2QD9A

P38 alpha map kinase inhibitor based on heterobicyclic scaffolds
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of p38alpha MAP kinase inhibitors based on heterobicyclic scaffolds.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qd9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qd9A01
2A0CX 4KS7A 4QNYA 4ZP5A 3FJQE 4YLKA 4EQCA 3Q3BA 5CALA 3R8UA 4X3JA 5A6NA 2GTNA 2XK6A 3GFEA 3PDTA 3FDNA 2XRUA 4AZSA 4MBIA 2WMBA 4AE6A 2UV2A 3B8QA 3TTJA 4HVIA 2XIXA 3EJ1A 5E8XA 4EC8A 2C5OA 3UO5A 5K3YA 4IB1A 2OZAA 4MF1A 4C37A 4YC8A 5E8SA 4MAOA 5HU3A 4TW9A 3N9XA 2QCSA 1YXUA 3MJ1A 4FYNA 4JT3A 4ANLA 2GS7A 4CV9A 4QMQA 2ITQA 5A4TA 3GU4A 5K4IA 5FP5A 5CAQA 4PWNA 1Y8GA 3QGYA 3JPVA 2HZ0A 5T6KA 1CSNA 5HE3A 2R64A 4PMTA 2ETRA 1KE5A 3RZFA 2BRHA 3ZZWA 5DT0A 4CT2A 4YJOA 4LRKA 1UU9A 3LHJA 1OVEA 4DEEA 2QOOA 2EXCX 3AC2A 3ULZA 4LV8A 5HG5A 1NY3A 2XBAA 3WF9A 3E62A 4CCBA 3OXZA 5CLPA 3PYYA 5F4NA 4AA0A 5JGDA 3HUBA 3VBYA 4AGDA 2I6LA 1PXMA 3HV5A 3LFDA 5I9UA 2J0KA 3UZPA 4F09A 2XMYA 4LUDA 2C68A 2QC6A 3GGFA 3ALNA 3PG3A 4RX7A 2PY3A 4PDPA 1JBPE 3GCUA 3C4FA 4WUNA 5AP2A 5HTBA 5CAPA 2WQMA 3GC7A 1BKXA 5I0BA 4USFA 5HNBA 4O84A 2PE1A 3HKOA 4PDYA 4OAUC 3OEZA 5CX9A 3TDVA 4A9TA 3MPTA 5LMKC 3FI3A 4FZ6A 4CRSA 4Z16A 3DKGA 3VS2A 4C57A 3Q4UA 2X2KA 5CF4A 3GC8A 5DMZA 3I0OA 4DF3A 1WBSA 3ZU7A 2HYYA 1AGWA 4X3FA 4CFFA 3TL8A 2UVZA 3G5DA 2E9PA 1KE9A 3VW8A 4BTJA 4E26A 1MUOA 2YZAA 5BYYA 4FTMA 4QYYA 4B99A 3MTFA 3JS2A 2VN9A 3MGYA 5JKGA 3G2FA 3WIGA 4KBAA 4I22A 2YEXA 4QMPA 4FEQA 4LUEA 2WTKB 2OWBA 3TTIA 4NIFA 4FV8A 2W7XA 2B7AA 1P14A 5M53A 4U6RA 4MF0A 4BF2A 5ICPA 5IA5A 1M52A 4U80A 2UZNA 3PPJA 1SVHA 5HE0A 2BFYA 1X8BA 2YCRA 3CJFA 4LGHA 4QMVA 3UYSA 2EXMA 2UZTA 4AUAA 3HAMA 4ZEGA 3D5XA 2FSTX 3G33A 3ZTXA 1REJA 3QYWA 3FMHA 1NVSA 4DAWA 3PSDA 4XEYA 5E8TA 2FVDA 3E63A 1JKTA 3OXIA 4F63A 1ZYSA 3AQVA 1Q8TA 3E3BX 1YXSA 2P2IA 1W0XC 5E7RA 4TWOA 3Q60A 5HLPA 3OWKA 2VWXA 1SYKA 3AGLA 5CY3A 5AFVA 3MWUA 3MA6A 5EQEA 5IDPA 4ZTRA 3I1AA 2IZTA 4ONAA 3PRIA 1XHAA 4J53A 1ZARA 4I4FA 1XH9A 2I1MA 5ANOA 1Q5KA 4CG8A 3LPBA 4LOPA 4GT4A 3QTXA 2X39A 1OM1A 3ETAA 3HMOA 4L00A 4HYHA 3DZQA 1RE8A 4F70A 5LXMA 4E4LA 3W2SA 3GVUA 3ZOSA 3A4OX 3L9LA 4FV7A 2CKQA 2OXXA 2BZHB 3CBLA 3LMGA 5AUTA 2HK5A 2WIHA 3UVQA 4FNXA 5I9VA 3F6XA 4QQCA 5ANDA 1Z57A 4U0IA 4D2SA 2F2CB 4BVUA 4DFLA 4E20A 2R3HA 5KUPA 2XZSA 4R1VA 4OTPA 1BI7A 1HCKA 2PE2A 3IKAA 3PUPA 4YLJA 4DFXE 4FTOA 3GFWA 3PVUA 3MDYA 2W9ZB 3RPYA 3I5NA 3UIXA 1TQMA 4IJ9A 4DCEA 4Y72A 1M2QA 2EB3A 3T3UA 5EM8A 3PP0A 5BYLA 5CVHA 5IQHA 5KZ0A 2AYPA 1WBPA 1OBGA 2BCJA 1YHSA 1PXLA 1BX6A 4RX8A 4IIRA 2Y0AA 1TKIA 4KBKA 4RC2A 2ZDUA 3POZA 4ITIA 4BKJA 2G15A 2HENA 3QTIA 2QKWB 3PP1A 5ETIA 4H36A 4PUZA 4YC6A 4BCGA 4R5SA 2ZMDA 3CJGA 2XNOA 3GQIA 3R73A 5K0KA 3QQJA 3SW4A 3ZYAA 4C3PA 2V22A 3EQGA 2Z7LA 4JAIA 2PVNA 3MJ2A 5DT4A 3RGFA 1WBWA 3SA0A 2GHGA 2SRCA 3MN3A 3OCTA 4U8ZA 4AAAA 1V0PA 1ZOHA 2W1EA 1YOJA 1YWVA 5FM3A 1WBOA 4FC0A 2ZV7A 5B2LA 2C6KA 3CE3A 3ORKA 3F2RA 4E5WA 4MD7E 5AV4A 4EI4A 3MFUA 5KBRA 4HJOA 1STCE 4R6VA 4RIYB 5H8EA 4C33A 3NMUF 3A8XA 3ZM9A 5ANGA 5AR5A 4E93A 2BRBA 4IVAA 1H1PA 2XP2A 3D15A 4MD8E 4P2KA 4DCAA 3C4CA 3KXZA 3BQRA 4XV3A 5IH5A 4ANBA 2QONA 5DHJA 4EHGA 5AM6A 4ZSGA 2BHEA 4FG8A 5HQ0A 4FSYA 4E8AA 1ZYCA 4TYHA 3UC3A 1LEWA 2GHMA 4QOXA 3VS1A 3WZEA 3ZUUA 4DFNA 2J7TA 3RCDA 1REKA 5FUTA 2X81A 4GJ2A 4P4CA 2AC3A 2RF9A 1IASA 1M7NA 4LG4A 4BDEA 2NNWB 1H1QA 3QC4A 4XOYA 3CSVA 3QRJA 5L6OA 2ZJWA 2VTHA 3R1NA 4F6SA 4RLKA 2PVFA 2CJMA 2GFSA 1ZYDA 3DJ6A 3O7LD 2C5XA 2JLDA 3FQSA 4FKPA 2X4FA 4BGGA 3G6GA 2BALA 5M4UA 5IQAA 4YJQA 2R3LA 4K77A 3SC1A 3NUUA 4EH3A 5LMAA 3NGAA 3RWQA 3P9JA 5AA8A 2PK9A 4FIIA 4YZ9A 4F4PA 1OB3A 1TVOA 5DR2A 2IW8A 3FMMA 3I81A 4RJ4A 3D0EA 3PZEA 3SD0A 4TYJA 4GKIA 3KN5A 2Q0BA 3MIYA 3PXFA 3C5UA 4O91A 4OLIA 5CU0A 4K2RA 4RWLA 2P0CA 2WD1A 2C1AA 4IB3A 4PX6A 4QMTA 3ANRA 5B2MA 1FBNA 4QMYA 3UP2A 3C9WA 3DCVA 4W9WA 3FSKA 5IH6A 2CPKE 4QP2A 2VNYA 3HECA 4R3RA 5KCVA 3D9VA 4PRJA 2DUVA 3G9NA 5C9CA 2P3GX 4QQ5A 3RAKA 1OL1A 3BBTB 4KIQA 5GNKA 3WF7A 3LXNA 3BU5A 4IAAA 5L8JA 2QG5A 3Q6UA 4L3JA 5TT7A 2IW6A 3O8TA 2ZM4A 4D58A 2EXEA 2YIYA 1I09A 2ACXA 3G51A 3VUHA 2PMNX 5DRBA 1E9HA 4A7CA 3ZBXA 2C6TA 4PNIA 2ITYA 4YJRA 4AQCA 4BTKA 3HA8A 4WSQA 3WE8A 4BCFA 2XK9A 3KVWA 4ALWA 3R83A 5K5NA 5M55A 1JSTA 2PUNA 3WZKA 2OIBA 2X7OA 2Y4IB 4O0SA 5B2KA 4ANMA 4AW0A 5BUIA 1OGUA 3NYVA 2PMIA 4FV3A 3DKFA 4OTQA 3TJCA 3BHTA 1UNLA 3VUGA 5GZ9A 2C69A 3LVPA 4I3ZA 4X3FC 3DJ7A 2QR8A 4G3CA 4V01A 5IDNA 3GC9A 3Q5ZA 3R63A 3ANQA 5J8IA 2R3OA 2X2MA 2A19B 4XP0A 3VW6A 3RPRA 5EW9A 3NX8A 4FSZA 3IO7A 2HY0A 1BUHA 4YBJA 4RC3A 4EH9A 3NZ0A 2E2BA 3VUDA 4HW7A 5E4HA 2JDTA 2XUUA 3PTGA 4M7IA 5CSXA 5EW3A 3SXFA 3LMHA 4CQEA 3HRFA 2C4GA 3KGAA 4IFCA 3Q2MA 2Z2WA 4FKVA 4R7HA 2HZNA 4L42A 2ZDTA 3GQLA 5L2SA 2WMSA 3BI6A 4O1PA 3FLSA 4E6QA 4FIEA 2QODA 3SX9A 3TIZA 4WOVA 3V5LA 4JR3A 4G5PA 3UPXA 4XG9A 3UIUA 3JY9A 1JKKA 3WZUA 2VO6A 1UKIA 4GIIA 1H07A 3QQLA 2R3QA 4UWYA 3F5XA 3QUPA 1OUKA 4UYNA 3IOKA 5HIBA 4Y85A 5HVJA 5CYIA 3C0HA 5FLFA 5I5ZA 5D10A 2XNMA 3SHEA 4RIWB 2EWAA 1DS5A 2XIYA 5FBOA 3NUNA 4CKJA 2PMLX 4F1OA 2ZVAA 4M67A 4Q2AA 3V5JA 3UNJA 1XH6A 3S3IA 4UMRA 3QKKA 3HZTA 3ALOA 3FL5A 1CKIA 2XYUA 4MYGA 4MXOA 4TZRA 4QTAA 2P33A 3R22A 2JD5A 3UGCA 3ZMMA 4U43A 1OKVA 3COKA 3OCBA 1GIIA 2GNHA 4BZDA 3NCGA 3D94A 2REIA 4C61A 4CD0A 2XNBA 5CSWA 4RT7A 4GK4A 4M69B 4DGOA 2BDJA 4AT3A 4RVTA 2C0OA 4XYFA 1NW1A 2ITTA 5JFWA 4LGDA 4AZEA 5M4CA 5GIPE 4K11A 4ZS0A 2W4JA 3PA5A 3KRXA 3R8LA 2YABA 4APPA 3DAEA 1B6CB 3PXYA 4KINA 3ZH8A 4FT3A 4Q5EA 3IONA 3ZO3A 4O2ZA 4YTIA 1Q8WA 5LARA 1SVGA 4YGAA 4D55A 4Z7HA 4DGLC 3BYSA 3IW4A 4EKLA 3B2TA 3KULB 5DT3A 4G16A 1U5RA 3UOLA 2GU8A 3KMWA 3GBZA 4WRGA 3QTWA 2VX0A 4GYGA 4LV5A 5DN3A 4RA4A 4TXCA 5TKDA 1QL6A 4QTDA 4QRCA 3P86A 3R1SA 5FTOA 4MH7A 4OTFA 5F1ZA 4DTBA 3ZSIA 2WNTA 1G3NA 3PE1A 2ITNA 2OJ9A 2WMUA 1WBVA 3AT3A 4UY9A 4ZY6A 3ZHPC 1YHVA 2HZIA 2WPAA 4DFUA 2AUHA 4HVDA 2QO7A 4AW2A 2UW3A 4EH7A 3GB2A 5HG7A 3ORPA 2GQRA 3RM6A 5HIEA 1YOMA 3KRRA 3LXLA 2WB8A 2XK3A 3HGKA 5CQWA 3QZHA 1XBAA 4G6LA 2ITWA 2VWZA 4S2ZA 5AAEA 4I0SA 2RFDA 3CQWA 3GU6A 3TXOA 5BPYA 4FBXA 1AQ1A 3QTZA 5FTQA 3NW7A 2F7XE 3MFRA 2E9OA 3KU2A 4YPDA 4C36A 5L8KA 5FTGA 1KOAA 3PIZA 4EUTA 5DGZA 4QP1A 3PZHA 5JFSA 4JLCA 1F5QA 2VX1A 4M97A 1V0BA 2HIWA 3EN6A 4FTAA 4EONA 4Y73A 5AM7A 4B8MA 4ZSEA 4GT3A 3F9NA 2VTAA 3ACKA 2PZIA 4MXXA 3V3VA 4CT1A 2VGOA 4G2FA 3QWKA 4YJSA 5A4QA 2VD5A 3BV3A 4AU8A 2A1AB 1B39A 3BHYA 3RZBA 5HZNA 3MESA 4JDHA 4DEBA 5HO6A 4YHFA 1W98A 4FKSA 4JBQA 4M14A 3FMNA 3OHTA 5BYZA 2NRYA 3AXWA 3RHKA 4D2RA 3KCFA 3W1FA 2G01A 2W5AA 3THBA 4IJPA 3MY5A 3W8LA 2GNIA 1JSVA 4RLLA 4AFJA 5FP6A 3O0GA 3LOKA 5CT0A 3KK9A 1IA9A 4CLJA 3AC8A 3N51A 3VN9A 4BKYA 2WMRA 3FC2A 3OWLA 4FTTA 4ZMFA 4EWQA 4O27B 2B4SB 4C4JA 2OXYA 3EFLA 3E8EA 3QAME 3PLSA 2F49A 3EQHA 5BVKA 5E8WA 3W33A 3A7HA 4DH7A 5J87A 1H08A 5A54A 2XB7A 3L9NA 5BMMA 1PKDA 3VBWA 4ANSA 4EZ5A 2ZV9A 2RL5A 4NM3A 3IPHA 5FD2A 3LM5A 4RVMA 5JH6A 2OJJA 2X4ZA 1JNKA 5EI8A 3W2RA 3EQCA 3ODZX 3NSZA 3KK8A 1NVQA 1W83A 3OXTA 4BICA 3F61A 1XH7A 4DC2A 4BIDA 2OBJA 1YOLA 2GPHA 2VZ6A 2Q83A 4FV2A 4M8TA 4FK3A 5EDQA 3II5A 2B9FA 1U54A 3KVXA 2VWWA 4EOSA 3VS6A 4DT8A 3EFWA 5IMXA 3R8MA 4FA2A 1ZZ2A 3DBDA 5EQYA 4W8EA 3ZO1A 4RWIA 4FGRA 2OICA 3PXRA 3OMVA 3R8VA 3ZLWA 4J97A 4C3RA 4EH8A 3AOXA 4BR3A 5BVWA 3VNTA 4BDCA 1A48A 4EJ7A 3NAXA 2I0YA 5C01A 4JG7A 1ZMUA 5HICA 3BELA 1IG1A 5IISA 4FUYA 5IA3A 4V05A 5L6PA 1H0VA 3FZ1A 4QMXA 5H2UA 5KE0A 2DWBA 4FKWA 3ZONA 4M68A 4O83A 2BAKA 2O3PA 3NYNA 5L2IA 3NYXA 5AR8A 3EFJA 1XKKA 3OS3A 3VUKA 2CNVA 2YIXA 4RQVA 2CHLA 2R3KA 3PIYA 4J8NA 4NH1A 3DNEA 3O50A 3QWJA 5DOSA 4D9UA 2B0QA 4RPVA 3FKOA 4GRBA 5EOBA 3GCPA 3UZTA 3ZDIA 4KIOA 5IA1A 3BV2A 1UWHA 3MVMA 3WYXA 1VR2A 2IVVA 5AMNA 1OPKA 1R3CA 3V5WA 4PV0A 4X21A 2ESMA 4DE4A 4MTAA 2WTJA 5A46A 3NIZA 5CSHA 1NXKA 3FLWA 4GJ3A 4JRNA 4IAYA 1U46A 3QRTA 4M84A 4QMLA 5CNOA 2GHLA 4DLJA 2YLEA 3KXGA 2BMCA 3BKBA 3G0FA 4O6EA 2ITZA 3L8PA 4YPSA 4IDVA 4Y83A 5EYKA 2VTRA 3Q4CA 3KF4A 4YO6A 1RJBA 5L2QA 1ND4A 5IEXA 2G2FA 4Y95A 3VIDA 2VWYA 1ZYJA 3VF8A 5IQBA 3F88A 4QTBA 3MH0A 4BIBA 5BQ0A 2BVAA 4HGSA 4O7VA 5HCXA 3R7OA 2A4LA 3LFSA 3WZJA 3POOA 5EKOA 1TQIA 1G8AA 4BBEA 4S33A 4ACCA 4XP2A 2XM8A 4C7TA 4F0GA 1PMUA 3V8TA 4FG7A 4ENYA 4ZY4A 1OI9A 3VS5A 3AT2A 3K3JA 2X0GA 1KE6A 4OTDA 5EW8A 4GEOA 4GFMA 2Z8CA 4FL3A 3LFNA 4FR4A 3COMA 3K3IA 2FH9A 3JYAA 3QHRA 4D28A 2JEDA 2R0IA 3LCOA 4AZWA 2RIOA 4QP3A 2WELA 4IVCA 3ZO2A 3OCSA 4BDAA 4E3CA 2UW8A 4YNEA 2CSNA 4BDFA 3OW3A 3VWAA 4C62A 4FKLA 4FKOA 1VEBA 2FUMA 2BTRA 4ZSJA 4L8MA 4FTRA 2WTCA 2PZYA 4IWDA 4YLLA 3NIEA 3FI2A 1ZLTA 5CXZA 3DB6A 3LM0A 5DVRA 2W1CA 4BKZA 4C59A 4ZTQA 3WIKA 4BCHA 3ZO4A 5DRDA 2YM5A 2GNFA 3KCKA 4IWOA 1OECA 4IZAA 4YO4A 2XRWA 3OWPA 5J1VA 3KY2A 3FMLA 1PXNA 3CTJA 2O63A 4U41A 4U5JA 2B54A 3RJCA 3W2PA 4HZSA 4C0TA 4BDDA 5IEVA 3F7WA 3P79A 1F3MC 5DG5A 2JBPA 1OL2A 2UW7A 4TL0A 2F4JA 2RFNA 4R7BA 2BROA 4RRVA 3R7EA 3VAPA 5C03A 4FV1A 2VTOA 2Q0NA 3CQEA 3MVLA 1URCA 3BE9A 2BDFA 4RVLA 3Q32A 1VYZA 1OKYA 4HVHA 3LFBA 3U51A 1Q8UA 4Z9LA 5EM7A 4FKQA 4P5QA 4TY1A 2ITOA 1IRKA 3SG8A 2QQ7A 3R02A 3BLQA 2WQBA 1SMHA 5HBHA 3Q53A 1K3AA 1YI6A 4UN0C 5EQPA 4WIHA 2C3JA 3SGCA 4LOQA 4JG6A 4RGJA 2ITXA 3FQHA 4OTWA 5FG8A 4U44A 4EC9A 4U3YA 5EDPA 3PVWA 2VV9A 5JFXA 3RPOA 2HAKA 4F6UA 4DH3A 3QCQA 1S9IA 1MQBA 4IMYA 3MH3A 4IXPA 1JLUE 4FV0A 4W4VA 4JXFA 4EK4A 2XJ1A 4KS8A 4DH1A 4ZJJA 5D11A 4FNYA 2PZPA 2WKMA 3D14A 2QO2A 4G3FA 5AUVA 4Y5QA 2QOLA 1Z9XA 4BDHA 2H96A 1R0PA 3U9CA 2BZJA 3ERKA 3LQ8A 4BCQA 4PQNA 4DTAA 4M3QA 2UW0A 2Y7JA 5C8MA 4C2VA 4MNEB 3GNIB 2GS6A 2YACA 4CZUA 2FB8A 4BN1A 4DFYA 2QG7A 2CKEA 2WU6A 4FSQA 4MK0A 4QMSA 2OI4X 4C38A 3FWQA 4LMNA 2XNNA 1O9UA 3MW1A 2C6DA 2XJ0A 4FZDB 3OZ6A 4IC7A 4IH8A 5CT7A 5I3OA 3ZS5A 1P4OA 4AXAA 3WYYA 2CGWA 3PWDA 2Z60A 3G0EA 3LJ2A 4RIXB 4LL5A 3QZFA 1Y6BA 5C4KA 3TKHA 3ZUVA 1OIRA 1CKJA 3FMEA 3KB7A 4IM3A 4OGRA 4PMSA 4X2FA 3R2YA 5DYJA 5JRSA 4L52A 4XJ0A 3TZMA 2IO6A 5AP3A 4BI0A 2C3IB 4AOIA 2GQSA 4CZYB 5AX9A 3P7BA 2IVTA 3Q6WA 3S1HA 1O6LA 4O0UA 2VGPA 4DH8A 5BX0A 4V0GB 2E9VA 2XCHA 5K9IA 5IU2A 3MBLA 3HNGA 4FKGA 5AA9A 4ITJA 3NW6A 4RJ5A 3VJOA 5CU2A 3LAUA 3FMKA 3WF5A 2YZLA 4WRSA 2WMAA 2VTIA 3QF9A 1U4DA 4YJNA 3DQXA 3ORMA 5B7VA 2ITUA 4OUCA 2JIIA 4I6BA 4CLIA 4EK8A 1VYWA 4CQGA 3LW0A 1YW2A 5EI2A 5EM6A 5CF8A 2PVHA 5D41A 3OP5A 5KHXA 3ENMA 2PULA 2XKEA 4M12A 3C4ZA 3DLZA 4ZTMA 4GFGA 3RNYA 3ORNA 3V6SA 4IB0A 4GV1A 4N4SA 3SW7A 2PMOX 4UMPA 2XIZA 3FZTA 3M42A 4F1TA 5I3RA 4EOLA 3PSCA 4HCVA 3CS9A 4E6CA 2XKCA 4UEUA 2PYWA 4FZ7A 3EZVA 1WVWA 4WNPA 2W1GA 2BHHA 1S9JA 2FSOX 3Q5IA 4H1JA 3SOAA 1UWJA 3ORTA 4IDTA 4XG2A 5EKNA 5EYCA 3HRCA 1KV1A 3OBJA 1VJYA 4EYJA 3TZ9A 4BCKA 3EN7A 3VHKA 4WBBB 4AOTA 3QALE 5D1JA 5A4CA 2NO3A 1J1CA 2KTYA 2I0EA 2IWIA 2QOIA 1JSUA 2HOGA 4GKHA 3DPKA 3LCTA 1PXPA 4EOKA 4PNKA 4MVFA 2F57A 4YSMA 3EQPA 2OJIA 4IBMA 3NR9A 4MWHA 3ZXTA 5EHLA 1H25A 5G1XA 4O7YA 4FSUA 4NSTA 3QLFA 2ERZE 3MPMA 4EYMA 1SVEA 3LKMA 4OTRA 4O38A 1FMKA 4TPTA 4ZIMA 4ACMA 3FXZA 4ANQA 3LJ0A 3VF9A 1OBDA 2VTQA 4L3LA 4FGBA 4O7LA 3DBFA 1O6KA 5DR6A 5E1EA 5B0XA 4XG6A 2GTMA 2OKRA 2Y8OA 3F3VA 5HIDA 4FTJA 3F2NA 5CU3A 3OY3A 5JEBA 3I4BA 2QHMA 2YM6A 3V8SA 3VBVA 1H0WA 4KIKB 4HVSA 5CSPA 5K4JA 5EHYA 5BVEA 3OOGA 3COHA 3U6HA 4BGQA 3C0IA 5BVNA 1UNGA 2CCHA 4UV0A 5FRIA 4XOZA 4D4VA 5IKWA 1FVRA 2BUJA 3QRIA 1Q24A 2XK4A 4RFYA 4WG3A 4O86A 1SNXA 4Z3VA 1GY3A 2R3NA 1B38A 2JDSA 2JDRA 3BHUA 3CPBA 1JWHA 3I5ZA 3IQ7A 4AGCA 3ODYX 5KNJA 3U54A 3ZEWA 3PRFA 1J1BA 4BL1A 2R5TA 5CEKA 3ENHA 3QXOA 4ASZA 4QYGA 4HPTE 5CEIA 1GZNA 3NNWA 4RBLA 4FV4A 4IM0A 4DG0E 2J50A 2CKOA 4EBWA 1F0QA 3BEGA 4JS8A 3LQ3A 3NS9A 1CKPA 2O2UA 3R30A 4FNZA 5CI6A 3QX4A 2QLUA 5GJGA 3NNXA 3V04A 4BDKA 5M06A 5AR2A 4FTNA 1BI8A 5BUJA 5J7BA 2OZAB 4ZS4A 4L3PA 4QP9A 2VWVA 1W7HA 4F6WA 3W8QA 3MVHA 3QA8A 4GS6A 4FV5A 2G1TA 1JAMA 3KA0A 4EEVA 5IUGA 4O81A 4NK9A 2PVJA 4L43A 4IZYA 3Q9ZA 3LFEA 3HDNA 4WHZA 2VTNA 1K9AA 4I4EA 4XG3A 2B1PA 3F7ZA 3PPKA 4J98A 2VTPA 3OG7A 3F69A 2I7QA 2BAJA 5J1WA 2PVRA 4H3BA 2UZVA 3BYMA 2RG5A 4XG8A 4JAJA 3MIAA 5AV0A 2WAJA 4L01A 4LRMA 4RC4A 4HYIA 5AV1A 4DEAA 3BX5A 1Q99A 4IACA 3RI1A 5H3QA 2C6MA 2EUFB 4TRLA 4D5KA 3ZRLA 2JDVA 4UXQA 3Q9XA 5K0XA 3R9DA 3DTCA 3EYHA 5KHWA 4KA3A 5LCJA 5HE1A 3NRMA 5CWZA 5KKRB 2R9SA 4O0WA 5KMOA 2GQGA 4OT6A 4YTHA 3KXXA 4AOJA 4DEHA 1PMNA 3QLGA 4FF8A 2LAVA 4J52A 4C4FA 5EOLA 2DQ7X 4DTKA 3DAKA 2Y4PA 3CTQA 5EM5A 2BKKA 3FAAA 4NEUA 4A9SA 3QBNA 4HNIA 4R8QA 4D0WA 5I4NA 3H9RA 4E6AA 4F99A 1L3RE 1UVRA 1XH5A 2QURA 3R0TA 1M7QA 4O7RA 2W0JA 3M1SA 3GXLA 3B8RA 4O1OA 4UYAA 2CGUA 1YWNA 4X3FB 4XH6A 4K33A 4A9YA 4FIJA 5E8YA 2W05A 2J0LA 5KMMA 1MRVA 2BIKB 2WMVA 5CS6A 2PVMA 3QQFA 2E9UA 4FEWA 3E64A 3KULA 2ERKA 4MXAA 3LMIA 3EHAA 2WOTA 3C50A 3DA6A 4MX9A 3R9NA 3RTPA 3CLYA 2C6OA 4MBLA 5IZFA 3KN6A 4OBPA 4NFMA 3WE4A 2JC6A 4ZZMA 3U4UA 3KQ7A 3KXHA 1W84A 3EMGA 2WQNA 4NIFB 4O0XA 1GAGA 3UQGA 4F9AA 5HX6A 4X6QC 2F7EE 5T68A 4XV1A 2J90A 3IGGA 2WU7A 4FSNA 2C6EA 2UZDA 3U4WA 5LVPA 3LLAA 3ROYA 4ASXA 2W17A 4USEA 2CNQA 3F82A 3SQQA 4I92A 2QKRA 5CZIA 3QQGA 2EU9A 4YZDA 4XUFA 5DEWA 1I44A 2VUWA 4QT1A 4NJ3A 2X1NA 4AS0A 3DGKA 3BHHA 5AP1A 2R3JA 4QP8A 3RK9A 1GIHA 2B52A 2FSMX 3FQEA 4O7TA 3DXQA 4ZMEA 4GU9A 5HCZA 3PA4A 3UVRA 4AP7A 3RNIA 5KX8A 4FMQA 4UALA 3RM7A 3RPSA 5TF9A 4O0RA 4TNDA 3KMUA 3MY0A 3ZXZA 4O7WA 4I21A 3OT8A 5DE2A 4M66A 4BDIA 4BZNA 2ZMCA 4DLIA 3E5AA 3EKKA 2QOFA 4FIGA 3MS9A 3QYZA 4PTGA 3UC4A 5HOAA 5FDPA 3FZOA 2QU5A 5I9WA 4C4GA 2CMWA 3HA6A 3R01A 2HY81 2YWPA 3A7JA 2CN5A 4A9UA 3KRLA 5FEQA 3FKNA 3VULA 1FINA 2QO9A 3VBQA 2OO8X 4O0TA 5IH4A 4IWPA 2QHNA 1Q61A 4C4HA 4QMWA 4CFNA 4CNHA 2HW7A 4CFVA 4FI1A 4XHKB 4Q9ZA 1H1SA 3BHVA 3CGOA 2G2HA 4JR7A 5HG9A 4J96A 3IG7A 4FSMA 5TOZA 2GSFA 1R0EA 2ZM1A 1PHKA 1ZMVA 3BYUA 3DK3A 3UO6A 5CAOA 4CMOA 3DOGA 3NUPA 4I6QA 3LFFA 4I6HA 3VS7A 3FYJX 1ZZLA 2W5BA 3AC5A 4QMZA 3UTOA 4FK6A 3CP9A 2CLXA 3F3TA 4C02A 3C4WA 4XX9A 3C13A 3P08A 4G3DA 4KABA 3ZFXA 3E3PA 2W99B 4RX5A 4GUBA 4D4SA 5M07A 4PL3A 1OUYA 4LQMA 2J0MB 2HWOA 2BDWA 2BAQA 2ZOQA 3DJ5A 3BQCA 4MEDA 3VUIA 4E5BA 4WNMA 5M57A 4RIOA 4YJTA 4ASDA 2XJ2A 3G90X 3C4XA 5JQ5A 4WD5A 1DAYA 3R1QA 1OIQA 4PMMA 2R3GA 2YCFA 4E7WA 3SAYA 3FLZA 4D2VA 3IW8A 3AC1A 4GT5A 3QTUA 5AAFA 4QPAA 4YSJA 2B55A 1DI9A 5HKMA 3EFKA 5ANEA 3RAWA 3P1AA 4EH2A 2R4BA 3ZSHA 4B0GA 5J79A 3MV5A 2YJSA 2B9IA 1IEPA 1PXOA 3P0MA 4F0IA 4A4OA 2W1DA 2ZV8A 3O2MA 3OW4A 3SDJA 3TNIA 3HL7A 4FIFA 2GNGA 4ZTSA 4KKEA 1IAHA 3PPZA 4JDJA 4KNBA 3LLTA 4O7ZA 4JNWA 3OTUA 4G9RA 2YJRA 3WF8A 5JT2A 3EN9A 4MD9E 3K5VA 5BVOA 4FEVA 2C3LA 2RG6A 3GOPA 4YTFA 4S31A 2GS2A 4AE9A 5ACKA 4L7SA 1XR1A 2UZBA 4BGHA 3A7IA 3KF7A 1OZ1A 2WFYA 5ETCA 3C1XA 5EYMA 4IWQA 2HWPA 4ID7A 4RVKA 5L2TA 4L46A 4FNWA 4O0YA 4BZOA 5CAVA 4BCOA 3QKLA 5CU6A 4U42A 4CZTA 4GFOA 4G5JA 4NCTA 3I6UA 5A6OA 4XMOA 2ZYBA 3E8CA 3OY1A 3L9MA 3R1YA 4UB7A 3CGFA 4J95A 4TYHB 3N4VA 4R3PA 1ZOGA 1G5SA 1OKZA 3FLQA 2OU7A 3D5WA 3NUXA 4R3CA 3ORLA 4A4XA 2CCIA 3L8SA 4LOOA 4IADA 4MNFA 2RSVA 3JVSA 4HCUA 4U7ZA 3AD4A 1PYXA 1UNHA 4G9CA 4J7BA 4DH5A 3OF0A 4IX4A 4L7FA 5HD7A 3HMNA 5HTCA 4DG3E 3MFSA 3CCNA 3Q9WA 1WVYA 3TCPA 4FV6A 3WOWA 5L8LA 3A61A 5HHWA 2Z7SA 3H3CA 2EVAA 5EDRA 4CYIA 1Y6AA 1OPLA 4AGUA 4BCNA 4CMUA 1DI8A 2J9MA 5FBNC 1YXVA 1XJDA 2YISA 3O7LB 1XBBA 4L67A 4KWPA 1UU8A 4TT7A 3T9IA 4CFWA 4D2PA 3R7GA 2C3KA 5AIRA 3SRVB 3CTHA 2V55A 4ANNA 1K2PA 4D4RA 3TUCA 1IAJA 3HP5A 1PRYA 5E9EA 4GU6A 5AWMA 4YU2A 3I7CA 4NZWB 4U40A 2XK8A 5IMEA 3RCJA 1YVJA 2UUEA 4AACA 2WQOA 4FZFB 1PJKA 5DEYA 4G1WA 2J6MA 4ZAUA 4Y46A 3ZRMA 5JSMA 5IA4A 3MA3A 4GL9A 3R04A 2WEVA 2FO0A 4BYIA 3PJCA 3OUKA 3RAHA 4BDBA 2O8YA 1L8TA 1Q3WA 3FY2A 4JIAA 2HELA 5KMJA 1YDRE 4HCTA 4QYEA 3AMAA 4XG4A 3WF6A 3OBGA 4AA4A 2JGZA 1H4LA 2XIKA 3BLHA 4BI1A 4N6ZA 3LJ1A 4OTIA 4N70A 5FGKA 3UVPA 5HD4A 4EH4A 4RG0A 2WTIA 3S95A 3DBCA 5JFVA 1G8SA 4MKCA 4V04A 3IECA 4GG7A 3W2OA 5HORA 2OFUA 3SLSA 2XM9A 2P55A 3H10A 3U8WA 3TN8A 5A4LA 1YI4A 3K54A 3O23A 3MSSA 3ORXA 4XLIA 3QCYA 4PL5A 4D1SA 1H27A 1FOTA 3RK7A 4LM5A 4UZDA 4FSWA 4OTHA 4GUEA 1QMZA 4GK2A 5FXRA 3V8WA 3PY3A 4RWJA 3DQWA 3FMJA 4JBOA 3Q4ZA 4JOAA 2V7OA 2RKUA 5D12A 3Q2JA 3PXKA 2XNGA 1OITA 2BKZA 3BGZA 4QP7A 4EHVA 3DK6A 4LGGA 4L9IA 3DBQA 4FSRA 4I0RA 5CF5A 5LQFA 3N4TA 3MYGA 2OW3A 4NUSA 5CVFA 2J2IB 3DTWA 4MXZA 3FBVA 5DIAA 5AP0A 3FI4A 2VTLA 4AGWA 2WOUA 4EH6A 4AW1A 4KRDA 3EQFA 5BVDA 2XNEA 3KRJA 3MI9A 3BE2A 5FEEA 3SV0A 2V7AA 5AUUA 3IW5A 2F7ZE 4ERKA 5CZHA 2YIRA 4GMYA 4YZBA 3FHRA 4ZJVA 4IQ6A 1M2RA 2YCQA 3QTRA 4HVGA 5L2WA 3UQCA 3ORZA 4MQ2A 3I0QA 5GZ8A 1XQZA 4G6OA 5ETAA 1Q8YA 2JAMA 2WXVA 3NNVA 4Q9SA 3ACJA 2W1HA 3GENA 4B4LA 3C0GA 4NM7A 2ETKA 3QGWA 5EH0A 2PZRA 2RFEA 5IF1A 3HV7A 2XNPA 3I6WA 3Q96A 3HV3A 2ZB0A 4JQEA 4RFMA 3MH1A 5CEOA 1RQQA 4CYJA 3HVCA 3O96A 3EL8A 1YRPA 3PE2A 5LVLA 1ZMWA 5FXQA 4PP9A 3QCSA 1LEZA 2PVKA 1PKGA 3S00A 5LMBA 2P2HA 4YJPA 1OMWA 2IVSA 3F5PA 3UOJA 5AUWA 5CEPA 5BUEA 3M11A 3IDCA 5HVYA 3TI1A 3E8NA 3ULIA 2GNLA 2PUIA 3OT3A 2YM8A 3QFVA 2X2LA 4PPAA 1U59A 2FSLX 2UZOA 1Q3DA 2JKMA 4PP7A 3PY0A 2ONLC 5CQUA 5AAGA 4NW6A 4NM5A 5A4EA 4G6NA 5AR3A 5JQ8A 5HU9A 4UX9A 1RW8A 4X0MA 3DY7A 4V0GA 4DGNA 3Q4TA 4DBNA 4FVRA 3A62A 5EFQA 1QPDA 3W55A 4GSBA 1PW2A 2XF0A 2OH0E 3QD4A 3LQ5A 4FT5A 4W9XA 3L8XA 5HBJA 4OW8A 2XA4A 4TTHB 3EWHA 4CGAA 3FZRA 3NEWA 1FGIA 4C8BA 3DT1A 2R3PA 4J71A 5GHVA 4RZVA 3VRZA 1FQ1B 1UV5A 2WGJA 1OIUA 5A14A 3LE6A 4OR5A 1ERKA 3UE4A 4EQMA 1E1VA 3G6HA 2A27A 4P5ZA 3DZOA 4FYOA 5CI7A 2YM7A 3TNPC 5GJDA 1GJOA 3PFQA 1SZMA 4CRLA 3FZSA 4BCIA 5C1QB 1J3HA 3RWPA 2C0TA 4FX3A 4BB4A 4QP6A 3TWJA 4I5MA 2WTWA 4IZ5A 3PVBA 3KREA 5J9LA 4QO9A 3OOMA 3PWYA 4L45A 3R9OA 4YUQA 3H9OA 4AWIA 1JPAA 1MRUA 1Y57A 2YDJA 3CY2A 4IB5A 1Q8ZA 3GT8A 1APME 4A06A 5HEZA 2XCKA 1V1KA 2I0VA 1URWA 2YHVA 4JL9A 2OF2A 5JGAA 3NW5A 3RPVA 4EHZA 2GNJA 4WA9A 2VWBA 4O6LA 3QA0A 4D1ZA 3A8WA 4D5HA 1WAKA 3EIDA 5JMSA 2ZM3A 3JXWA 1E1XA 4TWPA 1GOLA 1VZOA 2PZ5A 3PJ1A 4JDKA 3FLNC 3MPAA 4RWKA 1BYGA 4NCTC 2IZSA 5CU4A 4C58A 4E6DA 4K0YA 3TIYA 3JUHA 1JQHA 4EBVA 1NA7A 2XS0A 4EZ7A 3PG1A 4PPCA 4WBOA 3VBXA 2C1BA 3O17A 3CD8A 4RSSA 1A06A 1XH4A 3LFQA 1MQ4A 3VUMA 4AN2A 5CANA 2OXDA 4XP3A 1XBCA 3UODA 2R3FA 4AT5A 4O0VA 4E1ZA 3P4KA 5LVNA 4APCA 3ATSA 4L68A 2Y6MA 1ZRZA 1ZY5A 3A4PA 1Z5MA 4YJUA 5KMKA 3SKCA 3PXQA 1HCLA 2JIUA 4MXYA 3S2PA 5I9YA 3CEKA 3F5GA 3H30A 5F20A 4TKSA 1Q62A 4IFGA 4O21A 2J0IA 3UBDA 3CKXA 4ZSAA 4J99A 5ANIA 4K8AA 4HYSA 3QUDA 2I0HA 3UPZA 4S34A 3A2CA 4UWCA 4KAOA 2XIRA 3ZDUA 2IZRA 3ZLXA 4RZWA 4O82A 3R9RA 3WZDA 5CXHA 4H3PA 1U54B 3SXRA 4P7EA 5FQDC 4QTEA 3GC0A 4KIPA 4YHTA 3R7UA 3ZC5A 4P90A 4E4XA 3HP2A 5LWNA 4NJDA 1PYEA 3ORIA 4XCUA 4B8LA 5I9ZA 3QHWA 4FVQA 2YLFA 2OFVA 4IX6A 4NKSA 2C0IA 3D7ZA 2VO0A 4O2PA 2J0JA 4U9AA 5J5SA 4FIHA 3TNHA 3FPMA 3ITZA 1H00A 3M2WA 2GDOA 3EYGA 3PJ3A 3C7QA 3GOKA 5CENA 3KL8A 4B7TA 4PMPA 2BZIB 4F9YA 1OIYA 3TKIA 3REPA 1QPEA 1DM2A 3KXMA 5LJJA 2WZJA 4X2GA 3GEQA 4JX3A 1TQPA 4KKGA 5HO7A 3COIA 1KOBA 4X2JA 4LYNA 5IQCA 4ZOGA 4EOQA 3FPQA 3PJ2A 3ZLSA 3LCDA 3HV4A 5AADA 4QMOA 4EWHA 2H6DA 1BMKA 4HZRA 3VS0A 3ZBFA 4N57A 5HGIA 5AP5A 3DLSA 2VO3A 2RFSA 3ET7A 4DT9A 1BL6A 3EZRA 4QNAA 4MBJA 1PMVA 4UZHA 4OT5A 4R7IA 1KSWA 5FM2A 4B6LA 3DV3A 3FZPA 1OL7A 4DFZE 4BFMA 1OL6A 4WKQA 2JFMA 4RIYA 2WTVA 5C8NA 3TV4A 5IA0A 1ZYLA 2UZLA 4PL4A 4IANA 4ZJIA 5M4IA 3DKCA 3D7TB 5LCKA 2G2IA 5AJQA 3OEFX 3NNUA 4JQ8A 4C34A 2JKOA 3UZRA 5L6WL 4S32A 4ALVA 5CEQA 4BHNA 3E8DA 4ZLYA 1J7LA 1W82A 4ITHA 5JZJA 1CDKA 3I60A 4MXCA 3WILA 4BRXA 3EOCA 4UXLA 3HAVA 3GI3A 2FGIA 3E93A 4O22A 5KZIA 3K2LA 3TJDA 5DBXA 4DHFA 5M51A 4F9WA 4K1BA 4CFUA 2VTTA 1WFCA 3AGMA 5J9YA 2X8IA 5HI2A 2OJGA 3OFMA 3A7GA 3TEIA 3MY1A 4YTCA 4NTTA 4H58A 3IGOA 3MTLA 4EQUA 3P78A 4JJRA 5KBQA 1T45A 2OH4A 4KB8A 3NUAA 4LMUA 2PPQA 2VX3A 3W32A 2C47A 3DU8A 3SXSA 3CKWA 1FPUA 1R78A 2R3RA 4DBXA 4IX5A 2C30A 4BC6A 4OTGA 2C5YA 5DFPA 3PJ8A 3UG2A 3VUTA 3KXNA 2VAGA 2RGPA 4QQTA 4NTSA 2YFXA 1Y91A 3H0YA 4TYEA 5LWMA 3FLYA 5J9ZA 4NT4A 4PY1A 3UO4A 4ZXTA 4W8DA 2KULA 2YITA 3FE3A 3BLRA 1NVRA 3EB0A 5CTPA 3R6XA 5E8ZA 3TDWA 1Y8YA 4DN5A 4IAIA 3EH9A 4HYUA 2UW6A 5FWKK 3ZCLA 1JVPP 5E1SA 1RDQE 3QQHA 4BBMA 4D2WA 2B9JA 2QOQA 2W1ZA 4JDIA 3UOKA 1J7IA 3DK7A 2BZKB 3OWJA 2XK7A 4FTUA 5EHOA 5F9EA 4CXAA 3KRWA 3D83A 3U9NA 3ATTA 3WBLA 2UZUE 1QPCA 1T46A 3BGQA 4I93A 5ETFA 2E9NA 3ROCA 2X8EA 3VJNA 5DR9A 4F64A 1IA8A 4GIHA 3A60A 3DAJA 3FV8A 4FVPA 4D9TA 5CAUA 1CMKE 3UNZA 4I41A 3CR0A 4GK3A 5TE0A 2VWUA 1JOWB 4BTMA 3MB6A 1W8CA 2X9EA 4EOJA 4EK3A 4AF3A 4QMMA 2W96B 2XKFA 3W18A 4ACHA 2VTJA 1FVVA 2ITVA 3FKLA 4XRLA 2OK1A 1WCCA 3FC1X 3QD0A 4RFZA 1YDSE 2VTMA 4EOOA 3AC4A 5GIOE 4WG4A 4M0ZA 5FDXA 3VO3A 3NAYA 2IPXA 5JZNA 3QC9A 1ZWSA 4A4LA 4QMNA 3OC1A 3V51A 2PU8A 1KE7A 4TYIA 3F2AA 4XV2A 5L3AA 5D9HA 2OIDA 4WO5A 4M13A 4FE2A 4FEUA 2GMXA 3TNWA 2WTKC 3HRBA 4CMTA 3ID6C 4X6RA 1PXKA 3LXKA 4YC3A 4EKKA 4KUJA 3P5KA 3E7OA 3MB7A 3P7AA 3MFTA 5AIKA 2VO7A 2OIQA 3RALA 4U81A 5TO8A 3HYHA 1WMKA 4IE9A 1M14A 4QYHA 5EK7A 5F95A 3OD6X 3JR1A 3BIZA 2DYLA 3HEGA 4W4XA 4YBKA 5T3QA 4J8MA 4DITA 4IAZA 4IM2A 4F1MA 2NPQA 3QD3A 3DS6A 2X7FA 5L4QA 2DS1A 3TZ8A 2JBOA 5IUIA 3IW7A 4RIWA 4YHJA 3BPRA 4NWMA 4RJ7A 1CTPE 2CGVA 1MP8A 2R2PA 2W1IA 5JRQA 4CSVA 3EL7A 4Y5HA 5HG8A 3JY0A 3VQUA 3O71A 3UDBA 4FKUA 3D5UA 4IZ7A 3EKNA 3ZFYA 4R78A 4F7JA 3R71A 2QOBA 4XNEA 1HOWA 2HXLA 3PLAE 3DBEA 4FKTA 3VC4A 4AZTA 4EH5A 4IEBA 1M17A 4QP4A 5IUHA 3JVRA 4FKJA 4M69A 4O96A 3O8UA 2XYNA 2OG8A 4WNKA 1Q4LA 4DEGA 5KMLA 2PL0A 2HW6A 4CTBA 4GVJA 5C27A 1ZOEA 2PTKA 1YXXA 3E7VA 4FV9A 2QD9A 5LVOA 3AC3A 2PWLA 5AV3A 5CF6A 4F7LA 4USDA 4H05A 3KEXA 4CFXA 4IX3A 4DGMA 3PVGA 3RVGA 1NT2A 2BRGA 4YNOA 3GU5A 3DDPA 4C4EA 4I20A 3H9FA 2JKKA 3R7VA 4YZMA 1H28A 1XWSA 3HMPA 4FOBA 2ZB1A 1H1RA 1LUFA 1WVXA 3QD2B 4I94A 3U6JA 3F66A 2HXQA 5AX3A 1UU7A 4FOCA 4XRJA 2R3MA 5J7HA 4CEGA 4CCUA 4G34A 4CKIA 2BIYA 2WTDA 1Q41A 2WIPA 4RQKA 4NYEA 1PY5A 3HMIA 2X8DA 2WQEA 3LIJA 4YJVA 3TV6A 1GNGA 2YWVA 1UA2A 5A3XA 4FKIA 3LFCA 1OL5A 3GP0A 3W10A 4YURA 3EN5A 1SM2A 2O64A 2YAKA 1JKLA 2I40A 4BWKA 4D0XA 2UVXA 4YMJA 5IG1A 2NP8A 2QNJA 2O0UA 3Q52A 4GCJA 4G31A 1SNUA 4GG5A 1GZ8A 2XKDA 4GW8A 4MWIA 5E92A 3R28A 3UIMA 3SRVA 5A9UA 3L8VA 3D4QA 3F3WA 4G17A 2YA9A 4BCPA 3AMBA 5EG3A 5E8UA 2QOKA 3AD6A 4ORKA 1WZYA 3EQRA 4PTCA 3FXXA 3BWFA 4Z7GA 3R2BA 4XBUA 5CNNA 3ZRKA 3IDBA 3FHIA 4FT7A 4ZTHA 2LGCA 2GCDA 3DDQA 3DFAA 3UMXA 4M15A 4BY9E 4IAKA 4BWPA 4BBFA 2W5HA 3CPCA 3AD5A 2H8HA 2O65A 4JI9A 2CKPA 1H8FA 4IHPA 4ACDA 4AT4A 3QKMA 3QZIA 4AW5A 3V6RA 2OSCA 5HLNA 3OUNB 3TNQB 3ZZEA 4CKRA 4AZFA 1PMEA 3QUEA 5CSVA 4EOIA 3Q04A 3TUBA 3ZFMA 4F7NA 3QXPA 4Q5HA 3HX4A 2BR1A 3RAIA 5KKRC 2HCKA 2ZAZA 4R5YA 4LFIA 5H8GA 2WHBA 4IVBA 4EORA 4R77A 4RJ8A 2A2AA 2JITA 3BYVA 2ONLA 5AR4A 4ZLOA 1FGKA 1LR4A 4B9DA 4XS2A 3ZEPA 4GH2A 4QD6A 2NRUA 4ZTLA 1MRYA 4YR8A 2YIWA 2YN8A 3BBWA 3R9HA 3SOCA 1KUTA 1QCFA 2YM4A 3UMWA 1JKSA 3VHEA 1YI3A 2X6EA 3E92A 2IW9A 5HTIA 3ZUTA 3LCKA 2JDOA 3NWWA 1DAWA 4UMUA 2EB2A 4FODA 1WBTA 3DXNA 3FSFA 2XBJA 1YDTE 4KBCA 4CFMA 2CGXA 3V01A 4F9BA 4HNFA 2J51A 2WO6A 3CXWA 3QX2A 3GUBA 3KFAA 3DNDA 1KV2A 4BCJA 4E4NA 4E5AX 5M44A 4I5HA 3R8PA 4M0YA 3NPCA 3D2KA 5BNJA 3NVKI 3VS3A 2PVYA 4S30A 3QRUA 2XH5A 4TN6A 5AUYA 4E73A 2R3IA 2PSQA 1P5EA 3C51A 3IOPA 3G15A 3FY0A 3DKOA 1AD5A 3H4JA 2PE0A 5DLSA 3EN4A 3N4UA 4F0FA 5LOHA 3IK3A 4C4IA 4BDGA 3BU3A 2BILB 4ERWA 4GYIA 1H1WA 2Z02A 2BPMA 2X7GA 4UWBA 3R7IA 2JFLA 4EOMA 4I6FA 3LZBA 1O6YA 4FL1A 4YP8A 2QLQA 1WBNA 4JG8A 4K9YA 3D5VA 2IJMA 5GJFA 5C26A 2YIQA 3OVVA 4QPSA 4FTIA 4IW0A 3C5IA 2WMTA 3QQKA 4OBQA 3AMYA 2WMWA 4CV8A 5IA2A 3U6IA 4MHAA 3VVHA 5ANKA 3SG9A 4KKHA 4X2KA 2W4OA 4ASEA 5JK3A 2YDIA 4DINA 5K5XA 4BCMA 4ZZOA 3NDMA 2Y4IC 2CLQA 2O5KA 3GCVA 4A9RA 4QTCA 2OLCA 2ITPA 4H1MA 1KE8A 3O8PA 4G3GA 4LI5A 3RK5A 1GIJA 1H24A 2W1FA 4FL2A 4WSYA 4ARKA 3UQFA 5FXSA 5AP6A 4DG2E 4FTQA 3VRYA 3QCXA 5IQEA 3TZ7A 4AG8A 5J95A 4CTCA 4EHEA 5E90A 3OTVA 2VU3A 3HLLA 3RP9A 3TKUA 3S4QA 5KMNA 3ZC6A 4D1XA 4JX7A 3W2QA 3CQUA 4AA5A 4DGGA 4I0TA 1YXTA 3NCZA 4I23A 4I24A 1GZKA 3E87A 2V5QA 3F3ZA 3FUPA 4ZZNA 5IEYA 2UW5A 3OROA 4BDJA 4U79A 2B53A 2QU6A 2UVYA 4JBVA 4PDOA 5M56A 3R7YA 3MH2A 4ZTNA 4G3EA 4LRJA 2J5EA 2R0UA 3DFCB 5AR7A 4HGLA 5HNIX 2W06A 3LCSA 2WMXA 4H3QA 3VS4A 1FMOE 5ITAA 2X6DA 4RJ6A 4FT9A 4TNBA 5E8VA 5KMIA 3O51A 3NVMB 4HPUE 1BL7A 1XO2B 3QZGA 4PTEA 2JAVA 3PY1A 4XV9A 2Z7QA 1LPUA 5H8BA 2PUPA 3R00A 4U45A 3FMDA 4KD1A 4DEIA 5HVKA 4FUXA 4EJNA 3CD3A 2IN6A 5IQFA 3F5UA 2IVUA 3TT0A 4I5CA 5EI6A 5C8KA 4FTLA 2YDKA 3TACA 3U87A 4AN9A 1P4FA 3KC3A 3EQBA 3FL4A 3QQUA 4PF4A 5HBEA 5F94A 3KKVA 2ETMA 2F2UA 2QI8A 2XEZA 4K18A 4NFNA 4QMUA 3T9TA 4EOPA 4O7SA 3P7CA 4L44A 2VWIA 2IZUA 3UOHA 4F7SA 2H9VA 3IDPA 4BHZA 3UYTA 4RMZA 1R1WA 4N0SA 5AUZA 3L1SA 4PPBA 4TWCA 4ACGA 4AN3A 4D4YA 1UU3A 2FYSA 5HLWA 4IAFA 5HX8A 3FEGA 1H26A 2OJFE 4K6ZA 1H01A 2QOHA 3IS5A 2VRXA 4FICA 3MVJA 4X7QA 4UMQA 2PUUA 3ZSGA 2HZ4A 2YERA 4TWNA 2PHKA 3VBTA 1YQJA 4UMTA 5CASA 2WMQA 3PXZA 3WARA 3RKBA 4AFEA 3KMMA 3BU6A 4U3ZA 2PVLA 2YM3A 4RX9A 3HDMA 5CVGA 3TG1A 5M4FA 2C5NA 1CM8A 4CG9A 5ANJA 5DPVA 5LMKA 2R7BA 4F65A 5JN2A 2H34A 1M2PA 4HGTA 4II5A 4JBPA 4NM0A 5E91A 5HESA 5H9BA 3S0OA 1ZAOA 3QL8A 1PXJA 4O7NA 4MCVA 4XG7A 1YKRA 2QR7A 1LP4A 1PF8A 3VQHA 2UW4A 3CY3A 3TV7A 5J5TA 5D7AA 2X9FA 3A7FA 3V5TA 3LXPA 1ZXEA 3PSBA 2JIVA 4XLVA 4EUUA 3GU7A 4ALUA 3UJGA 3EQIA 1FVTA 3DB8A 4QYFA 4HGEA 2Y6OA 5G6VA 1A9UA 2JKQA 3HMMA 4JRVA 4U97A 1J91A 3BYOA 4YZCA 4NW5A 2QVSE 3BZ3A 3AT4A 4JVGA 4Y8DA 4XBRA 5AV2A 4AZVA 3PIXA 1YHWA 3QTQA 4WUAA 5HCYA 5GZAA 4A07A 5DNRA 4EL9A 2BRNA 2BFXA 4JIKA 4MNEA 1IR3A 5LVMA 4UBAA 4LL0A 3I79A 4BI2A 3V5PA 4KRCA 3CIKA 2GFCA 2WEIA 4FZAB 5DA3A 4DEDA 4NL0A 3NUYA 4WG5A 3FXWA 2W4KA 3SVVA 2F9GA 4IVDA 5CEMA 3HUCA 3TUDA 3GU8A 4PDSA 2UW9A 4JQ7A 4KSQA 3UNKA 4YZNA 3GCSA 2B9HA 3TM0A 1UKHA 4W4YA 5EYDA 4FEXA 3BWJA 1OKWA 4RIXA 3T3VA 5FEDA 3RBWA 5KO1A 4ENXA 2C6IA 3WI6A 3R8ZA 4MQ1A 3R21A 2VNWA 3B2WA 3NLBA 4ZLZA 5M08A 3U55A 4TYGA 4GVAA 3NUSA 3QTSA 3K5UA 5DWRA 1BLXA 3E88A 4EK6A 2CNUA 1V0OA 2P4IA 3ZM4A 3OCGA 5IQGA 4L53A 3BRBA 4X2NA 3AG9A 3FYKX 3D7TA 2YAAA 4BIEA 2V0DA 2CDZA 1ZY4A 1KWPA 1Q97A 3LFAA 4W4WA 3BEAA 5IPJA 1R39A 2XEYA 5C4LA 5DI1A 3P23A 4OAVB 4C2WA 5M09A 1PXIA 3QRKA 4BWXA 3DXPA 3G9LX 5AP4A 1J7UA 2QOCA 4C35A 2R7IA 3V5QA 1QPJA 1YWRA 1ATPE 4WT6A 5ACBC 3A99A 4WNOA 3UG1A 4E4MA 3BCEA 3EQDA 5D7VA 2BTSA 4RJ3A 3CC6A 2CN8A 3RHXA 2FA2A 5JGBA 2OGVA 4FT0A 4DYMA 4F08A 3UIBA 4DA5A 3ZLYA 1EH4A 5DH3A 2C5VA 3L9PA 4ZK5A 3RMFA 5HO8A 2ZV2A 4J1RA 4RA5A 1XH8A 5HE2A 4L6QA 4FSTA 2OZOA 4FTCA 2J5FA 3RINA 4IC8A 4CVAA 2OF4A 4I5PA 3W2CA 4F9CA 2VTSA 4N6YA 5HNGA 3PA3A 4D2TA 4DFBA 5BVFA 3T8OA 2XVDA 4I1ZA 5I9XA 5AUXA 3W16A 3ELJA 4BTFA 4R1YA 4EK5A 3F3UA 4Z55A 3I7BA 5GINE 2IG7A 2BRMA 1P2AA 3QU0A 4KSPA 3Q9YA 4H39A 4QPMA 5AEPA 4OBOA 2UZEA 5AP7A 4HOKA 3D2IA 4FG9A 4KIKA 3H0ZA 2J4ZA 3NYOA 5IQDA 4BYJA 5TR6A 4NKAA 2YCSA 3UP7A 2W9FB 3GCQA 2G9XA 4NU1A 4FTKA 4EZ3A 5IQIA 3HV6A 4ZY5A 2Y9QA 4C3FA 1OPJA 2C6LA 4ANOA 3FI8A 4FKRA 4AX8A 4ZSLA 3IW6A 2AC5A 4QQJA 5BMSA 1U5QA 1GZOA 2UZWE 3BGPA 2Z7RA 2V62A 3C4EA
chains in the Genus database with same CATH superfamily
2A0CX 4KS7A 4QNYA 1W2FA 4ZP5A 3FJQE 4YLKA 4EQCA 3Q3BA 5CALA 3R8UA 4X3JA 5A6NA 2X0OA 2GTNA 2XK6A 3GFEA 3PDTA 3FDNA 2XRUA 4AZSA 4MBIA 2WMBA 4AE6A 2UV2A 3B8QA 3TTJA 4HVIA 2XIXA 3EJ1A 5E8XA 4EC8A 2C5OA 3UO5A 5K3YA 4IB1A 2OZAA 4MF1A 4C37A 4YC8A 5E8SA 4MAOA 4QDVA 5HU3A 4TW9A 3N9XA 2QCSA 1YXUA 3MJ1A 4FYNA 4JT3A 4ANLA 2GS7A 5BV3A 4CV9A 4QMQA 2ITQA 5A4TA 3GU4A 5K4IA 5FP5A 4QDEA 5CAQA 4PWNA 1Y8GA 3QGYA 3JPVA 2HZ0A 5T6KA 1CSNA 5HE3A 2R64A 4PMTA 2ETRA 1KE5A 3RZFA 2BRHA 3ZZWA 5DT0A 4CT2A 4YJOA 4LRKA 1UU9A 3LHJA 1OVEA 4DEEA 2QOOA 2EXCX 3AC2A 3ULZA 4LV8A 5HG5A 1NY3A 2XBAA 3WF9A 3E62A 4CCBA 3OXZA 5CLPA 3PYYA 5F4NA 4AA0A 5JGDA 3HUBA 3VBYA 4AGDA 2I6LA 1PXMA 3HV5A 3LFDA 5I9UA 2J0KA 3UZPA 4F09A 2XMYA 4LUDA 2C68A 2QC6A 3GGFA 3ALNA 3PG3A 4RX7A 2PY3A 4PDPA 1JBPE 3GCUA 3C4FA 4WUNA 5AP2A 5HTBA 5CAPA 2WQMA 3GC7A 1BKXA 5I0BA 4USFA 5HNBA 4O84A 2PE1A 3HKOA 4PDYA 4OAUC 3OEZA 5CX9A 3TDVA 4A9TA 3MPTA 5LMKC 3FI3A 1XMMA 4FZ6A 4CRSA 4Z16A 3DKGA 3VS2A 4C57A 3Q4UA 2X2KA 5CF4A 3GC8A 5DMZA 3I0OA 4DF3A 1WBSA 3ZU7A 2HYYA 1AGWA 4X3FA 4CFFA 3TL8A 2UVZA 3G5DA 2E9PA 1KE9A 3VW8A 4BTJA 4E26A 1MUOA 2YZAA 5BYYA 4FTMA 4QYYA 4B99A 3MTFA 3JS2A 2VN9A 3MGYA 5JKGA 3G2FA 3WIGA 4KBAA 4I22A 2YEXA 4QMPA 4FEQA 4LUEA 2WTKB 2OWBA 3O5AA 2XAOA 3TTIA 4NIFA 4FV8A 2W7XA 2B7AA 1P14A 5M53A 4U6RA 4MF0A 4BF2A 5ICPA 5IA5A 1M52A 4U80A 2UZNA 3PPJA 1SVHA 5HE0A 2BFYA 1X8BA 2YCRA 3CJFA 4LGHA 4QMVA 3UYSA 2EXMA 2UZTA 4AUAA 3HAMA 4ZEGA 3D5XA 2FSTX 3G33A 3ZTXA 1REJA 3QYWA 3FMHA 1NVSA 4DAWA 3PSDA 4XEYA 5E8TA 2FVDA 3E63A 1JKTA 3OXIA 4F63A 1ZYSA 3AQVA 1Q8TA 3E3BX 1YXSA 2P2IA 1W0XC 5E7RA 4TWOA 3Q60A 5HLPA 3OWKA 2VWXA 1SYKA 3AGLA 5CY3A 5AFVA 3MWUA 3MA6A 5EQEA 3W0MA 5IDPA 4ZTRA 3I1AA 2IZTA 4ONAA 3PRIA 1XHAA 4J53A 1ZARA 4I4FA 1XH9A 2I1MA 5ANOA 1Q5KA 4CG8A 3NFGB 3LPBA 4LOPA 4GT4A 3QTXA 2X39A 1OM1A 3ETAA 3HMOA 4L00A 4HYHA 3DZQA 1RE8A 4F70A 5LXMA 4E4LA 3W2SA 3GVUA 3ZOSA 3A4OX 3L9LA 4FV7A 2CKQA 2OXXA 2BZHB 3CBLA 3LMGA 5AUTA 2HK5A 2WIHA 3UVQA 4FNXA 5I9VA 3F6XA 4QQCA 5ANDA 1Z57A 4U0IA 4D2SA 2F2CB 4BVUA 4DFLA 4E20A 2R3HA 5KUPA 2XZSA 4R1VA 4OTPA 1BI7A 1HCKA 2PE2A 3IKAA 3PUPA 4YLJA 4DFXE 4FTOA 3GFWA 3PVUA 3MDYA 2W9ZB 3RPYA 3I5NA 3UIXA 1TQMA 4IJ9A 4DCEA 4Y72A 1M2QA 2EB3A 3T3UA 5EM8A 3PP0A 4QEBA 5BYLA 5CVHA 5IQHA 5KZ0A 2AYPA 1WBPA 1OBGA 2BCJA 1YHSA 1PXLA 1BX6A 4RX8A 4IIRA 2Y0AA 1TKIA 4KBKA 4RC2A 2ZDUA 3POZA 4ITIA 4BKJA 2G15A 2HENA 3QTIA 2QKWB 3PP1A 5ETIA 4H36A 4PUZA 4YC6A 4DHZA 4BCGA 4R5SA 2ZMDA 3CJGA 2XNOA 3GQIA 3R73A 5K0KA 3QQJA 3SW4A 3ZYAA 4C3PA 2V22A 3EQGA 2Z7LA 4JAIA 2PVNA 3MJ2A 5DT4A 3RGFA 1WBWA 3SA0A 2GHGA 2SRCA 3MN3A 3OCTA 4U8ZA 4AAAA 1V0PA 1ZOHA 2W1EA 1YOJA 1OGYA 1YWVA 5FM3A 1WBOA 4FC0A 2ZV7A 5B2LA 2C6KA 3CE3A 3ORKA 3F2RA 4E5WA 4MD7E 5AV4A 4EI4A 3MFUA 5KBRA 4HJOA 1STCE 4R6VA 4RIYB 5H8EA 4C33A 3NMUF 3A8XA 3ZM9A 5ANGA 5AR5A 4E93A 2BRBA 4IVAA 1H1PA 2XP2A 3D15A 4MD8E 4P2KA 4DCAA 3C4CA 3KXZA 3BQRA 4XV3A 5IH5A 4ANBA 2QONA 5DHJA 4EHGA 5AM6A 4ZSGA 2BHEA 4FG8A 5HQ0A 4FSYA 4E8AA 1ZYCA 4TYHA 3UC3A 1LEWA 2GHMA 4QOXA 3VS1A 3WZEA 3ZUUA 4DFNA 2J7TA 3RCDA 1REKA 5FUTA 2X81A 4GJ2A 4P4CA 4I6LA 2AC3A 2RF9A 1IASA 1M7NA 4LG4A 4BDEA 2NNWB 1H1QA 3QC4A 4XOYA 3CSVA 3QRJA 5L6OA 2ZJWA 2VTHA 3R1NA 4F6SA 4RLKA 2PVFA 2CJMA 2GFSA 1ZYDA 3DJ6A 3O7LD 2C5XA 2JLDA 3FQSA 4FKPA 2X4FA 4BGGA 3W0PA 1TZDA 3G6GA 2BALA 5M4UA 5IQAA 4YJQA 2R3LA 4K77A 3SC1A 3NUUA 4EH3A 5LMAA 3NGAA 3RWQA 3P9JA 5AA8A 2PK9A 4FIIA 4YZ9A 4F4PA 1OB3A 1TVOA 5DR2A 2IW8A 3FMMA 3I81A 4RJ4A 3D0EA 3PZEA 3SD0A 4TYJA 3W0NA 4GKIA 3KN5A 2Q0BA 3MIYA 3PXFA 3C5UA 4O91A 4OLIA 4MUQA 5CU0A 4K2RA 4RWLA 2P0CA 2WD1A 2C1AA 4IB3A 4PX6A 4QMTA 3ANRA 5B2MA 1FBNA 4QMYA 3UP2A 3C9WA 3DCVA 4W9WA 3FSKA 5IH6A 2CPKE 4QP2A 2VNYA 3HECA 4R3RA 5KCVA 3D9VA 4PRJA 2DUVA 3G9NA 5C9CA 2P3GX 4QQ5A 3RAKA 1OL1A 3BBTB 4KIQA 5GNKA 3WF7A 3LXNA 3BU5A 4IAAA 5L8JA 2QG5A 3Q6UA 4L3JA 5TT7A 2IW6A 3O8TA 2ZM4A 4D58A 2EXEA 2YIYA 1I09A 2ACXA 3G51A 3VUHA 2PMNX 5DRBA 3VONA 1E9HA 4A7CA 3ZBXA 2C6TA 4PNIA 2ITYA 4YJRA 4AQCA 4BTKA 3HA8A 4WSQA 3WE8A 4BCFA 2XK9A 3KVWA 4ALWA 3R83A 5K5NA 5M55A 1JSTA 2PUNA 3PFYA 3WZKA 2OIBA 2X7OA 2Y4IB 4O0SA 5B2KA 4ANMA 4AW0A 5BUIA 1OGUA 4JMQA 3NYVA 2PMIA 4FV3A 3DKFA 4OTQA 3TJCA 3BHTA 1UNLA 3VUGA 5GZ9A 2C69A 3LVPA 4I3ZA 4X3FC 3NFFB 3DJ7A 2QR8A 4G3CA 4V01A 5IDNA 3GC9A 3Q5ZA 3R63A 3ANQA 5J8IA 2R3OA 2X2MA 2A19B 4XP0A 3VW6A 3RPRA 5EW9A 3NX8A 4FSZA 3IO7A 2HY0A 1BUHA 4YBJA 4RC3A 4EH9A 3NZ0A 2E2BA 3VUDA 4HW7A 5E4HA 2JDTA 2XUUA 3PTGA 4M7IA 5CSXA 5EW3A 3SXFA 3LMHA 4CQEA 3HRFA 2C4GA 3KGAA 4IFCA 3Q2MA 2Z2WA 4FKVA 4R7HA 2HZNA 4L42A 2ZDTA 3GQLA 5L2SA 2WMSA 3BI6A 4O1PA 3FLSA 4E6QA 4FIEA 2QODA 3SX9A 3TIZA 4WOVA 3V5LA 3AKJA 4JR3A 4G5PA 3UPXA 4XG9A 3UIUA 3JY9A 1JKKA 3WZUA 2VO6A 1UKIA 4GIIA 1H07A 3QQLA 2R3QA 4UWYA 3F5XA 3QUPA 1OUKA 4UYNA 3IOKA 5HIBA 4Y85A 5HVJA 5CYIA 3C0HA 5FLFA 5I5ZA 5D10A 2XNMA 3SHEA 4RIWB 2EWAA 1DS5A 2XIYA 5FBOA 3NUNA 4CKJA 2PMLX 4F1OA 2ZVAA 4M67A 4Q2AA 3V5JA 3UNJA 1XH6A 3S3IA 4UMRA 3QKKA 3HZTA 3ALOA 3FL5A 1CKIA 2XYUA 4MYGA 4MXOA 4TZRA 4QTAA 2P33A 3R22A 2JD5A 3UGCA 3ZMMA 4U43A 1OKVA 3COKA 3OCBA 1GIIA 2GNHA 4BZDA 3NCGA 3D94A 2REIA 4C61A 4CD0A 2XNBA 5CSWA 4RT7A 4GK4A 4M69B 4DGOA 2BDJA 4AT3A 4RVTA 2C0OA 4XYFA 1NW1A 2ITTA 5JFWA 4LGDA 4AZEA 5M4CA 5GIPE 4K11A 4ZS0A 2W4JA 3PA5A 3KRXA 3R8LA 2YABA 4APPA 3DAEA 1B6CB 3PXYA 4KINA 3ZH8A 4FT3A 4Q5EA 3IONA 3ZO3A 4O2ZA 4YTIA 1Q8WA 5LARA 1SVGA 4YGAA 4D55A 4Z7HA 4DGLC 3BYSA 3IW4A 4EKLA 3B2TA 3KIOC 3KULB 5DT3A 4G16A 1U5RA 3UOLA 2GU8A 3KMWA 1G8JA 3GBZA 4WRGA 3QTWA 2VX0A 4GYGA 4LV5A 5DN3A 4RA4A 4TXCA 5TKDA 1QL6A 4QTDA 4QRCA 3P86A 3R1SA 5FTOA 4MH7A 4OTFA 5F1ZA 1XMLA 4DTBA 3ZSIA 2WNTA 1G3NA 3PE1A 2ITNA 2OJ9A 2WMUA 1WBVA 3AT3A 4UY9A 4ZY6A 3ZHPC 1YHVA 2HZIA 2WPAA 4DFUA 2AUHA 4HVDA 2QO7A 4AW2A 2UW3A 4EH7A 3GB2A 5HG7A 3ORPA 2GQRA 3RM6A 5HIEA 1YOMA 3KRRA 3LXLA 2WB8A 2XK3A 3HGKA 5CQWA 3QZHA 1XBAA 4G6LA 2ITWA 2VWZA 4S2ZA 5AAEA 4I0SA 2RFDA 3CQWA 3GU6A 3TXOA 5BPYA 4FBXA 1AQ1A 3QTZA 5FTQA 3NW7A 2F7XE 3MFRA 2E9OA 3KU2A 4YPDA 4C36A 5L8KA 5FTGA 1KOAA 3PIZA 4EUTA 5DGZA 4QP1A 3PZHA 5JFSA 4JLCA 1F5QA 2VX1A 4M97A 1V0BA 2HIWA 3EN6A 4FTAA 1W2CA 4EONA 4Y73A 5AM7A 4B8MA 4ZSEA 4GT3A 3F9NA 2VTAA 3ACKA 2PZIA 4MXXA 3V3VA 4CT1A 2VGOA 4G2FA 3QWKA 4YJSA 5A4QA 2VD5A 3BV3A 4AU8A 2A1AB 1B39A 3BHYA 3RZBA 5HZNA 3MESA 4JDHA 4DEBA 5HO6A 4YHFA 1W98A 4FKSA 4JBQA 4M14A 3FMNA 3OHTA 5BYZA 2NRYA 3AXWA 3RHKA 4D2RA 3KCFA 3W1FA 2G01A 2W5AA 3THBA 4IJPA 3MY5A 3W8LA 2GNIA 1JSVA 4RLLA 4AFJA 5FP6A 3O0GA 3LOKA 5CT0A 3KK9A 1IA9A 4CLJA 3AC8A 3N51A 3VN9A 4BKYA 2WMRA 3FC2A 3OWLA 4FTTA 4ZMFA 4EWQA 4O27B 2B4SB 4C4JA 2OXYA 3EFLA 3E8EA 3QAME 3PLSA 2F49A 3EQHA 5BVKA 5E8WA 3W33A 3A7HA 4DH7A 5J87A 1H08A 5A54A 2XB7A 3L9NA 5BMMA 1PKDA 3VBWA 4ANSA 4EZ5A 2ZV9A 2RL5A 4NM3A 3IPHA 5FD2A 3LM5A 4RVMA 5JH6A 2OJJA 2X4ZA 1JNKA 5EI8A 3W2RA 3EQCA 3ODZX 3NSZA 3KK8A 1NVQA 1W83A 3OXTA 4BICA 3F61A 1XH7A 4DC2A 4BIDA 2OBJA 1YOLA 2GPHA 2VZ6A 2Q83A 4FV2A 4M8TA 4FK3A 5EDQA 3II5A 2B9FA 1U54A 3KVXA 2VWWA 4EOSA 3VS6A 4DT8A 3EFWA 5IMXA 3R8MA 4FA2A 1ZZ2A 3DBDA 5EQYA 4W8EA 3ZO1A 4RWIA 4FGRA 2OICA 3PXRA 3OMVA 3R8VA 3ZLWA 4J97A 4C3RA 4EH8A 3AOXA 4BR3A 5BVWA 3VNTA 4BDCA 1A48A 4EJ7A 3NAXA 2I0YA 5C01A 4AXDA 4JG7A 1ZMUA 5HICA 3BELA 1IG1A 5IISA 4FUYA 5IA3A 4V05A 5L6PA 1H0VA 3FZ1A 4QMXA 5H2UA 5KE0A 2DWBA 4FKWA 3ZONA 4M68A 4O83A 2BAKA 2O3PA 3NYNA 5L2IA 3NYXA 5AR8A 3EFJA 1XKKA 3OS3A 3VUKA 2CNVA 2YIXA 4RQVA 2CHLA 2R3KA 3PIYA 4J8NA 4NH1A 3DNEA 3O50A 3QWJA 5DOSA 4D9UA 2B0QA 4RPVA 3FKOA 4O4DA 4GRBA 5EOBA 3GCPA 3UZTA 3ZDIA 4KIOA 5IA1A 3BV2A 1UWHA 3MVMA 3WYXA 1VR2A 2IVVA 5AMNA 1OPKA 1R3CA 3V5WA 4PV0A 4X21A 2ESMA 4DE4A 4MTAA 2WTJA 5A46A 3NIZA 5CSHA 1NXKA 3FLWA 4GJ3A 4JRNA 4IAYA 1U46A 3QRTA 4M84A 4QMLA 5CNOA 2GHLA 4DLJA 2YLEA 3KXGA 2BMCA 3BKBA 3G0FA 4O6EA 2ITZA 3L8PA 4YPSA 4IDVA 4Y83A 5EYKA 2VTRA 3Q4CA 3KF4A 4YO6A 1RJBA 5L2QA 1ND4A 5IEXA 2G2FA 4Y95A 3VIDA 2VWYA 1ZYJA 3VF8A 5IQBA 3F88A 4QTBA 3MH0A 4BIBA 5BQ0A 2BVAA 4HGSA 4O7VA 5HCXA 3R7OA 2A4LA 3LFSA 3WZJA 3POOA 5EKOA 1TQIA 1G8AA 4BBEA 4S33A 4ACCA 4XP2A 2XM8A 4C7TA 4F0GA 1PMUA 3V8TA 4FG7A 4ENYA 4ZY4A 1OI9A 3VS5A 3AT2A 3K3JA 2X0GA 1KE6A 4OTDA 5EW8A 4GEOA 4GFMA 2Z8CA 4FL3A 3LFNA 4FR4A 3COMA 3K3IA 2FH9A 3JYAA 3QHRA 4D28A 2JEDA 2R0IA 3LCOA 4AZWA 2RIOA 4QP3A 2WELA 4IVCA 3ZO2A 3OCSA 4BDAA 4E3CA 2UW8A 4YNEA 2CSNA 4BDFA 3OW3A 3VWAA 4C62A 4FKLA 4FKOA 1VEBA 2FUMA 2BTRA 4ZSJA 4L8MA 4FTRA 2WTCA 2PZYA 4IWDA 4YLLA 3NIEA 3FI2A 1ZLTA 5CXZA 3DB6A 3TMOA 3LM0A 5DVRA 2W1CA 4BKZA 4C59A 4ZTQA 3WIKA 4BCHA 3ZO4A 5DRDA 2YM5A 2GNFA 3KCKA 4IWOA 1OECA 4IZAA 4YO4A 2XRWA 3OWPA 5J1VA 3KY2A 4AAYA 3FMLA 1PXNA 3CTJA 2O63A 4U41A 4U5JA 2B54A 3RJCA 3W2PA 4HZSA 4C0TA 4BDDA 5IEVA 3F7WA 3P79A 1F3MC 5DG5A 2JBPA 1OL2A 2UW7A 4TL0A 2F4JA 2RFNA 4R7BA 2BROA 4RRVA 3R7EA 3VAPA 1VLRA 5C03A 4FV1A 2VTOA 2Q0NA 3CQEA 3MVLA 1URCA 3BE9A 2BDFA 4RVLA 3Q32A 1VYZA 1OKYA 4HVHA 3LFBA 3U51A 1Q8UA 4Z9LA 5EM7A 4FKQA 4P5QA 4TY1A 2ITOA 1IRKA 3SG8A 2QQ7A 3R02A 3BLQA 2WQBA 1SMHA 5HBHA 3Q53A 1K3AA 1YI6A 4UN0C 5EQPA 4WIHA 2C3JA 3SGCA 4LOQA 4JG6A 4RGJA 2ITXA 3FQHA 4OTWA 5FG8A 4U44A 4EC9A 4U3YA 5EDPA 3PVWA 2VV9A 5JFXA 3RPOA 2HAKA 4F6UA 4DH3A 3QCQA 1S9IA 1MQBA 4IMYA 3MH3A 4IXPA 1JLUE 4FV0A 4W4VA 4JXFA 4EK4A 2XJ1A 4KS8A 4DH1A 4ZJJA 2XAMA 5D11A 4FNYA 2PZPA 2WKMA 3D14A 2QO2A 4G3FA 5AUVA 4Y5QA 2QOLA 1Z9XA 4BDHA 2H96A 1R0PA 3U9CA 2BZJA 3ERKA 3LQ8A 4LV7A 4BCQA 4PQNA 4DTAA 4M3QA 2UW0A 2Y7JA 5C8MA 4C2VA 4MNEB 3GNIB 2GS6A 2YACA 4CZUA 2FB8A 4BN1A 4DFYA 2QG7A 2CKEA 2WU6A 4FSQA 4MK0A 4QMSA 2OI4X 4C38A 3FWQA 4LMNA 2XNNA 1O9UA 3MW1A 2C6DA 2XJ0A 4FZDB 3OZ6A 4IC7A 4IH8A 5CT7A 5I3OA 3ZS5A 1P4OA 4AXAA 3WYYA 2CGWA 3PWDA 2Z60A 3G0EA 3LJ2A 4RIXB 4LL5A 3QZFA 1Y6BA 5C4KA 3TKHA 3ZUVA 1OIRA 1CKJA 3FMEA 3KB7A 4IM3A 4OGRA 4PMSA 4X2FA 3R2YA 5DYJA 5JRSA 4L52A 4XJ0A 3TZMA 2IO6A 5AP3A 4BI0A 2C3IB 4AOIA 2GQSA 4CZYB 5AX9A 3P7BA 2IVTA 3Q6WA 3S1HA 1O6LA 4O0UA 2VGPA 4DH8A 5BX0A 4V0GB 2E9VA 2XCHA 5K9IA 5IU2A 3MBLA 3HNGA 4FKGA 5AA9A 4ITJA 3NW6A 4RJ5A 3VJOA 5CU2A 3LAUA 3FMKA 3WF5A 2YZLA 4WRSA 2WMAA 2VTIA 3QF9A 1U4DA 4YJNA 3DQXA 3ORMA 5B7VA 2ITUA 4OUCA 2JIIA 4I6BA 4CLIA 4O4BB 4EK8A 1VYWA 4CQGA 3LW0A 1YW2A 5EI2A 5EM6A 5CF8A 2PVHA 5D41A 3OP5A 5KHXA 3ENMA 2PULA 2XKEA 4M12A 3C4ZA 3DLZA 4ZTMA 4GFGA 3RNYA 3ORNA 3V6SA 4IB0A 3W0SA 4GV1A 4N4SA 3SW7A 2PMOX 4UMPA 2XIZA 3FZTA 3M42A 4F1TA 5I3RA 4EOLA 3PSCA 4HCVA 3CS9A 4E6CA 2XKCA 4UEUA 2PYWA 4FZ7A 3EZVA 1WVWA 4WNPA 2W1GA 2BHHA 1S9JA 2FSOX 3Q5IA 4H1JA 3SOAA 1UWJA 3ORTA 4IDTA 4XG2A 5EKNA 5EYCA 3HRCA 1KV1A 3OBJA 1VJYA 4EYJA 3TZ9A 4BCKA 3EN7A 3VHKA 4WBBB 4AOTA 3QALE 5D1JA 5A4CA 2NO3A 1J1CA 2KTYA 2I0EA 2IWIA 2QOIA 1JSUA 2HOGA 4GKHA 3DPKA 3LCTA 1PXPA 4EOKA 4PNKA 4MVFA 2F57A 4YSMA 3EQPA 2OJIA 4IBMA 3NR9A 4MWHA 3ZXTA 5EHLA 1H25A 5G1XA 4O7YA 4FSUA 4NSTA 3QLFA 2ERZE 3MPMA 4EYMA 1SVEA 3LKMA 4OTRA 4O38A 1FMKA 4TPTA 4ZIMA 4ACMA 3FXZA 4ANQA 3LJ0A 3VF9A 1OBDA 2VTQA 4L3LA 4FGBA 4O7LA 3DBFA 1O6KA 5DR6A 5E1EA 5B0XA 4XG6A 2GTMA 2OKRA 2Y8OA 3F3VA 5HIDA 4FTJA 3F2NA 5CU3A 3OY3A 5JEBA 3I4BA 2QHMA 2YM6A 3V8SA 3VBVA 1H0WA 4KIKB 4HVSA 5CSPA 5K4JA 5EHYA 5BVEA 3OOGA 3COHA 3U6HA 4BGQA 3C0IA 5BVNA 1UNGA 2CCHA 4UV0A 5FRIA 4XOZA 4D4VA 5IKWA 1FVRA 2BUJA 3QRIA 1Q24A 2XK4A 4RFYA 4WG3A 4O86A 1SNXA 4Z3VA 1GY3A 2R3NA 1B38A 2JDSA 2JDRA 3BHUA 3CPBA 1JWHA 3I5ZA 3IQ7A 4AGCA 3ODYX 5KNJA 3U54A 3ZEWA 3PRFA 1J1BA 4BL1A 2R5TA 5CEKA 3ENHA 3QXOA 4ASZA 4QYGA 4HPTE 5CEIA 1GZNA 3NNWA 4RBLA 4FV4A 2XANA 4IM0A 4DG0E 2J50A 2CKOA 4EBWA 1F0QA 3BEGA 4JS8A 3LQ3A 3NS9A 1CKPA 3UDTA 2O2UA 3R30A 4FNZA 5CI6A 3QX4A 2QLUA 5GJGA 3NNXA 3V04A 4DDIA 4BDKA 5M06A 5AR2A 4FTNA 1BI8A 5BUJA 5J7BA 2OZAB 4ZS4A 4L3PA 4QP9A 2VWVA 1W7HA 4F6WA 3W8QA 3MVHA 3QA8A 4GS6A 4FV5A 2G1TA 1JAMA 3KA0A 4EEVA 5IUGA 4O81A 4NK9A 2PVJA 4L43A 4IZYA 3Q9ZA 3LFEA 3HDNA 4WHZA 2VTNA 1K9AA 4I4EA 4XG3A 2B1PA 3F7ZA 3PPKA 4J98A 2VTPA 3OG7A 3F69A 2I7QA 2BAJA 4O4FA 5J1WA 2PVRA 4H3BA 2UZVA 3BYMA 2RG5A 4XG8A 4JAJA 3MIAA 5AV0A 2WAJA 4L01A 4LRMA 4RC4A 4HYIA 5AV1A 4DEAA 3BX5A 1Q99A 4IACA 3RI1A 5H3QA 3AKKA 2C6MA 2EUFB 4TRLA 4D5KA 3ZRLA 2JDVA 4UXQA 3Q9XA 5K0XA 3R9DA 3DTCA 3EYHA 5KHWA 4KA3A 5LCJA 5HE1A 3NRMA 5CWZA 5KKRB 2R9SA 4O0WA 5KMOA 2GQGA 4OT6A 4YTHA 3KXXA 4AOJA 4DEHA 1PMNA 3QLGA 4FF8A 2LAVA 4J52A 4C4FA 5EOLA 2DQ7X 4DTKA 3DAKA 2Y4PA 3CTQA 5EM5A 2BKKA 3FAAA 4NEUA 4A9SA 3QBNA 4HNIA 4R8QA 4D0WA 5I4NA 3H9RA 4E6AA 4F99A 1L3RE 1UVRA 1XH5A 2QURA 3R0TA 1M7QA 4O7RA 2W0JA 3M1SA 3GXLA 3B8RA 4O1OA 4UYAA 2CGUA 1YWNA 4X3FB 4XH6A 4K33A 4A9YA 4FIJA 5E8YA 2W05A 2J0LA 5KMMA 1MRVA 2BIKB 2WMVA 5CS6A 2PVMA 3QQFA 2E9UA 4FEWA 3E64A 3KULA 2ERKA 4MXAA 3LMIA 3EHAA 2WOTA 3C50A 3DA6A 4MX9A 3R9NA 3RTPA 3CLYA 2C6OA 4MBLA 5IZFA 3KN6A 4OBPA 4NFMA 3WE4A 2JC6A 4ZZMA 3U4UA 3KQ7A 3KXHA 1W84A 3EMGA 2WQNA 4NIFB 4O0XA 1GAGA 3UQGA 4F9AA 5HX6A 4X6QC 2F7EE 5T68A 4XV1A 2J90A 4F78A 3IGGA 2WU7A 4FSNA 2C6EA 2UZDA 3U4WA 5LVPA 3LLAA 3ROYA 4ASXA 2W17A 4USEA 2CNQA 3F82A 3SQQA 4I92A 2QKRA 5CZIA 3QQGA 2EU9A 2ZFYA 4YZDA 4XUFA 5DEWA 1I44A 2VUWA 4QT1A 4NJ3A 2X1NA 4AS0A 3DGKA 3BHHA 5AP1A 2R3JA 4QP8A 3RK9A 1GIHA 2B52A 2FSMX 3FQEA 4O7TA 3DXQA 4ZMEA 4GU9A 5HCZA 3PA4A 3UVRA 4AP7A 3RNIA 5KX8A 4FMQA 4UALA 3RM7A 3RPSA 5TF9A 4O0RA 4TNDA 3KMUA 3MY0A 3ZXZA 4O7WA 4I21A 3OT8A 5DE2A 4M66A 4BDIA 4BZNA 2ZMCA 4DLIA 3E5AA 3EKKA 2QOFA 4FIGA 3MS9A 3QYZA 4PTGA 3UC4A 5HOAA 5FDPA 3FZOA 2QU5A 5I9WA 4C4GA 2CMWA 3HA6A 3R01A 2HY81 2YWPA 3A7JA 2CN5A 4A9UA 3KRLA 5FEQA 3FKNA 3VULA 1FINA 2QO9A 3VBQA 2OO8X 4O0TA 5IH4A 4IWPA 2QHNA 1Q61A 4C4HA 4QMWA 4CFNA 4CNHA 2HW7A 4CFVA 4FI1A 4XHKB 4Q9ZA 1H1SA 3BHVA 3CGOA 2G2HA 4JR7A 5HG9A 4J96A 3IG7A 4FSMA 5TOZA 2GSFA 1R0EA 2ZM1A 1PHKA 1ZMVA 3BYUA 3DK3A 3UO6A 5CAOA 4CMOA 3DOGA 3NUPA 4I6QA 3LFFA 4I6HA 3VS7A 3FYJX 1ZZLA 2W5BA 3AC5A 4QMZA 3UTOA 4FK6A 3CP9A 2CLXA