA 4H1JA 4QO9A 4YZDA 5DN3A 4BGGA 3IW7A 2PE2A 4IACA 4CG9A 4NL0A 5IUHA 1BL6A 4ZTMA 4JIKA 2P4IA 4JL9A 3D15A 5JSMA 3A60A 3F88A 4E6CA 2YAKA 4CZTA 4AZTA 5HLWA 2ZV7A 4ZZMA 1NXKA 4I5PA 1MQ4A 5BMMA 2OIDA 3EQBA 3IGGA 4G6OA 4BBMA 2GQSA 4FV8A 2DYLA 4Y5QA 3KGAA 5EYKA 3UQFA 2XM8A 2XCKA 4XV9A 3RCJA 3SW7A 1J7UA 2CLQA 1MQBA 4IBMA 4NKSA 2QODA 3V5QA 2WMSA 1Z9XA 4HYUA 2PZ5A 4PMPA 2HZNA 1H24A 4X6QC 3EMGA 2QOOA 2F4JA 3HDMA 3DXNA 4RT7A 3KXHA 5AV3A 4EYMA 3FV8A 2LGCA 2VWIA 5BUJA 4YC8A 3QTWA 2X8EA 3A7JA 3O8UA 3PLSA 1YI6A 3K3JA 4JG6A 4JS8A 5CSWA 3TJCA 3QLGA 4C57A 3FL5A 3QZIA 3DNDA 4A4XA 4IAAA 2V7OA 2XJ1A 3FLSA 2I0EA 5K0XA 1OKYA 1OUYA 3I0OA 3MSSA 4JQ8A 4EL9A 3VS0A 4FTAA 3O7LD 1M2RA 1JSVA 4ACDA 2CNQA 4FUYA 4EBWA 4CT1A 2P0CA 4B9DA 2IJMA 2UZTA 5HTCA 4D5HA 4BN1A 3BX5A 3WOWA 3TZ8A 4EKLA 5IPJA 4X6RA 3VF9A 3SVVA 3ZUTA 3UNKA 1H8FA 4FSZA 5AA9A 3ACJA 4FZ6A 4YO4A 5A4EA 4ASEA 2YZAA 3QWJA 1YXUA 4R1YA 2XYNA 3DJ5A 1YHVA 4X2NA 4EWHA 4IXPA 3IDPA 4BDAA 5J9ZA 3IDBA 4ZOGA 3OC1A 4NZWB 4YTCA 4FMQA 4Y95A 4AFEA 4CCUA 4KWPA 4D2PA 1APME 4FSMA 5BYZA 3PJ8A 2UZLA 3EFWA 3PPJA 4IIRA 3QZGA 1JKLA 2WIPA 4MXOA 4M14A 4QMOA 4AGWA 3UC4A 5CU2A 2BDWA 3NUYA 3DAKA 2JBOA 3G0EA 4G9RA 4I6BA 2R3JA 4KRDA 1DM2A 4JDKA 3BEGA 5HG7A 2JC6A 4K6ZA 4FTCA 4J96A 4TZRA 5EI6A 4F09A 3BQCA 4QMXA 1ZAOA 1WMKA 1Y8GA 3R73A 5KMJA 4MHAA 4HGEA 1J1BA 5ANKA 4NM0A 1BX6A 3V04A 1OPLA 2W9FB 1G8SA 2ZMDA 3KRLA 4MXZA 2VTTA 4FTJA 1YQJA 4WD5A 3FMNA 2RL5A 1JAMA 2C3KA 1M7QA 3CJGA 4G9CA 2ETKA 4MD8E 4RC4A 4TTHB 2YCSA 2G01A 3LXKA 3A7IA 4KSQA 3H10A 3R01A 2C5YA 3JYAA 5HNBA 3R8PA 4HCTA 2GS7A 5IA3A 3DBCA 3AC2A 4FYOA 5AP2A 3R8MA 4F0IA 4QYGA 1IEPA 5AUUA 3Q9WA 5EI2A 4ZZOA 3NNUA 3ORLA 3EZVA 3E8DA 4RQVA 3S1HA 5C01A 3F3WA 3TT0A 2YLFA 2BRMA 4FEXA 3ANRA 4ZTSA 4K2RA 1IASA 2XJ2A 4XP3A 4D0WA 4FODA 1K9AA 3RZFA 3RBWA 2VD5A 3REPA 4BZDA 1IAHA 3C51A 3PSCA 3QTIA 4OBPA 4G3CA 2WMRA 4O7RA 2CN5A 3ALNA 4P5ZA 3KL8A 2OFUA 2XKFA 2PZRA 3RPVA 4V05A 3ZS5A 3T9IA 2WTDA 3FPQA 4UN0C 4LRJA 1Y6AA 2HENA 2QI8A 3QUDA 3WARA 2C6OA 1SVHA 2X7GA 2GQGA 3UJGA 3F69A 4CYJA 5LJJA 4NIFA 3R71A 3PDTA 4BICA 4I22A 4KBCA 4MQ2A 4XBRA 4YHTA 5ICPA 5LVNA 4L00A 2B9IA 5LXMA 2ITTA 4DEAA 3ORKA 4FG8A 2PVJA 4HCVA 4RLLA 1UKHA 4AW0A 4PUZA 4BTFA 5HGIA 1GIJA 4CTBA 4EQCA 4I20A 3SV0A 5CNOA 2CN8A 2EVAA 5DWRA 4FTOA 4L45A 4TT7A 3U9CA 3SDJA 5CEIA 1JQHA 3CSVA 3B8RA 5EOLA 4A9TA 4E26A 4LUDA 4TN6A 5JN2A 3CY3A 4O6LA 2GNGA 4WUAA 3FC1X 1WZYA 4RWLA 4ASZA 3QLFA 3ZU7A 3VS4A 2OG8A 2EU9A 4NK9A 5J9YA 4H3QA 3SRVA 4R5YA 4FV6A 3COKA 3EQCA 1QPEA 1MRYA 3U6HA 5BUIA 2WIHA 2ACXA 1ZOEA 3F66A 4MXYA 2W1IA 3W8QA 2OJJA 2OWBA 4BHNA 2C5OA 3ZBFA 4FG7A 3D9VA 3DV3A 3GU7A 3G2FA 4RPVA 2BILB 4DEIA 3U6JA 4RJ8A 3QUPA 3T3VA 4AX8A 1Z5MA 4DGOA 4V0GB 4ZS0A 3LJ2A 1W8CA 3ZUVA 4GIHA 1W7HA 3FZRA 1GIIA 3ZCLA 4LV5A 3EN4A 3MIAA 3R8UA 2AC3A 1WBTA 3LFQA 3Q4TA 4TL0A 2V62A 4BKZA 3GQIA 3EN5A 3PPKA 4D4RA 3OS3A 4OTDA 2VNWA 3V51A 4RLKA 3EFLA 4I3ZA 4S32A 5L8JA 1LPUA 3OY3A 3FMDA 1ZLTA 2GHGA 2H9VA 4D2RA 4G5JA 4HCUA 1S9IA 4C35A 1PXPA 3FQEA 3DK3A 3ZUUA 3LCSA 3ERKA 2BROA 3EKNA 4G2FA 3RPSA 3G5DA 5DT4A 5CEKA 2ITPA 3FC2A 4NYEA 2E9OA 3V01A 4RX5A 4MBLA 4BWPA 2UW7A 2VUWA 4GFGA 3RVGA 3MVHA 2YEXA 4NW5A 3O0GA 2BIKB 2UVZA 4ZJJA 3V5LA 1ERKA 2GCDA 5KHWA 4R7HA 2JDOA 3FBVA 3D7ZA 2YDJA 4ZS4A 5J1WA 2Q83A 3GC9A 4ITIA 2QQ7A 3DKGA 4C59A 4H58A 4L52A 3QCXA 2RF9A 5AX9A 4QP1A 5IDNA 4OW8A 1OPJA 3HMMA 3P7AA 4NFMA 4DBXA 3AC1A 4DEBA 3BLHA 4DH8A 1SYKA 2BRHA 4YLKA 3F5GA 4BDDA 2YM8A 2HCKA 3BEAA 1Q8ZA 4B8MA 1OIYA 2H34A 3AD5A 4Y72A 2RFNA 3OT3A 2JFLA 4EK4A 2X2LA 4U41A 3TKIA 4AXAA 3ORPA 2J5FA 3OW3A 3C4FA 3UG1A 4RA5A 4ZY5A 5IG1A 2VTOA 2PVYA 3MY5A 4K0YA 2V22A 2RGPA 5IUGA 1YOJA 3BPRA 2O65A 4Q5EA 3CEKA 3TXOA 2X7FA 3OZ6A 4XJ0A 4AOTA 2YABA 3COHA 5ACKA 2BR1A 5CU6A 5J1VA 3W2PA 1YXTA 1MRUA 2CSNA 3Q2MA 1OM1A 2PMIA 4GRBA 5DEWA 1DI8A 4RJ4A 2F9GA 2I6LA 3S2PA 4FV4A 5FP5A 5JH6A 2Z7RA 2W5HA 4B99A 2PVKA 2BFYA 3CQWA 3R1SA 3LOKA 5AR4A 4ZTHA 4IZ5A 4FR4A 2ZVAA 2UV2A 4IAIA 4UYNA 4W9XA 3TZ9A 5CEMA 4DH3A 1RQQA 4KIKA 4AG8A 4ZLOA 3ODYX 4M84A 5LMAA 3CR0A 4E5AX 3TDVA 3FSFA 3C0HA 1BYGA 3IG7A 2J4ZA 3MH1A 4QMWA 3R9DA 4R7IA 2IW9A 5EW8A 3SLSA 3WBLA 4YLJA 4BRXA 1NW1A 4USFA 4ZJVA 4EH4A 3LZBA 4BY9E 1FINA 3C4ZA 4MF0A 4YHJA 3LCKA 3SAYA 3BV3A 3ALOA 3UVQA 5BVFA 2W1FA 3BHVA 4JX7A 5J5SA 2J0IA 2R3KA 4MD9E 5A4CA 1A06A 4O1OA 4H3BA 4RBLA 3ZDUA 3FLNC 3GU5A 3QTRA 4LRKA 4DFZE 5BPYA 4UMRA 4WNOA 4F63A 1L8TA 1W0XC 3QQJA 3BYVA 4CMUA 2HZIA 2PTKA 4G6NA 3CS9A 2JKMA 3BHTA 3EN6A 2FUMA 5L8KA 2R3OA 3E87A 3VN9A 4FKSA 4YU2A 4I1ZA 3FMMA 4BFMA 4AFJA 5A9UA 4O7TA 5HLPA 3ZBXA 4FT3A 4U8ZA 2OSCA 2W96B 4YC6A 1GJOA 3PG3A 5I5ZA 3DDQA 3OFMA 1M2QA 3NEWA 3HL7A 2C1BA 4IM0A 4U81A 4RJ5A 3NSZA 4G31A 4D1SA 3WYXA 3NAXA 3B8QA 1URWA 3Q53A 2IZSA 4XLIA 2XM9A 4C3FA 2PMNX 4WKQA 2OGVA 4XLVA 3DT1A 5H3QA 2FH9A 4YHFA 3L8XA 3PSDA 2C6EA 4W4VA 3I5NA 4DFXE 4UEUA 3W32A 5M56A 4EWQA 4XEYA 1GY3A 4AW1A 3LW0A 4GU9A 3KN6A 1XJDA 3NUAA 3V5JA 3AT4A 3TG1A 3WYYA 4EK6A 4DA5A 4E6QA 4PV0A 3HP2A 2WB8A 3P08A 1XWSA 3LM5A 3H3CA 2IG7A 3IQ7A 3D5VA 1U5RA 4OBQA 2R9SA 2ITZA 3EIDA 3DLSA 4KIPA 5EDQA 3DAJA 1PKDA 4CFNA 3GQLA 4QNAA 4L53A 2DUVA 3MFSA 3CPBA 2E9VA 3LQ5A 5ACBC 4KKHA 2VTAA 3EYGA 3F7WA 3BZ3A 3P4KA 3VJNA 4AOJA 3FI3A 3R7GA 4GFMA 2PZIA 4J99A 2A2AA 3PZHA 4NJ3A 3RWQA 1OKZA 5IH5A 4YNEA 3LJ0A 2JFMA 2JGZA 2PVFA 2PVNA 3A4OX 4UZHA 4XG7A 1IRKA 5ANIA 2YM4A 3R7OA 4BI2A 5JGBA 5M53A 2Z7SA 4PX6A 1H01A 3L8PA 4QQJA 5LOHA 2UW4A 5M09A 3T8OA 4UMTA 5LWNA 4N70A 4BBFA 4RA4A 4YJNA 3CP9A 2JITA 2R2PA 3PY0A 2SRCA 2WGJA 4FNXA 5H8GA 1XH9A 2O2UA 4HVIA 2OKRA 4G17A 3A2CA 4ZP5A 4HGLA 3RTPA 1IR3A 2PVHA 2H6DA 4FYNA 4O6EA 5HLNA 5C8KA 3FYJX 4QNYA 1K2PA 2CGWA 4L3PA 4S31A 3UYSA 3SG9A 5E91A 4RQKA 2VX3A 1OUKA 4HOKA 4MNFA 5F94A 3MB7A 5CI7A 5C9CA 4DFNA 2WQEA 4IX5A 3RINA 4D55A 4RIXA 5AP3A 4FK3A 5FM2A 3S4QA 4FEQA 1QMZA 5EOBA 3AXWA 3HRCA 1JBPE 4FZFB 5FQDC 4U45A 4BIDA 4B8LA 4S33A 4C4IA 4CZUA 5EM5A 3OWLA 4IZAA 5IDPA 5D7VA 3ZLWA 5CX9A 4D2VA 4I5CA 2XBJA 4QPSA 4BGQA 3HV5A 1OL1A 3D5UA 3KU2A 2HYYA 3F3VA 3P5KA 4U44A 4O83A 4EEVA 2QR8A 1V0BA 1PMNA 3MVMA 3ORXA 4QTBA 1Q99A 3QRJA 1VR2A 5AM7A 4RJ3A 4DTKA 3FKOA 4DEEA 5FDPA 3IO7A 2VTIA 4Y5HA 3G6GA 4BI0A 2W99B 5CQUA 5CVFA 3OEFX 5BVNA 3HZTA 5CF5A 4FEVA 1YXXA 4EH9A 5FUTA 3PJ1A 3TNIA 5M57A 3RALA 4PP7A 5IKWA 4CMTA 3W8LA 4AT3A 5I9ZA 2I0YA 3TV7A 5CEPA 3GB2A 3KMUA 1Y91A 5CTPA 2Y6MA 3BI6A 5CYIA 4AW5A 4YMJA 4PMMA 3QWKA 3VUGA 1WBNA 4FSQA 2ZAZA 3CD3A 2HIWA 3C50A 4YLLA 4ASDA 3FSKA 2VWVA 3L1SA 3LFSA 2QHNA 1M7NA 3EQDA 2QOCA 3OOMA 4KKEA 5I9XA 5JZJA 2VZ6A 1XQZA 3PXZA 3DKFA 1GOLA 3MY1A 1TVOA 4ZTLA 5DR9A 5AUYA 4WBOA 1PF8A 2JEDA 4ANMA 3TNPC 4M12A 5I9WA 4CEGA 2WU7A 4RIXB 5LVPA 4FTMA 4XX9A 4ZMFA 3ORMA 3C4XA 4ZSGA 4ALUA 4K18A 1WBPA 3MS9A 3VIDA 1W83A 3F82A 4EJNA 3V5TA 5HICA 5ANJA 4BGHA 4ENYA 2PYWA 1W84A 3R2YA 2IWIA 2BZHB 3EWHA 1URCA 1U54B 4XNEA 4JRVA 3NGAA 4P90A 5AJQA 3QL8A 2FSMX 3KMWA 3NDMA 3QXOA 4XYFA 5DI1A 3KRRA 2YIWA 1NT2A 2OF4A 3H9FA 4EHEA 1E1XA 4FKOA 2RG6A 2X2MA 3CJFA 3DJ7A 4PL3A 3E7VA 3UC3A 3ZLYA 2VN9A 3PJCA 4PF4A 4IAFA 4FK6A 2FGIA 2QU6A 4OT6A 3VVHA 4BDEA 4DEHA 3TCPA 2OH4A 2OH0E 5KZ0A 4YSMA 4O7LA 2UW0A 4LYNA 4AGUA 4FV3A 4UMQA 4A06A 4LMUA 2VGOA 2ZV8A 1H27A 4O0SA 4UB7A 4AT4A 4E8AA 2J51A 3NVKI 3PJ2A 2X6EA 3RI1A 2WTWA 3W2RA 5BQ0A 1W82A 4MAOA 3ZFYA 4YZBA 4XP2A 3FL4A 3S0OA 3GU6A 4M68A 2HW6A 5BVEA 3CCNA 2C69A 3V8SA 5IA2A 4G6LA 2CHLA 5CALA 3QKKA 4RMZA 5B2KA 1WBWA 3R1YA 3BYSA 1P4FA 3MTLA 1E1VA 2IVSA 1PMVA 3AMYA 4E4NA 3QQKA 4RVLA 2EXCX 3IDCA 5EHYA 2WD1A 3FQSA 5CXHA 4CKRA 1YXVA 2OXYA 3TWJA 4Q9ZA 3FWQA 4KIOA 2C5VA 5AP0A 1V0PA 4UMUA 3GI3A 3VRYA 4X3FB 1XH7A 2C0OA 2RKUA 3R00A 3NCZA 2W5AA 1HCKA 4AACA 1Q8WA 4PNKA 2Q0NA 2QO9A 5FEDA 4DGNA 2WQOA 2IW8A 5HU9A 4B0GA 3D7TB 3LJ1A 4UXLA 3CTJA 4YJPA 5J95A 3GXLA 3QF9A 5IQFA 5BMSA 5E8YA 4FKIA 1AD5A 3L8VA 3OW4A 3RMFA 5LMKC 3Q6WA 4I41A 5KMIA 2BKZA 4PDOA 3I6WA 4NWMA 2E9PA 3QZFA 2PVLA 2IO6A 4ZSJA 1XH6A 5M06A 4F1MA 1KV1A 3FI2A 3W55A 2Q0BA 4E20A 5A54A 4E1ZA 3RNIA 3UIBA 2XNMA 5ANOA 4AZEA 4R78A 4FZDB 3O50A 2CCHA 3MA6A 4AZVA 1OPKA 4KS7A 3HUCA 5FEEA 3KK8A 2P2IA 4MBJA 1WVXA 2JDSA 4UBAA 4L43A 4XG6A 2C5NA 5IQIA 3BU3A 2X39A 4IWOA 2VO6A 4DF3A 3ZHPC 5AP5A 5CZIA 4IWDA 5IMEA 4RZVA 2WTJA 3COMA 4A07A 2QOFA 1KWPA 2IZUA 4HGSA 1SNXA 4O0XA 4GMYA 3HLLA 1GZ8A 4Y8DA 2BTSA 5HO8A 2VAGA 4M0YA 3ZMMA 2P55A 1M2PA 3QTZA 4GS6A 5BX0A 4FEUA 3D2KA 4X2KA 5KNJA 3C1XA 4OT5A 1W98A 3AMAA 4F4PA 4HJOA 4F6UA 2VTMA 3DLZA 3P9JA 4RIWA 2H8HA 3DXQA 1PHKA 5B2LA 3VC4A 3ZSGA 2R3LA 4OLIA 2E9NA 1UNLA 3BU5A 1PXJA 4W4WA 3JUHA 3I6UA 4BDFA 4E7WA 4I93A 4QTEA 4K8AA 2X9EA 4PRJA 1WBVA 2BHEA 4CLIA 5C8MA 1P2AA 5AMNA 4C62A 2YM7A 3UPZA 3UBDA 5J7BA 3D5WA 2QURA 3JVSA 4XG3A 3A8XA 4ZEGA 4L42A 4AE9A 3EN7A 3PWYA 4O2ZA 4BCMA 4EC8A 2BAJA 3FLWA 4IC8A 4JX3A 3U4WA 3ZOSA 4QPAA 2JDVA 4M8TA 4S2ZA 1PKGA 4BI1A 3GC7A 4EZ5A 2VTRA 1OIRA 2HY81 4AOIA 4PDPA 1ZY4A 3W2SA 2QNJA 3C4WA 3SX9A 1B6CB 2JDRA 1NA7A 2Y4IC 5J87A 5F95A 5JGAA 4R5SA 4YP8A 3MYGA 4BKYA 4BC6A 2WNTA 5CWZA 2PY3A 4FVPA 4HPUE 4PTGA 4XV2A 3TTIA 4BZOA 4OTIA 4MQ1A 4BCKA 5J7HA 5BVKA 4UYAA 5HG8A 2REIA 3R7IA 4BYIA 4YNOA 3RKBA 4K1BA 3PP0A 5EM6A 5HVKA 5IF1A 3FEGA 3BHUA 4M69B 3TZ7A 3S00A 3GCPA 4BTJA 3FZSA 2PSQA 3DJ6A 2J6MA 3MVLA 4IFCA 1AGWA 2YIQA 4EH8A 1JSUA 4MCVA 4FNZA 3HYHA 4E5WA 5H2UA 5D11A 3VS6A 3LLAA 4PPBA 3QZHA 5K0KA 1V0OA 1G3NA 3LFAA 3VW6A 3IW4A 1VJYA 2HWOA 3RPOA 3PJ3A 3LXNA 2ITUA 5E9EA 3BLRA 2HAKA 5IQCA 1JPAA 2GNFA 3BIZA 4QMLA 4J95A 2QD9A 4ENXA 2GS6A 2YERA 3V8TA 2VO3A 3MH3A 4UV0A 3C5UA 4APCA 3Q2JA 4CXAA 3NVMB 2NRUA 2CKEA 3UNJA 4TY1A 5EW3A 3G90X 3KKVA 3PRIA 5E90A 3PTGA 3RK5A 4C4EA 3LMHA 3DB8A 5HCXA 3W18A 3OXTA 4U3ZA 5DMZA 2QVSE 3L9PA 3DQXA 3QRUA 2GQRA 5IH6A 3OMVA 3P78A 2W1EA 2W1ZA 3VW8A 5DVRA 5FTOA 4PMSA 3F6XA 3THBA 3CBLA 5HBHA 2OF2A 2PULA 2CLXA 1OZ1A 5AAFA 4RWJA 4AGCA 4J1RA 2RFSA 4Y46A 3H9OA 3KVXA 5CT7A 4RVMA 3UO6A 3VQHA 4L6QA 4BCOA 5HKMA 5HORA 4J52A 3POZA 2QLQA 2ZJWA 4RFMA 5HHWA 4PTCA 2WMAA 3ZXTA 3HA8A 3RGFA 4CKIA 4CFFA 5DRDA 4K11A 2QKRA 3QHRA 4WSQA 4HPTE 4DGGA 4CCBA 3LKMA 4O86A 3QQHA 1ZOGA 1BUHA 4YSJA 3R9OA 1TQIA 2FSLX 2R3QA 4O27B 4XHKB 3R8VA 5BYYA 5IQHA 3RZBA 4CTCA 3JPVA 3NAYA 4JBVA 4PPAA 2G2HA 2UW3A 5FBOA 3UOLA 2QG7A 2YFXA 3AC8A 5L2WA 5EHLA 3POOA 3VNTA 2YDIA 4JG8A 3PY1A 4FTTA 3KREA 4ZLYA 4FKLA 3HUBA 4QMNA 3PVBA 1MUOA 4RJ6A 4CGAA 5JFVA 3UO4A 4NH1A 4U6RA 4QOXA 2R0IA 3CGFA 3ITZA 2Z2WA 3NS9A 2KTYA 2E9UA 4IM2A 5KMNA 3PFQA 5CAOA 4MVFA 5DGZA 1YI3A 2VWYA 4XOZA 3RK9A 3LQ8A 3UTOA 3ZO4A 4FVQA 3BBWA 4BWXA 4DH5A 5J9LA 3DU8A 4J8NA 3H0YA 1H1SA 1G5SA 4IMYA 5KMKA 3EFKA 1WBOA 2BPMA 3MFUA 4G3EA 4V01A 5L4QA 4DEGA 5LMKA 3PY3A 4FNYA 2UW5A 1WAKA 4XH6A 3Q4ZA 4ZK5A 4NM3A 3AT2A 3AD6A 2XP2A 2ONLC 4DFYA 3E7OA 1BMKA 2C3LA 2WOTA 1T45A 2C68A 3EQGA 2VWBA 1F5QA 2X8IA 4GVJA 5ETCA 5FDXA 2B53A 2PMOX 1T46A 1PXMA 2ZOQA 4IJ9A 4IFGA 2G9XA 1OL6A 2XIXA 4CFMA 4OTHA 2WMXA 2W4OA 3VS3A 3ZXZA 2VTSA 4O7YA 4G1WA 3KXNA 3NUXA 3CE3A 3FI8A 3IOKA 1H00A 4NU1A 5M4IA 4FKTA 1PYXA 4EOKA 2J50A 1IAJA 4EQMA 4F6SA 2OJGA 5L2TA 3MPMA 2WQBA 4C4FA 3QAME 4BF2A 2OO8X 5JMSA 5BVOA 1Y8YA 2E2BA 2B55A 4FOBA 4LOPA 4NFNA 5EM7A 1JSTA 4CV8A 1P5EA 4TW9A 4OTGA 4GV1A 4QMZA 4E4LA 4G3GA 4EHGA 1YWVA 5CANA 1PMUA 3UDBA 5LMBA 3TUDA 4YPDA 3LFDA 4YTHA 4IB1A 5FGKA 1QPJA 3R63A 4NM7A 4ZTNA 4A4OA 4R3CA 2W05A 3OROA 3OXZA 5CU0A 5KO1A 3DFCB 3WZKA 1TQMA 2EUFB 4P2KA 3PVUA 4GK3A 3V8WA 4DH1A 4EOPA 1ZYDA 5JQ8A 2YLEA 4I5MA 4NM5A 4FV7A 3PG1A 4UZDA 4IVCA 4FT5A 3TEIA 3U4UA 4F7JA 2CNUA 4O0VA 2I1MA 3QQGA 1UWHA 3G9NA 3IONA 4JDJA 4GKHA 3BWFA 3O51A 4Z55A 2R3PA 4PWNA 5DT0A 4O1PA 4DAWA 2GS2A 4FV1A 3ZYAA 4IX3A 4LM5A 4KBKA 4ITJA 3PUPA 4KKGA 4Y73A 3NX8A 3F3TA 4LL0A 5I9VA 5JZNA 3KRJA 1Q4LA 5AP7A 5AV4A 4U43A 3TM0A 2ITNA 1X8BA 2GSFA 3OCTA 3NZ0A 3QQFA 1GAGA 4AT5A 3R7YA 2GU8A 3VF8A 2BRBA 5I9UA 3QXPA 4E4XA 3E64A 2PUPA 2HELA 4PL5A 4C2VA 4D5KA 4AZSA 3H30A 3BHHA 3E92A 3IS5A 2BZKB 3QC9A 5KKRB 2WMUA 5AR8A 1RW8A 4QPMA 2GFSA 3OBGA 5E4HA 1RE8A 1YKRA 2UZBA 2WZJA 5C1QB 4W8EA 2QOQA 5K9IA 3UO5A 4EOJA 2QKWB 3MVJA 4ZY4A 1TKIA 2YWVA 4FICA 4LL5A 3C13A 2AC5A 4QP7A 2XKEA 5J79A 4Z7GA 3OUNB 3KF4A 3DPKA 2ITYA 3D0EA 3RK7A 1R0EA 4MYGA 4IWPA 4EOOA 4X3FA 3ZM9A 2ITOA 3GC0A 4XV1A 2WELA 2X0GA 4WUNA 2PHKA 3W16A 5AUWA 3I0QA 4NW6A 4RZWA 3IW8A 4CRSA 3LMIA 5TE0A 3TV6A 3OEZA 3ODZX 4MTAA 4BWKA 3RPYA 4C33A 2OJIA 2V5QA 4KAOA 4WNMA 5L2QA 3F2AA 3VUHA 1ZWSA 2AUHA 2NP8A 4MK0A 4DGMA 4HYHA 3O8PA 1QL6A 1CKPA 3WF6A 4X21A 5HX6A 4EJ7A 3NIZA 2JIUA 2NRYA 4J98A 4ACMA 5L8LA 5FXSA 5I4NA 4O7NA 3HAVA 2YWPA 4OUCA 4QYFA 4N57A 2F2UA 3GCQA 4ZSEA 5HCZA 5EK7A 4GFOA 3VS2A 4EHZA 1Q8UA 3DOGA 3D14A 3TNQB 3ZM4A 3A7HA 3SOAA 4L7FA 3E3BX 4FT9A 1SZMA 2RG5A 4TWOA 3QD4A 3U9NA 4TYJA 5KUPA 4ACHA 5HD7A 4D9UA 3VUKA 4X0MA 5DOSA 3FQHA 5HZNA 5JFWA 1FQ1B 2IZRA 3U6IA 3QALE 4R1VA 1OL2A 4EK3A 5CAQA 3U54A 2OIQA 3PXRA 4CRLA 3F7ZA 4AUAA 3UZTA 2C30A 1FVRA 4JAIA 3PA4A 5FXQA 4BTMA 1IA9A 2A4LA 3UMWA 4ERWA 3IKAA 2F49A 2C0TA 3PRFA 4N6ZA 2YCFA 3UG2A 3S3IA 5HQ0A 3BE9A 1U5QA 4WNPA 3RCDA 4EUUA 4GJ2A 5C26A 2QOIA 4O2PA 5GJDA 3GFWA 3QKMA 3WE8A 1NY3A 3PIZA 4DFUA 3O2MA 4FZAB 3VRZA 3AGMA 4FT7A 3ZRLA 2XKDA 2YJRA 3GVUA 1KUTA 3GCVA 2Z8CA 1E9HA 3GUBA 4QYHA 5IA4A 4KBAA 2V7AA 3FXWA 4Y83A 1YW2A 2PE0A 3EHAA 4X2GA 2OXDA 1V1KA 4NKAA 4FVRA 2XH5A 3PA3A 4UWYA 4XOYA 3F5UA 5E8ZA 3VQUA 2OICA 3K5VA 4C7TA 5KCVA 3H9RA 4GSBA 3M2WA 4BHZA 3JR1A 3F61A 3C9WA 4R3PA 3FY0A 4L3LA 1OVEA 2Y4PA 4RWKA 3KRXA 2FYSA 3TIYA 2YA9A 4OTQA 4IDVA 3ZO2A 2CKPA 5L3AA 3PYYA 4QD6A 5D7AA 2O0UA 1XH8A 1U46A 3UPXA 3RPRA 5CS6A 5HNIX 3QYZA 2QONA 3UVPA 3FLQA 3FMKA 1U59A 4JVGA 5K4IA 5C4KA 3PE2A 1YDRE 4FIGA 1XR1A 4JXFA 5GJGA 3NCGA 3PA5A 4R3RA 3V5WA 4D4SA 1ZYSA 2HK5A 3AT3A 4E5BA 5BUEA 3VUMA 3Q5IA 4B7TA 4EC9A 1UU7A 4O7WA 3VS1A 4RX7A 5DBXA 2Y4IB 1OIQA 4ITHA 5FM3A 4QP2A 1O6KA 4I0TA 2W5BA 3R30A 5K4JA 5D41A 3HRBA 4DCEA 5TF9A 4IVDA 2X81A 4ACGA 1ZMWA 4M66A 5HD4A 4RWIA 1JWHA 4JDHA 3LM0A 5CF8A 1CKIA 2QOBA 3N9XA 4LUEA 3QTSA 4NIFB 2GTMA 2XNEA 2P33A 3KCKA 4KABA 4DYMA 5IQBA 2P3GX 3A62A 3GBZA 3BHYA 2B4SB 4P4CA 4UXQA 3WZJA 1VZOA 2J7TA 3GU8A 5E92A 1UU8A 3E88A 3DDPA 3KXGA 4RIYA 5AEPA 2C6IA 3Q52A 3MTFA 2XK7A 3NW7A 1WVWA 5CASA 3MH2A 1M14A 3NLBA 3O7LB 4AA5A 2WMTA 2HW7A
chains in the Genus database with same CATH superfamily
4JLCA 2IN6A 2PMLX 3DBDA 5FXRA 4O0RA 2YACA 2I40A 3RWPA 1NVSA 3LFCA 2KULA 5G1XA 3QGWA 4L46A 4GJ3A 2CPKE 3V3VA 4YJSA 2XNGA 5AUTA 2XBAA 3NRMA 4GG5A 3FUPA 5I3OA 3UIXA 4U40A 4AW2A 3TYKA 3W0MA 4NCTA 2JIIA 1RDQE 2R64A 2XZSA 3PIYA 2C6TA 3EQRA 3F3UA 3FZOA 3AMBA 4KS8A 4KSPA 4ORKA 1LEZA 2IW6A 4PP9A 4EZ3A 4F99A 5AUXA 5LARA 4EH5A 3DFAA 3NYVA 3TNHA 4A7CA 2Y0AA 1Y57A 4QP8A 1OKWA 3ZFMA 4KIQA 2UVYA 2XJ0A 2RFDA 2WAJA 5HX8A 4FTQA 3FHRA 5A3XA 4AA0A 4KB8A 4W8DA 5AX3A 3HDNA 4ALWA 4DG0E 3U8WA 5HE1A 3ATTA 2ITVA 5GZ8A 3I79A 3QRKA 4U79A 3TIZA 3PWDA 5CF6A 4YJTA 1B38A 4YJOA 1Q3WA 3NW6A 4C0TA 5HVYA 3TACA 2C3IB 4WRSA 5IEYA 5GNKA 2EB3A 3E5AA 3NPCA 4PDSA 4I23A 2GPHA 5AAGA 5T6KA 3NYXA 1KOAA 5JRSA 1H0WA 3WIGA 4JT3A 4DFLA 1WCCA 4FT0A 4I6HA 2X0PA 4F1TA 4L44A 3M11A 4QTCA 2C6MA 4WBBB 2A98A 3Q96A 4XUFA 4MD7E 3OBJA 2GNHA 1A9UA 3MJ2A 5TR6A 3N51A 2P2HA 2R5TA 4OGRA 3UVRA 3HMIA 4YBKA 3E62A 3F5PA 1BI8A 3Q9YA 5JEBA 3EB0A 2A19B 2XEYA 4NJDA 3DTCA 4FV2A 5CEQA 3SXSA 5AUVA 4FUXA 4IHPA 4H1MA 5AR3A 5HIDA 4RC2A 5IU2A 2WXVA 4QTDA 1H1WA 3O5AA 4FG9A 5EQYA 2OZAA 4O0YA 4RFYA 1JKSA 3UIUA 3OCBA 3L8SA 4AP7A 4F9AA 3PLAE 2YHVA 5ITAA 1UV5A 2NPQA 4II5A 4OTWA 4CYIA 5E8SA 3R0TA 3HV6A 5LQFA 4I0RA 2W7XA 5G6VA 3P7BA 3WZEA 4U97A 2OW3A 3AD4A 3V6RA 3GOPA 2BALA 4IWQA 3N4TA 4ZSAA 2A1AB 2PZYA 4QTAA 5KBQA 4BTKA 4RGJA 3KY2A 3FMJA 2EXEA 4QMTA 3QCQA 4YZNA 1PXOA 4WOVA 3R04A 3KULB 4FIJA 3I1AA 3SHEA 3QRTA 2PUIA 5EG3A 4OAUC 2ESMA 3CGOA 4C2WA 4FTUA 4FKWA 4M67A 4Z3VA 4E93A 3OUKA 2DS1A 2HXQA 5LCKA 3W1FA 4F6WA 4IANA 4ASXA 3CQEA 1A48A 4IEBA 3WI6A 3AG9A 5TOZA 3ZH8A 4Z16A 4BCQA 3QX4A 3TKHA 3ACKA 5CEOA 1YVJA 2HZ4A 2R7BA 4JQEA 4TYIA 5FTQA 3UYTA 4B4LA 4RIWB 3Q60A 2XK8A 4WSYA 4USEA 4F64A 4N0SA 4BDKA 5EM8A 2B52A 5FWKK 5DIAA 2FSTX 1I09A 1O6LA 1H07A 3TNWA 4X2FA 2WMBA 3L9MA 3MWUA 3R9HA 3CKWA 4CVAA 1R1WA 3OVVA 4XRLA 3R9NA 3EJ1A 2CKOA 1GZKA 2WEVA 1J91A 3KQ7A 3PE1A 2GFCA 4APPA 4C37A 1JKTA 1ZZLA 5H8EA 2WFYA 5HE0A 5LWMA 2OU7A 4LOOA 3VUDA 3OD6X 2WOUA 3UDSA 3ZRKA 3ML1A 3GOKA 4YO6A 3BCEA 4RIOA 4IZ7A 1PW2A 4DHJA 5AV1A 5JFSA 2JDTA 5IZFA 3JVRA 1YXSA 2YCQA 3I7BA 1GZNA 5EH0A 2WTCA 4D4YA 4AS0A 2G2FA 4Q9SA 4PNIA 2W4JA 3JS2A 5GHVA 5CAPA 3BGPA 4FKRA 4QQ5A 1FBNA 3U55A 5E1EA 4JBQA 3VAPA 3DKOA 4DH7A 3MPAA 3ENHA 1UVRA 4FL3A 2QO7A 2O63A 3PUFC 2VRXA 3KVWA 4NEUA 5D12A 4FA2A 4FSWA 5L2SA 5M44A 3CPCA 3KN5A 4GG7A 3CD8A 4FKVA 4JOAA 4OAVB 4FI1A 5DFPA 3NUPA 4QMSA 4IX4A 4QQCA 1FOTA 5HESA 3OTVA 1EH4A 4QMYA 1KSWA 3UNZA 4Q5HA 1OIUA 4EKKA 3FXXA 4ZSLA 3UOKA 3WF9A 5CSHA 3W0QA 4BCHA 4JQ7A 5D10A 3MBLA 3PXYA 4Z7HA 5AADA 1PJKA 1DAWA 1BKXA 1ZRZA 4GIIA 1XO2B 1QPDA 2BFXA 5C27A 4PL4A 4W4YA 3LXLA 5C03A 4EOIA 4YUQA 4BCGA 3WZUA 4HNFA 4TNBA 4GVAA 1VYWA 2EWAA 4GUEA 3KXMA 4FIHA 4O82A 4C4GA 4DHZA 4MBIA 1WFCA 1YDSE 1J7IA 3VHKA 5JFXA 1ST4A 5LCJA 3LPBA 4XS2A 2CJMA 4MXCA 3A7GA 5HVJA 4FV9A 3BRBA 3Q9XA 3HA6A 2UZOA 2B9HA 3Q04A 4OTRA 3TTJA 4AZWA 4FJVA 3TDWA 3F2RA 2XYUA 4ERKA 3MW1A 4G5PA 3TKUA 4I4EA 3IGOA 1UKIA 2OI4X 2FB8A 3DKCA 3E93A 4CQGA 4U7ZA 2CCIA 4GL9A 4WT6A 4O7ZA 4V04A 1VLRA 3W0PA 3VBYA 2YZLA 3R02A 5KMOA 2GHLA 2VTPA 3Q3BA 3ZSIA 2XNBA 2ZDTA 4FV5A 3JY9A 4O22A 2O64A 1JVPP 1IA8A 2O5KA 2WEIA 3DA6A 1GNGA 2Z60A 3G33A 1CDKA 5F20A 2V0DA 4D1ZA 4EH7A 5KHXA 5BYLA 1WVYA 3FKNA 1ATPE 2WTKC 2PK9A 3NW5A 3QA0A 3RM7A 1LR4A 4GKIA 1ZY5A 4FBXA 2XK3A 2UZNA 1BI7A 1SM2A 2OBJA 4PDYA 3R1NA 3EZRA 3QTXA 4RFZA 5ANGA 1ZZ2A 4EQUA 2XNNA 3KC3A 4JRNA 5A14A 3S95A 2HXLA 2UZUE 4FF8A 5TO8A 5FD2A 5IH4A 1LP4A 4TKSA 4F0FA 4TYEA 3OF0A 4BR3A 3ZTXA 4Q2AA 4BCPA 3LIJA 2BRNA 3D4QA 1H1QA 5AR5A 2XK9A 3VWAA 4LMNA 3MY0A 3EQIA 3GCUA 3SXRA 3EKKA 4C36A 3NNXA 3R22A 4XG8A 3G15A 5IEXA 5M08A 3OXIA 4ZMEA 4YZ9A 5DEYA 5HIBA 4RRVA 1O6YA 2BZIB 3KMMA 5IA0A 5M4FA 4NUSA 3AC5A 4A9RA 4RG0A 4FOCA 3A99A 4QMPA 5CAVA 4ONAA 3G0FA 1VYZA 5GZAA 2QHMA 4M15A 2CNVA 4O84A 1B39A 2PU8A 1KE7A 5DRBA 2XNPA 4HVDA 2NO3A 4O7SA 3OWJA 5CSVA 3BWJA 1OMWA 5M55A 4YJQA 2R4BA 3W2QA 4WIHA 3VUIA 2XKCA 3WF8A 5JT2A 5HCYA 4CZYB 1QCFA 3HRFA 3DQWA 4TWNA 5AWMA 5DYJA 4DE4A 2F2CB 4F65A 4F9YA 2W06A 4QP6A 4CMOA 4KUJA 2XIRA 4D2SA 5L6OA 5FLFA 4FSNA 3AGLA 3A7FA 3KFAA 3HVCA 3R6XA 5A4LA 3BYMA 2PWLA 2W1DA 4WNKA 4TNDA 4ANOA 2NYAA 3D94A 2UW6A 1OITA 1ZOHA 3P23A 3EYHA 3QA8A 5ANDA 1R78A 4RVTA 2QOHA 1Z57A 1IG1A 4XV3A 1U54A 3D83A 4LRMA 5FTGA 3FI4A 2UZEA 2VWXA 3SG8A 4GU6A 4CFWA 3R21A 2ZYBA 2PZPA 3QKLA 4O38A 3IECA 1GIHA 3BELA 3F9NA 5CF4A 4EI4A 1KE8A 4UALA 5LVLA 2RSVA 1OBDA 3HMPA 3VHEA 5KKRC 3I60A 5H9BA 4ZAUA 2QG5A 2Z7QA 4U5JA 3PVGA 2OIBA 2UVXA 4FSRA 4CNHA 1Q97A 5EKNA 4BIEA 4ZTQA 4I21A 4O0WA 4GT4A 4UMPA 3KEXA 3CXWA 3M42A 4GT5A 3E8CA 3SOCA 2XK4A 4I92A 4M69A 3KRWA 2R3GA 4UY9A 4BIBA 3FHIA 4BDJA 4M7IA 3UMXA 4RIYB 3VJOA 4V0GA 4TXCA 2BIYA 3WF5A 2CKQA 2YISA 2XF0A 4DGLC 2X6DA 5IQDA 4D2WA 5K5XA 2WMVA 3OHTA 4J71A 3C4EA 4QRCA 2AQXA 2OFVA 5DLSA 3G51A 4D58A 5GINE 3K5UA 5FEQA 5DR2A 5B7VA 3FZ1A 4D2TA 4HGTA 3GCSA 2X2KA 4MKCA 4JR7A 1FVTA 4FTIA 4F7LA 1YHSA 1UU9A 3VBWA 3CC6A 3QFVA 3LVPA 3EQFA 2JLDA 2HZ0A 2GHMA 2O8YA 1PXKA 4IZYA 5CY3A 3DAEA 4LI5A 4BCNA 2V55A 3O71A 4YPSA 3AKLA 4QYEA 3R7UA 1KOBA 5CSXA 4F7NA 5M4UA 2WHBA 3DCVA 1OL7A 4G16A 5FBNC 1ZYJA 3M1SA 5EDPA 4JJRA 4C4JA 2XIYA 4IE9A 2Y6OA 4WHZA 2I0HA 5A6OA 1KE6A 1PMEA 3QCSA 3SC1A 1OGUA 5JKGA 3IW5A 2BRGA 5HNGA 1Q8YA 4D28A 2JKOA 4E6DA 2UZDA 3KXXA 2VTNA 1REJA 2XRUA 5HO6A 5I9YA 4WA9A 3D7TA 1Q5KA 3I5ZA 3IPHA 2CMWA 2XK6A 5FRIA 2B1PA 3NR9A 4ALVA 4BDBA 4CT2A 1G8AA 4QDVA 3GGFA 4MNEB 4B6LA 3K3IA 4M97A 2W4KA 3EN9A 5E8WA 3Q4UA 3BQRA 4FTRA 4IAKA 3GC8A 2XUUA 1ZMUA 3G9LX 3MI9A 3TN8A 3WE4A 4LGDA 4CFVA 2BTRA 3ANQA 1DI9A 3TMOA 1OECA 4KINA 3I81A 4R6VA 3QTQA 3O17A 1ZARA 2VWUA 2IVUA 3QCYA 4FKJA 4ZLZA 5KX8A 3H4JA 3ZC5A 5F9EA 4BVUA 3F2NA 4IAYA 2VWWA 3NNWA 5A6NA 5HO7A 1KE9A 5B0XA 3FE3A 4FSUA 5A4TA 1P14A 2R3NA 4PTEA 4CFXA 4I24A 3VS7A 4TWPA 4DINA 2G15A 4U0IA 3MV5A 2B9FA 3HP5A 4C3RA 1OBGA 2CGVA 5AIKA 5BVDA 2PUNA 1KV2A 1JLUE 5JQ5A 4BDCA 2GNJA 4S30A 1KE5A 2WMQA 4O96A 3RHKA 3LLTA 2YIYA 3VULA 3SD0A 4IB3A 4OR5A 2ZM1A 4LQMA 3K54A 1U4DA 3ZZEA 5HBJA 3LFBA 2VNYA 4U42A 2Y8OA 2Z02A 4EUTA 2YCRA 3R83A 4G3DA 5B2MA 2HWPA 3OCSA 4BBEA 4F0GA 3OTUA 5HOAA 2XEZA 4YBJA 2XNOA 4MH7A 3DZOA 5E8UA 2PPQA 3F3ZA 5D1JA 3G6HA 1YWRA 1P4OA 4I5HA 2OZAB 4U80A 3OP5A 4IJPA 4L7SA 2X7OA 5I3RA 2IVVA 2VV9A 2YDKA 3FAAA 4QT1A 3V5PA 4ARKA 4EOLA 4QQTA 3COIA 4FTNA 4IQ6A 5F4NA 1JKKA 5D9HA 3ROCA 3TI1A 4UWBA 5KMLA 2C6KA 1XH4A 5LVMA 4EHVA 3NWWA 2C6DA 3C0IA 4UX9A 3QD3A 4FZ7A 4ZZNA 1F3MC 3NYNA 2W1GA 4Y85A 1QPCA 2ITXA 4R77A 1M17A 3RNYA 4BZNA 3PIXA 1CKJA 3BYUA 3HV4A 4ZIMA 3TZMA 3E8EA 4C8BA 4F08A 3UOJA 1ND4A 4EOSA 1XBBA 4FC0A 1F0QA 2JIVA 4AA4A 2JKQA 2VTQA 5IUIA 4DCAA 3D2IA 3ORTA 3QQUA 4JI9A 4KRCA 5IA5A 4PMTA 4YZMA 4IVAA 3QTUA 3UP7A 3N4UA 2XCHA 4LOQA 2YIXA 4UWCA 3MFTA 4O21A 3ORNA 2XAOA 3IOPA 1Y6BA 4JMQA 2RFEA 5EKOA 2F7XE 3MJ1A 5AP6A 1FGKA 1BLXA 2PUUA 4AGDA 3BKBA 2F7EE 3HV3A 4IAZA 4DG3E 3T9TA 4YTFA 3NUSA 3PZEA 2QO2A 5BNJA 4O7VA 5L2IA 2R7IA 3ZLXA 3UE4A 4PY1A 2J2IB 2BZJA 3QD0A 4D1XA 1LUFA 4P7EA 5M4CA 5FG8A 3WZDA 5E8XA 3CTQA 4XG4A 3L9NA 4KNBA 3RAHA 4FSTA 2YITA 4ANBA 1Q3DA 4AQCA 3P1AA 4EK8A 4HVGA 1XHAA 2WPAA 3JY0A 4L68A 5AR2A 3UODA 3KB7A 1G8KA 4DC2A 4EYJA 1UU3A 3DY7A 2QU5A 4GYGA 4KD1A 4C38A 2DQ7X 5M07A 5EYCA 2BCJA 2R3FA 2X4ZA 5CVGA 5HE2A 3TUBA 3HGKA 1Q61A 4RJ7A 3W10A 2ONLA 2XMYA 5KBRA 4EK5A 4J97A 5I0BA 2WTVA 3Q9ZA 3AQVA 4X7QA 2GDOA 4O91A 5HBEA 3U51A 4P5QA 2QC6A 4FE2A 1H25A 4MWHA 1PXIA 3QU0A 4EONA 4K9YA 4XMOA 4C34A 2X9FA 3ZONA 5LVOA 5IEVA 3MDYA 3ORZA 3ZEPA 4DN5A 5AAEA 5EW9A 3C4CA 4LG4A 3DBQA 3PP1A 4CKJA 4H36A 1H28A 2ZFYA 3GU4A 2ITWA 4HYSA 2RIOA 4XG2A 3VUTA 4DLJA 2VX0A 4I6FA 4ANQA 2GNLA 2UZWE 1H0VA 3D5XA 5CU4A 4YJVA 4AXEA 5DR6A 3NNVA 3OWPA 4TYHB 2ZDUA 2R3HA 5DNRA 3RAWA 3EFJA 1Q8TA 4MXXA 2XA4A 2NNWB 4DG2E 4HW7A 4FKUA 1K3AA 1VEBA 2JAVA 3LFNA 3LFEA 4XRJA 4QP3A 2BAKA 3BGQA 1Q62A 4YZCA 3TJDA 5ETIA 4EH3A 4DTAA 4YTIA 3O23A 4L8MA 1FPUA 3NMUF 3OOGA 2ZM3A 4HZRA 4ACCA 2X4FA 4MX9A 4R8QA 3ROYA 4C61A 4GK4A 4M13A 5K5NA 3LHJA 5CU3A 3R7EA 5EQPA 3NIEA 1FMOE 4CQEA 3LCTA 4E3CA 4FX3A 3EH9A 4EZ7A 4N6YA 3MH0A 3P86A 4FSYA 2B54A 3AC4A 3HV7A 4X3FC 3FXZA 5HU3A 4QEBA 3TUCA 3KXZA 4IH8A 3E3PA 2W1HA 3MGYA 3OG7A 3Q32A 5E7RA 3PXQA 3SGCA 2WTIA 4GUBA 4A9UA 1HOWA 1SNUA 4FGRA 4DFBA 5GIOE 1LEWA 5T3QA 2FO0A 3O96A 3E63A 2XIZA 3C7QA 4FKGA 2VTJA 4OTFA 4AU8A 4D0XA 1PY5A 1CMKE 4I0SA 2ITQA 5HG5A 4IB5A 2BKKA 1OL5A 5CENA 2WMWA 2WTKB 3Q5ZA 1ZMVA 4FKPA 5EHOA 3W2CA 4AWIA 1CSNA 1RJBA 3BLQA 3F5XA 4H3PA 4YC3A 4EOQA 3K2LA 2ERZE 4IDTA 4L3JA 4WRGA 4RC3A 3DGKA 2J0MB 4QP4A 2A27A 4TYHA 5L6PA 3ZZWA 3ZSHA 4J53A 1YHWA 4QMUA 4NCTC 1TQPA 3HECA 3OT8A 3FLZA 1WBSA 4NSTA 3UOHA 2GTNA 3ID6C 4L67A 4FNWA 1FMKA 4LGHA 2PVMA 4GK2A 2IPXA 4EH6A 3DBEA 2X1NA 3UQGA 3OWKA 5ANEA 2JD5A 4F9CA 2ZMCA 4L01A 4DT9A 3HMNA 4O0UA 3QGYA 4HYIA 2YM6A 3C0GA 4F9BA 4DEDA 5AV2A 1OI9A 4TPTA 1AQ1A 1YRPA 5K3YA 4FIIA 2F7ZE 3HMOA 3KCFA 2YN8A 3GT8A 4IX6A 4I6QA 4JBPA 3Q6UA 4JG7A 5AUZA 3BL7A 2W1CA 4BCJA 4D9TA 3P7CA 5CNNA 3NUUA 4XP0A 3BU6A 5GJFA 4KA3A 4U9AA 3QHWA 4EBVA 5IQGA 2YM3A 4NT4A 2BHHA 1DAYA 4RX9A 3HAMA 3WIKA 4F70A 2QLUA 5T68A 4USDA 4IW0A 4E6AA 1L3RE 3MESA 4FIFA 5CT0A 2W0JA 4J8MA 3LAUA 3CY2A 4FTKA 3DK7A 4DT8A 2R3IA 2LAVA 2G2IA 3ZEWA 2QCSA 4QP9A 5DG5A 4NTTA 3PXKA 5TKDA 4I4FA 2EB2A 5ETAA 2OXXA 1OB3A 5AP4A 3DZQA 4JNWA 1J3HA 3QD2B 1Q41A 2W9ZB 5AFVA 3HNGA 4E4MA 3VS5A 3QRIA 4BKJA 5CZHA 3UP2A 2VO7A 2O3PA 3MPTA 5HIEA 3RM6A 2WQMA 4KIKB 5J5TA 2J0LA 2BDJA 2WKMA 4ZXTA 2C1AA 4U3YA 2CGXA 3GFEA 3FLYA 3AOXA 4H39A 4OBOA 5HTIA 5IA1A 2JKKA 4M0ZA 3GP0A 4BDHA 4S34A 2W17A 5M51A 4AXCA 5CLPA 3GEQA 3N4VA 3UGCA 3LXPA 5HG9A 2OJFE 5HI2A 5L6WL 3W2OA 4BCFA 4DITA 5EI8A 3R8LA 4JAJA 2UW8A 2ETRA 2FA2A 3UZRA 1YOLA 2UW9A 3VO3A 3E8NA 5AR7A 4FTLA 2VTHA 3OY1A 1R0PA 2ZV2A 3VBXA 3UZPA 4AN3A 4QYYA 5KMMA 4ID7A 2OK1A 4F78A 4LFIA 3LFFA 5DE2A 3CKXA 4F1OA 4W4XA 5BVWA 3TV4A 4QMVA 4K77A 5AA8A 4EORA 4FEWA 3QQLA 3A4PA 2VO0A 1NVRA 1Q24A 2XRWA 3ET7A 3TL8A 2C4GA 4O81A 3CLYA 4FGBA 4A9SA 2B7AA 2VX1A 2R3RA 1H1PA 5E1SA 3H0ZA 3V6SA 4ANLA 1PYEA 4CG8A 4AXDA 4E73A 4IM3A 4MWIA 4WG4A 4QMQA 3ENMA 1YDTE 2J90A 2Y7JA 5GZ9A 4W9WA 3SW4A 3VBVA 3MB6A 5A4QA 2UUEA 3R8ZA 2ZB1A 2ZB0A 3FJQE 2OLCA 4XG9A 4PQNA 4BDGA 5HEZA 2C0IA 3MIYA 1W2CA 3JXWA 3CQUA 2JBPA 3MA3A 1BL7A 3GNIB 3ELJA 4J7BA 3ZDIA 5EDRA 4O0TA 3FMLA 2F57A 2Y9QA 3SRVB 1O9UA 5F1ZA 4G3FA 4AAAA 3LCOA 5H8BA 2YM5A 5IISA 3SKCA 3ULZA 5ETFA 2FVDA 4C3PA 3B2TA 3GENA 4X2JA 5CI6A 5GIPE 2OJ9A 2XVDA 5CAUA 4WO5A 4C58A 4CSVA 3EQHA 1PXNA 2CGUA 4DTBA 2PL0A 2ERKA 1SVGA 3FDNA 3I7CA 3B2WA 4O4EA 3RHXA 3EQPA 4GCJA 4DHFA 3HEGA 1XKKA 1HCLA 1G8JA 3HX4A 4BCIA 4OTPA 3KA0A 2ZM4A 3QX2A 4HVSA 5HTBA 3R28A 2YIRA 4WG5A 4WG3A 1OKVA 4PPCA 3ZC6A 1STCE 1UWJA 3IK3A 4GH2A 3ETAA 3LE6A 5DPVA 4MNEA 3QUEA 3DXPA 1CM8A 1M52A 4XBUA 4BB4A 5JGDA 5FP6A 5CXZA 3Q4CA 4A4LA 3DBFA 5EYDA 1XBCA 2J5EA 2IVTA 3MN3A 1J7LA 4LV8A 5C4LA 4JIAA 2AYPA 3BV2A 4GW8A 1H4LA 3L9LA 3ORIA 4RVKA 5IQEA 1XBAA 5KZIA 5KE0A 4ANNA 4RSSA 3AKKA 2XIKA 4FKQA 3KULA 3WILA 1ZYLA 3KK9A 3FPMA 4FV0A 4X3JA 3NUNA 1XMLA 2J0KA 3EL8A 3ZO1A 2ZV9A 2WQNA 1FGIA 4YGAA 3W33A 4AE6A 4QMMA 4ZY6A 5IMXA 4IC7A 1JNKA 2VWZA 4F7SA 3OCGA 5A46A 4EH2A 5EYMA 3CIKA 5HE3A 3BE2A 2R0UA 2FSOX 3EL7A 3ZRMA 2BAQA 3O8TA 4AN9A 4C4HA 3RAIA 3DNEA 4YJRA 3HKOA 4ZJIA 2WU6A 3FKLA 1REKA 2G1TA 4O4BB 3UQCA 4BJJB 3A61A 3DS6A 3KF7A 3VBTA 4NTSA 1MP8A 1SMHA 2C5XA 1YOMA 1MRVA 3BBTB 3W0RA 4HVHA 1UNHA 4EOMA 1CTPE 4CFUA 3P0MA 2PVRA 4ZTRA 3R2BA 1FVVA 5IQAA 1PXLA 1YWNA 2IZTA 2BVAA 4GEOA 4IVBA 4JBOA 4YURA 2VTLA 5E8VA 5AV0A 2PE1A 3PVWA 3BGZA 5JRQA 2WO6A 4HZSA 5DH3A 5DHJA 3R7VA 2BDFA 4BDIA 3AC3A 5JK3A 2A0CX 1XH5A 2GMXA 3C5IA 5CSPA 1NVQA 3ULIA 4A9YA 2B9JA 2Z7LA 3A8WA 3FYKX 3FZPA 3LCDA 3MFRA 4IADA 4MXAA 5J8IA 3WF7A 4C02A 2HOGA 3ZO3A 4D4VA 5EQEA 3PFYA 3R1QA 2VU3A 3LQ3A 2C6LA 1ZXEA 2DWBA 4FIEA 1I44A 2QR7A 4JR3A 2BUJA 4K33A 1R3CA 3UIMA 3QBNA 4TWCA 5CVHA 5DA3A 5TT7A 3P79A 3ZFXA 1DS5A 4IB0A 2VGPA 2J0JA 2X8DA 3I4BA 4YJUA 4HNIA 4FL1A 4L9IA 3EOCA 4BYJA 3II5A 2QOLA 3SQQA 4CD0A 4CV9A 4H05A 4JDIA 1R39A 3VBQA 4R7BA 4GYIA 2GNIA 4LGGA 2YJSA 4FL2A 4M3QA 4MEDA 2R3MA 1JOWB 3DB6A 4F9WA 2XS0A 1ZYCA 1J1CA 1S9JA 1H08A 5E8TA 3RJCA 1GZOA 2OZOA 5EFQA 2H96A 3FY2A 3RAKA 4DBNA 2B0QA 4G34A 4Z9LA 1PRYA 1H26A 3ZLSA 2JAMA 3FZTA 2QOKA 4TRLA 1UNGA 3BYOA 4XCUA 4DLIA 1ST0A 5C8NA 1UA2A 3IW6A 3CTHA 2ETMA 1SVEA 1YI4A 2I0VA 1H1RA 3QC4A 4MF1A 4BL1A 2I7QA 2CDZA 4CLJA 3NYOA 3PPZA 3SXFA 3T3UA 4N4SA 5AM6A 4RX8A 2BMCA 5AP1A 3QYWA 2J9MA 2UZVA 3FMEA 3U87A 4TYGA 3R9RA 5CQWA 3PSBA 3FMHA 3LMGA 4AF3A 5AIRA 4I94A 4GT3A 4ANSA 2C47A 2YAAA 2EXMA 2XB7A 3RP9A 2C3JA 5DT3A 4AZFA 4AN2A 2HY0A 3SA0A 4YR8A 3ATSA 3DTWA 3DK6A 3PXFA 4H1JA 4QO9A 4YZDA 5DN3A 4BGGA 3IW7A 2PE2A 4IACA 4CG9A 4NL0A 5IUHA 1BL6A 4ZTMA 4JIKA 2P4IA 4JL9A 3D15A 5JSMA 3A60A 3F88A 4E6CA 2YAKA 4CZTA 4AZTA 5HLWA 2ZV7A 4ZZMA 1NXKA 4I5PA 1MQ4A 5BMMA 2OIDA 3EQBA 3IGGA 4G6OA 4O4DA 4BBMA 2GQSA 4FV8A 2DYLA 4Y5QA 3KGAA 5EYKA 3UQFA 2XM8A 2XCKA 4XV9A 3RCJA 3SW7A 1J7UA 2CLQA 1MQBA 4IBMA 4NKSA 2QODA 3V5QA 2WMSA 1Z9XA 4HYUA 2PZ5A 4PMPA 2HZNA 1H24A 4X6QC 3EMGA 2QOOA 2F4JA 3HDMA 3DXNA 4RT7A 3KXHA 5AV3A 4EYMA 3FV8A 2LGCA 2VWIA 5BUJA 4YC8A 3QTWA 2X8EA 3A7JA 3O8UA 3PLSA 1YI6A 3K3JA 4JG6A 4JS8A 4AQKA 5CSWA 3TJCA 3QLGA 4C57A 3FL5A 3QZIA 3DNDA 4A4XA 4IAAA 2V7OA 2XJ1A 3FLSA 2I0EA 5K0XA 1OKYA 1OUYA 3I0OA 3MSSA 4JQ8A 4EL9A 3VS0A 4FTAA 3O7LD 1M2RA 1JSVA 4ACDA 2CNQA 4FUYA 4EBWA 4CT1A 2P0CA 4B9DA 2IJMA 2UZTA 5HTCA 4D5HA 4BN1A 3BX5A 3WOWA 3TZ8A 4EKLA 5IPJA 4X6RA 3VF9A 3SVVA 3ZUTA 3UNKA 1H8FA 4FSZA 5AA9A 3ACJA 4FZ6A 4YO4A 5A4EA 4ASEA 2YZAA 3QWJA 1YXUA 4R1YA 2XYNA 3DJ5A 1YHVA 4X2NA 4EWHA 3UDTA 4IXPA 3IDPA 4BDAA 5J9ZA 3IDBA 4ZOGA 3OC1A 4NZWB 4YTCA 4FMQA 4Y95A 4AFEA 4CCUA 4KWPA 4D2PA 1APME 4FSMA 5BYZA 3PJ8A 2UZLA 3EFWA 3PPJA 4IIRA 3QZGA