4RLKA

Crystal structure of z. mays ck2alpha in complex with the atp-competitive inhibitor 4-[(e)-(fluoren-9-ylidenehydrazinylidene)-methyl] benzoate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase II subunit alpha
publication title Protein kinase CK2 inhibition is associated with the destabilization of HIF-1 alpha in human cancer cells.
pubmed doi rcsb
source organism Zea mays
total genus 114
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rlkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rlkA02
5CENA 3FI8A 5C8KA 4GFOA 4QMWA 4WD5A 3ZONA 4FV5A 4FT3A 5AX9A 3DNEA 3ZSHA 5HBJA 2FVDA 2UZTA 2OXXA 2UW0A 2XCKA 4YTHA 1KUTA 4FNXA 4IAIA 4YJTA 3SXSA 5KZ0A 4PQNA 3UO6A 3DZQA 3V8TA 5IQEA 3E8EA 3IDCA 2EU9A 4RJ6A 5FRIA 4BWPA 2QONA 4H58A 4OT5A 4O81A 1HCKA 3JVSA 2HZ0A 1ZMVA 3E63A 3FMLA 3LW0A 1NT2A 2J90A 3HV4A 5FEEA 3W2PA 5FP6A 3FMEA 4AGUA 5JGBA 5K0XA 5FP5A 3G5DA 4YJRA 1WAKA 5AM6A 3H3CA 3OTVA 4ZTSA 4QQCA 5D1JA 4L53A 4EBWA 5AWMA 3BE2A 3FLZA 4BVUA 3QGYA 4MNEA 4O2PA 4BDDA 1H8FA 4I5HA 3R22A 2EXEA 2WQNA 3OZ6A 2C69A 1GIIA 1PKDA 1PXOA 5IMEA 4UMPA 4RFZA 1WBTA 1BL6A 1YOJA 2V55A 2WFYA 4DLIA 4EWQA 3FEGA 2EB2A 4IACA 1GZKA 3ORPA 3U4WA 1SVGA 4BTJA 4O6LA 2F7XE 4QTAA 1IASA 2V22A 3VVHA 3LVPA 3U55A 4FTUA 4RIYA 3IONA 3IS5A 4JJRA 4ZTQA 3D5WA 3RK5A 4OTRA 1CKJA 2YAKA 4BCHA 3PZEA 3AXWA 1U4DA 3NNXA 4O27B 4TY1A 4O91A 4CTBA 3UNZA 5HCZA 1YXTA 1XH6A 2GNJA 5EHLA 2C6EA 3SAYA 2REIA 3TTIA 4XG7A 3QAME 3I7BA 3PVGA 2J0LA 4IDTA 5EW8A 4DFXE 1Q8YA 3PUPA 1YXUA 4PL5A 3REPA 1MRYA 3EHAA 4C4JA 3HMOA 2ITOA 4WIHA 5BNJA 4FTMA 1H07A 2HW6A 2WEIA 4TW9A 2HENA 2UVXA 3E92A 3PXYA 4W9XA 4OBOA 3PE1A 5HIDA 4WG3A 2J4ZA 5CF5A 4I5CA 4ZTLA 3KCKA 4EBVA 5IQBA 3HMNA 5CU6A 1JKLA 3RHXA 3SOAA 4ANMA 2OH0E 4FE2A 3A60A 2VWVA 4M97A 2X4ZA 3MVMA 3NW7A 3DDQA 4Y5QA 3DXQA 4AGCA 3LOKA 4J98A 1OIRA 1UWJA 3LFQA 4IAFA 4M69A 4BCOA 4C02A 4F65A 1IA9A 2CJMA 3OXIA 5HEZA 3CE3A 3V5QA 4LL5A 3UNJA 4BI2A 5CU0A 3PPJA 4AT4A 4OW8A 4YBKA 3DS6A 4QMUA 5FEDA 3EJ1A 3ORLA 4MBLA 3SXRA 2RSVA 4RIXB 2O2UA 2XNEA 2R4BA 3FMDA 4GG7A 5DVRA 4EL9A 4EYMA 3TDVA 2BILB 4L01A 4MX9A 5GZ9A 2GQRA 2ONLA 2JIIA 3HVCA 5C03A 3QTWA 3DJ5A 5HO7A 3OHTA 4EEVA 1H25A 2P3GX 3ZCLA 4DGGA 5AV4A 5K4JA 3QBNA 3CR0A 3R02A 3R9DA 2Z2WA 1UNHA 3I0OA 4QP6A 3RCDA 2QODA 3HV5A 4DEAA 1IR3A 2HZNA 2PE2A 4PL3A 5GJFA 3LFFA 2JEDA 3W8QA 3UODA 4RVKA 4F9YA 1DI8A 1EH4A 3F7ZA 3H10A 3GQLA 3OW3A 3ZFMA 3KRWA 2C6LA 2W4KA 4JIKA 3OEZA 2LGCA 3WZDA 5KE0A 2C6MA 2C0IA 4K33A 5HVYA 3VRZA 4BDAA 5KBRA 4AOIA 1OKZA 3PRFA 3PTGA 2XVDA 4L52A 1H01A 2XKEA 4K1BA 4NIFA 1WBWA 1ZYDA 4JG6A 2BKZA 4YO4A 2R2PA 4BCNA 4EOJA 2Q0NA 3TNIA 4EZ5A 5E9EA 2WQBA 1XH4A 3QQFA 3NIZA 4D55A 3NUSA 4L43A 1JPAA 2FSMX 5E8WA 1JNKA 3NRMA 5E90A 1YOMA 4WNMA 5CT7A 4JLCA 2BRHA 5HG9A 4R8QA 3NVMB 4USFA 3CGOA 2GHMA 3ZM9A 2WAJA 4EQCA 1Q8UA 2OBJA 3R9HA 4C57A 4MNEB 2XBAA 2NNWB 4KAOA 4G3CA 4G34A 4O7YA 5IQGA 4FEXA 4U6RA 4ACCA 4A06A 2PUNA 2QOLA 3QGWA 4FSUA 4I4FA 1MQBA 4IAKA 4IM0A 4L67A 1BL7A 3EN6A 4HPUE 4O1PA 2XP2A 4TRLA 4GH2A 4G5JA 2ZAZA 4RLLA 5CVFA 5F4NA 2E9PA 4PPCA 3KREA 4X6RA 2CN5A 3H9RA 2B9JA 5CZHA 1H08A 5JMSA 3UTOA 3AMBA 3QTUA 4OTQA 3ROCA 1E1XA 4RIYB 4FTKA 4FTIA 2R3HA 3PSDA 4FSYA 5A46A 2WD1A 1V0OA 4IZYA 3MV5A 5AP4A 3SGCA 4C58A 4U8ZA 3R1NA 3P4KA 4V01A 4AOJA 4XBUA 4CMOA 4AS0A 3EB0A 3QD2B 4QMVA 4E1ZA 4O0YA 3OCBA 3BI6A 3PDTA 1Y6BA 2WIHA 1Q61A 5KZIA 2VTMA 4FEQA 2W99B 2YIRA 1J3HA 2JIUA 2R7IA 4USDA 2WOUA 3V5WA 3PSCA 3OROA 4BBFA 4FV0A 5K4IA 2GS6A 5LMBA 4ERWA 4EOKA 4FR4A 4ITHA 5D7AA 5BYYA 4F4PA 3HECA 3MPTA 3OUKA 5H3QA 2UW6A 3A7HA 4X7QA 4BIEA 5D41A 3NZ0A 2RF9A 2XKCA 4RA4A 2PE1A 3D7ZA 2GU8A 3C51A 3AGLA 4MBJA 5LJJA 5GIPE 1PXJA 2J5EA 5TOZA 2J50A 3MS9A 1H0VA 4Y46A 3U9NA 4EKLA 3DBQA 4PNIA 4QMPA 4GVJA 3KGAA 2VD5A 3QTXA 4XBRA 2H6DA 4BTKA 4ALWA 5IG1A 2CHLA 3Q4UA 4F1OA 5JFXA 5BVOA 3O17A 4WNOA 4ZP5A 5FBOA 4YZ9A 5E91A 5FM3A 2IW9A 2Q0BA 5GZAA 4MD9E 2WTKB 3GOKA 3KVWA 2BROA 3FC1X 4BBMA 4JNWA 5CX9A 5KUPA 3KXMA 3I81A 1KWPA 5LMKA 4XV2A 3P78A 4BCJA 2Y6OA 1AGWA 2XJ0A 2OZOA 3AMAA 1VZOA 1URWA 4KSQA 2A1AB 5IDNA 5AIRA 3II5A 5CVHA 4ZZMA 4GRBA 2VO7A 4NW6A 4LGHA 4GG5A 3G6HA 1K3AA 3SVVA 2W5AA 2WNTA 4O96A 3LIJA 3G2FA 4QP8A 4ALUA 3R9OA 3Q2MA 3HMIA 2WU6A 3LXKA 5CVGA 3I7CA 5DEYA 4N6YA 5JFSA 2VWZA 4ZZOA 5GJGA 2VNWA 2WQEA 5DIAA 4DBNA 1QL6A 4DGMA 3ZC6A 3R2YA 2GNFA 2GNHA 4EOIA 5AJQA 5CSVA 1Y8GA 2IZSA 1PXLA 2XM8A 4UEUA 3W2SA 5IF1A 4RJ7A 3FJQE 1ZOHA 5AP5A 2UW9A 1RE8A 3WF8A 3I0QA 2W05A 2XM9A 3FMMA 3L9LA 3ZXTA 3Q4TA 4BL1A 3MFTA 1Y91A 4A4OA 1RQQA 2W1HA 2OXDA 3UG2A 1XBCA 3U8WA 2W0JA 3PXZA 4LRKA 4FNYA 2GDOA 1UKIA 4F0GA 5KNJA 3C5UA 3NAXA 3CY2A 4BBEA 4ZJIA 4BRXA 4XLIA 4S2ZA 4C4FA 4JAIA 4BI1A 5JZJA 5D9HA 5E8VA 4YP8A 3A4PA 4E5AX 5CANA 4BTFA 3D94A 4QMNA 5AR7A 1IAJA 3NNVA 4KSPA 2YM5A 2QOIA 4AT5A 2FSTX 4D2PA 2QNJA 4F7JA 2GHLA 3EMGA 2X81A 3HZTA 4U81A 5B2KA 2XK3A 2A2AA 4EHEA 2EUFB 1REKA 3VBYA 2R3RA 5EQYA 3NSZA 4GK3A 4O83A 3DBEA 2EWAA 2VTSA 2Z60A 1SZMA 3G0FA 4V0GA 1S9JA 4HW7A 4JVGA 2A4LA 3HV7A 3KK8A 4PDOA 5AUYA 3BIZA 4Z7GA 3GCVA 4RJ4A 2I40A 2QLUA 3NUPA 4FSWA 3VUGA 3VQHA 2OFVA 3OCGA 4FKIA 5HD4A 5HTCA 4DEHA 1NVSA 5EK7A 4A7CA 4AZVA 5BVEA 3ZTXA 4WRSA 4U97A 3MH0A 3ODYX 4EOQA 3U6HA 4I23A 4J52A 3D5XA 3CLYA 1O6KA 4GIHA 5J1VA 3QTSA 3DB8A 2XNOA 2CMWA 1OL5A 4RG0A 3PJCA 2OGVA 4DAWA 2Z02A 3QC4A 2RFNA 2PZPA 2XNPA 4ZSLA 3QF9A 4PTEA 2JFLA 1ZZ2A 2OFUA 3PSBA 4YC3A 2GFCA 5JZNA 4DG3E 4U40A 3HL7A 4I93A 3E62A 4J71A 3RPOA 3MIYA 5B2LA 3PP0A 4IX5A 3DLSA 3QTZA 3DPKA 3QU0A 3Q4CA 4U79A 2XKFA 3HLLA 3FY0A 4C35A 3CTHA 4FG9A 5H9BA 4BICA 3VUHA 3ZOSA 1ZZLA 4XS2A 1R39A 3EFWA 4LGDA 1PXIA 2X2KA 4Z16A 4CKIA 3ZUVA 2XYUA 2X8DA 5JRQA 3LLAA 5DH3A 3WF5A 3VS2A 3MY0A 2VWYA 3BYOA 4A9YA 3MY1A 3DKFA 3L8VA 1W8CA 1GZNA 3G33A 3UC4A 2QOKA 4QMOA 3C5IA 1XH8A 4M3QA 3MN3A 4O7WA 3F9NA 3ODZX 4BKZA 2A0CX 4IDVA 4RZWA 5J1WA 2IVSA 3NYVA 4KB8A 2EXMA 2E9VA 3OD6X 2QOOA 3KULA 3QRIA 4S30A 3DAEA 4DE4A 3LQ3A 3OY1A 5EHOA 4O1OA 1RDQE 2QC6A 4FV1A 5D12A 3UVRA 5M55A 2JAMA 3W16A 4TYHA 4APCA 1JSUA 4TYJA 2J0IA 2X7FA 3FV8A 4J7BA 4KINA 4I24A 4KRCA 1PMUA 5I3OA 3WIGA 3R9RA 3DAKA 4R1VA 4ZJJA 4UXLA 3EQCA 3VBWA 2X4FA 5EHYA 3VNTA 3S00A 4UMRA 4RVLA 3Q6WA 2B7AA 3V5PA 3W2QA 3K54A 5I5ZA 3FZSA 4QP9A 3O8TA 3VJNA 4BI0A 3RM6A 4JOAA 2J51A 1KV1A 1W98A 4QTCA 1OGUA 4R5YA 4DTBA 5LVOA 3UQFA 1KE5A 4JDJA 5BMMA 2UZWE 5J5TA 4OTHA 4N57A 2R3NA 4C2WA 3S2PA 2JKOA 4V0GB 1M2QA 4QP3A 3PXRA 4BY9E 4L6QA 4KWPA 4LRJA 4S34A 3VIDA 3Q9ZA 1BI8A 1V1KA 1Y57A 2JKKA 2YCSA 2P33A 3DBDA 3PA3A 5KHXA 4O7SA 4QMZA 4EI4A 1PXNA 4L44A 4FL3A 3IOPA 4BCIA 4P5QA 5DGZA 4ANSA 1ZYLA 4RWJA 5C4KA 4EOMA 5CXZA 3K2LA 3SOCA 3NX8A 4O21A 1H1RA 4ZSAA 3UOHA 3ELJA 2UVYA 1GOLA 3CKXA 3CQEA 3KB7A 2AC5A 4I6FA 4DFZE 4G6LA 4EKKA 4UZDA 3UIBA 2X1NA 4NU1A 4F1MA 1DM2A 3ALNA 3PWDA 5LWNA 2OKRA 2OJJA 2YDJA 4CRSA 2QD9A 3IW5A 4P4CA 3ZDIA 4IZ5A 4FSZA 2QG5A 3RM7A 3O71A 4JQEA 4I0TA 3NCGA 4XG2A 5E8XA 2IZTA 3FZ1A 5FLFA 3BLQA 3KEXA 2PZRA 2YDKA 2VTOA 4AE9A 4MF1A 2P2HA 4QMXA 4B99A 3MI9A 4PTGA 5FM2A 4FVPA 5HIBA 3UDBA 3EFJA 3UIXA 4QPSA 4IFCA 5AR8A 1KV2A 4M0ZA 4D5KA 1FMKA 2UZDA 3ACKA 3H30A 4DEEA 5BPYA 4L42A 4GW8A 5HI2A 3LM5A 5JH6A 2ZM3A 1MUOA 4NM7A 4QP7A 4FYNA 5IQDA 4H3BA 5D11A 1V0BA 4AN9A 2VX3A 2YM7A 4JQ8A 3C7QA 3I4BA 5E8YA 4I41A 2QO2A 4RWKA 2QOQA 3VUIA 4F9WA 1QPDA 2O65A 4E4LA 2UZEA 4D2WA 2XK7A 2C3KA 5FDPA 1W7HA 4GFGA 2NPQA 3CD3A 3V51A 3NR9A 2QOBA 4AU8A 5AUXA 2YWPA 1ZYJA 4TT7A 2QKWB 2WTVA 3A7GA 3VBXA 5GINE 5CT0A 3TUBA 5I9UA 3KULB 5GNKA 4BTMA 1ZARA 4B8MA 3N4UA 4ZTRA 4AG8A 3FLYA 3HRBA 3M2WA 4FV4A 4XV3A 3MPAA 4YBJA 2OIDA 1Q41A 5J79A 2R0IA 3RALA 4TYHB 3C13A 2HXQA 2BIYA 4FKOA 4F0IA 2IZUA 5ETFA 4UX9A 5M4UA 4JX7A 4IB5A 4TWCA 3HRFA 3QYZA 4N70A 5EOLA 3GU4A 4FEVA 4BGGA 1NY3A 4O0SA 1BI7A 5I3RA 2C5NA 1I44A 1H4LA 2VX0A 3A2CA 3ANRA 4J8MA 5DNRA 4BIBA 3E7VA 2W1EA 3IKAA 2X2MA 4I94A 5CAQA 4S32A 1MRVA 3O96A 4F7SA 5BUIA 2VUWA 5IH5A 4O82A 1PMNA 1OZ1A 4ALVA 3LPBA 4EK5A 3AC3A 2P4IA 5AR5A 2B54A 2UZOA 5CAUA 2BALA 4UMUA 3TUDA 3ORMA 1SM2A 1YOLA 2ZB0A 3OEFX 5CI7A 3ZDUA 3LMHA 3TNPC 5IMXA 4MNFA 2XS0A 3TTJA 4Q5HA 5H8GA 5C27A 3ZS5A 2B53A 1OL1A 2QKRA 2XK8A 4CMUA 3U54A 5KBQA 4IB3A 1BMKA 3QCXA 4DYMA 5M4FA 5DPVA 2OU7A 4JG8A 3MFRA 3ZO2A 4TL0A 2CGWA 3KRXA 3NDMA 4O84A 4G2FA 5DLSA 2I6LA 2BTRA 2X8EA 1TQIA 4LUEA 1ZOGA 5C26A 4HNFA 2WMWA 3PXKA 3C4ZA 1WVYA 3JS2A 3RPVA 2RFDA 2PY3A 2BZKB 4ANOA 3F3UA 4AOTA 2WO6A 2WMQA 3KKVA 3C4WA 3L9NA 3QKLA 4F70A 5A6NA 1OI9A 3ORKA 3OS3A 4BDFA 2JBOA 3D9VA 3AT3A 3KXXA 1WVWA 3N4VA 4FV9A 3CKWA 2F2UA 1BYGA 2AC3A 3HGKA 4RC4A 5HLNA 3COKA 3ORXA 3FZOA 2HIWA 4C3PA 3WYYA 5C01A 5J5SA 2VNYA 4XOYA 4PP7A 4GYGA 2GMXA 3WIKA 3PXFA 4CVAA 1W83A 3BHYA 4BDIA 3DOGA 2XNBA 4RVMA 3N9XA 4FZAB 2DQ7X 4IXPA 5ICPA 5KHWA 3I5ZA 2HWPA 4FMQA 4M0YA 1W0XC 2R9SA 3RAIA 4CT2A 4E7WA 2VAGA 4YO6A 4CRLA 4O7RA 4BYIA 3PVBA 2WTWA 5HG8A 5KMNA 3JVRA 4D5HA 5JRSA 3COHA 2YCRA 4BDJA 5EDQA 3R1SA 3UG1A 1G3NA 3KN5A 4TZRA 5IUIA 5DR9A 2Z7LA 3ZRLA 3UOKA 2OSCA 3FYKX 4XP2A 2WOTA 3RAHA 3TCPA 4APPA 4LG4A 3AOXA 5CF6A 4XJ0A 1FINA 5IISA 4HGSA 4ZMFA 3EFKA 4YZDA 3O8UA 3QD4A 4PDYA 2CKQA 2V0DA 3V01A 1FQ1B 2QU6A 1F3MC 3MGYA 3DB6A 4ASXA 4QMQA 1SNXA 2BAQA 3QZIA 4DC2A 2GPHA 5KMLA 5BMSA 3TIYA 2PVLA 3KK9A 2G2FA 4XUFA 4HGLA 4J8NA 4AW1A 3RK9A 5HLPA 1VR2A 4FIFA 4WRGA 3UOLA 2XIRA 3F82A 4XH6A 2JGZA 3DGKA 3D5UA 2R3MA 3UIMA 4E6CA 1PF8A 4FTNA 4CXAA 4TYGA 2PVYA 4D9UA 4CEGA 5LVMA 5CZIA 4IJPA 2YERA 4UZHA 2GS7A 2JBPA 4P5ZA 3MDYA 1L3RE 4JDIA 4RBLA 1ZOEA 3ULZA 1OITA 2EB3A 5CF4A 3FQEA 2UW4A 5FXRA 4DTAA 3C4EA 3I6UA 4QYEA 3PP1A 4PY1A 4UYNA 5FWKK 4BWKA 4QTDA 4JAJA 2CKPA 2I1MA 2YIYA 3E3PA 5AA8A 2B9FA 3L8SA 5F95A 5C1QB 3FL5A 4ACGA 2C6KA 2WXVA 3G90X 4GV1A 3PJ2A 4AZTA 4FTTA 4GKIA 3HAMA 3DAJA 4FSQA 3RJCA 4BZDA 2I0EA 4I92A 4B8LA 4EORA 2C0TA 3G15A 2Z7RA 3R7EA 3O7LD 1XQZA 4AA4A 3SA0A 3S3IA 1PRYA 3EQPA 3Q9XA 2YIQA 4G31A 4G17A 4KIPA 2J9MA 3GCPA 3DZOA 3PA4A 4FKLA 5BYZA 1PKGA 3FMKA 4C3FA 5HLWA 4IAAA 2JDOA 2XIXA 4M66A 5BVNA 5J9YA 1H28A 3PLAE 3HDNA 5KKRB 4X3FC 4UMTA 1TVOA 3E93A 3BCEA 4UYAA 3TIZA 3NVKI 1R0EA 3I6WA 5EYDA 5JGAA 4YPDA 3RNYA 5HQ0A 3M42A 4FL2A 1PJKA 3QXOA 2W1ZA 2XRWA 3MVJA 4M14A 1M7NA 2IW8A 2O64A 3BHUA 3K3IA 1PYEA 3BKBA 3QRKA 4UY9A 3FMNA 4Y72A 2OJ9A 4MXAA 4AA5A 2X39A 5EDRA 1UU7A 3SQQA 4OTIA 3IW6A 1ZRZA 3MWUA 5IEYA 2BFXA 3E8DA 4EH7A 5AUZA 4DCEA 4KRDA 5E4HA 4QO9A 4ANBA 3R8ZA 4A07A 4ANLA 2C1AA 5AM7A 3D14A 4DH8A 3HEGA 4ZLOA 3CY3A 4FKWA 4FZ6A 5AP1A 3ALOA 1ZAOA 3O50A 4X2NA 3S4QA 4EONA 4X2GA 3EQFA 3BWFA 4R6VA 4HVSA 4RC3A 5KKRC 5IQIA 1XJDA 1YHWA 2ACXA 4FTRA 2G15A 3R7OA 2I0YA 4ERKA 1VYWA 3U6JA 1NVRA 2W96B 3F3WA 3QALE 2FUMA 2H34A 2O5KA 4V04A 3FI2A 5DG5A 1XHAA 1P5EA 4H36A 4KD1A 3D15A 1KE8A 3SD0A 5K5NA 3D0EA 5HBEA 4NL0A 3R04A 4E6QA 2H96A 3P1AA 5JEBA 2R3IA 3QD0A 4M84A 4TPTA 2ETKA 3MA6A 3AC1A 1RJBA 3NS9A 5CQWA 4ACMA 1OB3A 2B0QA 3VS3A 3UVPA 4YU2A 4QPAA 4NH1A 5I0BA 4ZMEA 2WMXA 3ZYAA 3W10A 4CZTA 3Q2JA 3LQ5A 5FTGA 5F9EA 5CS6A 4XG9A 4BGQA 3KQ7A 2QU5A 4MXYA 4D4YA 1FVVA 4FKQA 4BIDA 2PTKA 1H1SA 2OK1A 3OVVA 4QYYA 4RPVA 5IA3A 2X9EA 3QL8A 2QO9A 4EOLA 5H8EA 4YTCA 4Z55A 4YSJA 3DLZA 4IBMA 2C0OA 1UA2A 5L6PA 3IGOA 1PXMA 5H8BA 2UVZA 4QNYA 3BGZA 2XIYA 4ZAUA 2WQOA 4LQMA 5DT4A 4D4RA 5JFWA 5HE3A 3KMUA 3WZJA 2R3KA 3FMJA 4IANA 4IW0A 1SMHA 4FTJA 4BCGA 3KC3A 4XP0A 4WUAA 5BVKA 2G01A 3QFVA 3GU6A 4YZMA 4LOOA 3LHJA 4G1WA 4ACHA 5HVKA 4JR3A 2UW7A 3CQWA 4BB4A 5CSPA 4TWOA 4U42A 3EYGA 2NRYA 5FUTA 3PWYA 3DBFA 4I5PA 3ROYA 4Z3VA 4KIQA 2G9XA 5A3XA 1LP4A 3UYSA 4I22A 3TZ9A 3QCQA 4PNKA 2W5HA 4O22A 3A7IA 4F6WA 3NWWA 5LVLA 4X0MA 4D0XA 4EOPA 2PUIA 4DGOA 4E6AA 1QPJA 2C1BA 4O6EA 2BVAA 5EW9A 4CGAA 5J95A 3TT0A 4FSNA 4O0XA 4FA2A 5JKGA 2UW5A 1J7LA 4IVCA 5CLPA 1KE7A 1SYKA 4FNWA 4MXZA 1XH9A 3ZH8A 3CQUA 4OUCA 4OTWA 3DKGA 1GIHA 4CFMA 3DBCA 4IM2A 3EZRA 4I4EA 4M67A 4NCTA 5A9UA 3ID6C 4OR5A 5CQUA 3TV4A 4FKVA 4E4MA 4FUXA 4B6LA 3LFAA 2JKQA 5ACBC 5HNIX 2XMYA 4E26A 4YLLA 5BQ0A 2QR8A 2Z7QA 3DXPA 3BRBA 3F2RA 2WMBA 1W84A 2ITXA 3CS9A 1CSNA 3GCSA 4ZSJA 2W7XA 3QZFA 1Q62A 3D7TB 1YI4A 2Z7SA 2F2CB 4NM0A 4DN5A 5K3YA 2RKUA 3OP5A 4Z7HA 3VJOA 4QTBA 2JDTA 2G1TA 4PMPA 3TM0A 4RC2A 5E8SA 2VTAA 1FPUA 5EKOA 3GNIB 4C4HA 1IA8A 4L3PA 3GBZA 4CZYB 5HKMA 3VUKA 3I79A 3FY2A 1H00A 2UZLA 4JBPA 2F4JA 4NYEA 4I20A 4X3JA 3AT2A 2YCFA 3MA3A 3FLNC 3ZU7A 3Q5IA 4H3QA 3RK7A 3DXNA 1CTPE 2CLQA 3PVUA 4MD7E 4IM3A 3RZFA 1ZYCA 2IWIA 4LMNA 3Q9YA 4PDPA 5EM5A 4EJ7A 3POZA 2BR1A 1OMWA 2YA9A 3DA6A 1XKKA 2ESMA 3AD4A 3OCSA 4FKGA 4W8DA 3W2CA 3IDPA 5EQEA 2R3FA 3P08A 5AIKA 3NUYA 4CZUA 3PXQA 2BHHA 2HW7A 3JPVA 3TI1A 3O2MA 2BUJA 3IW8A 2WB8A 5D10A 3RCJA 4C37A 1WBSA 3GFWA 4I6HA 4QRCA 5LARA 2UZNA 2WMAA 1J91A 3QRJA 3Q4ZA 2ZM4A 3ORTA 1OUYA 3UMXA 3EL8A 2XB7A 2PVHA 3ATSA 2ETRA 3PY3A 4ZSEA 4JL9A 3KFAA 4ENXA 1PHKA 4J97A 1HCLA 3SC1A 3PIXA 5J9LA 1Q8TA 4FC0A 3LCOA 3AQVA 1QPCA 3FAAA 3CXWA 3QZGA 3E7OA 4WBBB 4C2VA 4HYSA 4LUDA 5HIEA 5HU3A 1M52A 1LPUA 5GJDA 3C9WA 4WNKA 4IWOA 3UC3A 5E92A 3C1XA 3VF9A 4AFEA 3WI6A 3RKBA 3LJ2A 4E8AA 3ITZA 3VUMA 4C7TA 5EM6A 5IDPA 1H1PA 3R00A 1Y8YA 2ZJWA 1JKTA 3ZRKA 5ANGA 2WZJA 4B4LA 2YLFA 5TF9A 3JUHA 2YEXA 5F1ZA 1WFCA 2J0KA 4KKHA 3ERKA 3QCYA 4EK4A 1OIUA 2X6DA 2C3JA 4XRLA 4FKUA 4KIKA 5FTQA 4EK3A 3NAYA 1CDKA 4QYGA 4QYHA 4Y8DA 2BRBA 3BV3A 3UP2A 5LWMA 3S1HA 4BCKA 5LQFA 3Q6UA 4U45A 4DCAA 5EI8A 4RGJA 2ITYA 2GNLA 2QURA 5DA3A 2LAVA 3TZMA 2IVUA 4EQMA 3V5TA 2F7ZE 4X6QC 1WBVA 4QOXA 4BHNA 1PW2A 3PG3A 3QC9A 5KMIA 3HAVA 4XV1A 2R3QA 2JITA 1PXPA 2HAKA 4YJVA 3DQXA 3D2KA 4RT7A 3VS0A 5EFQA 4DG0E 1BKXA 2XJ1A 2CGUA 5ANDA 2HY0A 3BGPA 5HE1A 1BX6A 2CCIA 5TT7A 5DE2A 1BLXA 4WA9A 3COMA 1STCE 3C4XA 3O51A 4G9RA 4GT4A 4N4SA 4YZBA 1JSTA 3MVHA 1YQJA 2FYSA 3BU3A 1OL7A 2Y4IC 5DMZA 3C4CA 5IKWA 4AAAA 5LMAA 4II5A 5J8IA 4MBIA 3IW7A 4UB7A 4MD8E 2J0MB 1OVEA 4OTDA 1U54A 3F66A 5HESA 3QXPA 4FZFB 3DK7A 4YSMA 3AGMA 3JXWA 4F08A 3V6SA 4FK3A 3U6IA 4CTCA 5EG3A 4EH2A 4D28A 3S0OA 4RFMA 5LCKA 3U51A 2XBJA 3G6GA 4FV7A 4XOZA 4GU9A 1XR1A 2CSNA 1OUKA 5HGIA 4F09A 4ZY5A 5LVPA 4C38A 4P90A 3POOA 4YMJA 4RWLA 4TYEA 3U4UA 2C6IA 2XK6A 4QMYA 4ASEA 4IZ7A 4YLKA 2V7AA 5CAVA 1DI9A 2J0JA 1A06A 3KF7A 2CNVA 4I6BA 5EI2A 3TV7A 2P2IA 2XKDA 3I60A 3QZHA 4JR7A 4AN3A 4O0RA 2OI4X 4CLIA 3LCSA 2CPKE 2ZDTA 3C0IA 4FT9A 2VTRA 4IJ9A 1OKYA 4KUJA 1GY3A 4ORKA 3MVLA 3BHVA 5DFPA 3D4QA 1FGIA 2RG6A 3QWKA 4W8EA 4XG3A 3L9MA 4FKJA 2XRUA 3MYGA 2PVFA 4RRVA 2E9NA 4YNOA 4YTFA 3GUBA 3BYUA 2R0UA 2VX1A 2PVRA 2W1GA 4MF0A 4BDHA 2W9ZB 5AR2A 3C0GA 2RFEA 3QQKA 3RVGA 3T9TA 2ZVAA 4EUUA 5JN2A 1IAHA 1WCCA 1Q24A 1UKHA 3LAUA 3R8LA 2E9OA 4GSBA 3GFEA 3BZ3A 3TV6A 2WGJA 2C5VA 5FEQA 1IRKA 5AUWA 3CPCA 5I9VA 4D1SA 4ITJA 2PHKA 3EN7A 4FL1A 4KIKB 5H2UA 3OT8A 3ZFYA 4YJUA 4W4WA 1YHVA 4BDKA 2ERZE 3LFCA 4FICA 3UJGA 3EQGA 5AP0A 2X9FA 3QYWA 2OWBA 5BUEA 4P7EA 5CNOA 3HA8A 3E87A 4ARKA 3MH3A 4GK4A 3KA0A 4JS8A 3FXZA 3RNIA 2O3PA 2VWWA 2ZV9A 3RP9A 4O0UA 4YHTA 1H24A 2NRUA 5HCXA 1UWHA 4CG9A 4FEWA 4FV6A 5I9XA 2DYLA 3BEGA 5CNNA 5FQDC 4FIGA 3OUNB 4IX4A 5EM7A 3EIDA 4MQ1A 5HNGA 2BZHB 4EOSA 4NEUA 3LE6A 4I6QA 2VWUA 4GCJA 1UNGA 4F9CA 4IFGA 2PUUA 2YLEA 2PMOX 4KS7A 4P2KA 1R0PA 3BV2A 3F3VA 4RX9A 5CU4A 2QHNA 1Q97A 1YW2A 5KX8A 5M4CA 3MSSA 3OC1A 4NJDA 4S33A 1XO2B 4IH8A 4DT8A 2OZAB 4IVAA 4R77A 3BQRA 3R8VA 5DOSA 5M57A 3Q52A 3R30A 4AP7A 3PIZA 2V62A 3NUNA 1U54B 4GVAA 4QT1A 3CIKA 4FNZA 4G16A 5ITAA 1ZMUA 3Q60A 4ZOGA 5FTOA 3ATTA 3OXTA 2JDRA 2VWXA 4GMYA 2F49A 2Z8CA 3CGFA 3GU7A 5T68A 2VTHA 4LOPA 4IE9A 1FVTA 4OTGA 4D1XA 3CEKA 4LI5A 4PDSA 4YTIA 3ZSIA 4DLJA 2PSQA 5K0KA 3HUCA 1SVHA 3VF8A 3KRRA 4H1MA 4A4XA 4MCVA 4HCUA 5DEWA 4LMUA 1YRPA 4AT3A 1UU3A 5M07A 4CKRA 3FZPA 2PE0A 2ITTA 4RLKA 2I0VA 1F5QA 4LV5A 3TNWA 1URCA 1GZOA 2PULA 4HVHA 3B2WA 4HZRA 4L3LA 1ZWSA 2OLCA 2E9UA 4TNBA 4O0TA 2WKMA 1O9UA 1Z57A 2R7BA 3GGFA 3H0YA 2WMSA 4J1RA 1Z9XA 2DS1A 3OWPA 4QP1A 5HE0A 3T9IA 3TWJA 3R1YA 3UPZA 4NSTA 3PA5A 5CTPA 4BGHA 4F0FA 5IQHA 1VEBA 1OBGA 4X21A 3TKIA 4F6UA 3AT4A 4JBVA 2G2IA 1WZYA 2BZIB 3ACJA 3GQIA 4IHPA 5AFVA 2BHEA 4PV0A 5DN3A 3FI3A 3GC0A 5HG7A 3OCTA 5KMOA 3NNWA 5I4NA 2R64A 3OXZA 3V3VA 4D2RA 3HA6A 4HZSA 3AD5A 5F20A 3ZZWA 2VO0A 3QTQA 2PL0A 3OBJA 1K9AA 2X2LA 4L9IA 5AAGA 3TNHA 3Q9WA 3TACA 2HOGA 4I21A 3UVQA 3WF7A 3QWJA 4FTOA 3DCVA 4U7ZA 3P5KA 4DTKA 3LFSA 3MFSA 4NKAA 4OAUC 2YAAA 3VC4A 2JDSA 1TKIA 2XCHA 4NM5A 4M13A 5AP3A 1WBNA 2ITUA 4AGWA 4M12A 1O6YA 5IA0A 2BDJA 2OF2A 2UZBA 3EH9A 4FTAA 1MRUA 3LXNA 4BCFA 5A4CA 5CALA 1AQ1A 3DT1A 5EI6A 5CEKA 3BHTA 4IVBA 4DF3A 5AADA 3QRUA 3RI1A 4UN0C 3WZUA 4EHGA 2CGVA 3ENMA 2EVAA 4RFYA 5JQ8A 1FGKA 2XNGA 5TE0A 3A4OX 5HTIA 4IZAA 3RPRA 4U0IA 1XH7A 3F61A 5AV3A 3NMUF 4BFMA 3LFEA 4ZIMA 2WTIA 4QQJA 3WARA 4MVFA 3ZLWA 5IH6A 5LCJA 4NZWB 3G51A 5AX3A 3W18A 1E9HA 4TWNA 5CXHA 3TNQB 4AUAA 4E5WA 3FI4A 4OTPA 4Z9LA 2VTPA 2CNUA 2QOCA 5CAPA 3E8NA 3DDPA 4K9YA 5B2MA 2PMIA 1QPEA 2C6OA 5A4LA 5CEPA 4GYIA 4JDHA 4XYFA 4RIOA 3ORNA 3OMVA 4L7FA 3BWJA 4HYHA 3ZRMA 2XUUA 5EYCA 4DH1A 2VV9A 3PJ8A 4BKYA 1A48A 3QA8A 2BRGA 1OBDA 1LR4A 3ZC5A 3GXLA 4IAZA 1YKRA 2YDIA 4MXXA 3VS5A 4RMZA 2YHVA 1GZ8A 4MYGA 3GB2A 4PMSA 4MH7A 4W4VA 3ZMMA 4L00A 3B2TA 3WBLA 4ANNA 5L4QA 5IUGA 2V5QA 4PUZA 2OJFE 3GOPA 3VBTA 4DGLC 3S95A 3RINA 3ZLYA 4AZFA 4OGRA 5M06A 1FOTA 1XWSA 1QCFA 3P9JA 3DKCA 4JBOA 4RJ3A 5EDPA 3V04A 3VN9A 2PPQA 2GS2A 2WTJA 4IEBA 5M53A 4C59A 4O0VA 2WIPA 2VO3A 3SRVA 5L2WA 4GU6A 4D4SA 2IVTA 3EYHA 4XMOA 4YNEA 1REJA 3R8PA 1APME 4LV8A 4WBOA 2XF0A 4ONAA 4AN2A 3IOKA 2YJRA 4JRVA 3BX5A 4J99A 4UALA 4F64A 5EW3A 3OT3A 5CYIA 2ETMA 2FSOX 3QLFA 2Y6MA 4FT0A 3CJGA 4GL9A 2F9GA 5BUJA 2WMRA 2HYYA 5FXQA 5KO1A 2WELA 2YM4A 3BPRA 5AAFA 5HU9A 1ZYSA 3PVWA 4YLJA 5DI1A 3RGFA 3GU5A 3T8OA 4N0SA 4U41A 4I0RA 1PY5A 4HVGA 3TXOA 2C68A 3VRYA 1UNLA 4AZWA 4FEUA 1Q4LA 5HICA 3SW7A 3HMMA 1QMZA 5DHJA 4FGBA 3E3BX 4HGTA 1YWVA 2QO7A 4HYUA 4NT4A 3VW8A 3FDNA 3WZKA 4OBPA 1T46A 1H1WA 3OF0A 4L3JA 4U3ZA 2R3PA 1M2RA 2C30A 2C6TA 4X3FB 4CV8A 5K9IA 4EHZA 2JFMA 1UV5A 3ZUUA 4AFJA 2YITA 4BZOA 2X0GA 4M8TA 2CNQA 5KCVA 2W1FA 5DWRA 3ZBFA 1FBNA 2OO8X 4K77A 2KULA 2VGPA 4K11A 4MK0A 4O7NA 5A6OA 5I9YA 3O8PA 2CN8A 3F5XA 4BWXA 3R7VA 1Z5MA 3CTJA 3LFBA 4FOBA 1DAYA 1V0PA 2VRXA 3FMHA 2YM8A 3C0HA 3UIUA 3OWJA 4A9UA 4EK8A 4BCMA 2ITVA 4PRJA 5C8NA 4C8BA 3W33A 2XZSA 3DK6A 3ZLXA 4NTTA 2ZMDA 1H27A 5EYKA 1CKPA 2AUHA 4KA3A 5J7BA 4QMLA 2CLXA 2AYPA 2X7GA 2XNMA 3DQWA 3VBQA 5CEOA 1LEZA 2IPXA 2B55A 5AP7A 3QQJA 1J1BA 3BQCA 3NYXA 3CJFA 2PVJA 4MXCA 3W1FA 2QG7A 4FIEA 3BLHA 4F9AA 3FZRA 4FKPA 4ZS0A 5E7RA 4C61A 4RX5A 4ZY4A 1M17A 1XBAA 3AG9A 4R7IA 3UZPA 3IPHA 3KU2A 2VGOA 2CGXA 3B8QA 5E8ZA 4O38A 4O7LA 4EQUA 3KL8A 4GEOA 4EJNA 3BELA 4O7TA 2WTCA 1I09A 3EWHA 4G9CA 2ITZA 2BMCA 3O7LB 3K5VA 1KSWA 1Y6AA 3QLGA 4S31A 2J6MA 5FDXA 3FPQA 3V5LA 2HXLA 3EQRA 1ZY4A 2ZDUA 4MHAA 4NW5A 2QLQA 2FO0A 5CASA 3CBLA 3LFNA 5CEMA 2Y7JA 3QX4A 4HOKA 4CFXA 3VAPA 4GUEA 4QP2A 4KBCA 3HV3A 4FBXA 4E4XA 5L3AA 2VTJA 2VTTA 4Y83A 2FGIA 3RHKA 4Y73A 3UO4A 3VULA 4FKSA 4HGEA 4DH3A 3SRVB 3W55A 1B38A 4JX3A 5JK3A 5L8KA 4AE6A 2BCJA 3U9CA 2IN6A 2CKOA 1P4OA 2BAJA 2PVNA 1SVEA 3IECA 1W82A 3PRIA 4G5PA 4U5JA 2IG7A 4IX3A 3FE3A 2HZIA 5L2QA 3QA0A 3QHWA 1S9IA 4DFLA 1OIYA 2F57A 2VTNA 1YWNA 3R1QA 4XG4A 1G5SA 1U5RA 4GJ2A 4WUNA 4ZXTA 3EQBA 3C4FA 4FK6A 3SW4A 2FB8A 4D2SA 1CMKE 4C0TA 4JQ7A 4H1JA 3QQHA 3D7TA 4DGNA 2YM6A 3AC4A 3VW6A 4C4IA 3A7JA 4FSTA 4ZTHA 2PUPA 1JVPP 3FPMA 2DWBA 3DTCA 3FSKA 5CEQA 4YJOA 2GQSA 5EYMA 1OM1A 3RWPA 2ZOQA 3BE9A 3A8WA 2WU7A 5FXSA 3WILA 4WT6A 5L2TA 4RX7A 1B39A 1YWRA 3FC2A 4W4XA 4YC8A 1CKIA 2B52A 3FKOA 1U5QA 2BZJA 3DV3A 3IK3A 4Q2AA 2VN9A 5JSMA 5HVJA 3GCUA 3MIAA 4IMYA 4MWHA 5TR6A 3BLRA 3D5VA 3WF9A 4PPBA 4AZSA 4DINA 3DU8A 5I9ZA 3LXPA 1YI3A 5DYJA 2HY81 3OW4A 2PMNX 2VTLA 4FIHA 4BF2A 3BBTB 2JIVA 3R8UA 4KNBA 4F6SA 1NW1A 3F2AA 3QKMA 4QD6A 4B9DA 4PPAA 3HP2A 3BBWA 1NA7A 3P7BA 2YABA 4FZDB 4QMTA 5KMJA 3A62A 3TZ8A 5E8UA 3SX9A 5M51A 5BVDA 2GTNA 4ZLZA 2YACA 3NW5A 4CKJA 4KKGA 2PMLX 4TTHB 4IIRA 4KABA 4CFVA 5LVNA 3M11A 4FSRA 4JBQA 4H39A 3TG1A 3P86A 3TL8A 3TDWA 4BR3A 2OH4A 3VS7A 1P14A 5CEIA 3UQCA 4JIAA 3RPYA 4KIOA 2J2IB 3VHEA 3LCDA 5AR3A 4FSMA 3FLSA 4EUTA 3F5GA 3VUTA 3LZBA 3GC9A 3PG1A 4CFNA 2G2HA 3KY2A 1OL6A 3IDBA 1E1VA 5HO6A 5J87A 4EH6A 2PK9A 4HNIA 4A9SA 2UW3A 3RTPA 1M14A 5DBXA 4EHVA 4FOCA 3BU5A 3GU8A 4FTQA 3VQUA 3F5PA 4QYFA 4BDEA 5BYLA 1FMOE 1GIJA 4D0WA 5AEPA 3DY7A 5C8MA 3OBGA 2Y0AA 3AC5A 4U3YA 3T3VA 1ND4A 4YUQA 4HVIA 4ZEGA 3SXFA 3RMFA 3EOCA 3F7WA 3QUDA 3NLBA 4RQVA 5L2SA 4JT3A 3HMPA 2R5TA 4AACA 4D1ZA 3F6XA 3PY0A 4GT5A 3IGGA 2CKEA 4MKCA 4MQ2A 5AMNA 5ANOA 3ZO1A 4E6DA 3MY5A 4QQTA 3IO7A 4FVQA 2VTIA 2X6EA 3LJ0A 1JQHA 4UBAA 2GNIA 3R8MA 3V8SA 3OOGA 3QKKA 4H3PA 2KTYA 3K3JA 4K2RA 3A7FA 3GP0A 4OTFA 5T6KA 2FSLX 4WHZA 2W1DA 3HX4A 3R71A 4ANQA 3LJ1A 2WMTA 3FYJX 3PPKA 3QX2A 5EQPA 4NM3A 4MTAA 4R3CA 4FZ7A 3OFMA 4L46A 3OY3A 3G9LX 5C4LA 5EM8A 2WQMA 5A54A 3DNDA 1H26A 4QTEA 5ANJA 3ZUTA 5EH0A 5J7HA 4E20A 1A9UA 2XA4A 2ITPA 3OOMA 4NJ3A 3TN8A 3A99A 4UV0A 2XH5A 5IA4A 3BYMA 2R3GA 4L7SA 4FV8A 5M56A 4EZ3A 4EZ7A 3IG7A 4YHFA 3PPZA 4J53A 4XG8A 2PZ5A 4BDGA 4IWQA 2B9IA 1OPLA 1PMEA 4RQKA 2O8YA 4X2JA 1P4FA 4V05A 5HBHA 1Q8WA 2BIKB 3LM0A 4UWBA 4UWYA 3V8WA 1OL2A 1OPJA 4ZZNA 2IZRA 2XYNA 4NUSA 3FQHA 4M69B 1Q99A 4H05A 4XRJA 4O86A 5IA1A 1WMKA 4XV9A 2A19B 4D2VA 3GVUA 4R1YA 2JDVA 2W4OA 3QQLA 1LEWA 3K5UA 4AW0A 1KE9A 4FIJA 3E64A 3H0ZA 5DT3A 3UP7A 4GKHA 4FTLA 1Q3DA 4IVDA 5CSHA 4YR8A 5JFVA 1B6CB 4IC8A 4K18A 5DRDA 4TYIA 3NNUA 4FT5A 5FBNC 4DEBA 3AD6A 2XK4A 3ZLSA 3FUPA 3DJ6A 4KBAA 2YN8A 5IPJA 4WO5A 3WE4A 2GFSA 4QMSA 4K6ZA 2V7OA 2QQ7A 4AW5A 1YDRE 3MTLA 3EN9A 3PY1A 2Y9QA 4YJQA 3LMGA 3HP5A 4CFFA 3KXGA 4WG5A 3WOWA 5IUHA 4XP3A 5L6OA 4ZY6A 5C9CA 2YCQA 4XEYA 3IW4A 3GCQA 1OECA 1JWHA 2OG8A 4NIFB 5IEVA 4DFUA 3R7UA 3Q5ZA 2Y4IB 2ITNA 3FKNA 4CFWA 4EH4A 4DEGA 4ZS4A 2BDFA 3HDMA 2W1IA 4XG6A 3V6RA 1ZXEA 3BGQA 5E8TA 4CQEA 3QQUA 2FA2A 3L1SA 4AXAA 4BKJA 4QPMA 2YM3A 2ONLC 3NYNA 3MBLA 3VO3A 4FG7A 3DFCB 4FKRA 2WTKC 3NCZA 1IG1A 3HRCA 5HX6A 5ANEA 3ORZA 5CWZA 3P0MA 3RBWA 5M4IA 4G3DA 5GZ8A 4K0YA 2HELA 3EKKA 4IX6A 3NYOA 4PMMA 5KMMA 4RZVA 3R73A 3ZBXA 2QCSA 3THBA 3LXLA 1NXKA 3WYXA 4GFMA 3VHKA 3MESA 4U80A 4F1TA 1KOAA 1ZLTA 4PF4A 3QTIA 4UWCA 4YURA 4IQ6A 4LM5A 4I3ZA 4MXOA 3UNKA 4DEDA 5M44A 2OW3A 4X2FA 3VS6A 5BVWA 2RFSA 4DITA 3DKOA 3ORIA 2ERKA 1YHSA 3Q53A 2RL5A 3F3TA 4PMTA 4OAVB 4O7ZA 1U59A 4HCTA 1R1WA 3AC2A 5CY3A 3TJCA 2JC6A 3A8XA 5JGDA 3E5AA 3HNGA 4J95A 4EK6A 5DT0A 2X7OA 3EQHA 3BYSA 3M1SA 3R7IA 2OZAA 4FG8A 3PFQA 2RG5A 5IEXA 4FV2A 4R3PA 3W2OA 3GENA 4JG7A 3KCFA 1O6LA 2C3LA 4C4EA 5AAEA 1M2PA 4HYIA 5ETIA 4TNDA 3MB7A 4DBXA 4YZNA 4QP4A 3ZFXA 2C47A 3R6XA 3P23A 3GI3A 4BDBA 4F7NA 1GJOA 4EH9A 1UU8A 4Q9SA 3AMYA 4YJNA 4LL0A 4IAYA 1GAGA 2PZIA 2PVKA 3TKHA 3ZSGA 5A4QA 5AUUA 3ZO3A 4RJ5A 1AD5A 4MAOA 4AWIA 2C5OA 2WMUA 2I7QA 4FT7A 4E73A 4R7BA 2C6DA 3UQGA 3O23A 1YDSE 4XLVA 4GIIA 1Q5KA 3H4JA 2QVSE 3V5JA 4JI9A 2B9HA 5K5XA 3EQDA 1BUHA 3MJ2A 4CSVA 4NCTC 2HK5A 3CSVA 2PVMA 5CI6A 5EKNA 5CSXA 1XH5A 3LQ8A 4TN6A 2P0CA 3HYHA 1IEPA 3MH1A 3PIYA 2J7TA 1R3CA 2OICA 5AV1A 3WZEA 4CCUA 3HV6A 5L8JA 4FYOA 3VS1A 3Q3BA 4G6NA 4U9AA 1OIQA 3KMMA 4GJ3A 4DFBA 2BDWA 1ATPE 2UUEA 1J7IA 1PYXA 2IO6A 2O63A 3KRLA 2SRCA 3QUPA 1RW8A 4LFIA 4YC6A 4AA0A 3ULIA 2ZYBA 3COIA 4FX3A 4ZLYA 2BRNA 3MPMA 4BDCA 4I1ZA 4YJPA 1ZMWA 1JAMA 3CP9A 4PL4A 3VUDA 5DR6A 1MP8A 3HKOA 3KRJA 2XJ2A 4U43A 3FL4A 4DEIA 4E3CA 4F7LA 1Q3WA 4FUYA 3R9NA 3NPCA 4GK2A 2YWVA 4IB0A 2W1CA 3JYAA 1YXSA 3Q32A 3UPXA 3FKLA 3B8RA 4M15A 3OG7A 1LUFA 3R7GA 1G8SA 3RWQA 2YIXA 1UVRA 1K2PA 3MJ1A 5AV0A 3SG8A 2I0HA 3KXHA 3ZO4A 2XEZA 4C4GA 4DHFA 3GEQA 3D2IA 1JKSA 1JBPE 2ZV7A 3TUCA 1GNGA 4W9WA 5E1EA 1JSVA 4B0GA 4M7IA 5LMKC 4X2KA 4IC7A 4OBQA 4WG4A 3UO5A 1SNUA 4C33A 3BU6A 3E88A 4XNEA 3FHIA 2HZ4A 3FXWA 3R28A 4CYJA 2QOHA 3E8CA 2W4JA 2QI8A 4ID7A 4XHKB 5HORA 4LOQA 2OIBA 3QD3A 3CPBA 4FODA 2Y8OA 4YGAA 3QUEA 4USEA 2ZV8A 4NTSA 1WVXA 2B4SB 1L8TA 3QTRA 2YISA 3QHRA 3PJ1A 5HD7A 2P55A 2BPMA 2WHBA 3RPSA 3TEIA 3FWQA 4DFYA 3RAWA 1WBOA 3KXZA 1YXXA 3P79A 5M09A 3UYTA 4CQGA 2ZMCA 2E2BA 3F2NA 4OT6A 3RZBA 4MWIA 5IA5A 4E5BA 2FH9A 4J96A 2NP8A 2W9FB 1ERKA 3F69A 3FHRA 4GT3A 4L68A 4ZTNA 4DG2E 2YZLA 1YVJA 3L8XA 1J7UA 2JAVA 5ETAA 4WKQA 5LXMA 4CCBA 4R3RA 4ZSGA 3H9OA 3UMWA 4CFUA 1YI6A 4EWHA 5CF8A 3DFAA 5L8LA 4Q5EA 4XCUA 5CAOA 4ASDA 3JR1A 3BEAA 3G0EA 4PWNA 3OWKA 5A4EA 4WSQA 3TZ7A 4G3GA 2R3JA 3ZEPA 3ZZEA 4CT1A 4EC8A 4F99A 5AA9A 3KF4A 4DT9A 3FSFA 4KBKA 5I9WA 3OTUA 3GT8A 5HCYA 2GSFA 3ZXZA 1P2AA 3F5UA 4K8AA 3LFDA 4RX8A 4BC6A 2UW8A 5IH4A 4FKTA 3DK3A 4DFNA 3SG9A 3I5NA 4AW2A 5FGKA 3BHHA 3Q04A 4ITIA 2XK9A 4I5MA 5E1SA 4BHZA 4AF3A 5G6VA 2IJMA 3W2RA 3FBVA 3R0TA 2XIZA 4FVRA 3F88A 2RGPA 4FF8A 4AX8A 2QR7A 3FLWA 3LKMA 2C4GA 4BCPA 2C3IB 1VYZA 4ZK5A 4Y85A 4IADA 5AV2A 3PLSA 2Y4PA 1UU9A 2PWLA 3TJDA 2YZAA 1R78A 3HUBA 2Q83A 4YZCA 2R3LA 3A61A 2ITWA 3N51A 2O0UA 1JLUE 4EOOA 2WEVA 1G8AA 3R63A 2YJSA 3GC7A 5AP2A 4EH8A 4CG8A 5J9ZA 4BYJA 4CNHA 2ITQA 5JQ5A 2W17A 4R7HA 4D4VA 4FV3A 4E4NA 4HCVA 5HG5A 3ANQA 4AGDA 4E93A 1PMVA 2XEYA 5L2IA 2BAKA 4DA5A 4EH5A 4JRNA 2NO3A 3ZHPC 3T3UA 4AQCA 5CU3A 2GCDA 4G3FA 4X3FA 3WE8A 3DJ7A 2WMVA 4KKEA 5T3QA 3WF6A 1DS5A 2WPAA 3MTFA 4TXCA 2VU3A 5F94A 5DRBA 3KMWA 5KMKA 5FG8A 4KS8A 3U87A 4NFNA 5IQFA 1H1QA 1JOWB 3CCNA 3ETAA 2JKMA 3FLQA 4Q9ZA 5B0XA 2IVVA 5B7VA 3UE4A 2X8IA 2UV2A 4PP9A 3JY0A 2ZV2A 3MW1A 5ACKA 4WSYA 5ETCA 5D7VA 1DAWA 2B1PA 3W8LA 2OF4A 5L6WL 3CC6A 3CTQA 4UMQA 1ZY5A 2UZUE 4O0WA 3KXNA 3PYYA 3I1AA 5IZFA 4L8MA 4M68A 3NEWA 5HO8A 4RA5A 3IQ7A 4RIWA 2OIQA 3FQSA 2J5FA 2WTDA 4BN1A 3MH2A 2VTQA 2GHGA 4W4YA 4F63A 3EQIA 5HTBA 1CM8A 4DH7A 4IWDA 1T45A 2JD5A 5HOAA 4XX9A 3PJ3A 2IW6A 3NUUA 2BFYA 4ENYA 4HJOA 3SV0A 4O7VA 4NFMA 3P7AA 4PTCA 2RIOA 2UZVA 1OKVA 1YXVA 2VWIA 3EL7A 3R01A 4LYNA 4O2ZA 4A9TA 3UZTA 1XBBA 4C36A 1X8BA 3KN6A 4I0SA 5FD2A 5TKDA 4HPTE 5EOBA 3LMIA 4WOVA 4D9TA 4WNPA 1M7QA 2PZYA 4IB1A 5ANIA 3NUAA 3EN5A 3NUXA 2GTMA 3G9NA 3QCSA 4RSSA 4YJSA 3PE2A 2HCKA 4NKSA 3Q96A 4DH5A 2C5YA 2ZM1A 5G1XA 2OJGA 4FTCA 5AUVA 3BYVA 2JLDA 3EN4A 5IQAA 4QQ5A 3R83A 4EC9A 2PYWA 3QRTA 4UXQA 1JKKA 2YIWA 3LLTA 4F9BA 2PU8A 5A4TA 3ZEWA 3AC8A 3DTWA 4C3RA 3VS4A 1VJYA 4GS6A 4QNAA 1KOBA 3LCTA 3SDJA 2GQGA 4CLJA 1YDTE 4MEDA 4RVTA 2EXCX 3KVXA 3EKNA 4IWPA 5CSWA 1OKWA 4D58A 4ZTMA 5HX8A 4LGGA 4CD0A 2W06A 3EZVA 1NVQA 1H0WA 4G3EA 3R7YA 3R2BA 3R21A 2ZB1A 4QMMA 3GC8A 4RJ8A 4C62A 4HVDA 5BVFA 4R78A 1PXKA 3VWAA 4ACDA 2OJIA 4NK9A 5JT2A 4EH3A 3QQGA 4LRMA 4JDKA 5HNBA 3UOJA 2GNGA 1MQ4A 3LCKA 3F3ZA 4FGRA 5M08A 2CCHA 5HE2A 4PX6A 3TKUA 2CDZA 3JY9A 2F7EE 1Q8ZA 4R5SA 3FXXA 3CD8A 4TKSA 5BX0A 4ZJVA 4JXFA 3D83A 3OWLA 5DR2A 2BRMA 3W32A 4BZNA 5ANKA 1TQPA 3UZRA 2YFXA 3ENHA 3ET7A 2QOFA 4TWPA 3N4TA 2H8HA 3L8PA 4C34A 2HWOA 4FIIA 3VBVA 3NGAA 3NW6A 4CYIA 1F0QA 3SLSA 1U46A 5AR4A 4AZEA 5LOHA 2VO6A 5IQCA 2DUVA 5TO8A 4YPSA 3PZHA 4B7TA 4G6OA 1FVRA 1OPKA 1TQMA 5IU2A 3NIEA 5GIOE 3UBDA 5AUTA 2BTSA 4RIXA 4EYJA 4ASZA 4OLIA 3O0GA 5HHWA 4CMTA 4D2TA 1J1CA 4L45A 2A27A 2OXYA 5A14A 4YHJA 1KE6A 4Y5HA 2XNNA 3MFUA 3UGCA 4Y95A 3SKCA 1HOWA 3H9FA 3ZM4A 2BKKA 2H9VA 4RIWB 3L9PA 4A9RA 3P7CA 4BCQA 2VZ6A 5CU2A 4A4LA 4RWIA 4U44A 2C5XA 2W5BA 5AP6A 5HZNA 5IA2A 2R3OA 4CV9A 2QHMA 5GHVA 3EFLA 3FZTA 4NWMA 3C50A 4N6ZA 2VWBA 4FI1A 1WBPA 4GUBA 3RAKA 3SHEA 2XIKA 3MB6A
chains in the Genus database with same CATH superfamily
5CENA 3FI8A 5C8KA 4GFOA 4QMWA 4WD5A 3ZONA 4FV5A 4FT3A 5AX9A 3DNEA 3ZSHA 5HBJA 2FVDA 2UZTA 2OXXA 2UW0A 2XCKA 4YTHA 1KUTA 4FNXA 4IAIA 4YJTA 3SXSA 5KZ0A 4PQNA 3UO6A 3DZQA 3V8TA 5IQEA 3E8EA 3IDCA 2EU9A 4RJ6A 5FRIA 4BWPA 2QONA 4H58A 4OT5A 4O81A 1HCKA 3JVSA 2HZ0A 1ZMVA 3E63A 3FMLA 3LW0A 1NT2A 2J90A 3HV4A 5FEEA 3W2PA 5FP6A 3FMEA 4AGUA 5JGBA 5K0XA 5FP5A 3G5DA 4YJRA 1WAKA 5AM6A 3H3CA 3OTVA 4ZTSA 4QQCA 5D1JA 4L53A 4EBWA 5AWMA 3BE2A 3FLZA 4BVUA 3QGYA 4MNEA 4O2PA 4BDDA 1H8FA 4I5HA 3R22A 2EXEA 2WQNA 3OZ6A 2C69A 1GIIA 1PKDA 1PXOA 5IMEA 4UMPA 4RFZA 1WBTA 1BL6A 1YOJA 2V55A 2WFYA 4DLIA 4EWQA 3FEGA 2EB2A 4IACA 1GZKA 3ORPA 3U4WA 1SVGA 4BTJA 4O6LA 2F7XE 4QTAA 1IASA 2V22A 3VVHA 3LVPA 3U55A 4FTUA 4RIYA 3IONA 3IS5A 4JJRA 4ZTQA 3D5WA 3RK5A 4OTRA 1CKJA 2YAKA 4BCHA 3PZEA 3AXWA 1U4DA 3NNXA 4O27B 4TY1A 4O91A 4CTBA 3UNZA 5HCZA 1YXTA 1XH6A 2GNJA 5EHLA 2C6EA 3SAYA 2REIA 3TTIA 4XG7A 3QAME 3I7BA 3PVGA 2J0LA 4IDTA 5EW8A 4DFXE 1Q8YA 3PUPA 1YXUA 4PL5A 3REPA 1MRYA 3EHAA 4C4JA 3HMOA 2ITOA 4WIHA 5BNJA 4FTMA 1H07A 2HW6A 2WEIA 4TW9A 2HENA 2UVXA 3E92A 3PXYA 4W9XA 4OBOA 3PE1A 5HIDA 4WG3A 2J4ZA 5CF5A 4I5CA 4ZTLA 3KCKA 4EBVA 5IQBA 3HMNA 5CU6A 1JKLA 3RHXA 3SOAA 4ANMA 2OH0E 4FE2A 3A60A 2VWVA 4M97A 2X4ZA 3MVMA 3NW7A 4AAYA 3DDQA 4Y5QA 3DXQA 4AGCA 3LOKA 4J98A 1OIRA 1UWJA 3LFQA 4IAFA 4M69A 4BCOA 4C02A 4F65A 1XMMA 1IA9A 2CJMA 3OXIA 5HEZA 3CE3A 3V5QA 4LL5A 3UNJA 4BI2A 5CU0A 3PPJA 4AT4A 4OW8A 4YBKA 3DS6A 4QMUA 5FEDA 3EJ1A 3ORLA 4MBLA 3SXRA 2RSVA 4RIXB 2O2UA 2XNEA 2R4BA 3FMDA 4GG7A 5DVRA 4EL9A 4EYMA 3TDVA 2BILB 4L01A 4MX9A 5GZ9A 2GQRA 2ONLA 2JIIA 3HVCA 5C03A 3QTWA 3DJ5A 5HO7A 3OHTA 4EEVA 1H25A 2P3GX 3ZCLA 4DGGA 5AV4A 5K4JA 3QBNA 3CR0A 3R02A 3R9DA 2Z2WA 1UNHA 3I0OA 4QP6A 3RCDA 2QODA 3HV5A 4DEAA 1IR3A 2HZNA 2PE2A 4PL3A 5GJFA 3LFFA 2JEDA 3W8QA 3UODA 4RVKA 4F9YA 1DI8A 1EH4A 3F7ZA 3H10A 3GQLA 3OW3A 3ZFMA 3KRWA 2C6LA 2W4KA 4JIKA 3W0NA 3OEZA 2LGCA 3WZDA 5KE0A 2C6MA 2C0IA 4K33A 5HVYA 3VRZA 4BDAA 5KBRA 2XANA 4AOIA 1OKZA 3PRFA 3PTGA 2XVDA 4L52A 1H01A 2XKEA 4K1BA 4NIFA 1WBWA 1ZYDA 4JG6A 2BKZA 4YO4A 2R2PA 4BCNA 4EOJA 2Q0NA 3TNIA 4EZ5A 5E9EA 2WQBA 1XH4A 3QQFA 3NIZA 4D55A 3NUSA 4L43A 1JPAA 2FSMX 5E8WA 1JNKA 3NRMA 5E90A 1YOMA 4WNMA 5CT7A 4JLCA 2BRHA 5HG9A 4R8QA 3NVMB 4USFA 3CGOA 2GHMA 3ZM9A 2WAJA 4EQCA 1Q8UA 2OBJA 3R9HA 4C57A 4MNEB 2XBAA 2NNWB 4KAOA 4G3CA 4G34A 4O7YA 5IQGA 4FEXA 4U6RA 4ACCA 4A06A 2PUNA 2XAOA 2QOLA 3QGWA 4FSUA 4I4FA 1MQBA 4IAKA 4IM0A 4L67A 1BL7A 3EN6A 4HPUE 4O1PA 2XP2A 4TRLA 4GH2A 4G5JA 2ZAZA 4RLLA 5CVFA 5F4NA 2E9PA 4PPCA 3KREA 4X6RA 2CN5A 3H9RA 2B9JA 5CZHA 1H08A 5JMSA 3UTOA 3AMBA 3QTUA 4OTQA 3ROCA 1E1XA 4RIYB 4FTKA 4FTIA 2R3HA 3PSDA 4FSYA 5A46A 2WD1A 1V0OA 4IZYA 3MV5A 5AP4A 3SGCA 4C58A 4U8ZA 3R1NA 3P4KA 4V01A 4AOJA 4XBUA 4CMOA 4AS0A 3EB0A 4AXDA 3QD2B 4QMVA 4E1ZA 4O0YA 3OCBA 1OGYA 3BI6A 3PDTA 1Y6BA 2WIHA 1Q61A 5KZIA 2VTMA 4FEQA 2W99B 2YIRA 1J3HA 2JIUA 2R7IA 4USDA 2WOUA 3V5WA 3PSCA 3OROA 4BBFA 4FV0A 5K4IA 2GS6A 5LMBA 4ERWA 4EOKA 4FR4A 4ITHA 5D7AA 5BYYA 4F4PA 3HECA 3MPTA 3OUKA 5H3QA 2UW6A 3A7HA 4X7QA 4BIEA 5D41A 3NZ0A 2RF9A 2XKCA 4RA4A 2PE1A 3D7ZA 2GU8A 3C51A 3AGLA 4MBJA 5LJJA 5GIPE 1PXJA 2J5EA 5TOZA 2J50A 3MS9A 1H0VA 4Y46A 3U9NA 4EKLA 3DBQA 4PNIA 4QMPA 4GVJA 3KGAA 2VD5A 3QTXA 4XBRA 2H6DA 4BTKA 4ALWA 5IG1A 2CHLA 3Q4UA 4F1OA 5JFXA 5BVOA 3O17A 4WNOA 4ZP5A 5FBOA 4YZ9A 5E91A 5FM3A 2IW9A 2Q0BA 5GZAA 4MD9E 2WTKB 3GOKA 3KVWA 2BROA 3FC1X 4BBMA 4JNWA 5CX9A 5KUPA 3BLAA 3KXMA 3I81A 1KWPA 5LMKA 4XV2A 3P78A 4BCJA 2Y6OA 1AGWA 2XJ0A 2OZOA 3AMAA 1VZOA 1URWA 4KSQA 2A1AB 5IDNA 5AIRA 3II5A 5CVHA 4ZZMA 4GRBA 2VO7A 4NW6A 4LGHA 4GG5A 3G6HA 1K3AA 3SVVA 2W5AA 2WNTA 4O96A 3LIJA 3G2FA 4QP8A 4ALUA 3R9OA 3Q2MA 3HMIA 2WU6A 3LXKA 5CVGA 4LV7A 3I7CA 5DEYA 4N6YA 5JFSA 2VWZA 4ZZOA 5GJGA 2VNWA 2WQEA 5DIAA 4DBNA 1QL6A 4DGMA 3ZC6A 3R2YA 2GNFA 2GNHA 4EOIA 5AJQA 5CSVA 2XM8A 1Y8GA 1PXLA 2IEWA 2IZSA 4UEUA 3W2SA 4RJ7A 3FJQE 1ZOHA 5AP5A 2UW9A 1RE8A 3WF8A 5IF1A 4MUQA 3I0QA 2W05A 2XM9A 3FMMA 3L9LA 3ZXTA 3Q4TA 4BL1A 3MFTA 1Y91A 4A4OA 1RQQA 2W1HA 2OXDA 3UG2A 1XBCA 3U8WA 2W0JA 3PXZA 4LRKA 4FNYA 2GDOA 1UKIA 4F0GA 5KNJA 3C5UA 3NAXA 3CY2A 4BBEA 4ZJIA 4BRXA 4XLIA 4S2ZA 4C4FA 4JAIA 4BI1A 5JZJA 5D9HA 5E8VA 4YP8A 3A4PA 4E5AX 5CANA 4BTFA 3D94A 4QMNA 5AR7A 1IAJA 3NNVA 4KSPA 2YM5A 2QOIA 4AT5A 2FSTX 4D2PA 2QNJA 4F7JA 2GHLA 3EMGA 2X81A 3HZTA 4U81A 5B2KA 2XK3A 2A2AA 4EHEA 2EUFB 1REKA 3VBYA 2R3RA 5EQYA 3NSZA 4GK3A 4O83A 3DBEA 2EWAA 2VTSA 2Z60A 1SZMA 3G0FA 4V0GA 1S9JA 4HW7A 4JVGA 2A4LA 3HV7A 3KK8A 4PDOA 5AUYA 3BIZA 4Z7GA 3GCVA 4AXEA 4RJ4A 2I40A 2QLUA 1G8JA 3NUPA 4FSWA 3VUGA 3VQHA 2OFVA 3OCGA 4FKIA 5HD4A 5HTCA 4DEHA 1NVSA 5EK7A 4A7CA 4AZVA 5BVEA 3ZTXA 4WRSA 4U97A 3MH0A 3ODYX 4EOQA 3U6HA 4I23A 4J52A 3D5XA 3CLYA 1O6KA 4GIHA 5J1VA 3QTSA 3DB8A 2XNOA 2CMWA 1OL5A 4RG0A 3PJCA 2OGVA 4DAWA 2Z02A 3QC4A 2RFNA 2PZPA 2XNPA 4ZSLA 3QF9A 4PTEA 2JFLA 1ZZ2A 2OFUA 3PSBA 4YC3A 2GFCA 5JZNA 4DG3E 4U40A 3HL7A 4I93A 3E62A 4J71A 3RPOA 3MIYA 5B2LA 3PP0A 4IX5A 3DLSA 3QTZA 3DPKA 3QU0A 3Q4CA 4U79A 2XKFA 3HLLA 3FY0A 4C35A 3CTHA 4FG9A 5H9BA 4BICA 3VUHA 3ZOSA 1ZZLA 4XS2A 1R39A 3EFWA 4LGDA 1PXIA 2X2KA 4Z16A 4CKIA 3ZUVA 2XYUA 2X8DA 5JRQA 3LLAA 5DH3A 3WF5A 3VS2A 4BJJA 3MY0A 2VWYA 3BYOA 4A9YA 3MY1A 3DKFA 3L8VA 1W8CA 1GZNA 3G33A 3UC4A 2QOKA 4QMOA 3C5IA 1XH8A 4M3QA 3MN3A 4O7WA 3F9NA 3ODZX 4BKZA 2A0CX 4IDVA 4RZWA 5J1WA 2IVSA 3NYVA 4KB8A 2EXMA 2E9VA 3OD6X 2QOOA 3KULA 3QRIA 4S30A 3DAEA 4DE4A 3LQ3A 3OY1A 5EHOA 4O1OA 1RDQE 2QC6A 4FV1A 5D12A 3UVRA 5M55A 2JAMA 3W16A 4TYHA 4APCA 1JSUA 4TYJA 2J0IA 2X7FA 3FV8A 4J7BA 4KINA 4I24A 4KRCA 1PMUA 5I3OA 3WIGA 3R9RA 3DAKA 4R1VA 4ZJJA 4UXLA 3O5AA 3EQCA 3VBWA 2X4FA 5EHYA 3VNTA 3S00A 4UMRA 4RVLA 3Q6WA 2B7AA 3V5PA 3W2QA 3K54A 5I5ZA 3FZSA 4QP9A 3O8TA 3VJNA 4BI0A 3RM6A 4JOAA 2J51A 1KV1A 1W98A 4QTCA 1OGUA 4R5YA 4DTBA 5LVOA 3UQFA 1KE5A 4JDJA 5BMMA 2UZWE 5J5TA 4OTHA 4N57A 2R3NA 4C2WA 3S2PA 2JKOA 4V0GB 1M2QA 4QP3A 3PXRA 4BY9E 4L6QA 4KWPA 4LRJA 4S34A 3VIDA 3Q9ZA 1BI8A 1V1KA 1Y57A 2JKKA 2YCSA 2P33A 3DBDA 3PA3A 5KHXA 4O7SA 4QMZA 4EI4A 1PXNA 4L44A 4FL3A 3IOPA 4BCIA 4P5QA 5DGZA 4ANSA 1ZYLA 4RWJA 5C4KA 4EOMA 5CXZA 3K2LA 3SOCA 2ZFYA 3NX8A 4O21A 1H1RA 4ZSAA 3UOHA 3ELJA 2UVYA 1GOLA 3CKXA 3CQEA 3KB7A 2AC5A 4I6FA 4DFZE 4G6LA 4EKKA 4UZDA 3UIBA 2X1NA 4NU1A 4F1MA 1DM2A 3ALNA 3PWDA 5LWNA 2OKRA 2OJJA 2YDJA 4CRSA 2QD9A 3IW5A 4P4CA 3ZDIA 4IZ5A 2XAMA 4FSZA 2QG5A 3RM7A 3O71A 4JQEA 4I0TA 3NCGA 4XG2A 5E8XA 2IZTA 3FZ1A 5FLFA 4QEBA 3BLQA 3KEXA 2PZRA 2YDKA 2VTOA 4AE9A 4MF1A 2P2HA 4QMXA 4B99A 3MI9A 4PTGA 5FM2A 4FVPA 5HIBA 3UDBA 3EFJA 3UIXA 4QPSA 4IFCA 5AR8A 1KV2A 4M0ZA 4D5KA 1FMKA 2UZDA 3ACKA 3H30A 4DEEA 5BPYA 4L42A 4GW8A 5HI2A 3LM5A 5JH6A 2ZM3A 1MUOA 4NM7A 4QP7A 4FYNA 5IQDA 4H3BA 5D11A 1V0BA 4AN9A 2VX3A 2YM7A 4JQ8A 3C7QA 3I4BA 5E8YA 4I41A 2QO2A 4RWKA 2QOQA 3VUIA 4F9WA 1QPDA 2O65A 4E4LA 2UZEA 4D2WA 2XK7A 2C3KA 5FDPA 1W7HA 4GFGA 2NPQA 3CD3A 3V51A 3NR9A 2QOBA 4AU8A 5AUXA 2YWPA 1ZYJA 4TT7A 2QKWB 2WTVA 3A7GA 3VBXA 5GINE 5CT0A 3TUBA 5I9UA 3KULB 5GNKA 4BTMA 1ZARA 4B8MA 3N4UA 4ZTRA 4AG8A 3FLYA 3HRBA 3M2WA 4FV4A 4XV3A 3MPAA 4YBJA 2OIDA 1Q41A 5J79A 2R0IA 3RALA 4TYHB 3C13A 2HXQA 2BIYA 4FKOA 4F0IA 2IZUA 5ETFA 4UX9A 5M4UA 4JX7A 4IB5A 4TWCA 3HRFA 3QYZA 4N70A 5EOLA 3GU4A 4FEVA 4BGGA 1NY3A 4O0SA 1BI7A 5I3RA 2C5NA 1I44A 1H4LA 2VX0A 3A2CA 3ANRA 4J8MA 5DNRA 4BIBA 3E7VA 2W1EA 3IKAA 2X2MA 4I94A 5CAQA 4S32A 1MRVA 3O96A 4F7SA 5BUIA 2VUWA 5IH5A 4O82A 1PMNA 1OZ1A 4ALVA 3LPBA 4EK5A 3AC3A 2P4IA 5AR5A 2B54A 2UZOA 5CAUA 2BALA 4UMUA 3TUDA 3ORMA 1SM2A 1YOLA 2ZB0A 3OEFX 5CI7A 3ZDUA 3LMHA 3TNPC 5IMXA 4MNFA 2XS0A 3TTJA 4Q5HA 5H8GA 5C27A 3ZS5A 2B53A 1OL1A 2QKRA 2XK8A 4CMUA 3U54A 5KBQA 4IB3A 1BMKA 3QCXA 4DYMA 5M4FA 5DPVA 2OU7A 4JG8A 3MFRA 3ZO2A 4TL0A 2CGWA 3KRXA 3NDMA 4O84A 4G2FA 5DLSA 2I6LA 2BTRA 2X8EA 1TQIA 4LUEA 1ZOGA 5C26A 4HNFA 3AKKA 2WMWA 3PXKA 3C4ZA 1WVYA 3JS2A 3RPVA 2RFDA 2PY3A 2BZKB 4ANOA 3F3UA 4AOTA 2WO6A 2WMQA 3KKVA 3C4WA 3L9NA 3QKLA 4F70A 5A6NA 1OI9A 3ORKA 3OS3A 4BDFA 2JBOA 3D9VA 3AT3A 3KXXA 1WVWA 3N4VA 4FV9A 3CKWA 2F2UA 1BYGA 2AC3A 3HGKA 4RC4A 5HLNA 3COKA 3ORXA 3FZOA 2HIWA 4C3PA 3WYYA 5C01A 5J5SA 2VNYA 4XOYA 4PP7A 4GYGA 2GMXA 3WIKA 3PXFA 4CVAA 1W83A 3BHYA 4BDIA 3DOGA 2XNBA 4RVMA 3N9XA 4FZAB 2DQ7X 4IXPA 5ICPA 5KHWA 3I5ZA 2HWPA 4FMQA 4M0YA 1W0XC 2R9SA 3RAIA 4CT2A 4E7WA 2VAGA 4YO6A 4CRLA 4O7RA 4BYIA 3PVBA 2WTWA 5HG8A 5KMNA 3JVRA 4D5HA 5JRSA 3COHA 2YCRA 4BDJA 5EDQA 3R1SA 3UG1A 1G3NA 3KN5A 4TZRA 5IUIA 5DR9A 2Z7LA 2XALA 3ZRLA 3UOKA 2OSCA 3FYKX 4XP2A 4DHJA 2WOTA 3RAHA 3TCPA 4APPA 4LG4A 3AOXA 5CF6A 4XJ0A 1FINA 5IISA 4HGSA 4ZMFA 3EFKA 4YZDA 3O8UA 3QD4A 4PDYA 2CKQA 2V0DA 3V01A 1FQ1B 2QU6A 1F3MC 3MGYA 3DB6A 4ASXA 4QMQA 1SNXA 2BAQA 3QZIA 4DC2A 2GPHA 5KMLA 5BMSA 3TIYA 2PVLA 3KK9A 2G2FA 4XUFA 4HGLA 4J8NA 4AW1A 3RK9A 5HLPA 1VR2A 4FIFA 4WRGA 3UOLA 2XIRA 3F82A 4XH6A 2JGZA 3DGKA 3D5UA 2R3MA 3UIMA 4E6CA 1PF8A 4FTNA 4CXAA 4TYGA 2PVYA 4D9UA 4CEGA 5LVMA 5CZIA 4IJPA 2YERA 4UZHA 2GS7A 2JBPA 4P5ZA 1XMLA 3MDYA 1L3RE 4JDIA 4RBLA 1ZOEA 3ULZA 1OITA 2EB3A 5CF4A 3FQEA 2UW4A 5FXRA 4DTAA 3C4EA 3I6UA 4QYEA 3PP1A 4PY1A 4UYNA 5FWKK 4BWKA 4QTDA 4JAJA 2CKPA 2I1MA 2YIYA 3E3PA 5AA8A 2B9FA 3L8SA 5F95A 5C1QB 3FL5A 4ACGA 2C6KA 2WXVA 3G90X 4GV1A 3PJ2A 4AZTA 4FTTA 4GKIA 3HAMA 3DAJA 4FSQA 3RJCA 4BZDA 2I0EA 4I92A 4B8LA 4EORA 2C0TA 3G15A 2Z7RA 3R7EA 3O7LD 1XQZA 4AA4A 3SA0A 3S3IA 1PRYA 3EQPA 3Q9XA 2YIQA 4G31A 4G17A 4KIPA 2J9MA 3GCPA 3DZOA 3PA4A 4FKLA 5BYZA 1PKGA 3FMKA 4C3FA 5HLWA 4IAAA 2JDOA 2XIXA 4M66A 5BVNA 5J9YA 1H28A 3PLAE 3HDNA 5KKRB 4X3FC 4UMTA 1TVOA 3E93A 3BCEA 4UYAA 3TIZA 3NVKI 1R0EA 3I6WA 5EYDA 5JGAA 4YPDA 3RNYA 5HQ0A 3M42A 4FL2A 4DHIB 1PJKA 3QXOA 2W1ZA 2XRWA 3MVJA 4M14A 4DDIA 1M7NA 2IW8A 2O64A 3BHUA 3K3IA 1PYEA 3BKBA 3QRKA 4UY9A 3FMNA 4Y72A 2OJ9A 4MXAA 4AA5A 2X39A 5EDRA 1UU7A 3SQQA 4OTIA 3IW6A 1ZRZA 3MWUA 5IEYA 2BFXA 3E8DA 4EH7A 5AUZA 4DCEA 4KRDA 5E4HA 4QO9A 4ANBA 3R8ZA 4A07A 4ANLA 2C1AA 5AM7A 3D14A 4DH8A 3HEGA 4ZLOA 3CY3A 4FKWA 4FZ6A 5AP1A 3ALOA 1ZAOA 3O50A 4X2NA 3S4QA 4EONA 4X2GA 3EQFA 3BWFA 4R6VA 4HVSA 4RC3A 5KKRC 5IQIA 1XJDA 1YHWA 2ACXA 4FTRA 2G15A 3R7OA 2I0YA 4ERKA 1VYWA 3U6JA 1NVRA 2W96B 3F3WA 3QALE 2FUMA 2H34A 2O5KA 4V04A 3FI2A 5DG5A 1XHAA 1P5EA 4H36A 4KD1A 3D15A 1KE8A 3SD0A 5K5NA 3D0EA 5HBEA 4NL0A 3R04A 4E6QA 2H96A 3P1AA 5JEBA 2R3IA 3QD0A 4M84A 4TPTA 2ETKA 3MA6A 3AC1A 1RJBA 3NS9A 5CQWA 4ACMA 1OB3A 2B0QA 3VS3A 3UVPA 4YU2A 4QPAA 4NH1A 5I0BA 4ZMEA 2WMXA 3ZYAA 3W10A 4CZTA 3Q2JA 3LQ5A 5FTGA 5F9EA 5CS6A 4XG9A 4BGQA 3KQ7A 2QU5A 4MXYA 4D4YA 1FVVA 4FKQA 4BIDA 2PTKA 1H1SA 2OK1A 3OVVA 4QYYA 4RPVA 5IA3A 2X9EA 3QL8A 2QO9A 4EOLA 5H8EA 4YTCA 4Z55A 4YSJA 3DLZA 4IBMA 2C0OA 1UA2A 2X0OA 3W0MA 5L6PA 3IGOA 1PXMA 5H8BA 2UVZA 4QNYA 3BGZA 2XIYA 4ZAUA 2WQOA 4LQMA 5DT4A 4D4RA 5JFWA 5HE3A 3KMUA 3WZJA 2R3KA 3FMJA 4IANA 4IW0A 1SMHA 4FTJA 4BCGA 3KC3A 4XP0A 4WUAA 5BVKA 2G01A 3QFVA 3GU6A 4YZMA 4LOOA 3LHJA 4G1WA 4ACHA 5HVKA 3PFYA 1G8KA 4JR3A 2UW7A 3CQWA 4BB4A 5CSPA 4TWOA 4U42A 3EYGA 2NRYA 5FUTA 3PWYA 3DBFA 4I5PA 3ROYA 4Z3VA 4KIQA 2G9XA 5A3XA 1LP4A 3UYSA 4I22A 3TZ9A 3QCQA 4PNKA 2W5HA 4O22A 3A7IA 4F6WA 3NWWA 5LVLA 4X0MA 4D0XA 4EOPA 2PUIA 4DGOA 4E6AA 1QPJA 2C1BA 4O6EA 2BVAA 5EW9A 4CGAA 5J95A 3TT0A 4FSNA 4O0XA 4FA2A 5JKGA 2UW5A 1J7LA 4IVCA 5CLPA 1KE7A 1SYKA 4FNWA 4MXZA 1XH9A 3ZH8A 3CQUA 4OUCA 4OTWA 3DKGA 1GIHA 4CFMA 3DBCA 4IM2A 3EZRA 4I4EA 4O4BB 4M67A 4NCTA 5A9UA 3ID6C 4OR5A 3P5JC 5CQUA 3TV4A 4FKVA 4E4MA 4FUXA 4B6LA 3LFAA 2JKQA 5ACBC 5HNIX 2XMYA 4E26A 4YLLA 5BQ0A 2QR8A 2Z7QA 3DXPA 3BRBA 3F2RA 2WMBA 1W84A 4O4EA 2ITXA 4QDVA 3CS9A 1CSNA 3GCSA 4ZSJA 2W7XA 3QZFA 1Q62A 3D7TB 1YI4A 2Z7SA 2F2CB 4NM0A 4DN5A 5K3YA 2RKUA 3OP5A 4Z7HA 3VJOA 4QTBA 2JDTA 2G1TA 4PMPA 3TM0A 4RC2A 5E8SA 2VTAA 1FPUA 5EKOA 3GNIB 4C4HA 1IA8A 4L3PA 3GBZA 4CZYB 5HKMA 3VUKA 3I79A 3FY2A 1H00A 2UZLA 4JBPA 2F4JA 4NYEA 4I20A 4X3JA 3AT2A 2YCFA 3MA3A 3FLNC 3ZU7A 3Q5IA 4H3QA 3RK7A 3DXNA 1CTPE 2CLQA 3PVUA 4MD7E 4IM3A 3RZFA 1ZYCA 2IWIA 4LMNA 3Q9YA 4PDPA 5EM5A 4EJ7A 3POZA 2BR1A 1OMWA 2YA9A 3DA6A 1XKKA 2ESMA 3AD4A 3OCSA 4FKGA 4W8DA 3W2CA 3IDPA 5EQEA 2R3FA 3P08A 5AIKA 3NUYA 4CZUA 3PXQA 2BHHA 2HW7A 3JPVA 3TI1A 3O2MA 2BUJA 3IW8A 2WB8A 5D10A 3RCJA 4C37A 1WBSA 3GFWA 4I6HA 4QRCA 5LARA 2UZNA 2WMAA 1J91A 3QRJA 3Q4ZA 2ZM4A 3ORTA 1OUYA 3UMXA 3EL8A 1W2FA 2PVHA 2XB7A 3ATSA 2ETRA 3PY3A 4ZSEA 4JL9A 3KFAA 4ENXA 1PHKA 4J97A 1HCLA 3SC1A 3PIXA 5J9LA 1Q8TA 4FC0A 3LCOA 3AQVA 1QPCA 3FAAA 3CXWA 3QZGA 3E7OA 4WBBB 4C2VA 4HYSA 4LUDA 5HIEA 5HU3A 1M52A 1LPUA 5GJDA 3C9WA 4WNKA 4IWOA 3UC3A 5E92A 3C1XA 3VF9A 4AFEA 3WI6A 3RKBA 3LJ2A 4E8AA 3ITZA 3VUMA 4C7TA 5EM6A 5IDPA 3NFGB 1H1PA 3R00A 1Y8YA 2ZJWA 1JKTA 3ZRKA 5ANGA 2WZJA 4B4LA 2YLFA 5TF9A 3JUHA 2YEXA 5F1ZA 1WFCA 2J0KA 4KKHA 3ERKA 3QCYA 4EK4A 1OIUA 4FJVA 2X6DA 2C3JA 4XRLA 4FKUA 4KIKA 5FTQA 4EK3A 3NAYA 1CDKA 4QYGA 4QYHA 4Y8DA 2BRBA 3BV3A 3UP2A 5LWMA 3S1HA 4BCKA 5LQFA 3Q6UA 4U45A 4DCAA 5EI8A 4RGJA 2ITYA 2GNLA 2QURA 5DA3A 2LAVA 3TZMA 2IVUA 4EQMA 3V5TA 1ST0A 3W0RA 2F7ZE 4X6QC 1WBVA 4QOXA 4BHNA 1PW2A 3PG3A 3QC9A 5KMIA 3HAVA 4XV1A 2R3QA 2JITA 1PXPA 2HAKA 4YJVA 4LDTA 2X0PA 3D2KA 3DQXA 4RT7A 3VS0A 5EFQA 4DG0E 1BKXA 2XJ1A 2CGUA 5ANDA 2HY0A 3BGPA 5HE1A 1BX6A 2CCIA 5TT7A 5DE2A 1BLXA 4WA9A 3COMA 1STCE 3C4XA 3O51A 4G9RA 4GT4A 4N4SA 4YZBA 1JSTA 3MVHA 1YQJA 2FYSA 3BU3A 1OL7A 2Y4IC 5DMZA 3C4CA 5IKWA 4AAAA 5LMAA 4II5A 5J8IA 4MBIA 3IW7A 4UB7A 4MD8E 2J0MB 1OVEA 4OTDA 1U54A 3F66A 5HESA 3QXPA 4FZFB 3DK7A 4YSMA 3AGMA 3JXWA 4F08A 3V6SA 4FK3A 3U6IA 4CTCA 5EG3A 4EH2A 4D28A 3S0OA 4RFMA 5LCKA 3U51A 2XBJA 3G6GA 4FV7A 4XOZA 4GU9A 1XR1A 2CSNA 1OUKA 5HGIA 4F09A 4ZY5A 5LVPA 4C38A 4P90A 3POOA 4YMJA 4RWLA 4TYEA 3U4UA 2C6IA 2XK6A 4QMYA 4ASEA 4IZ7A 4YLKA 2V7AA 5CAVA 1DI9A 2J0JA 1A06A 3KF7A 2CNVA 4I6BA 5EI2A 3TV7A 2P2IA