2QD9A

P38 alpha map kinase inhibitor based on heterobicyclic scaffolds
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
330
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of p38alpha MAP kinase inhibitors based on heterobicyclic scaffolds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qd9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qd9A01
4XBRA 2DQ7X 4PDSA 3ACJA 4P5ZA 2Y4PA 5AR3A 2GHGA 2OH4A 4JIAA 4H3QA 4NFMA 4CMUA 3VULA 4IACA 3CTQA 4EHEA 3LFFA 1ZYDA 2PZYA 5T6KA 1SMHA 4GSBA 4BC6A 4FYOA 5J87A 3E3PA 5KMJA 2GCDA 2WZJA 3FMKA 4C4FA 5ANDA 3BGQA 3HV4A 2HELA 1DI8A 3ZH8A 3E8EA 5H3QA 1QPDA 5AAGA 3FZOA 5F4NA 2IN6A 1MRYA 2XIXA 4GU6A 4WBBB 4QP1A 5DRBA 4H05A 2QR8A 3BHHA 2FA2A 1ZOGA 5ACKA 4BDCA 5M07A 5JRSA 5C4LA 2GFCA 3PP0A 4FVPA 1A06A 4QP7A 2O64A 3DS6A 4UXQA 2GNJA 4AN3A 3RK7A 5KUPA 2P3GX 3Q5ZA 4L45A 4LM5A 2W4OA 4M67A 2FSMX 3TDWA 2B0QA 2J5EA 2WAJA 2OGVA 2PTKA 2VWIA 3PWDA 4C2WA 5EM5A 1OKZA 4IWDA 4F9AA 3FSFA 4TYHB 3PYYA 2HZ0A 4ACDA 1M7NA 3AMAA 4I5MA 3V6SA 2YHVA 3V5QA 4C36A 5HU3A 4AN2A 4NTTA 3TN8A 3M1SA 4I21A 5AIRA 4QPMA 4F1OA 4HJOA 4QYYA 2HK5A 4QQ5A 4UWCA 4WUAA 4PDPA 2BKZA 2HCKA 5LARA 3WARA 2ZOQA 3DK7A 3MV5A 5HE1A 3SW7A 4QMYA 4UYNA 2QOFA 2C5VA 2NP8A 2QI8A 1Q8ZA 1PXPA 3QYZA 4JIKA 5ETCA 4AZVA 1R78A 4NJDA 4RSSA 3IO7A 4EOKA 3UQCA 4JG8A 4GT4A 4IZ5A 1IAJA 3DXPA 1YHWA 2XKDA 3R1YA 2PSQA 4BDGA 4EJNA 3N4TA 4BIDA 1UKIA 3LCSA 1U4DA 3K54A 5JFWA 4F1TA 4EH7A 2WOTA 4ITIA 2VTHA 2OFUA 3NYVA 3ZLYA 2B54A 2PVRA 3MA6A 1KE7A 4Y73A 2HW7A 3EKKA 4AOIA 5KBRA 2QONA 2R3OA 4ASEA 2WXVA 4G2FA 3E87A 3RBWA 4TWPA 4BY9E 2VGPA 3NNXA 3ZO2A 3NUUA 3MVMA 1U54B 3TIYA 5KKRB 2X4ZA 3S3IA 5I3RA 1JVPP 3O8UA 5DFPA 4AOJA 5AUTA 4PTEA 3EZRA 3DJ5A 2WTDA 4FSWA 4FGBA 4GFGA 5CTPA 1PXIA 2XKFA 2RFNA 4IC7A 4C35A 3U6IA 4FT0A 4PQNA 4DTAA 3KU2A 1A9UA 2WELA 4ORKA 2ITVA 3NYXA 1XH8A 5EYCA 5BQ0A 5HBHA 4GIIA 3BELA 3A62A 3OVVA 5D12A 1Q61A 4DFXE 5E7RA 1IA9A 1RDQE 3E3BX 4YZCA 1ZYSA 2X2MA 3DQXA 3RHXA 2F7XE 4HZSA 4V05A 1JWHA 4FNWA 1Q99A 1WAKA 4ZY4A 2BDFA 2XMYA 3H9RA 2XZSA 5JZNA 3FEGA 2X9EA 2XNOA 3VW8A 4DLJA 3JYAA 4NT4A 4IE9A 4M69A 3I4BA 4FKJA 4RIOA 4TY1A 4BBFA 1WVXA 3KVWA 3R7IA 4DE4A 2JKMA 4U6RA 1H07A 2QOOA 4BI1A 2F49A 5IG1A 2C30A 2CN5A 2JD5A 2PZPA 2QO9A 4RJ5A 3ZZEA 3MBLA 4XV9A 1DM2A 5CS6A 1H08A 4CFMA 3H10A 5EM8A 1WVYA 3PXQA 4CFVA 4GK2A 3II5A 2R9SA 4C3PA 2GQRA 4FEUA 3RPRA 2NPQA 4EYJA 5K0XA 2J7TA 2JIIA 2J5FA 3NW7A 4J98A 2HY81 4RRVA 4YC3A 5HE0A 5IQAA 4F6UA 4E4MA 5FWKK 3A99A 2BCJA 3QCXA 3MB6A 2OJ9A 4G3EA 3NVKI 3OTVA 3IQ7A 1R1WA 3BV2A 4BCNA 5FXRA 4IFCA 3U4WA 4CYJA 2P2IA 2C0TA 5AA8A 3DCVA 4C38A 5IUGA 5J79A 5A6NA 1Q62A 3TZ7A 3I0OA 3W1FA 4FKUA 1XH9A 4PUZA 4ALWA 3VRZA 3HP5A 4AZEA 5E1EA 2ITZA 2WFYA 4N70A 2PMIA 3R01A 5LCKA 3MWUA 3UQGA 5AUVA 3MYGA 2AC3A 4O1PA 3LM0A 2FH9A 1FMKA 2G01A 4KBAA 3UVPA 1ZARA 4OAUC 3R22A 4IVBA 3UMWA 2I7QA 3ZUVA 2QU6A 4GEOA 3VS7A 4WNKA 4BZOA 4QMUA 4Y5HA 5L8JA 1OPLA 4PMTA 3C4FA 4FICA 3K5VA 2WTKB 5TT7A 2YLFA 4J1RA 3QL8A 4FTJA 2I40A 4F0GA 2PVJA 3AT3A 3CD3A 4QMLA 4ACGA 3HRBA 2GNHA 2XM8A 3FLQA 4RIXA 2NNWB 2JFMA 3QCYA 4C59A 2W05A 1B38A 2XRWA 3VUMA 2YCRA 4BFMA 3R1SA 4LYNA 2BILB 3KULB 2XEYA 1J7LA 2OZAA 4MAOA 3C51A 3MN3A 3WZKA 3RWPA 4BDDA 3OC1A 4FYNA 1M52A 4AS0A 5LWNA 4Y46A 4GV1A 4EH8A 2UZLA 5I9YA 4ZS4A 3PVBA 3VBQA 5HCXA 2JGZA 2OIQA 3ROCA 3DT1A 2NRUA 3VS0A 3MPTA 2JKKA 3ZFMA 1FGIA 3NGAA 4L53A 4O27B 2BDJA 2CKOA 4NM7A 4MH7A 3A4OX 4EH5A 3NZ0A 3WZJA 5HG9A 3PXZA 3V3VA 3FHRA 5AWMA 3OWJA 4BIBA 1OIRA 4MBJA 4YJSA 4D55A 3I7CA 4HCUA 2WKMA 4M66A 4QYGA 2Z2WA 2ZJWA 3VN9A 2R3IA 4BYJA 2UVXA 1SZMA 2B4SB 2VN9A 5DR6A 5E92A 1J1CA 2Y7JA 4RFYA 2JC6A 5BNJA 4JAIA 5J9YA 5IKWA 4JG7A 1P4OA 3RPSA 1M2PA 4U7ZA 3EZVA 2QG5A 3LCKA 3QQKA 2O63A 4L67A 4YBKA 2EUFB 2IW9A 3NW6A 2WNTA 3SVVA 3TIZA 3V01A 3FMDA 2OFVA 3CTHA 4YBJA 5D41A 5DPVA 3EYHA 3MIAA 4AT4A 3L9MA 3LHJA 4DFUA 4L3JA 4WRGA 3QD2B 4YJTA 5E8XA 5AP7A 2WMRA 2Z60A 3D15A 5L8LA 2UZVA 4USDA 1IG1A 1R0EA 3E64A 4XG2A 5DEWA 3NWWA 4A06A 5DT4A 4BDKA 4O38A 5TE0A 3R8ZA 1QL6A 2WMQA 4WO5A 2GNLA 5ETIA 5JMSA 5AA9A 3C0GA 2WPAA 4X21A 4ZZOA 2WMSA 1JSUA 3KRJA 3NX8A 4IZYA 4KIKB 3BV3A 3PJCA 2FVDA 4J97A 1YRPA 4ID7A 1OI9A 5DWRA 2QQ7A 1A48A 2C69A 4JNWA 4D4RA 5L6OA 3PLAE 1UU9A 4WBOA 5AM6A 3ZYAA 4U3ZA 4FG9A 5CQUA 3OWPA 3RP9A 4E6CA 3F3ZA 2JDRA 2VTJA 4Y72A 2CGVA 1VYZA 4WUNA 2QHNA 3QCQA 2EB2A 4AG8A 3HRCA 4D28A 5EKNA 3MW1A 2FUMA 3FPQA 3ACKA 2IG7A 1KV2A 4MQ2A 1HOWA 1CKIA 2XJ1A 3BRBA 1H1SA 4RT7A 1ZMVA 4IZ7A 4E6DA 4CKJA 4XG3A 4RA5A 4WRSA 5K0KA 4EBVA 1ZZLA 5TR6A 3E8NA 3VVHA 3TNWA 2UZBA 3NUXA 3AC2A 4NCTC 3VF9A 3DZQA 1KSWA 4F0FA 5FM3A 4XYFA 3SRVA 3ZXZA 2Z8CA 3QZIA 4F64A 2VWVA 2G15A 3UOKA 3KMUA 4R1VA 4C58A 3EL7A 5HG8A 3UIMA 5HTIA 3LPBA 4IM2A 5HBJA 4HVHA 3QA8A 4ZSAA 4OTQA 3GGFA 2WOUA 1BL7A 5LVLA 4WG5A 4FSMA 5M51A 2ITNA 2WTJA 4YHFA 4X2GA 3ZEPA 2BR1A 4WKQA 4RQKA 3ZLSA 1GJOA 2XJ2A 4O0VA 1H1PA 5CU2A 4IBMA 1JNKA 1LPUA 3KRWA 3QXPA 4HGLA 2UW8A 4W9XA 5CENA 2RL5A 5DGZA 3PVGA 3E7OA 4L01A 4BCJA 4NCTA 3D0EA 1K9AA 3KRRA 2QO7A 4L44A 4BRXA 1W0XC 4FV7A 4OBQA 5ITAA 2YDJA 2C0IA 4FTTA 4ZTQA 5HNIX 4FK6A 4ARKA 3CKXA 5ANGA 1H27A 1WZYA 4W8DA 3AC4A 4GRBA 4IAIA 5DR2A 4NSTA 4BBEA 3FXWA 3CQEA 2E9OA 3UZTA 4ERKA 2OWBA 1YHSA 4R78A 5JFXA 3V8WA 3ULZA 3ORXA 4DEEA 4QMSA 5EM7A 3P4KA 3R8MA 3F7ZA 5CALA 4MVFA 4XNEA 3Q5IA 3HECA 4JR7A 4ANOA 4AWIA 5I9ZA 4WD5A 4R7BA 4G3FA 2BPMA 2BZIB 2I0VA 3CY2A 3IDCA 4KS8A 4CQGA 4XG4A 3OF0A 5CAVA 3RNYA 4EOPA 1PXNA 2C5XA 2JBPA 3FMNA 2NO3A 3E5AA 4FV0A 5CYIA 3OUNB 5CEIA 1X8BA 2X2LA 2CCHA 2PE0A 3A2CA 2BRGA 5AV3A 3PY3A 3R04A 1URWA 3OCTA 2XRUA 3PXRA 4TWNA 4YZMA 3ULIA 3UVRA 4BWXA 2XK9A 5A9UA 2BALA 1PKDA 3TZMA 1KOBA 5I9WA 1JKKA 3MFTA 4FT5A 4QNYA 1U5RA 1H25A 2SRCA 2F2CB 2W1GA 4FV4A 4D1XA 4FZ7A 2R3HA 3VBVA 3TUCA 2XNMA 4GIHA 1XBBA 1JSTA 5IDNA 4W8EA 4F6SA 1O6YA 5JEBA 3UO6A 3C7QA 4ZSEA 3UO4A 2QLQA 4QP2A 3R7UA 3DJ7A 2E2BA 2PMLX 2OBJA 3UC3A 4EQUA 1M7QA 1XJDA 5T68A 3T9IA 2OZOA 4JX7A 3Q2JA 2I0YA 2BDWA 5IQHA 4G17A 4XJ0A 4I3ZA 4RX7A 5HG5A 3VHEA 3TUBA 4QQTA 5HHWA 4E26A 3R63A 5EW3A 4RZWA 5EYKA 4E5BA 4XH6A 4QMZA 4AZFA 4K0YA 1TQMA 3I1AA 4U97A 3ORTA 3OBGA 4AF3A 4D4SA 3OUKA 3GU6A 1U46A 3I7BA 2XNNA 4OTWA 5CZHA 4ZTRA 3PVUA 5ANKA 3TACA 5M56A 5IQFA 2OKRA 3G90X 4BWKA 3MH2A 1YXTA 2C3KA 2R3RA 2R0IA 4AQCA 4NEUA 3DKFA 3KF7A 4CLJA 3F7WA 3P9JA 3S00A 2R4BA 4R1YA 3AGLA 3CPCA 3HKOA 3ZOSA 3FLNC 4RFMA 3OBJA 1JLUE 4MXOA 4RJ6A 4FTQA 3G9NA 3QZHA 4LI5A 3R7GA 4GYGA 4KS7A 1OBDA 2FB8A 3TTJA 1ZYJA 1LEZA 2IZUA 2WTVA 3AC3A 3FKLA 3MB7A 5D7VA 3QTWA 3UTOA 2OIDA 3V6RA 5C27A 3BLQA 3ID6C 3S4QA 4Q5HA 4X2JA 2X7GA 5D10A 2PY3A 4OGRA 2WMXA 3ZO1A 4JDKA 1GZNA 1V0PA 4E8AA 2IZRA 1BI7A 3IECA 4PPBA 4RZVA 4DA5A 4FKQA 2JBOA 3Q9WA 4U42A 4BZNA 4PPAA 2W99B 4AXAA 3D5WA 4M97A 2VTPA 1T45A 3SV0A 2CNUA 4FNZA 1OITA 3QTXA 4FTLA 5EM6A 4DEHA 3ETAA 3GFEA 4CFNA 4UWYA 4A07A 3BHUA 1OZ1A 3JPVA 2XIYA 4RBLA 1YDTE 4RA4A 2C3JA 3MY5A 5DT0A 4YUQA 3U4UA 4XS2A 5EFQA 2B53A 4OT5A 3FZTA 4FA2A 2JAMA 5IQGA 2F7ZE 5GIOE 4IX4A 2XK8A 4D9UA 1UNLA 1XHAA 2XCHA 4OTIA 3VS6A 3ANQA 2PVNA 3G0FA 4EZ5A 3QBNA 3QAME 5IH4A 2PUNA 4RIYB 1J7IA 4MD8E 4QPSA 2XKCA 3RM7A 5HEZA 4WA9A 4M3QA 4YNEA 3UDBA 5CVGA 2OF4A 3LCDA 4QQCA 3HA8A 4JQEA 3G0EA 1YVJA 3WIGA 4QTCA 4F1MA 2C47A 3AMBA 4L7SA 5E8SA 3PZHA 4RPVA 4UZHA 4BR3A 4L42A 4DGOA 4L9IA 4ITHA 3BU6A 1QCFA 1OL5A 5BVFA 4X7QA 2BZJA 3RI1A 4K8AA 4YZNA 4XG7A 4I5PA 3TTIA 5JSMA 4HPTE 2Y4IC 4ASZA 3ORPA 3QTZA 4J8NA 1P4FA 4RJ7A 3ENMA 4PP7A 2W06A 3TNHA 3R7OA 4ASDA 5I9XA 4R3CA 1YHVA 3G15A 2XUUA 3K5UA 1OPKA 3R71A 5IA5A 2HW6A 3NW5A 2JFLA 4FT7A 3QQGA 1Q3DA 5AADA 3VNTA 5C26A 4XV3A 3ATTA 4C4EA 1W7HA 4QP8A 5FGKA 4BCHA 3FQHA 1W84A 4CSVA 5AP5A 5GZ8A 4M8TA 4FSQA 4R5YA 4JVGA 3F3VA 5IEYA 1WBOA 4JT3A 4PMSA 4U45A 5KHXA 2X6EA 3Q6WA 3Q60A 5BYZA 3WF9A 2Q0BA 5B7VA 3NLBA 4DITA 4FIEA 4HZRA 2YM5A 3ORIA 5HTBA 5CT0A 5L4QA 3FY2A 2YZLA 4BDEA 3KK8A 3C9WA 5HLPA 3BYUA 1CSNA 2OI4X 2R7IA 3FLYA 5JGBA 4K9YA 4IANA 5L3AA 3NEWA 1OKVA 3NSZA 4NTSA 3FMMA 3W8QA 3VUGA 3VUDA 2G2IA 2HZIA 3LJ0A 4FV3A 4AW0A 3RALA 4J52A 1OL7A 4K2RA 4DBNA 4QO9A 4E3CA 2GMXA 2GS2A 2I0EA 1NVSA 2WMTA 3R8PA 4A4OA 4UZDA 2CCIA 2WHBA 1YXSA 2O8YA 4KA3A 3HEGA 5AR8A 4M13A 4EC9A 1FBNA 5BVEA 3R9NA 3WI6A 3K2LA 2XH5A 1WBTA 2XNEA 3O2MA 4H58A 3QRTA 2R3LA 3DNEA 4GUBA 4LGGA 2PMNX 2XK7A 3HAMA 4OTFA 5CSPA 3O96A 5HICA 3UGCA 3W2SA 4APCA 3R8VA 2ITPA 4YGAA 4IB3A 3B8QA 3EHAA 1UWJA 3C4WA 3QFVA 3QHWA 4FKLA 3I0QA 3VUTA 3W18A 3ATSA 3HMNA 4BCOA 5CNOA 2BIKB 5GJGA 3ZRKA 2ITTA 4DC2A 4F99A 5M4IA 1UV5A 4CFWA 5EHYA 3F3WA 4AGWA 2B9JA 5AV4A 2W1DA 4EH2A 2QG7A 4FKPA 2YCFA 4DBXA 1H1WA 4BTMA 5HD7A 3WILA 5IUIA 3K3JA 3ET7A 5A4QA 1IA8A 4LL0A 3DV3A 2UW9A 3OXIA 3NUSA 4DT9A 2XBJA 2ETKA 4DFBA 3SHEA 4KB8A 1NW1A 1PXJA 4HYIA 5TO8A 2BRMA 2HZ4A 2VTIA 3QGYA 1OUKA 5FTGA 1UNGA 4R6VA 4N4SA 4GKHA 3QD0A 3UMXA 4XRLA 1W98A 2YWVA 4O82A 2HZNA 2ZAZA 1NVRA 4MQ1A 3SD0A 2C3IB 3A4PA 3F88A 4B4LA 4MX9A 3IDBA 4RWJA 3OOGA 2QHMA 3E8DA 3D94A 5KBQA 4AGCA 1J3HA 3CS9A 5D9HA 2QCSA 4MCVA 1BX6A 3P7CA 4I1ZA 5FTQA 3H30A 5A14A 1HCLA 4FIIA 3IGGA 5DN3A 4BDIA 4C2VA 4O0SA 5HNBA 5L6PA 3UOLA 4FK3A 5K3YA 5AAFA 4DCEA 2R0UA 4G34A 4YO6A 3QC4A 4C4HA 3W32A 3D5VA 2V22A 3I5ZA 4BKZA 4KKHA 3QUPA 4BGQA 5FDPA 1BL6A 2CLQA 4K33A 4QYHA 4BCGA 2ITOA 3CIKA 3NR9A 3Q32A 2RGPA 3QQFA 4I6FA 4XP2A 4ACMA 4BI0A 5J7BA 2W9ZB 3JVSA 4G9CA 4LUEA 4YJVA 5JZJA 3HMIA 2ZMCA 3U8WA 5G1XA 4H3BA 5AP6A 3ZRMA 4ANMA 4BVUA 2AYPA 5AV0A 4QNAA 5IA2A 3GT8A 3RAIA 4FZFB 5A4EA 5HX8A 2R7BA 3G6GA 4CV8A 1NT2A 5CXHA 2Q83A 3TZ9A 4QTDA 4O2ZA 4WSQA 1WBVA 1OGUA 3SKCA 4ZZNA 5C01A 2VRXA 4FSYA 4K6ZA 4E4XA 3P7AA 3GC9A 1PMNA 2BKKA 1ZWSA 3EQHA 3ZO3A 4AN9A 4BGGA 1OIQA 4EEVA 2YIQA 4EKKA 3UC4A 2ZB0A 1H1RA 5F9EA 4TRLA 5KMOA 5HZNA 4IB1A 4TN6A 3KMWA 3WF7A 2HWOA 4K18A 2VWBA 5KHWA 3SG8A 5HG7A 4L3LA 2IVSA 2PZRA 2OJIA 4D4VA 4HOKA 3T8OA 4W4XA 4ZLZA 4X2KA 4XRJA 2XA4A 3NCZA 5EDQA 5ETAA 3LE6A 2YZAA 4IMYA 3U9CA 3UNKA 3O51A 5EI2A 4G6OA 1CKJA 3FWQA 2CNQA 2ITWA 1SNUA 3MFRA 4QMVA 4CXAA 2CSNA 4HCVA 5L2SA 4G5PA 2YITA 5IZFA 4GJ2A 4JX3A 5FUTA 1Q8YA 4BDJA 5IMEA 3OY3A 3FZSA 4DH5A 3CSVA 2IO6A 4A4XA 4R3PA 2YDIA 4DFZE 4B8MA 4I0SA 1S9JA 2GPHA 3H0YA 3KXNA 4GL9A 4O6LA 4QYEA 5HKMA 4DGNA 5C4KA 4IDTA 3CJFA 1WBSA 5A54A 2CPKE 3R00A 3U51A 3UIUA 5L2WA 3OW3A 4MD9E 4G3GA 3B8RA 3ZUUA 4X2NA 3W33A 4HNFA 3FL5A 5EH0A 4F9CA 3FJQE 4IWPA 2H9VA 3PJ1A 5CY3A 2OSCA 2P55A 1OVEA 4YHTA 2GTNA 1ZAOA 2XNBA 1LP4A 3UIBA 3V5TA 1UA2A 4FMQA 4N6ZA 4ZTSA 3R9HA 5FBNC 4LFIA 1MQ4A 5FM2A 1PY5A 3D83A 4FVRA 4WSYA 4BKJA 4FT3A 4E6QA 1V1KA 4V0GA 4FIGA 5AUUA 2VX0A 3RJCA 1O9UA 3HV7A 4H1MA 4TT7A 2I0HA 5CAOA 3QUDA 1WCCA 3LXKA 3QRKA 5E1SA 3O8TA 3KXXA 4I6BA 4AA4A 2X1NA 4DGGA 3FXZA 2W17A 5H2UA 4X2FA 2JEDA 3BE9A 2IW6A 4LRJA 1Z57A 2J0LA 3COMA 3NAXA 3RINA 1SYKA 5EOLA 4FTIA 1ZY5A 5F20A 4E5WA 5BUIA 3UG1A 1FVVA 3QD4A 3ALNA 2C5OA 2G9XA 3FZPA 4DEIA 3QZFA 2OXXA 3LFDA 1J7UA 2HXQA 5HTCA 4BCMA 5A4TA 2B7AA 5EYMA 3HZTA 4U5JA 1TVOA 1XWSA 3PIZA 3PRIA 2R5TA 4TNBA 5BX0A 2UW3A 4BIEA 3UNJA 4AGUA 4D9TA 1WFCA 4CZYB 5M53A 3F5PA 5JGAA 4MEDA 3OT8A 4EH4A 4QMWA 3MVLA 3KRXA 4CYIA 3EIDA 2V62A 3MSSA 3COIA 1PMVA 4DF3A 2VTSA 5M4FA 1IAHA 3L9LA 4IQ6A 4D58A 3CXWA 3EQGA 4EOSA 3ITZA 2O2UA 2YIYA 4WNMA 3QTRA 4DH3A 5JQ8A 2F4JA 1DI9A 1JPAA 4KD1A 3DXQA 2C68A 5JFSA 4ANSA 1YWNA 4ZSGA 4EONA 3ZZWA 5LJJA 5LVPA 3NCGA 3D7ZA 4QP4A 4ZY6A 3OW4A 4C37A 3IOPA 4OTDA 4C0TA 1P2AA 4IWOA 3ODYX 4F9WA 3V8TA 3VS5A 5KO1A 2O65A 3O8PA 4NIFB 4LRMA 3O50A 4O22A 4PNIA 4CFUA 4S34A 5IA4A 5E4HA 3AC1A 4RLLA 4CVAA 3KQ7A 5AX9A 2GQGA 1KWPA 4FVQA 4FKIA 2OJGA 2BRHA 1R3CA 2UUEA 3P0MA 2Y8OA 3E62A 4RGJA 4ERWA 5CEOA 4O21A 3QWKA 3LXNA 3BX5A 4FNXA 4MF1A 4QMXA 2YWPA 3TL8A 4AT3A 3PXFA 4HPUE 4LL5A 4WNOA 4Q9ZA 3EQRA 4ZS0A 5CZIA 5E8TA 5I0BA 4O0RA 3CCNA 3WF8A 3IW7A 3ORLA 3CGOA 4GU9A 1Y6AA 4E4LA 5GNKA 4C61A 3R28A 3LXPA 5LVOA 3DU8A 5CSHA 2JIUA 5GINE 5HO6A 3G2FA 4UWBA 2H6DA 5JH6A 3L8VA 4UMPA 5C8NA 3F3TA 1ATPE 4RJ8A 4AW5A 2GSFA 4DINA 1H24A 4AUAA 3HA6A 5KMMA 4FKWA 4JOAA 4XLIA 3FLSA 4IFGA 2IVVA 3C1XA 4RG0A 4KAOA 4FSNA 4DYMA 3QTUA 1M17A 2EVAA 5CI7A 5E8WA 4CRLA 4X3JA 3SA0A 2YFXA 3QRUA 3ZMMA 3M42A 3GCPA 3D7TB 5M09A 3HYHA 3KXMA 4NW6A 3EQFA 4O0YA 2W4JA 4PRJA 2ZM4A 5CT7A 2OF2A 3RCJA 2PWLA 3PJ2A 1YOJA 4MXYA 3KB7A 4S31A 2XK6A 5AUYA 1XH7A 5IPJA 3ODZX 2QODA 4F08A 3Q9XA 3MGYA 4F09A 5GIPE 3JY9A 1YXUA 3N4VA 3BHTA 2FGIA 2X8EA 5AR5A 3CTJA 3MTFA 4I6HA 3ZCLA 3U6HA 2PUPA 1ZY4A 4U0IA 5AP2A 5M55A 3TJDA 4O7YA 4O6EA 3R9RA 3GEQA 2R3PA 2UZNA 5FEDA 3I79A 1VYWA 4BTFA 2W1ZA 5A3XA 4O1OA 3H9FA 4P4CA 4EORA 4O7ZA 4O91A 5CANA 3RPOA 3L1SA 3BWJA 2CHLA 3FMHA 4TNDA 1Y8GA 2R64A 3FLZA 4R5SA 4R3RA 4YLLA 5FBOA 3OCGA 5EQPA 2J6MA 3L9PA 3PVWA 1PKGA 3QRJA 4IVDA 3VBXA 3ZSGA 4PPCA 4M14A 3KF4A 4YTFA 4DEAA 2GS7A 1BI8A 4O7NA 4TYIA 1TQIA 2V0DA 2BFYA 4U80A 3ZU7A 3HMMA 4AFJA 4I92A 4BDFA 3DK6A 5DRDA 3NAYA 1YXVA 3DBQA 4RFZA 5CU3A 5IDPA 1I09A 3CR0A 2RFEA 3RAWA 4EH6A 4A9SA 4JR3A 4TYHA 3HX4A 4ZK5A 3NIEA 2CGUA 3FAAA 2ERKA 4EYMA 3G6HA 1F5QA 2W1IA 2W96B 3VHKA 3ZXTA 3OD6X 5KZIA 5M57A 3TDVA 3A61A 2JKQA 4I20A 3VRYA 2PVFA 4AT5A 5KKRC 3LFCA 4PMPA 1R39A 3DPKA 4QMPA 2B52A 3V5PA 5AJQA 1YDRE 4C34A 4FV6A 4ZXTA 4EOJA 4JAJA 5AM7A 5KE0A 3SDJA 2PVHA 4XV2A 5IQDA 4FEXA 1WBPA 3EFKA 4CFFA 4UMQA 3BEAA 2BROA 3G5DA 4R8QA 4ACHA 1XQZA 1SVHA 1FOTA 5FEQA 4LV8A 3KN5A 4AZSA 4MKCA 3RCDA 4ZMFA 5CXZA 5CSVA 2BVAA 4I23A 5HX6A 5AV2A 1E1VA 3E92A 3R02A 1T46A 4UMTA 2XNPA 5K4JA 4LMNA 4YPSA 4JBOA 2ZM1A 4XG9A 4EOQA 1U54A 2B1PA 3HP2A 3FMLA 5HE3A 5EI8A 3ZFXA 4EH9A 4UMUA 2WMVA 5TKDA 5GHVA 2VUWA 3RAKA 3PWYA 3KK9A 2IZTA 4PMMA 3MS9A 3Q9YA 4BCQA 3PPZA 2PE2A 3CEKA 3R1NA 2GFSA 5LOHA 4NL0A 3PP1A 4LV5A 4MWIA 4U44A 4XOYA 3JS2A 5DIAA 5JGDA 1YKRA 1VR2A 4CEGA 1G8SA 1UVRA 4O83A 2BFXA 4USEA 4AACA 4AZWA 5AP1A 5EYDA 4BBMA 2LGCA 4HGTA 1M14A 4EH3A 3OTUA 3NUYA 3IONA 2YN8A 4V04A 2W5AA 2YAKA 4G1WA 3QTIA 1FINA 3FYJX 5GJFA 2CDZA 3WF6A 1H1QA 1JKLA 4KSPA 2UW0A 3PJ8A 2GTMA 4YPDA 2JLDA 3ZLWA 3DLZA 2C4GA 3TKIA 3WYXA 2PE1A 2QC6A 3I5NA 4FV1A 5KZ0A 2OJFE 3SOCA 2KTYA 2J0JA 4UALA 5F94A 4G31A 5DA3A 4FG8A 4D0XA 2QO2A 5BVWA 2ZV7A 4RJ4A 5ANIA 3P7BA 2BZKB 3QQJA 5G6VA 5K9IA 4FKSA 4UX9A 4JBPA 3A7IA 4ANBA 5CF5A 4FV5A 5HLNA 5H8BA 2F2UA 2BAKA 5CAQA 3EH9A 1H4LA 1FMOE 3PXYA 4PV0A 1OIYA 4PP9A 4TKSA 1ZMWA 3LFEA 4EK5A 5D7AA 4EQMA 4BCPA 5L2TA 4YJRA 2OICA 3CJGA 3NNUA 2WTKC 1YI3A 2C3LA 2J9MA 1SVEA 3D2IA 4RWIA 4XX9A 2PPQA 1PJKA 3QGWA 4XP3A 2W4KA 2PYWA 3MJ2A 2OK1A 3GU7A 3G9LX 4NKAA 4O7RA 2J50A 3UBDA 3GXLA 4UB7A 3UOHA 1SNXA 4TL0A 2I1MA 2WD1A 2WQOA 3DKGA 1MQBA 4Y8DA 4CT2A 4ZTMA 1PXOA 3UO5A 1JBPE 4PL5A 1QPJA 3P78A 1E9HA 2PUUA 4B8LA 3LMIA 5EW9A 3HDNA 2B55A 5FG8A 3QYWA 2V7AA 5KMNA 1YXXA 1PRYA 3ZFYA 2UV2A 3FLWA 2XIKA 3HUBA 4XEYA 5BVKA 4ACCA 1PMEA 1G5SA 2WTIA 3EQCA 3ERKA 3DTWA 5CNNA 3DFAA 5EI6A 4EK6A 3B2TA 1GOLA 3FI8A 2DUVA 1RE8A 4X3FB 4AAAA 2WQEA 4Y83A 3KULA 3OG7A 2RF9A 4H36A 5BMMA 4FTAA 4MTAA 4IB0A 3GCSA 1DS5A 2A19B 2B9IA 2Z7SA 3CD8A 4YZ9A 4ZTLA 3VS1A 4EWQA 1PHKA 1IR3A 4IW0A 3KA0A 3LMGA 3GCQA 4O96A 4ONAA 3KXHA 4CD0A 3VUIA 4AW2A 5ANJA 4F70A 4DG3E 4USFA 3EYGA 4LG4A 2H96A 2PVMA 2HYYA 2P0CA 3M2WA 4YTIA 3VO3A 3BLRA 3WYYA 4RVKA 1PXLA 4II5A 4CV9A 3EMGA 4BB4A 2G2FA 2WIHA 3I81A 4LGHA 5IA3A 5FP6A 2XBAA 2R3GA 3DAKA 3C5IA 5FLFA 3OROA 4GUEA 4W9WA 4KINA 4IJPA 5CQWA 2XM9A 2O0UA 3HLLA 3M11A 4LGDA 4IWQA 1YDSE 4BN1A 2GNIA 2ZV2A 4ZIMA 2VAGA 3R8LA 3CC6A 4Z55A 2A27A 3QU0A 4JL9A 2OU7A 1JQHA 4KNBA 1VZOA 3GI3A 3ZDUA 1L8TA 1GZOA 2EU9A 3F9NA 5HLWA 3BLHA 4UYAA 3UG2A 4FIJA 4AU8A 4NH1A 3TM0A 2ETMA 3R7VA 1Y6BA 3HNGA 2OLCA 3QQHA 3QXOA 1NVQA 1STCE 4WHZA 3FV8A 3DAJA 4EOLA 2JKOA 2CKQA 1ZOEA 2BRNA 2QLUA 4CTCA 3KFAA 4BL1A 2X7OA 2QNJA 3R83A 4CT1A 2EXMA 2G2HA 4JG6A 4O0WA 4FTKA 4QMTA 4FSRA 4APPA 1JKTA 2YA9A 3U9NA 2EB3A 5LMKC 2HXLA 5I5ZA 1H0WA 5DBXA 3NUAA 3ZM9A 4FKRA 4GFOA 4K1BA 4YLJA 3VJOA 3VS4A 3D14A 3EQPA 4A9UA 4F65A 4NUSA 3IOKA 4MBIA 4L7FA 1Q8UA 3BU3A 4MWHA 5D11A 4C33A 2WMWA 3R30A 3VF8A 5K5NA 3HMOA 4OAVB 3DNDA 3QA0A 3REPA 3VBYA 5AP0A 4FKVA 2QOBA 5DH3A 3Q4CA 3SG9A 2VO7A 3PSDA 2HOGA 2VWYA 4EC8A 4KIKA 3BKBA 4O0XA 3CQWA 1W83A 4GVJA 4AA0A 4CFXA 1ND4A 5FEEA 4FTNA 4YZBA 3EQDA 3KMMA 4IAYA 2VWUA 4IEBA 5L2IA 3TUDA 5LMKA 1OL6A 1JAMA 3QKKA 4L43A 3ZM4A 4FL3A 4C4IA 4BWPA 2YERA 2QOQA 4XOZA 4TYGA 4JLCA 4AOTA 3C50A 3L8SA 4MD7E 2GQSA 4P7EA 2XYUA 5L8KA 1Q4LA 3COHA 4FZ6A 2PK9A 2C1BA 5K5XA 5HOAA 3OEZA 3I6WA 2PVLA 2F9GA 4YJOA 2OXDA 3AMYA 3LZBA 1LR4A 3TNQB 3W16A 5I4NA 4C3RA 2R3MA 4YJNA 3VAPA 2EXCX 4YJQA 3DKCA 3F66A 3PDTA 3N51A 2C6DA 2G1TA 3MY0A 1QPEA 3OOMA 3BQCA 2Z7QA 4IADA 4W4VA 4B9DA 2GHMA 4F7SA 4BICA 2R3KA 2YIWA 3TCPA 4GK4A 3UODA 3V04A 2OO8X 2Y9QA 4UXLA 2WTWA 4ZSLA 3NIZA 5DHJA 5M06A 2ERZE 3OP5A 4I0RA 2UVZA 4XUFA 4TZRA 3AC5A 4IHPA 4M69B 5HBEA 1REJA 3GC0A 2F7EE 4ZMEA 3KVXA 5HO7A 3THBA 4MYGA 3FYKX 4RQVA 5DI1A 2CKEA 3AD6A 5HE2A 3KEXA 4FIFA 5ICPA 1BUHA 3MY1A 2KULA 4D5KA 2RFSA 3EL8A 4MK0A 2JDSA 5L6WL 5KNJA 1QMZA 4L6QA 5AX3A 5EDPA 1YWVA 3FY0A 2EWAA 2QR7A 3IDPA 2PHKA 2R3FA 4KIPA 5AEPA 4QP3A 5HCZA 1XH6A 3OZ6A 2B9HA 3R1QA 4HVDA 3RM6A 1EH4A 2YJSA 3GU4A 4FBXA 1YOLA 2VNWA 4FKTA 4OTRA 2JDTA 4I41A 4BKYA 4E7WA 1U5QA 2ESMA 2J2IB 5FP5A 3W2PA 4ALUA 4D2TA 3W8LA 3AXWA 1RJBA 2Q0NA 2V7OA 3TV6A 2AUHA 4R7IA 2X2KA 3Q3BA 2IZSA 3KGAA 1URCA 4KIQA 4ZTNA 3F2NA 2ZV8A 4S30A 5AFVA 3GQLA 4Z3VA 3W10A 1YI4A 3NYNA 3BBWA 4YJPA 4TYJA 2QKWB 2C1AA 2OW3A 2R3JA 3EN7A 3R2BA 3MVJA 4NM5A 3RWQA 4C57A 4EUUA 2GS6A 4RVLA 5HVJA 5LVMA 2W1FA 3R2YA 4NYEA 3MH3A 4TPTA 1XR1A 5FD2A 3EN9A 1GIHA 2REIA 2FYSA 1YOMA 1CDKA 2CMWA 3QALE 2DWBA 4FF8A 1VEBA 3BPRA 2R3NA 4F0IA 3LM5A 4R7HA 3VIDA 3DB6A 1YI6A 2QD9A 5CASA 4FTRA 3ENHA 4FZDB 4WOVA 3D9VA 1RW8A 2BHHA 3JY0A 3W2QA 4BCIA 1XKKA 4BHZA 3CY3A 3E8CA 4HVIA 3FC2A 2BAQA 3GOKA 4DTKA 4X3FA 1FGKA 1ZYLA 2JIVA 4CG9A 4U41A 1FVTA 4KRCA 4ZAUA 2JDOA 2X39A 5DLSA 3EFLA 3UP2A 4DFNA 3IW5A 3PY1A 4IAFA 4P90A 2ZDTA 3DDQA 3NUPA 4IJ9A 4EQCA 2ZYBA 3QX4A 5D1JA 4EK8A 4S33A 3P23A 3BEGA 2BHEA 3H3CA 2WTCA 3RHKA 3PA4A 4BDHA 2C6EA 4MHAA 4QMMA 4RIWB 5CVFA 5E8VA 5AUXA 4D2SA 4ENYA 4D2RA 5CAPA 1XBCA 4AZTA 3SW4A 3W2OA 4NM3A 3FDNA 5CF8A 4JRVA 3AOXA 4JDJA 4D0WA 3LLTA 2RG5A 4GT3A 4O2PA 4EUTA 2WQMA 1P14A 2C6OA 3FZ1A 2GNGA 3CP9A 5FXSA 3LFQA 5FDXA 3RNIA 3VBWA 4C4GA 1OBGA 2C6IA 4CKIA 4EK3A 4MF0A 2P33A 3R21A 3TV7A 2J51A 3FSKA 4BTJA 4C8BA 1NXKA 5E90A 4CZTA 5ANEA 4IVCA 4TWCA 3PG1A 2E9NA 4B7TA 5E91A 2OXYA 2CKPA 4L8MA 2A2AA 3SLSA 3PZEA 4JS8A 2C5NA 2PU8A 5T3QA 4DGMA 3PA3A 4GYIA 2OH0E 3ORZA 4KSQA 4RC3A 1UU8A 2BRBA 3BYOA 4QPAA 3A7GA 1E1XA 2FO0A 3A7JA 3SXFA 4LOPA 3EN5A 4LUDA 4MNEB 4NM0A 3UZRA 3AD5A 3ZSIA 3PY0A 2PUIA 3GU8A 3IW4A 4RIYA 4BI2A 2GU8A 3AT2A 5A4LA 1REKA 2A1AB 3HV5A 1Q41A 2W1CA 3IK3A 4E5AX 1XO2B 3V5LA 1Q97A 3P5KA 2C6TA 3PE2A 3PTGA 1Q8WA 4RVTA 3FPMA 4XG8A 2YACA 5CWZA 4O7SA 2W7XA 4QT1A 1APME 5KMLA 4FE2A 4U9AA 3PSBA 2P2HA 3LFBA 2Z7LA 2IW8A 4UEUA 3TJCA 1H8FA 4U43A 4FL2A 1WBWA 4I5CA 4HVSA 4GK3A 3NNVA 4Q2AA 3GFWA 4KRDA 4D2VA 1OL1A 4PX6A 4IAAA 5IMXA 3BCEA 3R73A 3DQWA 4F9BA 5C03A 4MXAA 4Y85A 3WIKA 4FIHA 4RLKA 1G8AA 4WNPA 5BUJA 4O7LA 3IG7A 4QMNA 4XG6A 5B2MA 3KCKA 3EN4A 3EJ1A 3PXKA 3Q96A 4OTGA 4B0GA 3MESA 4J8MA 2FSOX 2QOKA 4YR8A 3EWHA 2O3PA 4DLIA 3O71A 4ASXA 3IW6A 5J5SA 4FGRA 2A4LA 4F63A 4YMJA 4EZ3A 4YSMA 3DOGA 4U40A 4XMOA 2UZEA 3K3IA 5ACBC 3SRVB 4FG7A 4FUXA 3ZC6A 3ZONA 3DKOA 4ZP5A 4FV9A 4NW5A 3ZLXA 3NYOA 2OG8A 2YIRA 3GCUA 3C0IA 2J90A 5HGIA 3POZA 1KE9A 1P5EA 3TKUA 4IH8A 4IM0A 4YURA 3MVHA 5LVNA 2FSTX 5AR2A 3T3UA 5J5TA 3OCBA 1MRUA 3LOKA 4GJ3A 4V01A 1XH5A 3QZGA 4KKEA 3BQRA 3RVGA 4PTCA 4O7VA 1TQPA 3FL4A 4XP0A 5TF9A 3O23A 4NWMA 2E9VA 5DNRA 3F5XA 5IH6A 4FSUA 5A4CA 5AMNA 2IVUA 3H0ZA 5H8GA 3FQSA 4QMQA 3P79A 3RZFA 4L3PA 4FR4A 5HO8A 1ZMUA 2ZVAA 5DMZA 2UZTA 2YCQA 3GP0A 4DN5A 3MDYA 4C4JA 4GW8A 1CM8A 3DAEA 4W4YA 3SGCA 4NK9A 2P4IA 3PG3A 2R2PA 5AR7A 3VW6A 2E9UA 4MBLA 2QURA 5DT3A 2ETRA 3V8SA 2UZUE 4U8ZA 5C8KA 3G51A 1S9IA 2HWPA 3ORNA 3OFMA 3P1AA 4FL1A 4YTCA 1J1BA 3F61A 4D2PA 1KOAA 4O81A 5BYLA 5CU0A 4QTEA 3JUHA 4F4PA 1FVRA 1F0QA 4ANNA 2XF0A 4Y95A 3DY7A 4YC6A 3A7FA 4DH8A 3I6UA 3BGPA 3BU5A 2VO3A 3IPHA 4C02A 4FC0A 2C6MA 4K11A 5JT2A 2XJ0A 5ETFA 3LFSA 5FRIA 2YDKA 3LFNA 4IXPA 4CZUA 1WVWA 4FTOA 3NNWA 3BGZA 1RQQA 2ZV9A 4FODA 1ZLTA 4AE9A 4DH1A 4DH7A 5JN2A 3OY1A 2XCKA 4YJUA 5J8IA 4CRSA 3KXGA 4KWPA 2GNFA 3MH1A 2PZ5A 1OB3A 2F57A 4H39A 2Y6MA 3V5JA 4JBVA 5B2KA 1K2PA 3FKOA 3BYVA 4NFNA 3HMPA 4AP7A 1ZXEA 4FT9A 4WG4A 5IQCA 5I9VA 3EKNA 5KCVA 2QVSE 3LW0A 2IPXA 3WF5A 2Y0AA 2A0CX 2UZOA 4FEWA 2UZWE 3QF9A 4F6WA 5IA0A 4HW7A 3A7HA 1MUOA 4G3CA 2QOCA 4UV0A 2J0IA 3QUEA 2FSLX 3ZC5A 2W5BA 3BHVA 1XH4A 4QD6A 3WOWA 2JAVA 4ENXA 2VX1A 3FE3A 2YAAA 3T3VA 4D4YA 3MTLA 1LUFA 3C4XA 4OTPA 5J95A 3H9OA 5H8EA 3EN6A 2WMUA 1H26A 2O5KA 1VJYA 3D5XA 4FOBA 3POOA 4YLKA 4BYIA 4J71A 1Z9XA 3JXWA 4BCFA 3F6XA 1ZYCA 2X8IA 4WT6A 4YP8A 1XBAA 3HL7A 1H00A 4G9RA 3D4QA 4ZEGA 5BVNA 4QOXA 5GJDA 5HORA 5HQ0A 3OMVA 2VD5A 3EOCA 4FTCA 2YM8A 3C5UA 3F5GA 3F69A 4XCUA 2ZDUA 3UPXA 4O84A 4TW9A 4F7JA 3VS2A 3FHIA 2X4FA 3CPBA 3N4UA 5AP4A 3IW8A 4RX9A 3FC1X 3O7LD 4OW8A 1OKWA 3TZ8A 2YIXA 3PUPA 3GUBA 4FKGA 4EL9A 4RIWA 1HCKA 4RWLA 4UY9A 1Q24A 5CU4A 4A9YA 3VJNA 2XIZA 4EHZA 4RWKA 3BZ3A 3PE1A 4QQJA 3CGFA 3UNZA 4DGLC 3HAVA 4QMOA 2QU5A 4F7LA 4AA5A 3SX9A 3VQUA 4DT8A 1H01A 4MXCA 1I44A 3BIZA 4JDIA 2X81A 4G5JA 3CE3A 3ORKA 3QD3A 4HYHA 5BVOA 4DTBA 2YJRA 4S2ZA 1DAYA 2VTMA 3W2CA 4QP9A 5EKOA 5EDRA 5EQEA 1NA7A 3HV6A 4EJ7A 3C0HA 2DYLA 3CLYA 4JBQA 5F95A 5IISA 1M2QA 2CGWA 4CMOA 3MA3A 1KE5A 3LLAA 4EOIA 3NPCA 3ANRA 4J7BA 2ZB1A 4B6LA 5DYJA 4I94A 3MPMA 5DR9A 3Q9ZA 1ZRZA 5E8YA 3UPZA 2PL0A 1F3MC 3ZBFA 3R7YA 3R6XA 2HIWA 3SXSA 1YWRA 3C13A 2RIOA 4IVAA 3WBLA 5AAEA 3GBZA 1Z5MA 3T9TA 1GZ8A 1OM1A 4FZAB 5E8ZA 4MNEA 3VUHA 3KREA 3EFJA 1PF8A 3CBLA 4AGDA 1UKHA 4BDAA 3AC8A 5CAUA 2RFDA 5I3OA 4KABA 4KBCA 2UW7A 2VTQA 4L68A 3UJGA 2ZMDA 3F3UA 5I9UA 3RTPA 3VC4A 4D1ZA 5KMKA 4KUJA 4EHVA 4O86A 1OL2A 2XK3A 4A9TA 4YC8A 2VTOA 2VTNA 5AP3A 3PJ3A 3UYSA 4EOMA 2VO0A 4Z16A 5IA1A 5IQBA 5J1VA 4FEQA 4I6QA 2WQNA 4FNYA 4K77A 4OLIA 3QX2A 4E6AA 5EG3A 3U87A 3UIXA 2CLXA 4ZJJA 1BMKA 4TWOA 1V0OA 3Q52A 3Q4ZA 2CGXA 3IKAA 4ZJVA 2J0MB 5E9EA 2ZM3A 2XP2A 5E8UA 3SQQA 3C4EA 3KKVA 1JKSA 4FV2A 1Y57A 2VX3A 4FSTA 4EKLA 5M44A 3MIYA 4M84A 2YEXA 5CF4A 3TV4A 3WE8A 5LQFA 1ERKA 3E63A 2XYNA 5EHLA 4CQEA 5B2LA 2PVKA 3LIJA 4DG0E 3Q4UA 3PIYA 3PLSA 2Y4IB 2X8DA 2VWXA 4LRKA 5DG5A 4PDOA 3SOAA 3LQ8A 5IQIA 2PULA 5TOZA 4I4FA 2VNYA 4N0SA 5HIEA 2VV9A 3D2KA 3NRMA 4GS6A 3I60A 3LCOA 5L2QA 5CSXA 5DE2A 3TKHA 5A6OA 3EQIA 2Z02A 2BTSA 4PTGA 4AX8A 4DEGA 4IX6A 3PIXA 2V5QA 1PXMA 1UU3A 3RAHA 4UN0C 2WQBA 3GU5A 4P5QA 4LOQA 1G3NA 1IASA 3NVMB 4G3DA 3GOPA 2VZ6A 3H4JA 4QRCA 3EFWA 3BWFA 4BDBA 2WGJA 2OIBA 4D2WA 3DTCA 4IX3A 4JJRA 1H0VA 1PYEA 2C0OA 5IQEA 2ACXA 4E4NA 3BYMA 2YABA 3GENA 4PF4A 5CEKA 3HRFA 3F2RA 3LMHA 3PSCA 2RSVA 3Q53A 3SXRA 3UQFA 4A4LA 2YM7A 1CMKE 5LMAA 4CMTA 2Z7RA 3DLSA 4NIFA 2UW6A 3ZS5A 3NUNA 5A46A 4GVAA 4L00A 4O7TA 2HAKA 4FUYA 4JQ7A 5JFVA 1GZKA 2YM4A 4CCBA 1AGWA 3DXNA 1KE6A 2IVTA 3AQVA 3DBFA 3QQLA 2WEIA 5CVHA 5EK7A 2I6LA 5EHOA 5IEVA 3DK3A 3FI3A 4GT5A 4HGSA 3DBCA 3NDMA 3E7VA 2V55A 4YTHA 4PDYA 3OHTA 1M2RA 5LCJA 3GC8A 2XEZA 3DBDA 3ZHPC 3QKMA 3DGKA 4TXCA 4RVMA 3LJ2A 3BHYA 2QOHA 4HYSA 4RX5A 2ITYA 4BHNA 4UMRA 4M15A 3TT0A 4D5HA 5CEMA 4GG5A 4LOOA 1SVGA 3BBTB 4O0UA 4OBPA 4PY1A 3P08A 2JDVA 4WG3A 3G33A 1OIUA 3ALOA 3COKA 3OT3A 4H3PA 3TG1A 3V51A 4ALVA 4CKRA 5EQYA 4DFYA 4M0YA 1JSVA 4XV1A 4U3YA 3NS9A 5HNGA 3R0TA 4TYEA 2VGOA 4DAWA 3FUPA 3PPJA 1ZZ2A 4NU1A 2GHLA 1U59A 2CN8A 3FI4A 3ELJA 4Q9SA 2YISA 5HCYA 2W1EA 2YLEA 3O0GA 4FOCA 4YHJA 2YM3A 1WBNA 4IZAA 1H28A 3KXZA 4IX5A 5BYYA 3WZEA 3OS3A 1R0PA 4GG7A 3QCSA 4DHFA 4GH2A 3U6JA 4BF2A 3BI6A 3D7TA 4OTHA 3SAYA 4UBAA 1LEWA 2QKRA 4I0TA 5CLPA 5FTOA 4BCKA 2YM6A 3DB8A 3EQBA 3R9DA 2YCSA 2DS1A 1BKXA 4G6LA 5JKGA 4F9YA 5GZAA 1IEPA 4HYUA 4NKSA 4JDHA 2J4ZA 3SC1A 2QOIA 4RMZA 4I93A 4KIOA 2XB7A 3IGOA 2W0JA 4BZDA 4L52A 4TTHB 4IM3A 1V0BA 3OCSA 4G6NA 4FSZA 3ZSHA 5HIDA 5HU9A 1GAGA 4PL3A 5HI2A 3GB2A 3RPYA 2C5YA 3UOJA 3QTSA 3OWLA 4J96A 5BPYA 4O0TA 3VBTA 3Q6UA 3GCVA 3AT4A 4PL4A 2PVYA 5C8MA 4HGEA 4DCAA 2VWWA 3LVPA 4RC4A 4FEVA 4M0ZA 4XBUA 2VO6A 5B0XA 5EOBA 4M7IA 2XVDA 3B2WA 2ITXA 4XLVA 4YZDA 4PWNA 3RK9A 4IC8A 3RKBA 3KY2A 4M12A 4IDVA 3ZEWA 2C6KA 4S32A 3FBVA 3ZO4A 3MH0A 3QKLA 1NY3A 2VWZA 2BIYA 2OJJA 3TNPC 2WIPA 3BE2A 3VS3A 3EB0A 3BYSA 3R9OA 5C9CA 4ZTHA 3AD4A 3TI1A 3V5WA 2W5HA 3L8PA 4AFEA 4JXFA 1W8CA 4EOOA 4PNKA 4OR5A 4O7WA 2WO6A 1GIIA 3LQ5A 4D1SA 3ORMA 3RMFA 4IB5A 4MXXA 3E93A 1J91A 2B9FA 4I22A 3MPAA 4RX8A 4BTKA 4JQ8A 3W55A 4C62A 2H34A 4GMYA 1YW2A 1BLXA 1OUYA 1DAWA 2JITA 2CJMA 2WU6A 3GQIA 4E1ZA 5IU2A 2ITUA 3PFQA 4IAZA 2W1HA 1FQ1B 3RZBA 4MXZA 5K4IA 1SM2A 2UVYA 3FMEA 3PRFA 3E88A 3UZPA 4YSJA 1MP8A 3F5UA 1WMKA 3GVUA 1Q8TA 3OXZA 3LQ3A 1PMUA 4IIRA 4RJ3A 5J9ZA 2NRYA 3C4CA 3HDMA 3HV3A 3JVRA 2C6LA 3AGMA 5CU6A 4FX3A 4R77A 3D5UA 4GFMA 4J53A 4U81A 4E20A 4CGAA 4F7NA 2RG6A 3LKMA 5M4CA 4QYFA 3TEIA 5JQ5A 3A60A 1KUTA 4GKIA 3PA5A 4Q5EA 1AQ1A 1FPUA 3KC3A 4I4EA 5AUWA 5HVYA 3RGFA 3WZDA 4AW1A 2WU7A 3FMJA 2X0GA 3CQUA 4B99A 5JK3A 3MJ1A 5DEYA 4C3FA 5CI6A 4FTMA 4W4WA 5AR4A 3UYTA 4ZY5A 1OKYA 4CG8A 2VU3A 1KE8A 3CKWA 4V0GB 3KN6A 4ITJA 2IJMA 1GNGA 3FXXA 3LAUA 3ZTXA 4DFLA 4H1JA 3UE4A 3QQUA 2BTRA 5LXMA 4QTBA 3VWAA 4IAKA 4RC2A 4BGHA 3OWKA 3HUCA 2HY0A 4MNFA 5AUZA 3FI2A 1UWHA 2XK4A 2W9FB 4CNHA 4DEDA 3JR1A 3O7LB 2HENA 3KCFA 1PXKA 4KKGA 4NJ3A 5HVKA 5EW8A 4L46A 5LWMA 3UVQA 3ZBXA 3MI9A 4EHGA 1AD5A 5HIBA 4DEBA 4FI1A 1KV1A 2WMBA 1B39A 4FKOA 4LQMA 3S2PA 3Q4TA 2Y6OA 3MFUA 3TXOA 5BVDA 1PW2A 5KMIA 2VTRA 2R3QA 5ANOA 1PYXA 1ZOHA 5FQDC 4EK4A 3U54A 2E9PA 4ZOGA 5FXQA 5HESA 3WE4A 2QOLA 5F1ZA 3TWJA 5J9LA 3P86A 4EI4A 2BMCA 2RKUA 1CTPE 2UZDA 1Q3WA 4X0MA 5CF6A 4HNIA 4P2KA 4CTBA 1BYGA 3GC7A 1O6LA 2GDOA 5DVRA 4J95A 4NZWB 3DDPA 4C7TA 3VQHA 4N57A 3HVCA 4OT6A 4Z7GA 4M68A 5CEQA 5AV1A 4FV8A 3IS5A 5M4UA 5CX9A 5M08A 2BUJA 1YQJA 3A8WA 4ANQA 3DFCB 3OXTA 4HCTA 3RK5A 3PPKA 4A9RA 3QRIA 3L8XA 4DG2E 3ROYA 4KBKA 1Q5KA 3ZUTA 3LJ1A 3QTQA 4J99A 1Y8YA 3KRLA 2IWIA 2XKEA 1OECA 2PMOX 3S95A 2CNVA 5HD4A 1GY3A 2VTAA 4JRNA 3OEFX 3F2AA 4YU2A 5IUHA 3F82A 4X6RA 2BAJA 4OBOA 3NMUF 4GCJA 3HGKA 4QP6A 2BZHB 1QPCA 3W2RA 1IRKA 3ZRLA 3QLGA 4EZ7A 5IEXA 4YNOA 2X6DA 1K3AA 3S1HA 1UNHA 3QLFA 3VUKA 3C4ZA 4WIHA 2ONLC 1OMWA 4ANLA 4G16A 1MRVA 2ITQA 4ZSJA 4QTAA 4CLIA 4X3FC 3RPVA 4LMUA 4Z7HA 1JOWB 3UP7A 2WB8A 4ZZMA 2UW5A 4AE6A 5BMSA 2WMAA 3ZDIA 4ZJIA 4XHKB 5J1WA 5IF1A 2WEVA 4N6YA 2XS0A 4ZLOA 4EWHA 4YO4A 3O17A 3QC9A 2VTLA 3LFAA 4Y5QA 5GZ9A 1B6CB 4FTUA 4X6QC 3FZRA 5LMBA 4HVGA 1L3RE 3FQEA 3QWJA 3QHRA 4RIXB 4Z9LA 2VTTA 1GIJA 2X7FA 2AC5A 3LXLA 5CSWA 4CCUA 2XIRA 3N9XA 3TNIA 2UW4A 4EBWA 2ONLA 3MFSA 2OZAB 5H9BA 1OPJA 3GNIB 3DJ6A 4OUCA 4E73A 3L9NA 4E93A 3R7EA 2H8HA 3DA6A 3KL8A 3DBEA 3FKNA 4I5HA 5C1QB 5JRQA 1CKPA 3A8XA 5AIKA 1W82A 5IH5A 2J0KA 4ZLYA 5BUEA 4I24A 3Q2MA 3S0OA 3LCTA 2XNGA 2X9FA 3DZOA 5J7HA 5DOSA 3R8UA 5CEPA 4JI9A 3WZUA 5KX8A 4U79A 4A7CA 1UU7A 1Y91A 2EXEA 3AG9A 1TKIA 2LAVA 2PZIA 3U55A 1O6KA 3Q04A
chains in the Genus database with same CATH superfamily
4XBRA 2DQ7X 4PDSA 3ACJA 4P5ZA 2Y4PA 5AR3A 2GHGA 2OH4A 4JIAA 4H3QA 4NFMA 4CMUA 3VULA 4IACA 3CTQA 4EHEA 3LFFA 1ZYDA 2PZYA 5T6KA 1SMHA 4GSBA 4BC6A 4FYOA 5J87A 3E3PA 5KMJA 2GCDA 2WZJA 3FMKA 4C4FA 5ANDA 3BGQA 3HV4A 2HELA 1DI8A 3ZH8A 3E8EA 4LDTA 5H3QA 1QPDA 5AAGA 3FZOA 5F4NA 1ST0A 2IN6A 1MRYA 2XIXA 4GU6A 4WBBB 4QP1A 5DRBA 4H05A 2QR8A 3BHHA 2FA2A 1ZOGA 5ACKA 4BDCA 5M07A 5JRSA 5C4LA 2GFCA 3PP0A 4FVPA 1A06A 4QP7A 2O64A 3DS6A 4UXQA 2GNJA 4AN3A 3RK7A 5KUPA 2P3GX 3Q5ZA 4L45A 4LM5A 2W4OA 4M67A 2FSMX 3TDWA 2B0QA 2J5EA 2WAJA 2OGVA 2PTKA 2VWIA 3PWDA 4C2WA 5EM5A 1OKZA 4IWDA 4F9AA 3FSFA 4TYHB 3BL7A 3PYYA 2HZ0A 4ACDA 1M7NA 3AMAA 4I5MA 3TYKA 3V6SA 2YHVA 3V5QA 4C36A 5HU3A 4AN2A 4NTTA 3TN8A 3M1SA 4I21A 5AIRA 4QPMA 4F1OA 4HJOA 4QYYA 2HK5A 4QQ5A 4UWCA 4WUAA 4PDPA 2BKZA 2HCKA 5LARA 3WARA 2ZOQA 3DK7A 3MV5A 5HE1A 3SW7A 4QMYA 4UYNA 2QOFA 2C5VA 2NP8A 2QI8A 1Q8ZA 1PXPA 3QYZA 4JIKA 5ETCA 4AZVA 1R78A 4NJDA 4RSSA 3IO7A 4EOKA 3UQCA 4JG8A 4GT4A 4IZ5A 1IAJA 3DXPA 1YHWA 2XKDA 3R1YA 2PSQA 4BDGA 4EJNA 3N4TA 4BIDA 1UKIA 3LCSA 1U4DA 3K54A 5JFWA 4F1TA 4EH7A 2WOTA 4ITIA 2AQXA 2VTHA 2OFUA 3NYVA 3ZLYA 2B54A 2AEGA 2PVRA 3MA6A 1KE7A 4Y73A 2HW7A 3EKKA 4AOIA 5KBRA 2QONA 2R3OA 4ASEA 2WXVA 4G2FA 3E87A 3RBWA 4TWPA 4BY9E 2VGPA 3NNXA 3ZO2A 3NUUA 3MVMA 1U54B 3TIYA 5KKRB 2X4ZA 3S3IA 5I3RA 1JVPP 3O8UA 5DFPA 4AOJA 5AUTA 4PTEA 3EZRA 3DJ5A 2WTDA 4FSWA 4FGBA 4GFGA 5CTPA 1PXIA 2XKFA 2RFNA 4IC7A 4C35A 3U6IA 4FT0A 4PQNA 4DTAA 3KU2A 1A9UA 2WELA 4ORKA 2ITVA 3NYXA 1XH8A 5EYCA 5BQ0A 5HBHA 4GIIA 3BELA 3A62A 3OVVA 5D12A 1Q61A 4DFXE 5E7RA 1IA9A 1RDQE 3E3BX 4YZCA 1ZYSA 2X2MA 3DQXA 3RHXA 2F7XE 4HZSA 4V05A 1JWHA 4FNWA 1Q99A 1WAKA 4ZY4A 2BDFA 2XMYA 3H9RA 2XZSA 5JZNA 3FEGA 2X9EA 2XNOA 3VW8A 4DLJA 3JYAA 4NT4A 3UDTA 4IE9A 4M69A 3I4BA 4FKJA 4RIOA 4TY1A 4BBFA 1WVXA 3KVWA 3R7IA 4DE4A 2JKMA 4U6RA 1H07A 2QOOA 4BI1A 2F49A 5IG1A 2C30A 2CN5A 2JD5A 2PZPA 2QO9A 4RJ5A 3ZZEA 3MBLA 4XV9A 1DM2A 5CS6A 1H08A 4CFMA 3H10A 5EM8A 1WVYA 3PXQA 4CFVA 2X0QA 4DHJA 4GK2A 3II5A 2R9SA 4C3PA 2GQRA 4FEUA 3RPRA 2NPQA 4EYJA 5K0XA 2J7TA 2JIIA 2J5FA 3NW7A 4J98A 2HY81 4RRVA 4YC3A 5HE0A 5IQAA 4F6UA 4E4MA 5FWKK 3A99A 2BCJA 3QCXA 3MB6A 2OJ9A 4G3EA 3NVKI 3OTVA 3IQ7A 1R1WA 3BV2A 4BCNA 5FXRA 4IFCA 3U4WA 4CYJA 2P2IA 2C0TA 5AA8A 3DCVA 4C38A 5IUGA 5J79A 5A6NA 1Q62A 3TZ7A 3I0OA 3W1FA 4FKUA 1XH9A 4PUZA 4ALWA 3VRZA 3HP5A 4AZEA 5E1EA 2ITZA 2WFYA 4N70A 2PMIA 3R01A 5LCKA 3MWUA 3UQGA 5AUVA 3MYGA 2AC3A 4O1PA 3LM0A 2FH9A 1FMKA 2G01A 4KBAA 3UVPA 1ZARA 4OAUC 3R22A 4IVBA 3UMWA 2I7QA 3ZUVA 2QU6A 4GEOA 3VS7A 4WNKA 4BZOA 4QMUA 4Y5HA 5L8JA 1OPLA 4PMTA 3C4FA 4FICA 3K5VA 2WTKB 5TT7A 2YLFA 4J1RA 3QL8A 4FTJA 2I40A 4F0GA 2PVJA 3AT3A 3CD3A 4QMLA 4ACGA 3HRBA 2GNHA 2XM8A 3FLQA 4RIXA 2NNWB 2JFMA 3QCYA 4C59A 2W05A 1B38A 2XRWA 3VUMA 2YCRA 4BFMA 4DDGA 3R1SA 4LYNA 2BILB 3KULB 2XEYA 1J7LA 2OZAA 4MAOA 3C51A 3MN3A 3WZKA 3RWPA 4BDDA 3OC1A 4FYNA 1M52A 4AS0A 5LWNA 4Y46A 4GV1A 4EH8A 2UZLA 5I9YA 4ZS4A 3PVBA 3VBQA 5HCXA 2JGZA 2OIQA 3ROCA 3DT1A 2NRUA 3VS0A 3MPTA 2JKKA 3ZFMA 1FGIA 3NGAA 4L53A 4O27B 2BDJA 2CKOA 3W0MA 4NM7A 4MH7A 3A4OX 4EH5A 3NZ0A 3WZJA 5HG9A 3PXZA 3V3VA 3FHRA 5AWMA 3OWJA 4BIBA 1OIRA 4MBJA 4YJSA 4D55A 3I7CA 4HCUA 2WKMA 4M66A 4QYGA 2Z2WA 2ZJWA 3VN9A 2R3IA 4BYJA 2UVXA 1SZMA 2B4SB 2VN9A 5DR6A 5E92A 1J1CA 2Y7JA 4RFYA 3W0QA 2JC6A 5BNJA 4JAIA 5J9YA 5IKWA 4JG7A 1P4OA 3RPSA 1M2PA 4U7ZA 3EZVA 2QG5A 3LCKA 3QQKA 2O63A 4L67A 4YBKA 2EUFB 2IW9A 3NW6A 2WNTA 3SVVA 3TIZA 3V01A 2IEWA 3FMDA 2OFVA 3CTHA 4YBJA 5D41A 5DPVA 3EYHA 3MIAA 4AT4A 3L9MA 3LHJA 4DFUA 4L3JA 4WRGA 3QD2B 4YJTA 5E8XA 5AP7A 2WMRA 2Z60A 3D15A 5L8LA 2UZVA 4O4EA 4USDA 1IG1A 1R0EA 3E64A 4XG2A 5DEWA 3NWWA 4A06A 5DT4A 4BDKA 4O38A 5TE0A 3R8ZA 1QL6A 2WMQA 4WO5A 2GNLA 5ETIA 5JMSA 5AA9A 3C0GA 2WPAA 4X21A 4ZZOA 2WMSA 1JSUA 3KRJA 3NX8A 4IZYA 4KIKB 3BV3A 3PJCA 2FVDA 4J97A 1YRPA 4ID7A 1OI9A 5DWRA 2QQ7A 1A48A 3AKJA 2C69A 4JNWA 4D4RA 5L6OA 3PLAE 1UU9A 4WBOA 5AM6A 3ZYAA 4U3ZA 4FG9A 5CQUA 3OWPA 3RP9A 4E6CA 3F3ZA 2JDRA 2VTJA 4Y72A 2CGVA 1VYZA 4WUNA 2QHNA 3QCQA 2EB2A 4AG8A 3HRCA 4D28A 5EKNA 3MW1A 2FUMA 3FPQA 3ACKA 2IG7A 1KV2A 4MQ2A 1HOWA 1CKIA 2XJ1A 3BRBA 1H1SA 4RT7A 1ZMVA 4IZ7A 4E6DA 4CKJA 3KIOC 4XG3A 4RA5A 4WRSA 5K0KA 4EBVA 1ZZLA 5TR6A 3E8NA 3VVHA 3TNWA 2UZBA 3NUXA 3AC2A 4NCTC 3VF9A 3DZQA 1KSWA 4F0FA 5FM3A 4XYFA 3SRVA 3ZXZA 2Z8CA 3QZIA 4F64A 2VWVA 2G15A 3UOKA 3KMUA 4R1VA 4C58A 3EL7A 5HG8A 3UIMA 5HTIA 3LPBA 4IM2A 5HBJA 4HVHA 3QA8A 4ZSAA 4OTQA 3GGFA 2WOUA 1BL7A 5LVLA 4WG5A 4FSMA 5M51A 2ITNA 2WTJA 4YHFA 4X2GA 3ZEPA 3ML1A 2BR1A 4WKQA 4RQKA 3ZLSA 1GJOA 2XJ2A 4O0VA 1H1PA 5CU2A 4IBMA 1JNKA 1LPUA 3KRWA 3QXPA 4HGLA 2UW8A 4W9XA 5CENA 2RL5A 5DGZA 3PVGA 3E7OA 4L01A 4BCJA 4NCTA 3D0EA 1K9AA 3KRRA 2QO7A 4L44A 4BRXA 1W0XC 4FV7A 4OBQA 5ITAA 2YDJA 2C0IA 4FTTA 4ZTQA 5HNIX 4FK6A 4ARKA 3CKXA 5ANGA 1H27A 1WZYA 4W8DA 3AC4A 4GRBA 4IAIA 5DR2A 4NSTA 4BBEA 3FXWA 3CQEA 2E9OA 3UZTA 4ERKA 2OWBA 1YHSA 4R78A 5JFXA 3V8WA 3ULZA 3ORXA 4DEEA 4QMSA 5EM7A 3P4KA 3R8MA 3F7ZA 5CALA 4MVFA 4XNEA 3Q5IA 3HECA 4JR7A 4ANOA 4AWIA 5I9ZA 4WD5A 4R7BA 4G3FA 2BPMA 2BZIB 2I0VA 3CY2A 3IDCA 4KS8A 4O4FA 4XG4A 3OF0A 4CQGA 3RNYA 4EOPA 1PXNA 2C5XA 2JBPA 3FMNA 2NO3A 3E5AA 4FV0A 5CYIA 3OUNB 5CEIA 1X8BA 2X2LA 2CCHA 2PE0A 3A2CA 2BRGA 5AV3A 3PY3A 3R04A 1URWA 3OCTA 2XRUA 3PXRA 4TWNA 4YZMA 3ULIA 3UVRA 4BWXA 2XK9A 5A9UA 2BALA 1PKDA 3TZMA 1KOBA 5I9WA 1JKKA 3MFTA 4FT5A 4QNYA 1U5RA 1H25A 2SRCA 2F2CB 2W1GA 4FV4A 4D1XA 4FZ7A 2R3HA 3VBVA 3TUCA 2XNMA 4GIHA 1XBBA 1JSTA 5IDNA 4W8EA 4F6SA 1O6YA 4AQKA 5JEBA 3UO6A 3C7QA 4ZSEA 3UO4A 2QLQA 4QP2A 3R7UA 3NFFB 3DJ7A 2E2BA 2PMLX 2OBJA 3UC3A 4EQUA 1M7QA 1XJDA 5T68A 3T9IA 2OZOA 4JX7A 3Q2JA 2I0YA 2BDWA 5IQHA 4G17A 4XJ0A 4I3ZA 4RX7A 5HG5A 2XARA 3VHEA 3TUBA 4QQTA 5HHWA 4E26A 3R63A 5EW3A 4RZWA 5EYKA 4E5BA 2NYAA 4XH6A 4QMZA 4AZFA 4K0YA 1TQMA 3I1AA 4U97A 3ORTA 3OBGA 4AF3A 4D4SA 3OUKA 3GU6A 1U46A 3I7BA 2XNNA 4OTWA 5CZHA 4ZTRA 3PVUA 5ANKA 3TACA 5M56A 3TMOA 2OKRA 5IQFA 3G90X 4BWKA 3MH2A 1YXTA 2C3KA 2R3RA 2R0IA 4AQCA 4NEUA 3DKFA 3KF7A 4CLJA 3F7WA 3P9JA 3S00A 2R4BA 4R1YA 3AGLA 3CPCA 3HKOA 3ZOSA 3FLNC 4RFMA 3OBJA 1JLUE 4MXOA 4RJ6A 4FTQA 3G9NA 3QZHA 4LI5A 3R7GA 4GYGA 4KS7A 1OBDA 2FB8A 3TTJA 1ZYJA 1LEZA 2IZUA 2WTVA 3AC3A 3FKLA 3MB7A 5D7VA 3QTWA 3UTOA 2OIDA 3V6RA 5C27A 3BLQA 3ID6C 3S4QA 4Q5HA 4X2JA 2X7GA 5D10A 2PY3A 4OGRA 2WMXA 3ZO1A 4JDKA 1GZNA 1V0PA 4E8AA 2IZRA 1BI7A 3IECA 4PPBA 4RZVA 4DA5A 4FKQA 2JBOA 3Q9WA 4U42A 4BZNA 4PPAA 2W99B 4AXAA 3D5WA 4M97A 2VTPA 1T45A 3SV0A 2CNUA 4FNZA 1OITA 3QTXA 4FTLA 5EM6A 4DEHA 3ETAA 3GFEA 4CFNA 4UWYA 4A07A 3BHUA 1OZ1A 3JPVA 2XIYA 4RBLA 1YDTE 4RA4A 2C3JA 3MY5A 5DT0A 4YUQA 3U4UA 4XS2A 5EFQA 2B53A 4OT5A 3FZTA 4FA2A 2JAMA 5IQGA 2F7ZE 5GIOE 4IX4A 2XK8A 4D9UA 1UNLA 1XHAA 2XCHA 4OTIA 3VS6A 3ANQA 2PVNA 3G0FA 4EZ5A 3QBNA 3QAME 5IH4A 2PUNA 4RIYB 1J7IA 4MD8E 4QPSA 2XKCA 3RM7A 5HEZA 4WA9A 4M3QA 4YNEA 3UDBA 5CVGA 2OF4A 3LCDA 4QQCA 3HA8A 4JQEA 3G0EA 1YVJA 3WIGA 4QTCA 4F1MA 2C47A 3AMBA 4L7SA 5E8SA 4AXDA 3PZHA 4RPVA 4UZHA 2IF8A 4BR3A 4L42A 4DGOA 4L9IA 4ITHA 3BU6A 1QCFA 2ZFYA 1OL5A 5BVFA 4X7QA 2BZJA 3RI1A 4K8AA 4YZNA 4XG7A 4I5PA 3TTIA 5JSMA 4HPTE 2Y4IC 4ASZA 3ORPA 3QTZA 4J8NA 1P4FA 4RJ7A 3ENMA 4PP7A 2W06A 3TNHA 3R7OA 4ASDA 5I9XA 4R3CA 1YHVA 3G15A 2XUUA 3K5UA 1OPKA 3R71A 5IA5A 2HW6A 3NW5A 2JFLA 4FT7A 3QQGA 1Q3DA 5AADA 3VNTA 5C26A 4XV3A 3ATTA 4C4EA 1W7HA 4QP8A 5FGKA 4BCHA 3FQHA 1W84A 4CSVA 5AP5A 5GZ8A 4M8TA 4FSQA 4R5YA 4JVGA 3F3VA 5IEYA 1WBOA 4JT3A 4PMSA 4U45A 5KHXA 2X6EA 3Q6WA 3Q60A 5BYZA 3WF9A 2Q0BA 5B7VA 3NLBA 4DITA 4FIEA 4HZRA 2YM5A 3ORIA 5HTBA 5CT0A 5L4QA 3FY2A 2YZLA 4BDEA 3KK8A 3C9WA 5HLPA 3BYUA 1CSNA 2OI4X 2R7IA 3FLYA 5JGBA 4K9YA 4IANA 5L3AA 3NEWA 1OKVA 3NSZA 4NTSA 3FMMA 3W8QA 3VUGA 3VUDA 2G2IA 2HZIA 3LJ0A 4FV3A 4AW0A 3RALA 4J52A 1OL7A 4K2RA 4DBNA 4QO9A 4E3CA 2GMXA 2GS2A 2I0EA 1NVSA 2WMTA 3R8PA 4A4OA 4UZDA 2CCIA 2WHBA 1YXSA 2O8YA 4KA3A 3HEGA 5AR8A 4M13A 5BV3A 4EC9A 1FBNA 5BVEA 3R9NA 3WI6A 3K2LA 2XH5A 1WBTA 2XNEA 3O2MA 4H58A 3QRTA 2R3LA 3DNEA 4GUBA 4LGGA 2PMNX 2XK7A 2XAOA 3HAMA 4OTFA 5CSPA 3O96A 5HICA 3UGCA 3W2SA 4APCA 3R8VA 2ITPA 4YGAA 4IB3A 3B8QA 3EHAA 1UWJA 3C4WA 3QFVA 2XANA 3QHWA 4FKLA 3I0QA 3VUTA 3W18A 3ATSA 3HMNA 3BLAA 4BCOA 5CNOA 2BIKB 5GJGA 3ZRKA 2ITTA 4DC2A 4F99A 5M4IA 1UV5A 4CFWA 5EHYA 3F3WA 4AGWA 2B9JA 5AV4A 2W1DA 4EH2A 2QG7A 4FKPA 2YCFA 4DBXA 1H1WA 4BTMA 5HD7A 3WILA 5IUIA 3K3JA 3ET7A 5A4QA 1IA8A 4LL0A 3DV3A 2UW9A 3OXIA 3NUSA 4DT9A 2XBJA 2ETKA 4DFBA 3SHEA 4KB8A 1NW1A 1PXJA 4HYIA 5TO8A 2BRMA 2HZ4A 2VTIA 3QGYA 1OUKA 5FTGA 1UNGA 4R6VA 4N4SA 4GKHA 3QD0A 3UMXA 4XRLA 1W98A 2YWVA 4O82A 2HZNA 2ZAZA 1NVRA 4MQ1A 3SD0A 2C3IB 3A4PA 3F88A 4B4LA 4MX9A 3IDBA 4RWJA 3OOGA 2QHMA 3E8DA 3D94A 5KBQA 4AGCA 1J3HA 3CS9A 5D9HA 2QCSA 4MCVA 1BX6A 3P7CA 4I1ZA 5FTQA 3H30A 5A14A 1HCLA 4FIIA 3IGGA 5DN3A 4BDIA 4C2VA 4O0SA 5HNBA 5L6PA 3UOLA 4FK3A 5K3YA 5AAFA 4DCEA 2R0UA 4G34A 4YO6A 3QC4A 4C4HA 3W32A 3D5VA 2V22A 3I5ZA 4BKZA 4KKHA 3QUPA 4BGQA 5FDPA 1BL6A 2CLQA 4K33A 4QYHA 4BCGA 2ITOA 3CIKA 3NR9A 3Q32A 2RGPA 3QQFA 4I6FA 4XP2A 4ACMA 4BI0A 5J7BA 2W9ZB 3JVSA 4G9CA 4LUEA 4YJVA 5JZJA 3HMIA 2ZMCA 3U8WA 5G1XA 4H3BA 5AP6A 3ZRMA 4ANMA 4BVUA 2AYPA 5AV0A 4QNAA 5IA2A 3GT8A 3RAIA 4FZFB 5A4EA 5HX8A 2R7BA 3G6GA 4CV8A 1NT2A 5CXHA 2Q83A 3TZ9A 4QTDA 4O2ZA 4WSQA 1WBVA 1OGUA 3SKCA 4ZZNA 5C01A 2VRXA 4FSYA 4K6ZA 4E4XA 3P7AA 3GC9A 1PMNA 2BKKA 1ZWSA 3EQHA 3ZO3A 4AN9A 4BGGA 1OIQA 4EEVA 2YIQA 4EKKA 3UC4A 2ZB0A 1H1RA 5F9EA 4TRLA 5KMOA 5HZNA 4IB1A 4TN6A 3KMWA 3WF7A 2HWOA 4K18A 2VWBA 5KHWA 3SG8A 5HG7A 4L3LA 2IVSA 2PZRA 2OJIA 4D4VA 4HOKA 3T8OA 4W4XA 4ZLZA 4X2KA 4XRJA 2XA4A 3NCZA 5EDQA 5ETAA 3LE6A 4BJJB 2YZAA 4IMYA 3U9CA 3UNKA 3O51A 5EI2A 4G6OA 1CKJA 3FWQA 2CNQA 2ITWA 1SNUA 3MFRA 4QMVA 4CXAA 2CSNA 4HCVA 5L2SA 4G5PA 2YITA 5IZFA 4GJ2A 4JX3A 5FUTA 1Q8YA 4BDJA 5IMEA 3OY3A 3FZSA 4DH5A 3CSVA 2IO6A 4A4XA 4R3PA 2YDIA 4DFZE 3PFYA 4B8MA 4I0SA 1S9JA 2GPHA 3H0YA 3KXNA 4GL9A 4O6LA 4QYEA 5HKMA 4DGNA 4QDEA 4IDTA 3CJFA 1WBSA 5A54A 2CPKE 3R00A 3U51A 3UIUA 5L2WA 3OW3A 4MD9E 4G3GA 3B8RA 3ZUUA 4X2NA 3W33A 4HNFA 3FL5A 5EH0A 4F9CA 3FJQE 4IWPA 2H9VA 3PJ1A 5CY3A 2OSCA 2P55A 1OVEA 4YHTA 2GTNA 1ZAOA 2XNBA 1LP4A 3UIBA 3V5TA 1UA2A 4FMQA 4N6ZA 4ZTSA 3R9HA 5FBNC 4LFIA 1MQ4A 5FM2A 1PY5A 3D83A 4FVRA 4WSYA 4BKJA 4FT3A 4E6QA 1V1KA 4V0GA 4FIGA 5AUUA 2VX0A 3RJCA 1O9UA 3HV7A 4H1MA 4TT7A 2I0HA 5CAOA 3QUDA 1WCCA 3LXKA 3QRKA 5E1SA 3O8TA 3KXXA 4I6BA 4AA4A 2X1NA 4DGGA 3FXZA 2W17A 5H2UA 4X2FA 2JEDA 3BE9A 2IW6A 4LRJA 1ST4A 1Z57A 2J0LA 3COMA 3NAXA 3RINA 1SYKA 5EOLA 4FTIA 1ZY5A 5F20A 4E5WA 5BUIA 3UG1A 1FVVA 3QD4A 3ALNA 2C5OA 2G9XA 3FZPA 4DEIA 3QZFA 2OXXA 3LFDA 1J7UA 2HXQA 5HTCA 4BCMA 5A4TA 2B7AA 5EYMA 3HZTA 4U5JA 1TVOA 1XWSA 3PIZA 3PRIA 2R5TA 4TNBA 5BX0A 2UW3A 4BIEA 3UNJA 4AGUA 4D9TA 1WFCA 4CZYB 5M53A 3F5PA 5JGAA 4MEDA 3OT8A 4EH4A 4QMWA 3MVLA 3KRXA 4CYIA 3EIDA 2V62A 3MSSA 3COIA 1PMVA 4DF3A 2VTSA 5M4FA 1IAHA 3L9LA 4IQ6A 4D58A 3CXWA 3EQGA 4EOSA 3ITZA 2O2UA 2YIYA 4WNMA 3QTRA 4DH3A 5JQ8A 2F4JA 1DI9A 1JPAA 4KD1A 3DXQA 2C68A 5JFSA 4ANSA 1YWNA 4O4BB 4ZSGA 3ZZWA 4EONA 5LJJA 5LVPA 3NCGA 3D7ZA 4QP4A 4ZY6A 3OW4A 4C37A 3IOPA 4OTDA 4C0TA 1P2AA 4IWOA 3ODYX 4F9WA 3V8TA 3VS5A 5KO1A 2O65A 3O8PA 4NIFB 4LRMA 3O50A 4O22A 4PNIA 4CFUA 4S34A 5IA4A 5E4HA 3AC1A 4RLLA 4CVAA 3KQ7A 5AX9A 2GQGA 1KWPA 4FVQA 4FKIA 2OJGA 2BRHA 1R3CA 2UUEA 3P0MA 2Y8OA 3E62A 4RGJA 4ERWA 5CEOA 4O21A 3QWKA 3LXNA 3BX5A 4FNXA 4MF1A 3PUFC 4QMXA 2YWPA 3TL8A 4AT3A 3PXFA 4HPUE 4LL5A 4WNOA 4Q9ZA 3EQRA 4ZS0A 5CZIA 5E8TA 5I0BA 4O0RA 3CCNA 3WF8A 3IW7A 3ORLA 3CGOA 4GU9A 1Y6AA 4E4LA 5GNKA 4C61A 3R28A 3LXPA 5LVOA 3DU8A 5CSHA 2JIUA 5GINE 5HO6A 3G2FA 4UWBA 2H6DA 5JH6A 3L8VA 4UMPA 5C8NA 4F78A 3F3TA 1ATPE 4RJ8A 4AW5A 2GSFA 4DINA 1H24A 4AUAA 3HA6A 5KMMA 4FKWA 4JOAA 4XLIA 3FLSA 4IFGA 2IVVA 3C1XA 4RG0A 1W2CA 4KAOA 4FSNA 4DYMA 3QTUA 1M17A 2EVAA 5CI7A 5E8WA 4CRLA 4X3JA 3SA0A 2YFXA 3QRUA 3ZMMA 3M42A 3GCPA 3D7TB 5M09A 3HYHA 3KXMA 4NW6A 3EQFA 4O0YA 2W4JA 4PRJA 2ZM4A 5CT7A 2OF2A 3RCJA 3W0NA 2PWLA 3PJ2A 1YOJA 4MXYA 3KB7A 4S31A 2XK6A 5AUYA 1XH7A 5IPJA 3ODZX 2QODA 4F08A 3Q9XA 3MGYA 4F09A 5GIPE 3JY9A 1YXUA 3N4VA 3BHTA 2FGIA 2X8EA 5AR5A 3CTJA 3MTFA 4I6HA 3ZCLA 3U6HA 2PUPA 1ZY4A 4U0IA 5AP2A 5M55A 3TJDA 4O7YA 4O6EA 3R9RA 3GEQA 2R3PA 2UZNA 5FEDA 3I79A 1VYWA 4BTFA 2W1ZA 5A3XA 4O1OA 3H9FA 4P4CA 4EORA 4O7ZA 4O91A 5CANA 3RPOA 3L1SA 3BWJA 2CHLA 3FMHA 4TNDA 1Y8GA 2R64A 3FLZA 4R5SA 4R3RA 4YLLA 5FBOA 3OCGA 5EQPA 2J6MA 3L9PA 3PVWA 1PKGA 3QRJA 4IVDA 3VBXA 3ZSGA 4PPCA 4M14A 3KF4A 4YTFA 4DEAA 2GS7A 1BI8A 4O7NA 4TYIA 1TQIA 2V0DA 2BFYA 4U80A 3ZU7A 3HMMA 4AFJA 4I92A 4BDFA 3DK6A 5DRDA 3NAYA 1YXVA 3DBQA 4RFZA 5CU3A 5IDPA 1I09A 3CR0A 2RFEA 3RAWA 4EH6A 4A9SA 4JR3A 4TYHA 3HX4A 4ZK5A 3NIEA 2CGUA 3FAAA 2ERKA 4EYMA 3G6HA 1F5QA 4BJJA 2W1IA 2W96B 3VHKA 3ZXTA 3OD6X 5KZIA 5M57A 3TDVA 3A61A 2JKQA 4I20A 3VRYA 2PVFA 4AT5A 5KKRC 3LFCA 4PMPA 1R39A 3DPKA 4QMPA 2B52A 3V5PA 5AJQA 1YDRE 4C34A 4FV6A 4ZXTA 4EOJA 4JAJA 5AM7A 5KE0A 3SDJA 2PVHA 4XV2A 5IQDA 4FEXA 1WBPA 3EFKA 4CFFA 4UMQA 3BEAA 2BROA 3G5DA 4R8QA 4ACHA 1XQZA 1SVHA 1FOTA 4DHZA 5FEQA 4LV8A 3KN5A 4AZSA 4MKCA 3RCDA 4ZMFA 5CXZA 5CSVA 2BVAA 4I23A 5HX6A 5AV2A 1E1VA 3E92A 3R02A 1XMMA 1T46A 4UMTA 2XNPA 4DHIB 5K4JA 4LMNA 4YPSA 4JBOA 2ZM1A 4XG9A 4EOQA 1U54A 2B1PA 3HP2A 3FMLA 5HE3A 5EI8A 4JMQA 3ZFXA 4EH9A 4UMUA 2WMVA 5TKDA 5GHVA 2VUWA 2X0PA 3RAKA 3PWYA 3KK9A 2IZTA 4PMMA 3MS9A 3Q9YA 4BCQA 3PPZA 2PE2A 4MUQA 3CEKA 3R1NA 2GFSA 5LOHA 4NL0A 3PP1A 4LV5A 4MWIA 4U44A 4XOYA 3JS2A 5DIAA 5JGDA 1YKRA 1VR2A 4CEGA 1G8SA 1UVRA 4O83A 2BFXA 4USEA 4AACA 4AZWA 5AP1A 5EYDA 4BBMA 2LGCA 4HGTA 1M14A 4EH3A 3OTUA 3NUYA 3IONA 2YN8A 4V04A 2W5AA 2YAKA 4G1WA 3QTIA 1FINA 3FYJX 5GJFA 2CDZA 3WF6A 1H1QA 1JKLA 4KSPA 2UW0A 3PJ8A 2GTMA 4YPDA 2JLDA 3ZLWA 3DLZA