2QD9A

P38 alpha map kinase inhibitor based on heterobicyclic scaffolds
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of p38alpha MAP kinase inhibitors based on heterobicyclic scaffolds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qd9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qd9A01
3A62A 4RFMA 2GQGA 3HKOA 4I5HA 2W1CA 2O0UA 2IN6A 3DY7A 3F5PA 3MY1A 2OBJA 2ITTA 3ANRA 4HNIA 4PMTA 3N4UA 3BLRA 4G2FA 1Q3WA 2JBPA 3E7VA 2C30A 5HKMA 4OTPA 2IZTA 2PMIA 3CTQA 3OF0A 3UIBA 2G01A 3EYHA 4WG4A 4RQVA 3SXRA 3TV6A 4CV8A 2XK8A 5CU0A 2A27A 4JXFA 4MHAA 4DG3E 5CSPA 2YITA 3U87A 4KBKA 4I3ZA 3NIZA 5IDPA 4DYMA 4C4FA 3PVGA 1R39A 1JKTA 2QURA 3AMBA 4K6ZA 5CTPA 4I21A 4DEIA 3ENHA 1Q8TA 3U9NA 4NYEA 5DFPA 3LMHA 2X8DA 2E9VA 3F9NA 4QMNA 4BDHA 4BWXA 2FB8A 4K9YA 2OJGA 2PTKA 3D5WA 4X3JA 4Y73A 2EXEA 4IHPA 5FDPA 4K77A 4KA3A 3EYGA 2YCRA 2XK9A 4RQKA 4YZCA 4CVAA 4C61A 2C6EA 4GT5A 4XEYA 4C57A 3GEQA 2CPKE 3ZZEA 3KC3A 3JY0A 4FV8A 4QMOA 5AADA 1OB3A 2BIKB 4BIEA 5CU2A 1YQJA 2HAKA 2X8IA 3FXXA 3QA0A 1KV2A 3UIMA 3C51A 4GFGA 1Q5KA 2JGZA 4YU2A 3E62A 3U6JA 3G9LX 5TKDA 2ZM1A 3M11A 4APCA 4D2VA 5JGAA 2V55A 3DBFA 4RX8A 3ROYA 5HGIA 1IR3A 2YCFA 4TKSA 1WFCA 3BGZA 2QHNA 5CY3A 4PQNA 4WA9A 3LKMA 3O50A 3QCXA 4IC7A 3HL7A 4I0SA 1WVXA 2R3OA 4BCFA 3DT1A 3QXOA 4N6ZA 1Q24A 5IF1A 1M52A 4GW8A 3WIGA 4RFYA 5CT0A 4O84A 4OLIA 4LYNA 1AGWA 4FKRA 2PUPA 3AMYA 1U54B 3F5UA 4R3CA 2GS7A 4M68A 3F2NA 1XBAA 5EYMA 3LFQA 3ZBFA 2F49A 3BHTA 1YHSA 4XLIA 3GU6A 2VTAA 1ZMVA 5TF9A 5EQYA 4XOYA 2F7XE 5F94A 5HHWA 4E4NA 4FT3A 4H3PA 2C4GA 3PFQA 4X2JA 5FXQA 3WF6A 1YXUA 5C4LA 3FMNA 2Y0AA 3EQIA 2YA9A 3CBLA 4JDKA 4O86A 3RCJA 2YM8A 3MW1A 4RJ6A 3TNIA 4CCBA 4EUUA 3C0GA 5H8GA 5CZIA 3FKOA 3KRJA 4JDHA 3SOCA 3OHTA 4RZWA 1JAMA 3UIUA 2IZUA 2HCKA 4F70A 5CASA 5HLNA 2UV2A 2ITWA 4YHFA 4MVFA 1H00A 4YHTA 5FDXA 4E7WA 2J50A 4FKOA 4PL3A 3I6UA 3LZBA 3WZKA 4HGEA 5CEIA 3VBWA 4AX8A 5M51A 3DZQA 4LUDA 3IW4A 3NUYA 3ORIA 4Z7GA 3DAEA 4CQEA 3Q2MA 3VS2A 4F6UA 2QVSE 2YM4A 3KRWA 5LWNA 4YGAA 4FV1A 3R02A 5K0KA 4BGHA 5LARA 2W4OA 4CRLA 4HVGA 4ZLOA 3WARA 1Z57A 3CGFA 3R8ZA 3KY2A 5J5SA 4NFNA 3BELA 1MQ4A 4UMPA 1IA8A 4GFOA 4FGBA 4KKHA 3PJ8A 1PF8A 2BPMA 4KAOA 4XP0A 2O8YA 4IANA 4S32A 2G2IA 1YWRA 3Q3BA 5GJFA 4DLIA 5IU2A 3IS5A 4FIFA 2BZJA 1IRKA 3K5UA 3EN5A 3QZGA 4UB7A 4EQUA 2R3FA 1IG1A 2XK3A 3UC4A 3V6RA 2XNBA 2WTVA 4RIXB 2C1AA 2Y9QA 2YIYA 4BZDA 4IZYA 2BTRA 4JBOA 3I81A 4EC9A 2XBJA 3NW6A 4GEOA 4X2NA 5FEQA 5IISA 3U6IA 5GIPE 5F9EA 2C5XA 1V0OA 1NT2A 3E8CA 5IQIA 2ZJWA 4FMQA 4FSWA 4DT8A 5L4QA 4WOVA 2QKRA 4TZRA 4FT5A 4ZSEA 4AOJA 4DT9A 4AGDA 5BYLA 4EK6A 4UV0A 4HCVA 4FTUA 4CFVA 4JG6A 4D28A 4XX9A 5HBJA 4Z55A 3U54A 4AQCA 1KOAA 3VWAA 5BPYA 5FM2A 3QA8A 2VGPA 1ATPE 2VWBA 2I1MA 2X2LA 5KE0A 3H4JA 5CEMA 2I0HA 3I79A 4FVPA 3U4UA 4CMUA 2WNTA 4KS8A 3CJFA 3EN4A 2WMBA 3R9NA 3SGCA 3HDNA 4FNYA 1GIJA 4A9SA 4D4RA 2C0OA 3VULA 4LOQA 4LL5A 3HV4A 3F88A 4IBMA 3EFWA 4DGOA 4BDCA 2C3JA 3MTFA 2JDSA 4QP9A 3FLWA 4O7RA 4EZ5A 4QP1A 3BBTB 4J53A 3FMHA 4U3YA 4O0XA 4OTDA 5H3QA 2JEDA 3GU8A 3ODYX 3TV7A 5DEYA 3OMVA 2XIZA 4ZLZA 3VS1A 3WILA 3R21A 3A61A 3QYWA 3ZC5A 5LWMA 2XB7A 4FTQA 4QMPA 5BMSA 4DGGA 3MFRA 4Z9LA 1BKXA 3FPQA 4W4VA 3PDTA 3PG1A 4BBEA 2ZVAA 1IAHA 3ZUVA 5F20A 4DEAA 3VC4A 4XG9A 3FLZA 1PKGA 4H39A 4CT1A 4M84A 4DFXE 4AA4A 4F08A 4E8AA 3B8RA 4GK2A 2PE0A 3GUBA 3MIAA 5E8WA 5M56A 1UWHA 3SKCA 4Z7HA 4MQ2A 2YM6A 1PXJA 3RWPA 3FHIA 4HZRA 4I93A 2I0EA 4O7LA 2R9SA 3R22A 4JL9A 4E93A 3OUKA 5E8TA 4W4WA 5IQHA 4E5AX 4MWHA 5KHXA 4DBXA 2HZ0A 5IH6A 5KNJA 1OKVA 2R3NA 2XYUA 3MB6A 2WTKC 4FKLA 4HCTA 4O2PA 3NZ0A 2E2BA 3MFSA 4O6LA 4AN9A 2B53A 2X8EA 4O7VA 4EL9A 2HWPA 4C38A 1GAGA 3PXYA 4FE2A 4RJ8A 2WQBA 4LM5A 4GG5A 4AT4A 2GNLA 3P9JA 3Q60A 4O38A 3E5AA 4IAFA 4J97A 3C4XA 2ERKA 4D5HA 4BCPA 1ZYCA 4K0YA 4F4PA 5CAPA 3KXHA 3ZZWA 5A6OA 5LJJA 1TQIA 5HD7A 3AD6A 4CFMA 2XH5A 3D7TB 3D15A 4QQCA 5ETCA 5FTOA 4D1SA 5IQDA 2QG7A 3GENA 3F66A 5AP2A 5GINE 3ORKA 4IAZA 1JSTA 3ZRKA 2HXQA 4E20A 3GCPA 1MRUA 3DTCA 4QQ5A 2RFNA 5A54A 1CM8A 4PMSA 2XIXA 4AW1A 4X0MA 3KA0A 3ZMMA 4X7QA 3EN7A 3EJ1A 3QC9A 3ATSA 3PP1A 2NRYA 2QOLA 3IOPA 3FKNA 3G51A 4PV0A 4QP3A 4WKQA 4XBUA 1RQQA 4AS0A 2VN9A 4EOIA 3G6HA 4F1MA 1H1QA 2R3KA 4GCJA 3VJOA 4CGAA 3OT3A 1KE7A 2BZKB 2UZNA 1W82A 2XRUA 3I60A 3KULB 3LMGA 3POZA 4U97A 4EH6A 1UU8A 3G9NA 3QF9A 2OJ9A 4DEHA 3PXRA 5HTBA 4ANLA 3GVUA 1NY3A 2WU6A 1U59A 2P0CA 1H28A 3QTQA 4AAAA 3TNQB 3PXZA 3D5UA 4ENXA 4MD8E 4S30A 4EK5A 3PZHA 4ZAUA 5AV1A 2J4ZA 3NLBA 4EHVA 1H0VA 4IAYA 5ANGA 2ITXA 4AT5A 4CCUA 3DLZA 4FNXA 5LVNA 4FTLA 4HPUE 4H36A 4ZZOA 3HGKA 4EKKA 1ND4A 4U3ZA 4EBWA 3Q96A 5CI6A 3ORLA 5B2LA 1WBNA 4TY1A 5DGZA 4HYUA 3E8DA 4ANNA 3ID6C 4BBFA 3BV3A 4EJ7A 2YZAA 3HECA 3RZBA 2ACXA 1V0PA 2BDJA 5J7BA 1J3HA 5AJQA 3EOCA 4ZTQA 4H1JA 5M07A 2X7GA 4NH1A 3ZSHA 5EQPA 1UU9A 3E3BX 1BYGA 3BLQA 4MNFA 3QQGA 4MXOA 1WZYA 2ITQA 3KK8A 3VIDA 3K3IA 4AXAA 2OXXA 2JKQA 4FKTA 4BDFA 3BPRA 4RVTA 4FKUA 1M2QA 4ZY4A 3R8LA 2GSFA 5DOSA 4QYHA 3TKHA 4BB4A 3C4FA 2RF9A 3PPZA 2H96A 3POOA 4QQJA 5M4FA 2VWUA 1H1PA 3EHAA 3UQFA 4OT6A 5JEBA 4LV8A 2YHVA 4UZDA 1YWNA 1QPDA 4BY9E 4HVIA 4RWLA 1W83A 2JDRA 3NUSA 5ETAA 3PJCA 4CFUA 4UMRA 4FYNA 3LCKA 2XIRA 2P2HA 4FT7A 4XMOA 3ZOSA 3DU8A 3UIXA 2X0GA 4UMUA 3GXLA 2GQSA 2C5YA 1VJYA 2ITVA 3DAKA 3G2FA 3OTVA 3QD3A 3L8SA 5DE2A 3PIXA 4QD6A 3UO4A 3DS6A 3DJ6A 2VTHA 2BRBA 4F9YA 4AGUA 3NW7A 3BHUA 4YJOA 4C62A 2VWVA 3QKMA 1PXOA 4H58A 4X6QC 2BFXA 4DEEA 3CJGA 3Q32A 3NPCA 5AX3A 2HOGA 3BYMA 5JFVA 4JBQA 5M4CA 1ZRZA 3OT8A 4CYIA 1DAWA 2WIPA 3SA0A 4IEBA 2EB2A 1H1RA 2VX1A 1FVVA 2BRMA 4FKIA 4JDIA 4L01A 3NAYA 3P4KA 3Q9WA 1SYKA 1FOTA 2W1ZA 2W5HA 3EQDA 4I6HA 4ZTSA 5JZNA 3UBDA 4G3EA 3HMOA 5EOLA 4YMJA 1ZYSA 3LAUA 4E6QA 3EKNA 3BBWA 4EONA 2JC6A 1LR4A 4OTQA 1UKHA 1JKKA 4A9RA 1ZOEA 1YOJA 4OTFA 4O0SA 3ZLYA 3R2YA 2IPXA 2JD5A 4DTBA 4C4GA 3OXZA 4CYJA 4XV1A 5EW8A 2YABA 3VUIA 1I09A 2OSCA 3ORNA 4U42A 4FKQA 3VS0A 4A4LA 4BDIA 2A2AA 3I4BA 4EOJA 4GV1A 3RVGA 1OVEA 5KCVA 4DE4A 3QRTA 1SMHA 2C5NA 3TKUA 3C0IA 3Q53A 2UZTA 3DNEA 3D14A 5L3AA 3HA8A 3MPTA 2BVAA 3FI3A 3DK7A 3KRLA 4M67A 3WF8A 2C68A 4IB0A 4ENYA 1OKWA 4ZTHA 1Y6AA 2Y8OA 4L9IA 3Q04A 5EI2A 1S9IA 4L53A 3DKGA 3FY0A 4CG9A 2GHLA 5DBXA 3LQ3A 3VQUA 2NNWB 4IX6A 2JDVA 3BV2A 5DMZA 4V01A 4JIAA 4XP3A 3MH3A 4N6YA 4RZVA 3W2CA 2EWAA 3VNTA 4O0RA 4XV2A 4BDKA 4OUCA 1VR2A 1S9JA 5GJGA 4H1MA 3MH2A 3BCEA 3BGQA 3FXZA 1KE8A 3R28A 3FYJX 4JAJA 4QTDA 5AWMA 4Y95A 5BVEA 3P7CA 4JDJA 1PXNA 5C27A 4XJ0A 4DBNA 2R64A 3HMIA 1ZY5A 4IFGA 4FV0A 3HVCA 2XIYA 4YZ9A 3KEXA 3M1SA 4N4SA 4BWPA 4WHZA 3RINA 3UG2A 3O51A 4F9WA 3F7ZA 3F7WA 3MN3A 2BHHA 3FKLA 5FRIA 2UZLA 3Q4ZA 4O1PA 4RJ4A 4AU8A 1XQZA 2XNEA 2CKEA 2WHBA 3MI9A 4QMZA 4X3FC 4C33A 4U6RA 1OZ1A 2JIIA 3G6GA 4X3FA 3VBTA 2CNQA 3IW5A 3FI2A 3O8UA 3DJ7A 4QT1A 3R1YA 1M7NA 1XHAA 1VZOA 4I6BA 4QO9A 4DC2A 2WB8A 5AR7A 2RG6A 3OVVA 4DEBA 3ATTA 1PMVA 5LQFA 3ZEWA 5EHYA 4YLKA 3VS4A 3RM7A 3IGOA 5IMXA 4IDVA 4KUJA 2GDOA 3AC4A 5B7VA 4TNBA 4PDPA 2WEVA 5EW3A 2G2FA 1FGKA 3FC2A 2F7EE 3MWUA 2A1AB 1M14A 3KF4A 3E92A 3NUAA 4ACGA 3R30A 3AGMA 3F3ZA 1BMKA 2XMYA 3LCOA 3IGGA 3FSKA 3NEWA 2IW9A 3VBVA 3QWJA 2B9JA 3IO7A 4GUEA 3ZUTA 4FZFB 5D12A 3TNHA 3LQ5A 2CN8A 4J96A 1QPJA 5KZIA 3TZ8A 2PZPA 5ICPA 3O23A 2C6KA 1ERKA 3R1SA 2HY0A 3ALNA 4MBIA 4USDA 3BWJA 4DTAA 4O81A 4LQMA 5ACKA 2AUHA 4DG0E 3O71A 4BBMA 3E88A 2B52A 1H01A 4E6AA 2IO6A 4KIPA 3JYAA 1R3CA 5E7RA 5FGKA 3ULZA 2VNWA 2PUNA 2XZSA 2W7XA 2OICA 3C4ZA 4QYFA 1UU7A 4TNDA 4FR4A 4NM7A 3MFTA 3UOJA 4X2FA 1H8FA 2ZV9A 5CLPA 1PY5A 3EQPA 3LQ8A 2ZB0A 3BX5A 3TZ7A 2XBAA 3MVLA 4F6SA 3B2TA 4RWKA 3SHEA 2B1PA 3WOWA 5KZ0A 2ONLC 5IH5A 4GJ3A 3FPMA 5AUYA 2B9FA 5IA1A 2GTNA 3SDJA 1L3RE 1XJDA 5IG1A 1JBPE 2W5BA 3LMIA 4O7SA 3D94A 3SRVA 2OZAA 4FTCA 2VTOA 3E7OA 1ZARA 2Q0NA 3L9NA 3CEKA 4FZDB 3IONA 5DI1A 3AMAA 2A19B 2F57A 3VUTA 2GNHA 3NVKI 3D2IA 1YI3A 2BRNA 5JH6A 5A46A 3FZ1A 4JBPA 4YJPA 4HZSA 4C4IA 2XEZA 3O96A 5L2TA 4IM2A 1XH6A 5FEEA 3AC5A 4D1ZA 3E3PA 5ITAA 4R6VA 3I5ZA 1WVWA 3EWHA 4FA2A 4Y72A 4DFZE 5CNNA 2J5EA 5BMMA 2VO7A 4ZJIA 2OO8X 2ZM4A 5CEQA 1KOBA 4NIFB 4GIHA 5CAOA 4USFA 4WSYA 5H2UA 4M69B 3UVQA 3MS9A 5L2SA 2WGJA 1YXTA 3A8WA 4L8MA 4Y5QA 5H9BA 2I40A 1RE8A 3MVHA 3D9VA 4HGLA 2JAVA 3V3VA 4YJQA 2X4FA 5ANDA 4ZY5A 4FYOA 5HE3A 2UW5A 4IM0A 2ZM3A 1F0QA 3PJ2A 1XH4A 2UZVA 4RVKA 5DVRA 5EHLA 1JKLA 3F61A 3KRRA 4F6WA 2XNNA 3GC8A 4H05A 5DR9A 5HESA 4ZS4A 1OKZA 4M0YA 3AT4A 3AC2A 5AA9A 5AR8A 2BAJA 2J9MA 2O3PA 2R5TA 2Y6MA 2YISA 4IQ6A 4D0XA 2R0IA 4JT3A 2VD5A 1BI7A 1JPAA 3BU6A 2F2UA 4EH7A 2EU9A 3BIZA 3R2BA 4FKVA 4RVLA 5EYDA 3V5PA 3VBYA 4D2PA 3QZIA 4OBOA 1Z9XA 4GUBA 3SAYA 3FXWA 3P78A 2OKRA 4NJDA 3QXPA 4FV4A 1BL6A 4IWDA 2HIWA 4QP8A 1KE5A 3V5TA 2RSVA 5I3RA 3CKWA 2CGVA 3R71A 2BRHA 3EKKA 4DGLC 5IQGA 1ZOHA 2BDWA 2XJ2A 2XRWA 3LIJA 3UYSA 1XH5A 4B6LA 5K5NA 2B4SB 2JFMA 2R3LA 3UQGA 2PUIA 5AIRA 3RPVA 4FI1A 3R8UA 3DQXA 5EM5A 4D55A 4YNOA 5J79A 4TWOA 3NYOA 3RNYA 4BDGA 4DFLA 3QHRA 4KRCA 4M66A 3IG7A 2XNGA 2QU5A 4YHJA 4IJPA 5E8UA 4EK8A 1YHWA 5E1EA 2JLDA 3MIYA 4QMUA 4C2VA 3FHRA 2PVJA 2XUUA 4U9AA 1UKIA 3LJ0A 3OCSA 3GCVA 4AZEA 5JQ5A 3BHHA 3MESA 4RC3A 4GSBA 3R9OA 2C69A 3RK9A 5CS6A 4QTEA 3JR1A 2QU6A 3IW7A 4GT3A 4RSSA 3R7UA 2OI4X 2EXMA 4XHKB 3REPA 2VTLA 2CNUA 3QQFA 4PPCA 4FKGA 4NTSA 4WBOA 3NWWA 4ITHA 3CQWA 2QO9A 4IADA 4RC2A 3HLLA 2B9IA 4G5JA 5J87A 5AUXA 4O0WA 4CKIA 4NKAA 1OKYA 4NW6A 4S2ZA 4FTOA 3DKCA 2PL0A 2BAQA 2CDZA 2GS2A 2YAAA 5IQAA 1Q8WA 3PWDA 2GS6A 2QOKA 2UVXA 4KD1A 4J8MA 2FH9A 4NUSA 4QOXA 4R7HA 4EWQA 3PUPA 3UMWA 2HELA 3DTWA 2OFVA 4BI2A 2WKMA 4ZEGA 4TPTA 3BYUA 1E1VA 5CU3A 5CF6A 1UWJA 1GIHA 2UW3A 3PZEA 4XLVA 5D10A 5DR6A 5HD4A 4FSZA 2XKDA 1YVJA 4BCNA 2X4ZA 2FYSA 2X9EA 1YWVA 4DEDA 3G0FA 2OFUA 2ZV7A 4BDDA 1KWPA 4FZAB 2X7OA 4K1BA 4L3LA 3TDVA 5GNKA 1A9UA 1U46A 3FZTA 3NNWA 2R3JA 3O2MA 5HG7A 1JSVA 3VS6A 3PVUA 4FV9A 4C4HA 1DM2A 4KKEA 1URWA 2W96B 5EFQA 4QP6A 2XCKA 5LCJA 4GYIA 5E8SA 3KU2A 4UALA 5ANIA 4FTNA 4O0TA 5EHOA 1QPCA 3KK9A 2RL5A 3C50A 4GS6A 3ZBXA 4DH7A 4E73A 2W1DA 3FMDA 4ZSJA 2IVUA 4FG8A 4CG8A 2VGOA 3I7CA 3ORTA 2X2KA 4L3PA 1WBWA 2QG5A 2XM9A 4R5YA 3IW6A 4BZOA 3KREA 3QQJA 2PZ5A 5E8XA 2OK1A 3EMGA 3GQIA 4MXZA 4X2KA 3QX4A 3UC3A 4E26A 2ITYA 4F7SA 4BICA 3SV0A 2QNJA 3EFLA 3G0EA 4IZ7A 3PA4A 4GK4A 5AR4A 2GHGA 3GOPA 4LL0A 3ZYAA 1G8SA 4YR8A 4FNZA 2J0MB 2DWBA 2G1TA 2WD1A 4CTBA 5DT4A 2CLXA 1OECA 4C3PA 4ASEA 3TJCA 1MRVA 2O2UA 3VF9A 5TT7A 3RJCA 3TV4A 3HV3A 2IZSA 3E64A 4XNEA 2QHMA 1WCCA 3ERKA 4IH8A 2C5OA 3Q4CA 4FX3A 5ETIA 2NP8A 4XG6A 3CKXA 3E87A 4MXYA 2YLFA 5T3QA 4D5KA 1JSUA 3FLNC 5J1VA 4BI1A 2C3IB 3O7LD 3RGFA 5KMOA 1OPLA 2XNPA 4FTJA 1R1WA 1PMUA 3KKVA 5CX9A 3A4PA 4BIBA 2O64A 4EZ3A 5HNBA 4QNYA 3SG9A 4ZK5A 2HZNA 4IVAA 5I9UA 1OBGA 5JGDA 2YDJA 4WBBB 5GHVA 3R8VA 3UZPA 5HCXA 3R8MA 2BRGA 4CZTA 3B8QA 4AE9A 3RM6A 3KB7A 5HVJA 3ZDUA 4FSUA 3PXKA 3QQKA 3I0QA 4PNIA 4FIIA 5L2WA 5HICA 3T3VA 4DAWA 1KE6A 2YM5A 3NIEA 3ORPA 3W10A 4XH6A 4XV9A 4EH3A 5IPJA 3II5A 1OIRA 2W4JA 4H3QA 4R3RA 4XBRA 5AM6A 2IW8A 3W2QA 4LGDA 3RTPA 4C7TA 5FTGA 2XEYA 4XYFA 3GP0A 1X8BA 3RK7A 2C6LA 3AT3A 4IFCA 1JQHA 1SNUA 4KIOA 4V0GB 3Q4TA 3W32A 4R7BA 5L6PA 5BVKA 2W05A 5GIOE 3R1QA 1W0XC 4MBLA 3G33A 2ETRA 3MJ1A 1SZMA 3U9CA 3UDBA 3ZRLA 4N70A 4YZBA 4EOMA 3S1HA 5E8YA 1TQPA 2WTKB 2YWPA 3FL5A 3MDYA 5CU4A 3TKIA 5AR5A 4DEGA 1P14A 3FUPA 3TUBA 3GI3A 3P5KA 1QL6A 4R3PA 1A48A 1FQ1B 2Z60A 1H1SA 3TG1A 4B8MA 2QOQA 3PP0A 4G3GA 5E9EA 2PZRA 3OXTA 3RPOA 5LMKC 5M4UA 2JAMA 4MNEB 5LMKA 1PKDA 1XH7A 4BDJA 5TO8A 4ASZA 3OW4A 4C8BA 2V7OA 5EDPA 2Z7RA 3BLHA 1Q62A 4EORA 3RKBA 3VUKA 4BTMA 2WMAA 4R8QA 3LXNA 3WF9A 5DNRA 3UO5A 2PY3A 5EI6A 3QD4A 5DN3A 5FM3A 2JFLA 3PJ1A 5A9UA 2WTDA 2R3IA 3DQWA 4IZ5A 3JXWA 3DKFA 2RIOA 1AD5A 3PVBA 4KIKB 5AUZA 1U54A 5AM7A 2QONA 1CKJA 2HENA 4E6CA 5DYJA 4B99A 3ZDIA 4BDEA 2FSLX 4HVDA 4R1YA 4TYHB 4LRMA 3U4WA 5AEPA 4OTIA 4IAKA 4LOOA 4R5SA 5F1ZA 2KULA 1PHKA 2NO3A 5IQBA 3JVSA 3R8PA 4TL0A 2CNVA 1Y91A 4WUNA 4EOKA 3SXFA 4ZXTA 1XR1A 5IUGA 3H0YA 3LM5A 1YDTE 2QO7A 3R83A 5AP5A 3PRIA 3UNKA 5A3XA 2G15A 3PSCA 2F4JA 5H8BA 4U8ZA 4FT9A 1OL1A 4HGSA 3RMFA 5I9XA 4EK4A 4OTRA 3ITZA 3FMEA 4FV3A 4UYNA 4BL1A 4I22A 3O7LB 2QO2A 4TWCA 1VYWA 4TRLA 1VYZA 1LUFA 2PWLA 5HCYA 4FICA 4EBVA 2IJMA 3WZJA 4QMQA 3R9HA 1U5QA 4N57A 4RIOA 3EQRA 3F82A 4EZ7A 5LCKA 4IVBA 3WE4A 4I6FA 2QD9A 1XWSA 2YEXA 4HYIA 3WF7A 4LOPA 1SVHA 4LRJA 4CKJA 5A14A 5LMBA 1REJA 2AYPA 3ACKA 3GB2A 2UW9A 1J91A 4IX5A 4P2KA 5JFSA 3MPAA 5F95A 5JK3A 2P55A 4GVJA 2R4BA 4XS2A 3EFKA 4JR3A 4RJ3A 4ZP5A 5HG5A 5KHWA 1OGUA 2W9ZB 4EYMA 3QLGA 4FKWA 5JFWA 4E4MA 1WBPA 2H8HA 1OL5A 3EH9A 4W8DA 5EM6A 3EQHA 4MXXA 4AN3A 4ZMEA 4RIXA 4I92A 3PVWA 5DRBA 1OUKA 5L8JA 4L7FA 2WMUA 4TTHB 3QHWA 4MCVA 4B8LA 1E1XA 5I5ZA 3D83A 1OPKA 5ANEA 5D41A 5CF8A 5KMJA 3KXMA 2QQ7A 2RKUA 4F9CA 4L43A 4OBQA 5TOZA 3U55A 4O0YA 2XIKA 3ZXTA 1G5SA 3AD5A 4XG4A 3SD0A 3F69A 3UNZA 5AAFA 3L8VA 4WG3A 2QKWB 4F7LA 5FWKK 4L46A 4FUYA 3VW6A 4XG7A 4DCAA 3AXWA 4PF4A 4U5JA 4YJSA 4DG2E 5AP0A 4ASXA 4JS8A 2HW6A 5C03A 1GY3A 3QLFA 3NUUA 5ANJA 4TN6A 4DFYA 3ET7A 5T68A 4IM3A 3OCBA 2VNYA 4GYGA 1GNGA 5KBQA 5CNOA 4DCEA 2X39A 3CD8A 4EHEA 4O6EA 3AC1A 4ZZNA 3COKA 1DS5A 5J8IA 1WMKA 5HLPA 3UE4A 3GOKA 4YPDA 1M2PA 5KKRC 4YJUA 4JBVA 2B7AA 2PVRA 4IB5A 3PY1A 3R01A 1OUYA 1K9AA 5TR6A 4U45A 3RCDA 5K3YA 5A4QA 3V8TA 4AZFA 3EL7A 5T6KA 3D5XA 3LXKA 2C3KA 2RFDA 4FL3A 3ULIA 3DFAA 2BUJA 5IA5A 2VTJA 4F7JA 5JQ8A 5IA3A 3DB6A 3OS3A 5HX6A 1J1CA 3W33A 4LMNA 4M12A 1BL7A 1YOLA 3AGLA 3FSFA 4XOZA 2PMOX 5HTIA 3H9FA 5AP6A 3L9PA 4AZTA 2WMSA 2ZAZA 3VJNA 3RZFA 1NW1A 4ACCA 2X2MA 4Y8DA 3UP7A 2R0UA 3QKLA 4YZDA 1MP8A 1LEZA 4R7IA 2WMQA 4WRGA 1H07A 4D9UA 4O7NA 4LGHA 4D58A 5J9ZA 4FGRA 5H8EA 5CWZA 3AG9A 4KB8A 2VTIA 4LGGA 3BEGA 5B0XA 4X6RA 4YNEA 5AP3A 4QP4A 4C36A 4E4LA 1CDKA 4F0GA 3OEZA 4KABA 4PDOA 5GZAA 4BR3A 4EC8A 3NUNA 4I0TA 1TKIA 2W9FB 4CNHA 3SG8A 1OIUA 3KF7A 5DG5A 3GU7A 4I5CA 3OW3A 4USEA 5M53A 3TUDA 4O7TA 3QCSA 3FZOA 3LCDA 2J0IA 4RIWA 4GU6A 4O7YA 3DK3A 3OWKA 4TXCA 3ZLXA 3H30A 4C4EA 3GCUA 4EOLA 3QTIA 1CSNA 1UNGA 3I5NA 4FSQA 5CYIA 4FNWA 4X3FB 5E8VA 5HO7A 4NL0A 3QTXA 2R3QA 4YPSA 2X7FA 3LXLA 5KMNA 2C5VA 4I4FA 3LW0A 3P7BA 1Q61A 4KBAA 5LVMA 3NSZA 1L8TA 2R3HA 3BE9A 4TW9A 4ZY6A 4NK9A 2BKZA 2OU7A 4G17A 3L9LA 2Q83A 3C9WA 3D7TA 2PMNX 4FL2A 5J7HA 3RAKA 3NW5A 3COMA 5HE1A 2O65A 2YDIA 3NDMA 4G9RA 4YC6A 2WFYA 4EH9A 4ZMFA 4ALUA 3W2OA 3PSDA 4YBJA 3TEIA 4F65A 4W8EA 3TI1A 4F1TA 4W4YA 4TYEA 3RAHA 1ZY4A 3OC1A 2OXYA 3CPBA 4D4SA 2VTMA 1DAYA 4AFEA 1YDRE 5AIKA 4IE9A 2A0CX 3R7EA 3VUHA 2GNGA 2ZMCA 2LAVA 5AV4A 2OJIA 2XK6A 3HA6A 3KULA 4O0UA 4IACA 5E90A 5HOAA 3TCPA 3FMMA 3UODA 4ORKA 3FAAA 3FDNA 4AWIA 1ZYLA 1R0EA 1B39A 3GC9A 5HU9A 3NR9A 2VTQA 3HAMA 4IWQA 4JLCA 3UZTA 3KCKA 4IAIA 2CKQA 4AA0A 4UZHA 4ANOA 1JLUE 2YM3A 3TTJA 3PA5A 4Q2AA 1PJKA 4MD7E 2IVTA 3C4WA 3L8XA 4GT4A 3KXNA 5AV0A 5LVOA 3FYKX 4A9TA 4DGNA 4HNFA 2PVLA 3QTWA 4HPTE 4KSQA 3ZO3A 3PLAE 3W2SA 3BYOA 4IWPA 5KMMA 3ORZA 4X21A 1Q4LA 3HV7A 2EVAA 4QTBA 3BHYA 3EQGA 5KMIA 2Z02A 3S95A 2C1BA 3ZM4A 3ZH8A 3TN8A 4Y5HA 5C1QB 2VWZA 1H0WA 3D5VA 2UW6A 5L2IA 2OZAB 4FSTA 3V6SA 1GZOA 1J1BA 4S34A 2UZWE 3HV5A 3RPRA 4EKLA 3QGWA 1ZYJA 5HQ0A 4YLJA 2V0DA 4IZAA 4M3QA 3TTIA 4C34A 2YWVA 3G90X 4MD9E 1HOWA 2WTIA 5HIDA 3U51A 2WXVA 4FV6A 3E8EA 3GQLA 4WT6A 3SVVA 3Q6WA 2J51A 4BHNA 3S4QA 3UNJA 4DA5A 4AZVA 4ZIMA 4PNKA 3CP9A 3A8XA 1K3AA 5BVDA 4RIYB 2UW7A 4U41A 2R7IA 2XP2A 3CY2A 2OIDA 4FL1A 3V5LA 4NM3A 4CFNA 3F2RA 3QD2B 4I94A 2WQNA 4JIKA 4K18A 3UVRA 2R3MA 3DAJA 2F7ZE 1NXKA 2RG5A 3I0OA 4JVGA 4U79A 4YJNA 3UOHA 4ACHA 4IB3A 4RX5A 4XV3A 5CXHA 2WEIA 5IH4A 4G1WA 4EH4A 4MK0A 3WYXA 5HVYA 4ACMA 4YTHA 3WZDA 5L8LA 3HRBA 5E91A 2ETMA 3C1XA 5HZNA 4YSJA 3U6HA 4GU9A 1WBOA 3CTJA 5CVHA 3OWLA 4QMTA 5KUPA 4OT5A 3TIYA 3VRYA 3EL8A 3A7HA 2B0QA 2UVZA 4I4EA 2I7QA 3C5UA 4U81A 4WD5A 3QX2A 1JWHA 4FOCA 5CANA 4E5BA 5EYKA 2V62A 4KKGA 2UW4A 4U44A 2J90A 4BCJA 2FSMX 4F7NA 2W1IA 4FZ6A 4YC3A 2OZOA 4EHGA 3DXPA 4CSVA 5HX8A 4HW7A 5C4KA 1PW2A 2CGXA 3PRFA 4YSMA 3UOKA 2XJ0A 3KRXA 5LXMA 5I9WA 4J98A 1Q99A 2YZLA 5E92A 3DXQA 3ANQA 4CZUA 4QPSA 1PMEA 3F3TA 2GNIA 4NWMA 4RPVA 4G6LA 4HOKA 3TT0A 4CEGA 4H3BA 3Q2JA 3ODZX 3NYNA 1YXSA 3GFWA 5ANKA 1ZMWA 2F2CB 3W1FA 4UYAA 2W0JA 3BE2A 2PVYA 3DDPA 4BCQA 2XK7A 4FTRA 1MUOA 2DQ7X 2NPQA 2ZOQA 3LFAA 4YJRA 2V22A 4LI5A 5BVWA 2AC3A 2PE1A 4FBXA 3LFFA 4W4XA 4NCTA 3PTGA 3WYYA 3B2WA 3C4EA 2JDTA 4PDSA 4RA5A 2LGCA 1QCFA 3KVWA 3I7BA 3PJ3A 3GNIB 3QALE 4Y83A 3N9XA 5IMEA 1TQMA 3Q52A 1DI9A 3P1AA 4RT7A 2Q0BA 4N0SA 1NVQA 4MH7A 5HBEA 5HI2A 4A7CA 4R78A 4CFWA 2ERZE 3IPHA 2FGIA 3LCSA 1WVYA 4BI0A 4L45A 5DRDA 4G3CA 5J1WA 3PE2A 4K11A 4I24A 5FP5A 5JZJA 2P4IA 4BKZA 4HVHA 4I41A 3HRFA 1CMKE 2VU3A 3QZHA 2HY81 3BYSA 3W16A 2XS0A 4U7ZA 1XKKA 5BX0A 5K0XA 4G6NA 5JSMA 5HBHA 3E63A 5EM7A 2PZYA 1DI8A 3CXWA 2C6TA 1T46A 1OIQA 2AC5A 4PRJA 5TE0A 5KBRA 4RX7A 5DHJA 3MJ2A 2WOTA 4QMVA 5DEWA 2CGUA 3WIKA 5M08A 4HVSA 4I1ZA 3GCQA 1LEWA 2VWWA 4P5ZA 5DH3A 3D2KA 4MAOA 4AT3A 4FG7A 4DN5A 2H34A 2YJSA 3TXOA 4NM5A 4BKJA 2GMXA 3FJQE 4UN0C 3FQHA 4QMMA 3RHKA 3ELJA 3DNDA 4FG9A 3QTZA 5D7VA 5HO6A 4E6DA 1H27A 4O7ZA 2WMXA 3GC0A 5HE2A 3QUPA 1P5EA 4O2ZA 5HG8A 5J9LA 2XCHA 3THBA 3ZS5A 3S3IA 4A4OA 4AGWA 1LPUA 4PMMA 4QYEA 3ZCLA 3LJ1A 2GQRA 2W1EA 2UZEA 4L67A 5JMSA 4NM0A 4D9TA 5AP4A 4GIIA 1Z5MA 2QODA 5K5XA 5M09A 3TJDA 1H25A 2VTPA 1PXLA 2VX0A 5JFXA 1GIIA 4C35A 3H9OA 5BVNA 2GFCA 1ZOGA 3NGAA 2VO0A 5A6NA 2ZB1A 3HDMA 4FEWA 1Q8YA 3COHA 4IMYA 1JOWB 2BZIB 4YZNA 3DJ5A 2UZOA 3A7JA 1O6LA 1WBTA 4O96A 4D0WA 3F3VA 4AACA 1YW2A 3R73A 2DYLA 4ANQA 5D1JA 2XNMA 5BNJA 1O9UA 4F9BA 3N4VA 4KNBA 5AUUA 3QYZA 4UWBA 4WUAA 4YP8A 3VS3A 2W4KA 3GU4A 4G3FA 1PXIA 3F2AA 5HCZA 1PYXA 1UVRA 1W98A 4YO6A 5L6OA 2XKFA 3I1AA 1OL6A 5HORA 2YIQA 3ZTXA 3SXSA 3CR0A 4ALVA 2BKKA 5FUTA 1MQBA 5FLFA 2XK4A 3NRMA 4GFMA 4L52A 4OW8A 5F4NA 3N4TA 3QCYA 2XM8A 5I3OA 5IDNA 5M4IA 3WBLA 5B2KA 3K3JA 5EKOA 3GBZA 4FVQA 3IQ7A 2J2IB 4BCKA 5CVGA 3PPKA 3QQHA 1O6KA 3A99A 1SVEA 1YI4A 2YIXA 4TWPA 3EB0A 4BWKA 5HIEA 5AV2A 5HLWA 5CZHA 4O1OA 3A7FA 3VF8A 2FSTX 3NUXA 2PE2A 2RFEA 3DA6A 3HRCA 4NT4A 2PYWA 1M7QA 2VWYA 3GT8A 5FEDA 4NW5A 4B9DA 4FEXA 5G1XA 1J7LA 2REIA 2YN8A 4QPAA 3V5QA 3HMPA 2PUUA 4JQ8A 5AP7A 4GH2A 4O82A 1MRYA 3RHXA 1QMZA 4NIFA 1B6CB 3FV8A 3AT2A 2XJ1A 2VTSA 3R7YA 5A4EA 4M69A 4RX9A 3A7GA 3QRJA 3CGOA 4W9XA 4E5WA 4QMXA 3CY3A 5E1SA 2J6MA 3DKOA 5FBOA 3MGYA 4L6QA 2HYYA 1XBCA 4Q5HA 3JUHA 2OJJA 2Y4IC 5FXRA 3BI6A 2O5KA 4M7IA 3ZFXA 3V5WA 4FSRA 1WAKA 2C0IA 2W17A 4MYGA 3EN6A 3GC7A 4MXAA 4PTGA 5CI7A 2BDFA 3R7VA 3ZU7A 2JIVA 4A9UA 1Q97A 3C0HA 1AQ1A 3G5DA 4JOAA 2ITZA 2QOCA 4Z3VA 1GZNA 2CKPA 3T3UA 1FMKA 3O17A 2EXCX 3R00A 2FA2A 3BKBA 1YXXA 4YBKA 3UG1A 4EOPA 4F99A 5KO1A 3EIDA 3GGFA 3VW8A 3R9RA 4WRSA 2WOUA 2ZMDA 5KX8A 1TVOA 3QKKA 3DBCA 4MBJA 4EI4A 1URCA 4I23A 2E9NA 4NTTA 4DLJA 3NUPA 1J7UA 5M06A 2R3PA 2VTRA 3DPKA 4AP7A 4BTFA 5B2MA 2QOFA 4UX9A 2WMTA 3KXXA 3ZHPC 4RMZA 4D4VA 3FBVA 3CS9A 3OY1A 4RA4A 4BF2A 4GVAA 4DH3A 3LHJA 2OF2A 3PYYA 3CQEA 3V8SA 3NCGA 4FKJA 4JG7A 4Q5EA 5CXZA 5CSHA 2VO3A 4F09A 4MF1A 3IK3A 3RI1A 3UYTA 4M97A 1GJOA 4JI9A 4CFXA 4CMTA 1V1KA 5IA4A 2BMCA 3JS2A 4P7EA 3PPJA 4UY9A 4CZYB 5DIAA 1OBDA 4FK6A 3BU5A 3RP9A 5J9YA 2B55A 3AQVA 5EKNA 2Y7JA 3R7OA 5I4NA 5HNGA 3VUGA 4PP7A 1CTPE 3W8QA 4AE6A 4EHZA 3DLSA 2WMRA 3DV3A 4DH1A 5JKGA 2YFXA 3ZC6A 2C0TA 5FP6A 4D2RA 3KVXA 3KXZA 3OTUA 4GRBA 3ZLWA 4HCUA 5AUWA 1XH8A 3TZMA 4AF3A 2VWXA 4TYJA 3TZ9A 5JGBA 4K8AA 5HE0A 4R1VA 1BI8A 3BEAA 3PIYA 2ZV8A 3R7GA 1W8CA 3R7IA 4E3CA 5CEKA 3PG3A 4BCMA 4K2RA 1H08A 2FSOX 5KMLA 4C3RA 4LG4A 2QOOA 1OITA 2BALA 3OFMA 5C8NA 4CKRA 4D1XA 3LFSA 4J7BA 4F1OA 2ETKA 3QD0A 2X6EA 3UQCA 4EOOA 3L1SA 3D4QA 4PTEA 3ORXA 2WELA 4L42A 5DPVA 2E9PA 4TT7A 1Q8UA 3VS5A 3QCQA 1CKIA 2Y4PA 3EN9A 4QYGA 1YDSE 5FD2A 2HWOA 4G5PA 2BAKA 5HG9A 3UO6A 4BDAA 2YCQA 2V5QA 3UTOA 3NNUA 3LOKA 2VRXA 1UA2A 4O91A 4FIGA 3BHVA 4NZWB 3UPXA 4L44A 1GZ8A 3HNGA 3IKAA 3LJ2A 3LFEA 5AP1A 2HW7A 2V7AA 4M14A 3WE8A 4ZTMA 4EYJA 3UZRA 4PWNA 2CKOA 4ZTLA 4JQEA 2FO0A 1R0PA 3DOGA 4RGJA 5CALA 4AW5A 4FSYA 3Q9ZA 5E8ZA 3MH0A 2WAJA 2R3GA 3OP5A 2VUWA 4RJ5A 3L9MA 3S2PA 1H4LA 4IJ9A 3HAVA 4FV7A 3TL8A 2H6DA 5EM8A 3ROCA 4DH5A 4FK3A 2ESMA 4GKHA 2WTCA 4FSNA 5LMAA 4EJNA 5IEVA 5LVPA 2UZDA 4J99A 4FTTA 1RJBA 2WZJA 3QWKA 4UMTA 4YUQA 3FI8A 3P79A 2R7BA 2QI8A 5D7AA 3WZEA 3FZRA 2Z8CA 1P4OA 2BILB 4R77A 3A7IA 3PE1A 4PPAA 3BWFA 3EQCA 5E4HA 4EWHA 4RWIA 1OI9A 4O22A 3O0GA 3W2PA 4BYIA 1Y8YA 5BYYA 3TNPC 1UV5A 3ZSIA 2W06A 2YIRA 3EZVA 4FODA 5L6WL 3RPSA 2PVNA 2JKMA 5CU6A 2BROA 3CLYA 3Q9XA 2PZIA 5HTCA 4ITIA 5EDQA 1Q8ZA 3R1NA 3L8PA 4F0FA 1FINA 4I5PA 3U8WA 4DITA 3HMNA 4OAVB 3IDCA 4FV5A 4AUAA 4IXPA 2I0VA 4C02A 1OL2A 2HXLA 3COIA 3ORMA 4YURA 5K4IA 3QRKA 4NSTA 4Q9ZA 1HCLA 2OGVA 3A4OX 4I5MA 4MQ1A 3GU5A 5IA0A 5K9IA 2ITNA 2WU7A 3QU0A 4PPBA 3HEGA 4APPA 3CPCA 4D2SA 2OIQA 3TNWA 3HYHA 4QPMA 4UBAA 3W18A 4JX3A 2B9HA 4L00A 2Z2WA 1KE9A 3N51A 4J8NA 4RBLA 3IECA 4QYYA 3V8WA 4E4XA 2IVSA 5GZ9A 5KKRB 4BCOA 3MTLA 3QUDA 3EQBA 3DBDA 3BZ3A 3OY3A 4FZ7A 4ZSLA 4C2WA 2J7TA 3QGYA 3W8LA 3G15A 2P33A 4WNKA 3S0OA 3DK6A 2KTYA 3ZFYA 4BGGA 4Z16A 3F6XA 3OOMA 4S33A 3RPYA 5I9YA 4YTIA 4J71A 2G2HA 4CV9A 4G34A 3E8NA 1CKPA 1FMOE 4JQ7A 1H26A 1XH9A 4FTAA 2RFSA 4CD0A 3VS7A 2IVVA 4FEQA 5IKWA 4XUFA 4RWJA 2IW6A 4S31A 3F3WA 2CJMA 5C9CA 4IDTA 4FOBA 3QC4A 3ZSGA 5DWRA 2QR8A 4NJ3A 3ALOA 3ZLSA 5BYZA 4AOIA 4E1ZA 5GJDA 4OTHA 2QOIA 3FEGA 3HX4A 3D0EA 4QMLA 4YLLA 2GCDA 3HZTA 4M0ZA 3TIZA 4CQGA 3PY3A 3QRIA 4WNPA 1FGIA 2WTJA 2UZUE 3FE3A 2CMWA 4PMPA 1T45A 5FG8A 4KIQA 4QTAA 2EUFB 3T8OA 4WIHA 4V0GA 2C6DA 3ZXZA 4DF3A 4RIWB 3KGAA 4A06A 4AZSA 3DB8A 2GU8A 5FXSA 3SX9A 1UU3A 4BDBA 5EH0A 2PVMA 3IDBA 5M57A 3BRBA 4LUEA 5EDRA 4F0IA 1ZYDA 2YM7A 4D2TA 3DGKA 5CENA 3RAIA 3NYVA 3UPZA 3SQQA 4JX7A 2PVFA 2G9XA 1ZMUA 3BGPA 3ZM9A 3FZPA 3Q9YA 4XRLA 4MNEA 2QC6A 3TACA 3V5JA 4BKYA 1BX6A 4KINA 3FL4A 2XNOA 3NNXA 4MXCA 5CQUA 4G6OA 4RLKA 4J95A 1M17A 5CSVA 3VAPA 4D4YA 4TYGA 2VAGA 4HYSA 2Z7QA 3VRZA 5AAEA 4FIEA 2QR7A 3TDWA 4WG5A 4L3JA 3TWJA 2P2IA 2VO6A 4CMOA 4GKIA 3Q4UA 4UXLA 3QTUA 4KIKA 4F63A 5AAGA 1SM2A 1J7IA 5FBNC 4IC8A 1Y57A 3HMMA 3QL8A 2J0KA 4UXQA 2XA4A 3FLSA 3TUCA 3UGCA 2O63A 4TYHA 4UWYA 3VN9A 2YJRA 4HJOA 5DLSA 5IUHA 1FVTA 4AFJA 2IZRA 4OBPA 2YERA 4KBCA 4Q9SA 5BUJA 1SNXA 5EG3A 1EH4A 2X9FA 1W84A 1ZWSA 5IQCA 1PXMA 4JAIA 1W7HA 3DZOA 4O27B 5IQFA 1YXVA 4OTWA 1IAJA 3MH1A 3DDQA 4BC6A 3FMKA 3VO3A 4YZMA 5I9VA 2HZIA 4FEVA 4QP2A 4LRKA 3CQUA 4AZWA 1OM1A 4FVRA 4QMWA 4IX4A 4UWCA 1GOLA 3CSVA 1F3MC 3BYVA 2C6OA 3O8PA 3PSBA 1PXPA 4JJRA 5AX9A 1WBSA 3FQEA 5IUIA 5IA2A 4B0GA 4NKSA 3LLTA 2CHLA 1APME 2UVYA 5EW9A 3BU3A 4AGCA 4BN1A 4NEUA 5K4JA 5DT3A 3HUBA 2WQMA 4CLIA 1Y8GA 2WMVA 3FQSA 4C37A 4EQMA 3ETAA 4DHFA 1UNLA 3Q5IA 5CVFA 3OCGA 4ALWA 1ZAOA 2ZV2A 2OIBA 4IVCA 4A07A 3LFCA 3R9DA 3JVRA 3SLSA 2QOHA 4CLJA 3MV5A 2BTSA 4Y46A 2JDOA 3EFJA 3M2WA 3MYGA 4ZSGA 3SW4A 3VHKA 2PU8A 3S00A 3FZSA 5G6VA 3CIKA 2QLUA 2BR1A 2Z7SA 3LCTA 4I20A 3HV6A 4LMUA 1JNKA 2ITPA 3WF5A 1VEBA 4P5QA 5ACBC 3UJGA 3RK5A 1I44A 4B4LA 3AD4A 4KWPA 4YTFA 3KL8A 4FEUA 5BVOA 5EQEA 3NCZA 3KMUA 3QRUA 3OXIA 2I0YA 3KQ7A 4L68A 5DT0A 5HU3A 2UUEA 4IW0A 3GFEA 3R63A 4ITJA 4XG8A 1OPJA 1XBBA 3I6WA 1P4FA 1U5RA 4QMSA 4HYHA 3SOAA 2ITOA 4MEDA 3K2LA 4U80A 3EZRA 4AW0A 4IX3A 1PRYA 2W1FA 3NAXA 1UNHA 3K5VA 4KS7A 5L2QA 1STCE 4CTCA 4W9WA 3HP2A 3H9RA 4EQCA 5CEOA 4PUZA 3ZUUA 3LFNA 1PYEA 4PDYA 3P0MA 1B38A 4BFMA 3DXNA 4JRNA 4CRSA 3SW7A 2RGPA 4FC0A 4FIHA 4PL4A 2W1HA 1G3NA 3QZFA 3CC6A 3FMLA 4DGMA 4ZJVA 4NFMA 3PWYA 1YHVA 3ZONA 5BQ0A 4JR7A 4PY1A 4EH8A 3E93A 3MA3A 4F64A 3V01A 3AC3A 1Q3DA 3RBWA 1YRPA 2ZYBA 3KMMA 5L8KA 4OAUC 4BYJA 2PK9A 4DFNA 1XO2B 2PHKA 4U40A 3F3UA 3CE3A 2UZBA 4B7TA 4DINA 4GJ2A 1IA9A 3ZRMA 3JY9A 3FWQA 3V51A 3VBQA 2X1NA 4QQTA 4GL9A 3ACJA 5LOHA 3DFCB 4BVUA 4CT2A 1YOMA 2JBOA 4J52A 4MTAA 5IQEA 3DBEA 4CXAA 4M8TA 5C8KA 4RFZA 3SRVB 1OL7A 1O6YA 4X2GA 1E9HA 3QTRA 4FTMA 1RW8A 3OEFX 5JRSA 2W1GA 3FLYA 3PA3A 2JITA 3VBXA 4IIRA 4C4JA 5AR2A 2OH4A 4EUTA 4FIJA 1ZZLA 1V0BA 3QFVA 4C59A 2SRCA 4UEUA 4O7WA 4DH8A 4ACDA 3CD3A 4ZSAA 4I6QA 1JKSA 2DUVA 4OR5A 5FTQA 3NS9A 3OUNB 1H24A 5CEPA 4M13A 4ZS0A 4FKPA 3MBLA 5AV3A 3D7ZA 1KV1A 4EOQA 4BIDA 3TM0A 4FF8A 2BIYA 2JIUA 4ANBA 5JRQA 1G8AA 4GK3A 3JPVA 3P86A 5JN2A 3IW8A 3MPMA 5HO8A 1OMWA 2CSNA 2J5FA 3H3CA 3MSSA 5LVLA 1IASA 5M55A 3NVMB 4DFBA 2R2PA 4I0RA 3ZO4A 2P3GX 3LFDA 2YIWA 3Q6UA 4F9AA 4JNWA 4P90A 2C3LA 4ANSA 3FY2A 2CN5A 3BQRA 3WI6A 3C13A 5AUTA 5C26A 5IEYA 2HK5A 3QQLA 2PULA 3P08A 3FLQA 2BZHB 2WMWA 5CSWA 4QNAA 2IG7A 3NX8A 4BTKA 2C6MA 3CTHA 2Z7LA 4UMQA 5I0BA 2VV9A 3F5XA 1U4DA 1KSWA 4EOSA 3OD6X 3VUMA 3PY0A 1FVRA 2QLQA 2CGWA 2UW0A 3ZFMA 2OXDA 5AUVA 3R6XA 5HNIX 1IEPA 3Q5ZA 2WIHA 3KN6A 5D11A 5IEXA 5CAVA 3T9IA 4G16A 4BCHA 4WNOA 5ANOA 3K54A 2CCIA 4C58A 4EEVA 1YKRA 2E9UA 2QCSA 3FC1X 4MKCA 3V04A 2QOBA 1PMNA 3LXPA 5A4CA 3RWQA 4Y85A 2W5AA 3OOGA 2WQEA 2FUMA 2GTMA 5A4TA 2PVHA 5EYCA 2EB3A 3UP2A 3W55A 2A4LA 4NU1A 3SC1A 4DTKA 5CSXA 5HVKA 4BCIA 5DA3A 3O8TA 2E9OA 3LE6A 3UVPA 5AMNA 2JKOA 3P23A 3NNVA 4AW2A 3IDPA 3H10A 5ETFA 2OH0E 4G3DA 5CF4A 4BRXA 2YAKA 2YLEA 4FV2A 5IZFA 1K2PA 4NCTC 3C4CA 2B54A 4XG3A 4O83A 3DCVA 4OTGA 3H0ZA 3KCFA 3KFAA 2X81A 1ZXEA 3MA6A 4FSMA 4FTKA 1F5QA 1P2AA 4YJVA 4MX9A 3AOXA 4IWOA 4K33A 4U0IA 4ANMA 2H9VA 2VX3A 1FPUA 3QTSA 4BCGA 3NMUF 4JG8A 2XF0A 1FBNA 3W2RA 3RALA 4ZZMA 2OF4A 3EQFA 4BGQA 4LFIA 3VUDA 3AC8A 4WNMA 5CF5A 3OCTA 4BZNA 4FKSA 4C0TA 2OWBA 2WTWA 5BUEA 3C7QA 5BUIA 2NRUA 3KN5A 4GG7A 4ZOGA 2XVDA 4ARKA 3WZUA 4QRCA 4BTJA 1H1WA 2XYNA 4WO5A 2ONLA 3MFUA 2PMLX 2PVKA 2WQOA 2GNJA 1ZLTA 1RDQE 3LFBA 5HIBA 4EK3A 4A9YA 4A4XA 1LP4A 4PP9A 1YI6A 2OJFE 4RRVA 4ERKA 3NYXA 4FUXA 3VQHA 3PIZA 2ITUA 5C8MA 2C6IA 3LM0A 3KMWA 4PX6A 3LVPA 4FTIA 4PTCA 5FQDC 5BVFA 4YJTA 2X6DA 5CT7A 2JKKA 5JT2A 4P4CA 5AFVA 2GPHA 4XRJA 3F5GA 3DBQA 3QAME 4YO4A 3OROA 5C01A 4O21A 4XCUA 4ASDA 4KSPA 2VTTA 4AOTA 1OIYA 2HZ4A 2XKCA 2BFYA 1M2RA 2GHMA 4RIYA 4AG8A 2ZDUA 5AA8A 3OBJA 4TWNA 3T9TA 5GZ8A 4V04A 2DS1A 2I6LA 3OBGA 3C5IA 4M15A 2BHEA 1R78A 3OWPA 5J5TA 1NVRA 2OW3A 4MF0A 2J0LA 4YTCA 5CAUA 1Y6BA 2IWIA 2GNFA 4DFUA 2CLQA 3KXGA 1REKA 2PSQA 4XP2A 3OWJA 3GCSA 3ZO2A 5KMKA 4LV5A 2Y4IB 4J1RA 2FVDA 3R0TA 3MY5A 3OZ6A 4MWIA 5D9HA 3ZO1A 1BLXA 4D2WA 3ENMA 1NVSA 4QTCA 4XG2A 3QBNA 4FT0A 4YC8A 3PXQA 3LLAA 3HUCA 2C47A 5CQWA 3PLSA 3VVHA 2GFSA 4OGRA 4QMYA 2WO6A 4TYIA 4ZLYA 4RVMA 2W99B 4ID7A 2YCSA 3QQUA 4WSQA 2OG8A 2VWIA 4AA5A 4CFFA 5A4LA 4V05A 2OLCA 3BQCA 5J95A 4G31A 3UOLA 4RJ7A 2F9GA 2YACA 4AN2A 1SVGA 1ZZ2A 5AR3A 3R04A 3LPBA 4ZTRA 3HP5A 4RC4A 5CAQA 3OG7A 4JRVA 5EI8A 3VHEA 4ONAA 4QP7A 2ZDTA 4KRDA 2WPAA 2PPQA 3FI4A 1BUHA 2YDKA 3A2CA 3MB7A 1JVPP 5EOBA 5DR2A 4U43A 4IVDA 3M42A 4EH5A 5I9ZA 3MVJA 3ZEPA 4PL5A 2R3RA 3UMXA 4GMYA 1HCKA 1GZKA 1A06A 4EH2A 4ZTNA 3QUEA 3IOKA 4IAAA 4O0VA 5EK7A 4RLLA 3PXFA 3RAWA 2VZ6A 3CCNA 4ZJJA 2BCJA 4RG0A 5HEZA 3MVMA 4BHZA 3P7AA 5M44A 2CCHA 2J0JA 3MY0A 2Y6OA 1NA7A 1WBVA 3A60A 4C3FA 4ERWA 3RNIA 2UW8A 4IB1A 2VTNA 1KUTA 4II5A 1QPEA 3FMJA 4HGTA 4L7SA 2XKEA 1PXKA 1Q41A 4G9CA
chains in the Genus database with same CATH superfamily
3A62A 4RFMA 2GQGA 3HKOA 4I5HA 2W1CA 2O0UA 2IN6A 3DY7A 3F5PA 3MY1A 2OBJA 2ITTA 3ANRA 4HNIA 4PMTA 3N4UA 3BLRA 4G2FA 1Q3WA 2JBPA 3E7VA 2C30A 5HKMA 4OTPA 2IZTA 2PMIA 3CTQA 3OF0A 3UIBA 2G01A 3EYHA 4WG4A 4RQVA 3SXRA 3TV6A 4CV8A 2XK8A 5CU0A 2A27A 4JXFA 4MHAA 4DG3E 5CSPA 2YITA 3U87A 4KBKA 4I3ZA 3NIZA 5IDPA 4DYMA 4C4FA 3PVGA 1R39A 1JKTA 2QURA 3AMBA 4K6ZA 5CTPA 4I21A 4DEIA 3ENHA 1Q8TA 3U9NA 4NYEA 5DFPA 3LMHA 2X8DA 2E9VA 3F9NA 4QMNA 4BDHA 4BWXA 2FB8A 4K9YA 1XMMA 2OJGA 2PTKA 3D5WA 4X3JA 4Y73A 2EXEA 4IHPA 5FDPA 4K77A 4KA3A 3EYGA 2YCRA 2XK9A 4RQKA 4YZCA 4CVAA 4C61A 2C6EA 4GT5A 4XEYA 4C57A 3GEQA 2CPKE 3ZZEA 3KC3A 3JY0A 4FV8A 4QMOA 5AADA 1OB3A 2BIKB 4BIEA 5CU2A 1YQJA 2HAKA 2X8IA 3FXXA 3QA0A 1KV2A 3UIMA 3C51A 4GFGA 1Q5KA 2JGZA 4YU2A 3E62A 3U6JA 3G9LX 5TKDA 2ZM1A 3M11A 4APCA 4D2VA 5JGAA 2V55A 3DBFA 4RX8A 3ROYA 5HGIA 1IR3A 2YCFA 4TKSA 1WFCA 3BGZA 2QHNA 5CY3A 4PQNA 4WA9A 3LKMA 3O50A 3QCXA 4IC7A 3HL7A 4I0SA 1WVXA 2R3OA 4BCFA 3DT1A 3QXOA 4N6ZA 1Q24A 5IF1A 1M52A 4GW8A 3WIGA 4RFYA 5CT0A 4O84A 4OLIA 4LYNA 1AGWA 4FKRA 2PUPA 3AMYA 1U54B 3F5UA 4R3CA 2GS7A 4M68A 4I6LA 3F2NA 1XBAA 5EYMA 3LFQA 3ZBFA 2F49A 3BHTA 1YHSA 4XLIA 3GU6A 2VTAA 1ZMVA 5TF9A 5EQYA 4XOYA 2F7XE 5F94A 5HHWA 4E4NA 4FT3A 4H3PA 2C4GA 3PFQA 4X2JA 5FXQA 3WF6A 1YXUA 5C4LA 3FMNA 2Y0AA 3EQIA 2YA9A 3CBLA 4JDKA 4O86A 3RCJA 2YM8A 3MW1A 4RJ6A 3TNIA 4CCBA 4EUUA 3C0GA 5H8GA 5CZIA 3FKOA 3KRJA 4JDHA 3SOCA 3OHTA 4RZWA 1JAMA 3UIUA 2IZUA 2HCKA 4F70A 5CASA 5HLNA 2UV2A 2ITWA 4YHFA 4MVFA 1H00A 4YHTA 5FDXA 4E7WA 2J50A 4FKOA 4PL3A 3I6UA 3LZBA 3WZKA 4HGEA 5CEIA 3VBWA 4AX8A 5M51A 3DZQA 4LUDA 3IW4A 3NUYA 3ORIA 4Z7GA 3DAEA 4CQEA 3Q2MA 3VS2A 4F6UA 2QVSE 2YM4A 3KRWA 5LWNA 4YGAA 4FV1A 3R02A 5K0KA 4BGHA 5LARA 2W4OA 4CRLA 4HVGA 4ZLOA 3WARA 1Z57A 3CGFA 3R8ZA 3KY2A 5J5SA 4NFNA 3BELA 1MQ4A 4UMPA 1IA8A 4GFOA 4FGBA 4KKHA 3PJ8A 1PF8A 2BPMA 4KAOA 4XP0A 2O8YA 4IANA 4S32A 2G2IA 1YWRA 3Q3BA 5GJFA 4DLIA 5IU2A 3IS5A 4FIFA 2BZJA 1IRKA 3K5UA 3EN5A 3QZGA 4UB7A 4EQUA 2R3FA 1IG1A 2XK3A 3UC4A 3V6RA 2XNBA 2WTVA 4RIXB 2C1AA 2Y9QA 2YIYA 4BZDA 4IZYA 2BTRA 4JBOA 3I81A 4EC9A 2XBJA 3NW6A 4GEOA 4X2NA 5FEQA 5IISA 3U6IA 5GIPE 5F9EA 2C5XA 1V0OA 1NT2A 3E8CA 5IQIA 2ZJWA 4FMQA 4FSWA 4DT8A 5L4QA 2XAOA 4JMQA 4WOVA 2QKRA 4TZRA 4FT5A 4ZSEA 4AOJA 4DT9A 4AGDA 5BYLA 4EK6A 4UV0A 4HCVA 4FTUA 4CFVA 4JG6A 4D28A 4XX9A 5HBJA 4Z55A 3U54A 4AQCA 1KOAA 3VWAA 5BPYA 5FM2A 3QA8A 2VGPA 1ATPE 2VWBA 2I1MA 2X2LA 5KE0A 3H4JA 5CEMA 2I0HA 3I79A 4FVPA 3U4UA 4CMUA 2WNTA 4KS8A 3CJFA 3EN4A 2WMBA 3R9NA 3SGCA 3HDNA 4FNYA 1GIJA 4A9SA 4D4RA 4AXCA 2C0OA 3VULA 4LOQA 4LL5A 3HV4A 3F88A 4IBMA 3EFWA 4DGOA 4BDCA 2C3JA 3MTFA 2JDSA 4QP9A 3FLWA 4O7RA 4EZ5A 4QP1A 3BBTB 4O4DA 4J53A 3FMHA 4U3YA 4O0XA 4OTDA 5H3QA 2JEDA 3GU8A 3ODYX 3TV7A 5DEYA 3OMVA 2XIZA 4ZLZA 3VS1A 3WILA 3R21A 3A61A 3QYWA 3ZC5A 5LWMA 2XB7A 4FTQA 4QMPA 4BJJA 5BMSA 4DGGA 3MFRA 4Z9LA 1BKXA 3FPQA 4W4VA 3PDTA 3PG1A 4BBEA 2ZVAA 1IAHA 3ZUVA 5F20A 4DEAA 3VC4A 4XG9A 3FLZA 1PKGA 3P5JC 4H39A 4CT1A 4M84A 4DFXE 4AA4A 4F08A 4E8AA 3B8RA 5BV3A 4GK2A 2PE0A 3GUBA 3MIAA 5E8WA 4DDIA 5M56A 1UWHA 3SKCA 4Z7HA 4MQ2A 2YM6A 1PXJA 3RWPA 3FHIA 4HZRA 4I93A 2I0EA 4O7LA 2R9SA 3R22A 4JL9A 4E93A 3OUKA 5E8TA 4W4WA 5IQHA 4E5AX 4MWHA 5KHXA 4DBXA 2HZ0A 5IH6A 5KNJA 1OKVA 2R3NA 2XYUA 3MB6A 2WTKC 4FKLA 4HCTA 4O2PA 3NZ0A 2E2BA 3MFSA 4O6LA 4AN9A 2B53A 2X8EA 4O7VA 4EL9A 2HWPA 4C38A 1GAGA 3PXYA 4FE2A 4RJ8A 2WQBA 4LM5A 4GG5A 4AT4A 2GNLA 3P9JA 3Q60A 1W2FA 4O38A 3E5AA 4IAFA 4J97A 3C4XA 2ERKA 3NFGB 4D5HA 4BCPA 1ZYCA 4K0YA 4F4PA 5CAPA 3KXHA 3ZZWA 5A6OA 5LJJA 1TQIA 5HD7A 3AD6A 4CFMA 2XH5A 3D7TB 3D15A 4QQCA 5ETCA 5FTOA 4D1SA 5IQDA 2QG7A 3GENA 3F66A 5AP2A 5GINE 4DHZA 3ORKA 4IAZA 1JSTA 3ZRKA 2HXQA 4E20A 3GCPA 1MRUA 3DTCA 4QQ5A 2RFNA 5A54A 1CM8A 4PMSA 2XIXA 4AW1A 4X0MA 3KA0A 3ZMMA 4X7QA 3EN7A 3EJ1A 3QC9A 3ATSA 3PP1A 2NRYA 2QOLA 3IOPA 3FKNA 3G51A 4PV0A 4QP3A 4WKQA 4XBUA 1RQQA 4AS0A 2VN9A 4EOIA 3G6HA 4F1MA 1H1QA 2R3KA 4GCJA 3VJOA 4CGAA 3OT3A 1KE7A 2BZKB 2UZNA 1W82A 2XRUA 3I60A 3KULB 3LMGA 3POZA 4U97A 4EH6A 1UU8A 3G9NA 3QF9A 2OJ9A 4DEHA 3PXRA 5HTBA 4ANLA 3GVUA 1NY3A 2WU6A 1U59A 2P0CA 1H28A 3QTQA 4AAAA 3TNQB 3PXZA 3D5UA 4ENXA 4MD8E 4S30A 4EK5A 3PZHA 4ZAUA 5AV1A 2J4ZA 3NLBA 4EHVA 1H0VA 4IAYA 5ANGA 2ITXA 4AT5A 4CCUA 3DLZA 4FNXA 5LVNA 4FTLA 4HPUE 4H36A 4ZZOA 3HGKA 4EKKA 1ND4A 4U3ZA 4EBWA 3Q96A 5CI6A 3ORLA 5B2LA 1WBNA 4TY1A 5DGZA 4HYUA 3E8DA 4ANNA 3ID6C 4BBFA 3BV3A 4EJ7A 2YZAA 3HECA 3RZBA 2ACXA 1V0PA 2BDJA 5J7BA 1TFFA 1J3HA 5AJQA 3EOCA 4ZTQA 4H1JA 5M07A 2X7GA 4NH1A 3ZSHA 5EQPA 1UU9A 3E3BX 1BYGA 3BLQA 4MNFA 3QQGA 4MXOA 1WZYA 2ITQA 3KK8A 3VIDA 3K3IA 4AXAA 2OXXA 2JKQA 4FKTA 4BDFA 3BPRA 4RVTA 4FKUA 1M2QA 4ZY4A 3R8LA 2GSFA 5DOSA 4QYHA 3TKHA 4BB4A 3C4FA 2RF9A 3PPZA 2H96A 3POOA 4QQJA 5M4FA 2VWUA 1H1PA 3EHAA 3UQFA 4OT6A 5JEBA 4LV8A 1VLRA 2YHVA 4UZDA 1YWNA 1QPDA 4BY9E 4HVIA 4RWLA 1W83A 2JDRA 3NUSA 5ETAA 3UDZA 3PJCA 4CFUA 4UMRA 4FYNA 3LCKA 2XIRA 2P2HA 4FT7A 4XMOA 3ZOSA 3DU8A 3UIXA 2X0GA 4UMUA 3GXLA 2GQSA 2C5YA 1VJYA 2ITVA 3DAKA 3G2FA 3OTVA 3QD3A 3L8SA 5DE2A 3PIXA 4QD6A 3UO4A 3DS6A 3DJ6A 2VTHA 2BRBA 4F9YA 4AGUA 3NW7A 3BHUA 4YJOA 4C62A 2VWVA 3QKMA 1PXOA 2X0QA 4H58A 4X6QC 2BFXA 4DEEA 3CJGA 3Q32A 3NPCA 5AX3A 2HOGA 3BYMA 5JFVA 4JBQA 5M4CA 1ZRZA 3OT8A 4CYIA 1DAWA 2WIPA 3SA0A 4IEBA 2EB2A 1H1RA 2VX1A 1FVVA 2BRMA 4FKIA 4JDIA 4L01A 3NAYA 3P4KA 3Q9WA 1SYKA 1FOTA 2W1ZA 2W5HA 3EQDA 4I6HA 4ZTSA 5JZNA 3UBDA 4G3EA 3BLAA 3HMOA 5EOLA 4YMJA 1ZYSA 3LAUA 4E6QA 3EKNA 3BBWA 4EONA 2JC6A 1LR4A 4OTQA 1UKHA 1JKKA 4A9RA 1ZOEA 1YOJA 4OTFA 4O0SA 3ZLYA 3R2YA 2IPXA 2JD5A 4DTBA 4C4GA 3OXZA 4CYJA 4XV1A 5EW8A 2YABA 3VUIA 1I09A 2OSCA 3ORNA 4U42A 4FKQA 3VS0A 4A4LA 4BDIA 3W0PA 2A2AA 3I4BA 4EOJA 4GV1A 3RVGA 1OVEA 5KCVA 4DE4A 3QRTA 1SMHA 2C5NA 3TKUA 3C0IA 3Q53A 2UZTA 3DNEA 3D14A 5L3AA 3HA8A 3MPTA 2BVAA 3FI3A 3DK7A 3KRLA 4M67A 3WF8A 2C68A 4IB0A 4ENYA 1OKWA 4ZTHA 1Y6AA 2Y8OA 4L9IA 3Q04A 5EI2A 1S9IA 4L53A 3DKGA 3FY0A 4CG9A 2GHLA 5DBXA 3LQ3A 3VQUA 2NNWB 4IX6A 2JDVA 3BV2A 5DMZA 4V01A 4JIAA 4XP3A 3MH3A 4N6YA 4RZVA 3W2CA 2EWAA 3VNTA 4O0RA 4XV2A 4BDKA 4OUCA 1VR2A 1S9JA 5GJGA 4H1MA 3MH2A 3BCEA 3BGQA 3FXZA 1KE8A 3R28A 3FYJX 4JAJA 4QTDA 5AWMA 4Y95A 5BVEA 3P7CA 4JDJA 1PXNA 5C27A 4XJ0A 4DBNA 2R64A 3HMIA 1ZY5A 4IFGA 4FV0A 3HVCA 2XIYA 4YZ9A 3KEXA 3M1SA 4N4SA 4BWPA 4WHZA 3RINA 3UG2A 3O51A 4F9WA 3F7ZA 3F7WA 3MN3A 2BHHA 3FKLA 5FRIA 2UZLA 3Q4ZA 4O1PA 4RJ4A 4AU8A 1XQZA 2XNEA 2CKEA 2WHBA 3MI9A 4QMZA 4X3FC 4C33A 4U6RA 1OZ1A 2JIIA 3G6GA 4X3FA 3VBTA 2CNQA 3IW5A 3FI2A 3O8UA 3DJ7A 4LDTA 4QT1A 4AQKA 3R1YA 1M7NA 1XHAA 1VZOA 4I6BA 4QO9A 4DC2A 2WB8A 5AR7A 2RG6A 3OVVA 4DEBA 3ATTA 1PMVA 5LQFA 3ZEWA 5EHYA 4YLKA 3VS4A 3RM7A 3IGOA 5IMXA 4IDVA 4KUJA 2GDOA 3AC4A 5B7VA 4TNBA 4PDPA 2WEVA 5EW3A 2G2FA 1FGKA 3FC2A 2F7EE 3MWUA 2A1AB 1M14A 3KF4A 3E92A 3NUAA 4ACGA 3R30A 3AGMA 3F3ZA 1BMKA 2XMYA 3LCOA 3IGGA 3FSKA 3NEWA 2IW9A 3VBVA 3QWJA 2B9JA 3IO7A 4GUEA 3ZUTA 4FZFB 5D12A 3TNHA 3LQ5A 2CN8A 4J96A 1QPJA 5KZIA 3TZ8A 2PZPA 5ICPA 3O23A 2C6KA 1ERKA 3R1SA 2HY0A 3ALNA 4MBIA 4USDA 3BWJA 4DTAA 4O81A 4LQMA 5ACKA 2AUHA 4DG0E 3O71A 4BBMA 3E88A 2B52A 1H01A 4E6AA 2IO6A 4KIPA 3JYAA 1R3CA 5E7RA 5FGKA 3ULZA 2VNWA 2PUNA 4QEBA 2XZSA 2W7XA 2OICA 3C4ZA 4QYFA 1UU7A 4TNDA 4FR4A 4NM7A 3MFTA 3UOJA 4X2FA 1H8FA 2ZV9A 5CLPA 1PY5A 3EQPA 3LQ8A 2ZB0A 3BX5A 3TZ7A 2XBAA 3MVLA 4F6SA 3B2TA 4RWKA 3SHEA 2B1PA 3WOWA 5KZ0A 2ONLC 5IH5A 4GJ3A 3FPMA 5AUYA 2B9FA 5IA1A 2GTNA 3SDJA 1L3RE 1XJDA 5IG1A 1JBPE 2W5BA 3LMIA 4O7SA 3D94A 3SRVA 2OZAA 4FTCA 2VTOA 3E7OA 1ZARA 2Q0NA 3L9NA 3CEKA 4FZDB 3IONA 5DI1A 3AMAA 2A19B 2F57A 3VUTA 2GNHA 3NVKI 3D2IA 1YI3A 2BRNA 5JH6A 5A46A 3FZ1A 4JBPA 4YJPA 4HZSA 4C4IA 2XEZA 3O96A 5L2TA 4IM2A 1XH6A 5FEEA 3AC5A 4D1ZA 3E3PA 5ITAA 4R6VA 3I5ZA 1WVWA 3EWHA 4FA2A 4Y72A 4DFZE 5CNNA 2J5EA 5BMMA 2VO7A 4ZJIA 2OO8X 2ZM4A 5CEQA 1KOBA 4NIFB 4GIHA 5CAOA 4USFA 4WSYA 5H2UA 4M69B 3UVQA 3MS9A 5L2SA 2WGJA 1YXTA 3A8WA 4L8MA 4Y5QA 5H9BA 2I40A 1RE8A 3MVHA 3D9VA 4HGLA 2JAVA 3V3VA 4YJQA 2X4FA 5ANDA 4ZY5A 4FYOA 5HE3A 2UW5A 4IM0A 2ZM3A 1F0QA 3PJ2A 1XH4A 2UZVA 4RVKA 5DVRA 5EHLA 1JKLA 3F61A 3KRRA 4F6WA 2XNNA 3GC8A 4H05A 5DR9A 5HESA 4ZS4A 1OKZA 4M0YA 3AT4A 3AC2A 5AA9A 5AR8A 2BAJA 2J9MA 2O3PA 2R5TA 2Y6MA 2YISA 4IQ6A 4D0XA 2R0IA 4JT3A 2VD5A 1BI7A 1JPAA 3BU6A 2F2UA 4EH7A 2EU9A 3BIZA 3R2BA 4FKVA 4RVLA 5EYDA 3V5PA 3VBYA 4D2PA 3QZIA 4OBOA 1Z9XA 4GUBA 3SAYA 3FXWA 3P78A 2OKRA 4NJDA 3QXPA 4FV4A 1BL6A 4IWDA 2HIWA 4QP8A 1KE5A 3V5TA 2RSVA 5I3RA 3CKWA 2CGVA 3R71A 2BRHA 3EKKA 4DGLC 5IQGA 3BL7A 1ZOHA 2BDWA 2XJ2A 2XRWA 3LIJA 2NYAA 3UYSA 1XH5A 4B6LA 5K5NA 2B4SB 2JFMA 2R3LA 3UQGA 2PUIA 5AIRA 3RPVA 4FI1A 3R8UA 3DQXA 5EM5A 4D55A 4YNOA 5J79A 2XAMA 4TWOA 3NYOA 3RNYA 4BDGA 4DFLA 3QHRA 4KRCA 4M66A 3IG7A 2XNGA 2QU5A 4YHJA 4IJPA 5E8UA 4EK8A 1YHWA 5E1EA 2JLDA 3MIYA 4QMUA 4C2VA 3FHRA 2PVJA 2XUUA 4U9AA 1UKIA 3LJ0A 3OCSA 3GCVA 4AZEA 5JQ5A 3BHHA 3MESA 4RC3A 4GSBA 3R9OA 2C69A 3RK9A 5CS6A 4QTEA 3JR1A 2QU6A 3IW7A 4GT3A 4RSSA 3R7UA 2OI4X 2EXMA 4XHKB 3REPA 2VTLA 2CNUA 3QQFA 4PPCA 4FKGA 4NTSA 4WBOA 3NWWA 4ITHA 3CQWA 2QO9A 4IADA 4RC2A 3HLLA 2B9IA 4G5JA 5J87A 5AUXA 4O0WA 4CKIA 4NKAA 1OKYA 4NW6A 4S2ZA 4FTOA 3DKCA 2PL0A 2BAQA 2CDZA 2GS2A 2YAAA 5IQAA 1Q8WA 3PWDA 2GS6A 2QOKA 2UVXA 4KD1A 4J8MA 2FH9A 4NUSA 4QOXA 4R7HA 4EWQA 3PUPA 3UMWA 2HELA 3DTWA 2OFVA 4BI2A 2WKMA 4ZEGA 4TPTA 3BYUA 1E1VA 5CU3A 5CF6A 1UWJA 1GIHA 2UW3A 3PZEA 4XLVA 5D10A 5DR6A 5HD4A 4FSZA 2XKDA 1YVJA 4BCNA 2X4ZA 2FYSA 2X9EA 1YWVA 4DEDA 3G0FA 2OFUA 2ZV7A 4BDDA 1KWPA 4FZAB 2X7OA 4K1BA 4L3LA 3TDVA 5GNKA 1A9UA 1U46A 3FZTA 3NNWA 2R3JA 3O2MA 5HG7A 1JSVA 3VS6A 3PVUA 4FV9A 4C4HA 1DM2A 4MUQA 4KKEA 1URWA 2W96B 5EFQA 2AEGA 4QP6A 2A98A 2XCKA 5LCJA 4GYIA 5E8SA 3KU2A 4UALA 5ANIA 4FTNA 4O0TA 5EHOA 1QPCA 3KK9A 2RL5A 3C50A 4GS6A 3ZBXA 4DH7A 4E73A 2W1DA 3FMDA 4ZSJA 2IVUA 4FG8A 4CG8A 2VGOA 3I7CA 3ORTA 2X2KA 3S1HA 4L3PA 1WBWA 2QG5A 2XM9A 4R5YA 3IW6A 4BZOA 3KREA 3QQJA 2PZ5A 5E8XA 2OK1A 3EMGA 3GQIA 4MXZA 4X2KA 3QX4A 3UC3A 4E26A 2ITYA 4F7SA 4BICA 3SV0A 2QNJA 3EFLA 3G0EA 4IZ7A 3PA4A 4GK4A 5AR4A 2GHGA 3GOPA 4LL0A 3ZYAA 1G8SA 4YR8A 4FNZA 2J0MB 2DWBA 2G1TA 2WD1A 4CTBA 5DT4A 2CLXA 1OECA 4C3PA 4ASEA 3TJCA 1MRVA 2O2UA 3VF9A 5TT7A 3RJCA 3TV4A 3HV3A 2IZSA 3E64A 4XNEA 2QHMA 1WCCA 3ERKA 4IH8A 2C5OA 3Q4CA 4FX3A 5ETIA 2NP8A 4XG6A 3CKXA 3E87A 4MXYA 2YLFA 5T3QA 4D5KA 1JSUA 3FLNC 5J1VA 4BI1A 2C3IB 3O7LD 3RGFA 5KMOA 1OPLA 2XNPA 4FTJA 1R1WA 1PMUA 3KKVA 5CX9A 3A4PA 4BIBA 2O64A 4EZ3A 5HNBA 4QNYA 3SG9A 4ZK5A 2HZNA 4O4FA 4IVAA 4BJJB 5I9UA 1OBGA 5JGDA 2YDJA 4WBBB 5GHVA 3R8VA 3UZPA 5HCXA 3R8MA 2BRGA 4DDGA 4CZTA 3B8QA 4AE9A 3RM6A 3KB7A 5HVJA 3ZDUA 4FSUA 3PXKA 3QQKA 3I0QA 4PNIA 4FIIA 5L2WA 5HICA 3T3VA 4DAWA 1KE6A 2YM5A 4AXEA 3NIEA 3ORPA 3W10A 4XH6A 4XV9A 4EH3A 5IPJA 3II5A 1OIRA 2W4JA 4H3QA 4R3RA 4XBRA 5AM6A 2IW8A 3W2QA 4LGDA 3RTPA 4C7TA 5FTGA 2XEYA 4XYFA 3GP0A 1X8BA 3RK7A 2C6LA 3AT3A 4IFCA 1JQHA 1SNUA 4KIOA 4V0GB 3Q4TA 3W32A 4R7BA 5L6PA 5BVKA 2W05A 5GIOE 3R1QA 3TMOA 1W0XC 4MBLA 3G33A 2ETRA 3MJ1A 1SZMA 1TZDA 3UDBA 3U9CA 4N70A 4YZBA 3ZRLA 4EOMA 5E8YA 1TQPA 2WTKB 2YWPA 3FL5A 3MDYA 5CU4A 3TKIA 5AR5A 4DEGA 1P14A 3FUPA 3TUBA 3GI3A 3P5KA 1QL6A 4R3PA 1A48A 1FQ1B 2Z60A 1H1SA 3TG1A 4B8MA 2QOQA 3PP0A 4G3GA 5E9EA 2PZRA 3OXTA 3RPOA 5LMKC 5M4UA 2JAMA 4MNEB 5LMKA 1PKDA 1XH7A 4BDJA 5TO8A 4ASZA 3OW4A 4C8BA 2V7OA 5EDPA 2Z7RA 3BLHA 1Q62A 4EORA 3RKBA 3VUKA 4BTMA 2WMAA 4R8QA 3LXNA 3WF9A 5DNRA 3UO5A 2PY3A 5EI6A 3QD4A 5DN3A 5FM3A 2JFLA 3PJ1A 5A9UA 2WTDA 2R3IA 3DQWA 4IZ5A 3JXWA 3DKFA 2RIOA 1AD5A 3PVBA 4KIKB 5AUZA 1U54A 5AM7A 2QONA 1CKJA 2HENA 4E6CA 3PFYA 5DYJA 4B99A 3ZDIA 4BDEA 2FSLX 4HVDA 4R1YA 4TYHB 4LRMA 3U4WA 5AEPA 4OTIA 4IAKA 4LOOA 4R5SA 5F1ZA 2KULA 1PHKA 2NO3A 5IQBA 3JVSA 3R8PA 4TL0A 2CNVA 1Y91A 4WUNA 4EOKA 3SXFA 1W2CA 1XR1A 4ZXTA 3H0YA 5IUGA 2ZFYA 3LM5A 1YDTE 2QO7A 3R83A 5AP5A 3PRIA 3UNKA 5A3XA 2G15A 3PSCA 2F4JA 5H8BA 4U8ZA 4FT9A 1OL1A 4HGSA 3RMFA 5I9XA 4EK4A 4OTRA 3ITZA 3FMEA 4FV3A 4UYNA 4BL1A 4I22A 3O7LB 2QO2A 4TWCA 1VYWA 4TRLA 1VYZA 1LUFA 2PWLA 5HCYA 4FICA 4EBVA 2IJMA 3WZJA 4QMQA 3R9HA 1U5QA 4N57A 4RIOA 3EQRA 3F82A 4EZ7A 5LCKA 4IVBA 3WE4A 4I6FA 2QD9A 1XWSA 2YEXA 4HYIA 3WF7A 4LOPA 1SVHA 4LRJA 4CKJA 5A14A 5LMBA 1REJA 2AYPA 3ACKA 3GB2A 3UDTA 2UW9A 1J91A 4IX5A 4P2KA 5JFSA 3MPAA 5F95A 5JK3A 2P55A 4GVJA 2R4BA 4XS2A 3EFKA 4JR3A 4RJ3A 4ZP5A 5HG5A 5KHWA 1OGUA 2W9ZB 4EYMA 3QLGA 4FKWA 5JFWA 4E4MA 1WBPA 2H8HA 1OL5A 3EH9A 4W8DA 5EM6A 3EQHA 4MXXA 4AN3A 4ZMEA 4RIXA 4I92A 3PVWA 5DRBA 1OUKA 5L8JA 4L7FA 2WMUA 4TTHB 3QHWA 4MCVA 4B8LA 1E1XA 5I5ZA 3D83A 1OPKA 5ANEA 5D41A 5CF8A 1XMLA 5KMJA 3KXMA 3KIOC 2QQ7A 2RKUA 4F9CA 4L43A 4OBQA 5TOZA 3U55A 4O0YA 2XIKA 3ZXTA 1G5SA 3AD5A 4XG4A 3SD0A 3F69A 3UNZA 3W0RA 5AAFA 3L8VA 4WG3A 2QKWB 4F7LA 5FWKK 4L46A 4FUYA 3VW6A 4XG7A 4DCAA 3AXWA 4PF4A 4U5JA 4YJSA 4DG2E 5AP0A 4ASXA 4JS8A 2HW6A 5C03A 1GY3A 3QLFA 3NUUA 5ANJA 4TN6A 4DFYA 3ET7A 5T68A 4IM3A 3OCBA 2VNYA 4GYGA 1GNGA 5KBQA 5CNOA 4DCEA 2X39A 3CD8A 4EHEA 4O6EA 3AC1A 4ZZNA 3COKA 1DS5A 5J8IA 1WMKA 5HLPA 3UE4A 3GOKA 4YPDA 1M2PA 5KKRC 4YJUA 4JBVA 2B7AA 2PVRA 4IB5A 3PY1A 3R01A 1OUYA 1K9AA 5TR6A 4U45A 3RCDA 5K3YA 5A4QA 3V8TA 4AZFA 3EL7A 5T6KA 3D5XA 3LXKA 2C3KA 2RFDA 4FL3A 3ULIA 3DFAA 2BUJA 5IA5A 2VTJA 4F7JA 5JQ8A 5IA3A 3DB6A 3OS3A 5HX6A 1J1CA 3W33A 4LMNA 4M12A 1BL7A 1YOLA 3AGLA 3FSFA 4XOZA 2PMOX 5HTIA 3H9FA 5AP6A 3L9PA 4AZTA 2WMSA 2ZAZA 3VJNA 3RZFA 1NW1A 4ACCA 2X2MA 4Y8DA 3UP7A 2R0UA 3QKLA 4YZDA 1MP8A 1LEZA 4R7IA 2WMQA 4WRGA 1H07A 4D9UA 4O7NA 4LGHA 4D58A 5J9ZA 4FGRA 5H8EA 4DHIB 5CWZA 3AG9A 4KB8A 2VTIA 4LGGA 2X0OA 3BEGA 5B0XA 4X6RA 4YNEA 5AP3A 4QP4A 4C36A 4E4LA 1CDKA 4F0GA 3OEZA 4KABA 4PDOA 5GZAA 4BR3A 4EC8A 3NUNA 4I0TA 1TKIA 2W9FB 4CNHA 3SG8A 1OIUA 3KF7A 5DG5A 3GU7A 4I5CA 3OW3A 4USEA 5M53A 3TUDA 4O7TA </