4XG7A

Crystal structure of an inhibitor-bound syk
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
266
Chain Sequence
YLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKNEAPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 266
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xg7A01
4LV8A 2QOIA 4ZSAA 3FKNA 4PTCA 2XH5A 4XG8A 1T46A 2XNOA 4O1PA 2G9XA 2X8EA 4AT3A 2DWBA 2Y9QA 3ODZX 4HGEA 4G5PA 5EOBA 3GXLA 1ZARA 4FKQA 3TTJA 3U55A 3T3VA 5AP3A 4FV6A 4DCEA 2J0LA 4JLCA 5EM8A 1PRYA 4BCJA 2XK6A 4NIFB 3ZS5A 5B7VA 4FTTA 4E6CA 4ZEGA 4E3CA 4BDKA 1J1CA 4AQCA 3IOPA 2R0IA 3QQUA 3QUEA 3KMMA 5TOZA 4QMVA 3QZHA 3KF7A 4EOLA 1GIJA 5AUWA 4H3BA 2RG6A 2ZDTA 4UXQA 3RHKA 5M53A 5HHWA 2B9FA 4ACMA 1AQ1A 4ASDA 1H1SA 4P90A 4JG6A 5M4FA 5A54A 1FMKA 3MS9A 5DN3A 1BYGA 1PXKA 3Q52A 2QOLA 3L8PA 3DAJA 3WZKA 5DLSA 5T68A 3O71A 1OBGA 2Z02A 4EWHA 5ANOA 5H3QA 4GVAA 4M14A 5C1QB 2VNWA 3BYSA 1GZNA 3KXXA 3UC4A 1YWNA 1H26A 2UZLA 1WVWA 3IDCA 2A19B 3ORLA 4AA5A 3F7ZA 4FIJA 4NKAA 3PY0A 4WG5A 4XV2A 2O2UA 4GUEA 4QMXA 5L8LA 3OFMA 1UKHA 4OT5A 2G2IA 3PXQA 3G2FA 3GC9A 2ZOQA 3NYOA 4L3LA 5F95A 5GZ9A 3CSVA 2XA4A 3FI2A 3D94A 3FL5A 3NGAA 1G8SA 1ZYSA 2QOOA 1XH4A 4FT7A 5HG7A 3R9NA 5CEKA 4OAUC 2W99B 3TNPC 1YDRE 4NM7A 2BFXA 2CSNA 3SA0A 2C0OA 3VUHA 1UU3A 3F2RA 2GSFA 2YCFA 4GG7A 4QQ5A 5L4QA 4HNFA 3FMJA 4BY9E 5E91A 3LLAA 2I0VA 1R1WA 3MN3A 3QTUA 3VRYA 3AC8A 1PMNA 4YJOA 4I20A 4FL1A 1FVVA 2Y4IB 4CFFA 1YQJA 2C3IB 3PVBA 2XBAA 4C2WA 5LARA 3R1NA 4ALVA 3VF8A 3NCGA 5A46A 2OJIA 3ZEPA 2XK9A 3ZO4A 4PL4A 3C9WA 1KSWA 3OTVA 4C33A 2VV9A 4R7IA 2BDFA 2HOGA 3NZ0A 2PE2A 1JKKA 2BILB 1XH8A 2LGCA 3V51A 4FTJA 4LL5A 2GQGA 3DBQA 5FDXA 3R8UA 4I92A 5ANJA 5J9ZA 2VX3A 3FLZA 2SRCA 3CY3A 3MY1A 3W2PA 1YDTE 5K3YA 4A4OA 4RJ7A 4D4RA 3R7IA 3RZBA 4Y95A 5M57A 4DFLA 4UB7A 4FKRA 1JVPP 2P3GX 4MF1A 4Y85A 4PDPA 5F4NA 3VUIA 3BGPA 5H8EA 3S4QA 1V1KA 2PVYA 4O84A 4FTQA 5AUXA 3WBLA 4IWPA 4UYNA 3QKMA 2ITXA 1PYXA 2JAMA 3UGCA 4HNIA 4KIKA 2R9SA 4RC3A 3NUAA 2GTNA 3CXWA 3F61A 5HIDA 5B2LA 4IMYA 1FGKA 5BPYA 4DITA 4IVAA 3V3VA 2WZJA 4M69B 3AT3A 3O8UA 3I6UA 4RT7A 5H8GA 4RPVA 3UP7A 5AUUA 5LCJA 3P86A 3OEZA 3R8LA 4RIWB 1TKIA 2VO7A 5GINE 2BIKB 4MF0A 4UWCA 3GB2A 5KMIA 4CLIA 4S31A 3ULIA 4C3PA 3C13A 3RHXA 3VUDA 1Q3WA 3O96A 3GQLA 1BX6A 4FK6A 1Q3DA 3U87A 4XOYA 3I7CA 3EQCA 4EQMA 3KY2A 5FGKA 2XRWA 4FSNA 4NW5A 3CY2A 4RIXB 1OMWA 4EKKA 4FKSA 3E3BX 5HI2A 4DT9A 2OZAB 2HYYA 5KKRB 3U9CA 2R3HA 3NLBA 4MH7A 3PRFA 3TNQB 2QO7A 4ITIA 4MVFA 2G2FA 4HZRA 5HIEA 2HXLA 3DJ6A 3FZRA 3VO3A 3IG7A 4NK9A 3NW7A 1WVYA 3QTWA 4YZCA 3SXSA 4QTEA 4ZMEA 2GTMA 3SVVA 1ZLTA 3G0EA 3BI6A 4IXPA 3MY0A 2X4ZA 3ZEWA 2YLFA 5J95A 4DYMA 2VGOA 2XJ0A 1H01A 4ZSGA 3PP0A 4E4XA 3NEWA 3AT4A 4ACDA 2UW6A 4GYGA 5HTIA 3GC7A 3ALNA 4QMNA 3F3TA 4GK4A 4ENYA 3ZUVA 2PMNX 3MV5A 4FTAA 5JFXA 2OLCA 1VR2A 3DKOA 2X8IA 5CAOA 5EKNA 1PMUA 1RDQE 2C6MA 3VW8A 4ASEA 1JPAA 2C5VA 4I6FA 5I9UA 3RNIA 3TI1A 5CAQA 5IG1A 4B0GA 4MEDA 1XBAA 3BBTB 4IW0A 4NZWB 4W8EA 3SW4A 4FTCA 2GDOA 3FZOA 4S33A 4DLIA 4TYHA 4ZTMA 2XIRA 2XIZA 4BHZA 4DTKA 4JR3A 4V05A 4QMLA 3RWQA 3TXOA 4YR8A 2OJGA 3D7TA 4GKIA 2W7XA 4JAJA 4FVQA 2VX0A 2W1FA 2I0EA 4WNOA 1WFCA 4LGGA 1GZ8A 3B8RA 5AJQA 4DA5A 3OT3A 2FYSA 3O7LD 1H08A 2OFVA 3U6JA 4AP7A 2VTNA 3U4WA 5EW8A 2GPHA 4DFYA 3C4WA 1IAHA 2BRHA 3QQLA 5HTBA 4UALA 3AC2A 5BVFA 5HD4A 4GFOA 4EOKA 3I1AA 2WOTA 2BAQA 3BQCA 4LGDA 2WD1A 4HGSA 3GCVA 4FKLA 4J96A 5DT0A 5L2QA 3R7VA 1OPKA 3G9LX 3Q4UA 3FKOA 4RC2A 3ROCA 3P7CA 4C62A 3LLTA 3QTSA 4YNEA 3VHKA 4E5AX 5EHLA 1ZMWA 2W9FB 4C58A 3K54A 2UW3A 3WYYA 4LUEA 5ITAA 4NJDA 4O2ZA 1Z5MA 2VWWA 4E5BA 4AE6A 3H9FA 1SNUA 5HO6A 3EKKA 5C8KA 1MP8A 5CU3A 3Q9WA 4EKLA 5B2MA 3FV8A 3PG3A 4BWXA 3EJ1A 1R3CA 3DBEA 3DKGA 4PTGA 4TXCA 1NT2A 4YNOA 4BIEA 3DKFA 2YIQA 5J7BA 1Y8GA 3RAIA 5AV0A 3D4QA 4PRJA 4YO6A 4JBOA 3II5A 4JBVA 4Z7HA 5HE2A 4I1ZA 5EQYA 4A9SA 4AXAA 2UVZA 5J5SA 4W4VA 3W8QA 4X3FC 1W83A 1WBSA 3KVXA 3QD0A 5BUIA 1UWHA 1XH9A 4O0WA 4O0VA 5AUTA 3HMIA 3LKMA 4ZTSA 2ITWA 2ONLA 1H07A 4I5HA 4PUZA 3TV4A 2W0JA 5AA8A 5CF4A 5IMEA 1JWHA 3CLYA 2BROA 3OBJA 4FZ6A 3QTRA 3UJGA 2ITTA 3BCEA 4DGMA 4JBQA 4YHFA 3LCSA 4G3EA 1H1PA 2J7TA 3FMDA 3MVMA 4JI9A 4OTRA 5DWRA 4CMUA 5L2WA 4O0TA 2CGVA 1OKVA 5DNRA 3MGYA 4MBJA 5I3RA 5KMJA 4YSMA 3C4CA 3ENMA 5AR2A 3H10A 4IBMA 4JDHA 2ETMA 2G2HA 4RVTA 1WBVA 3DQWA 4I93A 4K1BA 3UVQA 4ANQA 5HG9A 3CKXA 3HV7A 3QRTA 4IFGA 3TZMA 5LQFA 2PYWA 3SG9A 5HVJA 3L8VA 3NW5A 2R2PA 4APPA 2EWAA 3QYZA 4RX5A 2VTPA 4GJ2A 1H24A 3ZONA 2F2CB 3BGQA 3ZXZA 4PY1A 3E8CA 2AUHA 5E8UA 1OGUA 3RINA 1ZMVA 1WVXA 4KBCA 3UQCA 2X7OA 3ORTA 4YLLA 5IH6A 2RFDA 3PJ1A 3BHTA 3RPYA 3RP9A 5CTPA 4YC3A 3JUHA 4EUTA 4HVSA 3VS6A 3A99A 4GSBA 3A62A 4OGRA 4OTWA 3PLSA 2RSVA 2XIYA 1CDKA 5EI8A 3OTUA 2XM8A 5KHXA 4FT3A 5L2SA 2CKEA 3O51A 3RNYA 3UOLA 2ZB1A 3AQVA 1J3HA 4FSUA 1QPEA 3TN8A 3HMMA 2B7AA 4D1XA 3AD5A 2F7EE 2BTSA 3D5XA 3HUBA 5LVPA 5DMZA 1FOTA 1IG1A 2C4GA 4JQEA 2WMRA 5HG5A 3MFTA 3TJCA 5BUJA 4D58A 4MNEA 5J8IA 4JX7A 3TNHA 2BDWA 3SKCA 2C6TA 3I81A 3EB0A 4YO4A 3BE2A 2Y8OA 5G6VA 3D7ZA 5IQHA 4LOQA 1ZYDA 3C4EA 3LJ1A 3OHTA 3KVWA 3UNKA 2YFXA 2YM6A 4QTCA 4RZWA 3ZRMA 4YJNA 2HXQA 4EEVA 2J0JA 2WTKC 4NTSA 3ZLSA 2JLDA 4ZY6A 3LXKA 2IZRA 5GNKA 4X6RA 3LQ5A 3RMFA 3OCBA 5M4UA 2ZVAA 3P4KA 5ANGA 4PPBA 2QR8A 4M68A 4EONA 4CYIA 4HW7A 4IX3A 3TIZA 1J7LA 2C1AA 2ETRA 2OJJA 4U3YA 2C6OA 3KMWA 3AD6A 4ZZMA 2JC6A 3LM0A 2Z8CA 3PY3A 4A7CA 1PHKA 2J51A 5IKWA 4BWKA 4FV4A 3LOKA 3TG1A 3PA4A 4UEUA 4M0YA 5ETAA 1BKXA 2W1DA 3QQHA 4FTLA 3IECA 3MFRA 5JRSA 1RE8A 2E2BA 4N6ZA 3COKA 2Y0AA 2YABA 3BHHA 4D55A 2WMBA 4O7TA 3EFLA 1PKGA 3S00A 4FV8A 5EM5A 5IH5A 5EOLA 3QRJA 5I0BA 5KE0A 2ESMA 3Q6UA 5LJJA 3PRIA 5EW3A 1TQMA 5A4LA 4S2ZA 4B6LA 4BGHA 5L2TA 2X0GA 4NCTC 5E8YA 5DR6A 5TF9A 4PV0A 2HELA 4K77A 4LOOA 4BHNA 2QOHA 4XBUA 5IA1A 3WF6A 1YXUA 2WQOA 3ORIA 4E4MA 4QMYA 4QP7A 3DQXA 3EN6A 4MQ2A 2YLEA 3R9HA 3CE3A 4BTKA 4Q9ZA 3FLSA 3MJ2A 1DAYA 2GNHA 2RKUA 2BAJA 3M2WA 2FO0A 4MYGA 1Y6AA 2JAVA 5LMKA 5M07A 3A2CA 3UPXA 3EL8A 2E9UA 4OUCA 4XG4A 2W05A 4XMOA 2AYPA 4M13A 4WG3A 4BFMA 2JEDA 2RL5A 1YOLA 2XRUA 2XNPA 3V8WA 3HV4A 4TN6A 2ZJWA 5GJGA 1APME 3NUXA 4MXZA 2UZTA 3QF9A 3EZVA 4ZTQA 5GJDA 4Z55A 2WMQA 2VTTA 4ZOGA 3VULA 3OXTA 2PZ5A 5LWMA 3QGWA 3LXNA 4FL2A 1E1VA 5CX9A 4PP7A 3KRLA 4F9AA 2R3FA 4MNFA 4QQJA 5BVNA 4O7NA 4FIHA 4RQKA 4FNZA 5AM7A 3NUNA 3A7FA 2W17A 3O8PA 4BCOA 3EYHA 2A2AA 4TPTA 3ZMMA 2JGZA 3KRJA 3UO4A 5HICA 4CT1A 5A4QA 2VZ6A 2VX1A 4ZMFA 4I23A 5A9UA 4MXYA 3OVVA 2J9MA 2JDVA 4BGGA 5KZIA 3TKIA 5CYIA 3R8PA 2UZEA 3NSZA 4AN9A 2JKQA 3DB6A 2WEIA 5A3XA 4R77A 1Z9XA 5AX9A 3L1SA 2J50A 3VQHA 3POOA 2ZB0A 4EH3A 3SOAA 5GIOE 2ZAZA 4EC9A 1CMKE 4UZDA 4XG9A 1F5QA 2A1AB 5IA0A 4AW2A 3LIJA 3RALA 3IONA 1U4DA 4XP2A 3HL7A 5E8VA 3DGKA 3CBLA 3HAMA 3ENHA 3QYWA 4FEWA 5EFQA 2VU3A 3KEXA 4IVBA 3DBFA 2PPQA 2J6MA 4FOCA 3REPA 3DTWA 5BVDA 4E4LA 3QUPA 3C1XA 3FJQE 3PWYA 3SC1A 3FC1X 3WE8A 2ZDUA 3QCQA 3EZRA 3WOWA 4ZTHA 2ZM1A 3ODYX 3VVHA 4QMTA 5EHYA 3JXWA 3Q4TA 4FNYA 4QQCA 5M06A 3BLRA 4EYMA 2VO6A 4U6RA 5E7RA 3ORPA 5AX3A 4CFNA 2UZUE 2C6KA 2XZSA 4LL0A 5CI7A 5FP6A 1ZWSA 4D4SA 3DV3A 4JDIA 2QD9A 2Y4PA 2UZDA 5HGIA 3V5PA 4MD9E 2YAKA 2JKMA 3NUYA 2ZV7A 2VN9A 3VJNA 3UG1A 4AW1A 3OCGA 2RG5A 4JDKA 4I0RA 4A4LA 4CQEA 4FSYA 5CF6A 4DEIA 1UNLA 4EH9A 1KUTA 4C59A 1R0EA 1PXOA 3QQJA 5GZ8A 5FRIA 4CKRA 4KINA 4LV5A 4O0YA 2NNWB 4QMMA 3DJ5A 1PXMA 2YDJA 3UIBA 4AGUA 4BDAA 2BHEA 2C5YA 3GFWA 4AAAA 3UQFA 1PW2A 4IAZA 3ZM9A 2F7XE 2BIYA 4CTBA 1TQPA 1VYZA 4AZWA 3FXZA 2UZNA 3FZ1A 1BMKA 1PMVA 4R1VA 5JSMA 3A4OX 4ANOA 2VWUA 4CFVA 5BVKA 5EM6A 5HNBA 2UW4A 2QKRA 4BCGA 5EHOA 2B4SB 4G17A 3UZTA 4FV9A 2UW8A 3CD8A 3FMHA 1G5SA 3IW5A 5LOHA 4XS2A 3FSKA 3VRZA 3OWJA 3K5UA 3BWJA 3OY3A 3RCJA 2UW0A 4FYOA 4FKOA 3QTIA 1WCCA 2GHMA 1OIYA 3PY1A 5AIKA 3I0OA 4CZTA 5D7VA 5M4CA 4DFNA 1VZOA 3KCFA 4XCUA 2WTJA 3Q60A 1IAJA 5LCKA 4ANBA 2CNVA 4AACA 4BI0A 4OT6A 3L9NA 4IH8A 4MWHA 4NT4A 3QRUA 4QTBA 3QHWA 3PTGA 2W06A 3EQRA 2VO3A 4TWOA 5DR2A 5I3OA 3PJ8A 3GCSA 4FF8A 3R8MA 4NU1A 4W9WA 4GK3A 5IZFA 4FGRA 3IW8A 4PDOA 3R7EA 4I0SA 1DS5A 2HAKA 2WHBA 2XUUA 2FSTX 4BYJA 1GJOA 3IW7A 4E8AA 3GU7A 5DVRA 4BIDA 4U81A 3C0GA 5HD7A 4EUUA 5BYYA 4KIKB 4HZSA 2OG8A 5HQ0A 2B54A 5CQUA 3S2PA 3GUBA 3H0ZA 4U97A 3EIDA 5AA9A 4EH7A 4FI1A 4KUJA 4XP3A 5AAGA 2W1GA 4UMQA 2YERA 4KIOA 4C34A 2JDSA 3LPBA 4ZTLA 3MB6A 1AD5A 4I5CA 3TUCA 2R3QA 3VBWA 4AW0A 2W1EA 3PSCA 3QD4A 3D2IA 4LYNA 3F69A 1BUHA 1F3MC 3MI9A 2R3LA 5D10A 1U54A 2WMXA 4KIQA 3GT8A 3HKOA 2RFNA 4R3PA 3A8WA 2A27A 2VTMA 4J8MA 4G9RA 4GT3A 5C27A 5K0XA 5CSPA 3LFAA 2O63A 3NAXA 3QXOA 3E88A 5DHJA 1MQBA 3QCXA 5IH4A 1FPUA 4XH6A 3O0GA 4JBPA 1LP4A 4G3DA 4IQ6A 1ZRZA 2F2UA 3Q4CA 2R3OA 3JS2A 2F49A 3ZBXA 4C38A 1JQHA 3ZCLA 5C03A 4H1MA 5DBXA 3ZZWA 3PSBA 4GJ3A 4J52A 4O96A 5FQDC 4TW9A 5HZNA 3R28A 3A7HA 2QOKA 3GBZA 4H05A 1Y91A 2BZKB 3WZDA 3K3IA 3QRKA 2WKMA 3EYGA 4OBQA 3PFQA 3H30A 4D9TA 3V8SA 2KULA 4LRJA 4UWBA 2V22A 3IK3A 4CQGA 3OP5A 5HBHA 4BF2A 3WF5A 3OG7A 5DRDA 3BWFA 5HBEA 3RAKA 4G6LA 4Q5EA 3P1AA 5HBJA 3S3IA 2DYLA 4RMZA 2OBJA 4U42A 4YTCA 3QWJA 5AEPA 2X7FA 1H00A 4FZFB 2NPQA 2QOBA 2WMUA 4HYUA 5DG5A 4IM3A 4Z7GA 1R0PA 3ACJA 4FSTA 3VWAA 5LVLA 5EK7A 5CEPA 4TYHB 1CSNA 3QRIA 4C37A 3NDMA 3WYXA 3O50A 1VEBA 3QQGA 5AUVA 4GFGA 2PVMA 5EDRA 4EWQA 4E20A 2YITA 4BDFA 4O6LA 4KSQA 4FL3A 4L44A 2O0UA 2YM5A 4BCHA 3BU6A 4UMTA 2XYUA 2Z7RA 2OZOA 3UYSA 3COMA 3P9JA 3QALE 5FLFA 3D5VA 1QPDA 3F82A 2LAVA 1Q62A 4DG3E 5L6PA 1VYWA 3F5UA 2WTVA 5CY3A 1K2PA 4BCKA 3EOCA 5JGAA 2C3KA 2JFMA 5JN2A 1H0VA 4M84A 4RA5A 4Y83A 4FT9A 4FEVA 4FUYA 3RPSA 2OXXA 4Z16A 1P4OA 5CNNA 2Y4IC 4APCA 4V04A 5E90A 3F3WA 2QLQA 4HYSA 4F0GA 2OIBA 4BCNA 4JVGA 3ZBFA 4I94A 2ITYA 4FNWA 4BWPA 3T8OA 4D2SA 2UVYA 3BHUA 2IW8A 3QQFA 4RZVA 3W33A 3FLWA 4BR3A 3NS9A 4XJ0A 2WELA 1OM1A 5A4EA 2WXVA 4IIRA 5CI6A 3CPCA 4IB1A 5ANKA 4O0UA 1Q61A 3E93A 4Z9LA 4AE9A 4KD1A 2ITUA 3KGAA 1GZOA 3JY9A 3HP2A 1KV1A 5C8MA 5A6OA 5J9LA 5CXZA 3RWPA 3KXHA 4GVJA 2A0CX 4RX7A 3WARA 5JQ8A 4NW6A 5JFVA 3TT0A 1J91A 3AC1A 1U46A 2QOQA 4V0GA 4ZP5A 3BIZA 4NM5A 3E62A 3FYKX 4AZVA 4BIBA 4AGCA 4C0TA 4RA4A 3HP5A 4ZIMA 4ZS4A 4QYFA 5EM7A 4A9RA 4BTMA 2HWPA 3PP1A 4RGJA 3UVPA 3IW6A 1YXTA 4WRSA 3IS5A 4UMPA 1NVRA 2IWIA 3IPHA 3OOMA 3R63A 1URWA 2BVAA 3D14A 4FE2A 2I40A 2GNJA 2IJMA 3FSFA 2V0DA 3CTHA 4LUDA 3EFKA 1IRKA 4IAYA 5CZHA 4ASXA 2HZ4A 2PK9A 3UNZA 3ITZA 5IEXA 3FZSA 2XKDA 3CR0A 3KC3A 4H36A 4JL9A 4F1OA 2XK4A 3D0EA 1CTPE 4O21A 5HNGA 1JKTA 3KRRA 4WBBB 4YHJA 5CVGA 4NYEA 2QNJA 4E5WA 5LVOA 2EXCX 2ERKA 4TYJA 2W5AA 1SMHA 2QI8A 3QTXA 2HZ0A 3ZSGA 2X81A 2JBPA 3ZC5A 4NM3A 4R5SA 4C8BA 1K9AA 3P79A 3T3UA 4CVAA 4IM2A 3COIA 3ELJA 2B9IA 1FVTA 3GENA 5TE0A 1P5EA 4AFEA 4FSZA 2PUUA 2CJMA 5C9CA 1J7IA 3PXZA 4FV1A 3PPZA 2JBOA 4R8QA 3KXMA 3UIXA 4CT2A 5KKRC 1SVHA 3GP0A 3F5XA 2BUJA 4J71A 1MQ4A 1Q8TA 4QMPA 4CNHA 4QP4A 2FUMA 2HK5A 3LFEA 3LJ2A 3R7OA 4HVGA 2IVUA 2IZSA 2XNGA 3DZQA 3E8EA 4XRLA 3ZYAA 4O6EA 2Z60A 3R71A 5FBOA 4C4GA 4ZXTA 4ANMA 1OBDA 3ORKA 2BMCA 3ATTA 1B6CB 3N9XA 5CSVA 4DTBA 4AF3A 4JT3A 5AP7A 3ZFYA 3PZHA 3DJ7A 3UOKA 3AT2A 4IJPA 2QLUA 3FY0A 4AOTA 4CD0A 2JIIA 3C51A 4F65A 1CKPA 1OL6A 4I6HA 4MX9A 4ALUA 4J97A 3RPVA 4BICA 4RJ3A 4CMOA 2BKKA 5J1WA 3FMKA 5IF1A 5AP4A 2P55A 3HV3A 4GU9A 2XEYA 3QC4A 2V7AA 3LFDA 3AMYA 5BMMA 5EI6A 3V8TA 4BGQA 2OI4X 5DR9A 2YM8A 4EL9A 5EG3A 4JRVA 1F0QA 1ND4A 4H3PA 4U79A 2P0CA 4CKJA 5LXMA 4F08A 3TDWA 3G90X 4MNEB 4ZLZA 4JNWA 1M7NA 2C6EA 5DI1A 5HLPA 4AX8A 3QKKA 4DEDA 4GU6A 4LG4A 2WMSA 2XEZA 2VTOA 3BGZA 3Q53A 4IZAA 3KXGA 4EORA 2CKOA 3L8XA 4GW8A 5HX8A 4QP1A 1W98A 3R1QA 2J4ZA 3HRCA 5HKMA 4FIEA 3ZRKA 5IDNA 3W18A 4BZDA 3RCDA 3COHA 2P2HA 3OWPA 3LCDA 5CVHA 2EUFB 4CFUA 4EOMA 4F64A 4GCJA 5FTGA 3ZUTA 4JQ8A 4C4JA 1Q5KA 4E1ZA 2JDTA 4NIFA 1B38A 3NR9A 4XOZA 2F9GA 2R7IA 2CGUA 2W4KA 4EQCA 5BQ0A 3S1HA 1H1WA 3AC4A 5CAUA 2YM3A 4FKTA 4LFIA 2J0MB 4I4EA 1KE6A 4D2TA 3Q2JA 3ZU7A 4PDSA 4NTTA 4MXCA 1FINA 3CC6A 4IAAA 3SDJA 3HAVA 2C6DA 3FMEA 3LAUA 2XNBA 3PA3A 5JMSA 4QPAA 3F2NA 3GVUA 4U9AA 3OOGA 1NY3A 3K2LA 4ACGA 5HCXA 3VJOA 3TDVA 3U8WA 3ORMA 2R64A 1XO2B 3QGYA 5J1VA 5AR4A 4DH3A 3JVSA 3C4XA 1BI7A 1XBCA 3LMGA 2PULA 1A06A 1XH5A 1Y6BA 4X21A 4M7IA 4L3PA 5JZNA 2VTHA 4GT5A 4II5A 3R9OA 3R1YA 3ZLXA 4IDVA 4MD8E 3RPOA 4AU8A 2B9HA 4PX6A 3HA6A 4PNIA 4XRJA 4GFMA 4UMRA 4L68A 5DRBA 4FODA 1AGWA 3HMPA 1IEPA 1GAGA 3BRBA 5BYLA 1FGIA 4PWNA 4C3RA 5IEYA 3FKLA 4USEA 1I44A 2BRMA 4GIHA 3E8NA 4YMJA 3BYUA 4FKVA 3ZZEA 1Q41A 4NWMA 2WGJA 3NIZA 4M0ZA 4FSQA 2PSQA 4FTIA 4WKQA 3W2QA 3MFSA 3VUTA 3BYOA 4D2VA 4HYIA 3MW1A 4OTFA 4FIIA 3PDTA 1YI6A 5IQEA 4O2PA 5E8SA 3ZO1A 5CU0A 3OWKA 3FLNC 4JR7A 5CASA 2YWPA 4FTNA 3RVGA 4RX9A 4BDJA 3FBVA 4BBEA 3SX9A 4FV7A 3FEGA 3ETAA 1O6KA 4WIHA 4WD5A 3UIMA 3R7YA 3W1FA 4AA0A 4QQTA 3BHYA 4J8NA 2WU7A 2CGWA 4RVMA 3Q5IA 2VTSA 4P2KA 4HVDA 2PVKA 5IQGA 1R78A 2EU9A 3R04A 4F1MA 2PZPA 4YU2A 4GS6A 4IX5A 2YAAA 3PIZA 4QYGA 4F0IA 2OW3A 3AC3A 1G3NA 3ZTXA 5T6KA 3SAYA 3IOKA 4K0YA 4BDBA 4UY9A 4C36A 4GK2A 3MH3A 1UU9A 1Q8WA 1S9JA 4ZTNA 1M2RA 3DPKA 1O9UA 2XK7A 5IUGA 4PMPA 4AGDA 4O7VA 2CCHA 2WMTA 2PE0A 1SVGA 5E9EA 3AMBA 4A4XA 4O0XA 3ACKA 3ZDUA 3RM6A 3UQGA 3ZLYA 4N4SA 4J95A 4YZBA 3QTQA 3MTLA 2PVNA 4RIYA 4E6AA 2IVTA 3K5VA 3NW6A 4C61A 4DEAA 2X2LA 5C4KA 1DI9A 2B55A 4JG7A 4QYHA 5AIRA 4DFZE 3ZUUA 1LUFA 4YJUA 2UZWE 4ASZA 4DEBA 3RBWA 4O81A 2YA9A 3GCUA 2V5QA 4C3FA 1T45A 4D5HA 3KB7A 5AAEA 3O7LB 4TNBA 3KKVA 2C6IA 4G31A 3BLHA 4C4IA 4F4PA 4DCAA 4RLLA 4ERWA 4U40A 4IDTA 3R2YA 3MYGA 3VS2A 2XB7A 4ANLA 4X2FA 5K4IA 1PXLA 3CQEA 2YM4A 4L8MA 5FEEA 4FTKA 4RIWA 5KMOA 3KN5A 3NNVA 3H9RA 3V6SA 3QX4A 2CPKE 2G01A 4YJVA 1MRUA 2ZYBA 3G6HA 3CJFA 2VAGA 3PVUA 3HX4A 3OXZA 1YHSA 4ZSLA 4DFBA 3O8TA 3V5WA 2W4JA 2XKEA 4TTHB 4U41A 2PVLA 5I9VA 1OIRA 2CHLA 4RIXA 2C6LA 5H8BA 5BNJA 3G0FA 3KREA 5DOSA 1GIHA 3UO6A 3W55A 4RWKA 4O7ZA 4DTAA 4QP3A 5IPJA 1Q8YA 4L9IA 5FWKK 3NUUA 2VWXA 4TYIA 3OZ6A 5IU2A 4D1SA 2GHLA 3CP9A 3EHAA 2PMLX 4FT5A 4F7NA 3P0MA 3QWKA 3HV6A 4QYEA 3PPKA 4CXAA 5TR6A 4O27B 5CT0A 3DS6A 4D28A 2DUVA 2XBJA 3FI8A 2PVRA 2X6EA 5M55A 4A9UA 2BPMA 4EJNA 3FMMA 3VUGA 3H3CA 1IA8A 4FG7A 4ERKA 3GU4A 5BVWA 5TO8A 4L6QA 3UNJA 3CTQA 1LPUA 5AV4A 2O8YA 3UOHA 1PJKA 3RI1A 4FNXA 1KV2A 1P2AA 4YLKA 4E73A 5H9BA 4RC4A 5L3AA 3QQKA 5C26A 5FEQA 4ARKA 4I0TA 2V55A 4DFXE 3B2WA 3I60A 3E5AA 4I41A 5DT3A 3UIUA 4EOQA 3Q9YA 2R3KA 4BKZA 4EK3A 4HOKA 2NP8A 4L01A 3ZHPC 4GH2A 5IA4A 5AP6A 4RJ4A 4DG0E 4OTQA 3AD4A 1WBPA 3E63A 4RWJA 3PIXA 4M97A 1XWSA 5E8TA 5AADA 1WBOA 1XR1A 2BTRA 2CLXA 4L7SA 4M3QA 4B99A 4EK8A 5K0KA 1V0PA 2DQ7X 1NA7A 4F7SA 3DT1A 4K11A 4XG7A 4AOJA 4ZLYA 3NNXA 5CAVA 2GNGA 4H39A 3SLSA 4BN1A 3GCQA 4ZY4A 4W8DA 3GU8A 1ZAOA 4ZJIA 3UTOA 3ZO3A 2PL0A 4YTHA 3VNTA 4BCIA 4CSVA 2UVXA 3RK7A 3DK7A 5HE0A 2VTLA 2X2MA 3VBXA 4O38A 3R83A 4EOSA 4F7LA 3A7JA 2R3IA 4BKJA 3TM0A 3SD0A 1O6YA 3S0OA 4Q9SA 3ZDIA 3PPJA 3AXWA 3FHRA 4IB5A 5CAPA 1OL2A 3U4UA 3UE4A 3ZRLA 4EZ5A 1Q8ZA 4TZRA 1U59A 2WB8A 3ORZA 3D83A 2B53A 3KULA 1ZOEA 3R00A 3N4VA 4MHAA 4YSJA 5E4HA 2PVJA 3EQPA 2FSMX 2Q83A 4IACA 2GQRA 3SRVB 3SQQA 4DEGA 2YDKA 4OW8A 4PDYA 2VWIA 2FB8A 5A4CA 5CF8A 4XHKB 2YJRA 5FEDA 4BDIA 3CS9A 3E3PA 4AZEA 3HRFA 3QCSA 4MBIA 4E6DA 4EI4A 3U9NA 3EQHA 4QYYA 4O82A 5CEOA 2WMAA 3UO5A 3CGFA 3V5LA 2EB2A 2QCSA 1M7QA 2VWYA 3MVLA 4R6VA 4IZYA 3RK9A 3DXPA 3MESA 4KABA 2W1ZA 3N51A 3BX5A 4QMZA 3DLSA 2C3LA 4P4CA 5DYJA 4ITJA 4J99A 3TKHA 4TYGA 4WG4A 2QU6A 4G5JA 4NL0A 2J90A 2O3PA 3W2OA 5FP5A 5AP5A 2WNTA 4IB0A 1U54B 4MK0A 3VBYA 4NEUA 2CN8A 4DEHA 1Y8YA 2I7QA 1Q8UA 4GT4A 3VUMA 4AFJA 5I9ZA 3E7VA 5T3QA 3GFEA 1S9IA 2E9NA 2R3MA 2XK8A 3SG8A 2QODA 4QMQA 4P7EA 4DT8A 3DDPA 1W8CA 4O0RA 4WSQA 4NUSA 3DDQA 4KAOA 4X3FA 3HNGA 5J79A 2BHHA 4BZOA 1HCKA 1XJDA 2IVSA 2KTYA 3FAAA 4IZ7A 4WNPA 2BZJA 4AG8A 1W82A 3I5NA 5GJFA 2HY81 1JLUE 4FTUA 1SVEA 3LCKA 4EZ3A 2XF0A 2YIYA 3UOJA 1DI8A 3WILA 3R7GA 4YJPA 4N0SA 1FBNA 3I6WA 2ZV8A 2VGPA 3L9PA 2ITZA 4YUQA 5CEMA 5LWNA 2JDOA 3BBWA 3PJ3A 5EQPA 2PUIA 2UZOA 4R7HA 4Y72A 3GOKA 3A7IA 5KMLA 2YZLA 4GKHA 3OCSA 1H25A 3NX8A 4U43A 3QBNA 5EW9A 3HLLA 1WAKA 2IW9A 1KE5A 3JYAA 1P14A 4PL3A 3PLAE 5D12A 5EDQA 4YTFA 5A6NA 4C57A 4HPUE 2W4OA 1XH7A 3TV6A 5ETCA 4KRCA 4D4VA 4FOBA 3IW4A 1M2PA 4KIPA 2EXMA 3QD2B 4FKGA 4GV1A 4U0IA 4YP8A 4RLKA 3TKUA 3VS0A 2JITA 4F7JA 4W9XA 3F7WA 3OCTA 4D4YA 2R3NA 3BU3A 3G9NA 3KA0A 3PXKA 4MXXA 5CWZA 5FTQA 5HO8A 1A9UA 3DOGA 3K3JA 4DAWA 3ZLWA 4MBLA 4I5PA 4PTEA 5IA2A 2OFUA 2QC6A 1DAWA 2QONA 4PMSA 1SM2A 2X7GA 3Q9ZA 1XBBA 2VD5A 4X2GA 4BCFA 4Y73A 4DH8A 4EHZA 5I9YA 5C4LA 3GU6A 2XIKA 2Y6MA 4IVDA 4ONAA 3RPRA 1OITA 2BDJA 4MXOA 4D2PA 4PPCA 3LFBA 4CCBA 3JR1A 4W4YA 2WIHA 4LRKA 4EC8A 3F88A 4E7WA 2PMIA 4RG0A 2XP2A 1NW1A 3N4TA 4KBKA 4G16A 1YI3A 4E26A 4EOIA 1TQIA 4ZZOA 5BUEA 4O7WA 5HX6A 4C4HA 2CNQA 3A60A 4FIFA 4UZHA 3TUDA 4G3GA 1OIQA 4I6QA 3LMIA 3UZRA 4MTAA 5D11A 2I0YA 5ANIA 3IO7A 4AT5A 5KBQA 3QAME 3NIEA 4QPMA 4X2KA 5KZ0A 2RF9A 1M17A 4K8AA 4O7SA 3FMNA 5DGZA 3DCVA 3IQ7A 3I4BA 3Q2MA 5DH3A 4FSWA 4U44A 3DAKA 5IUIA 5KMKA 3NNWA 4DH1A 5IQIA 2OGVA 4JG8A 4D1ZA 3OF0A 3RAHA 4ANNA 1JSTA 4B4LA 4KNBA 5CENA 4PL5A 1UWJA 4DC2A 5F20A 5CALA 1ZY4A 4E6QA 5AP0A 4DG2E 5HIBA 4WSYA 4DE4A 4FC0A 2WFYA 2JKOA 4W4WA 4WA9A 2UZVA 1YXSA 3HDNA 5CS6A 2OF4A 1O6LA 2IPXA 2YHVA 2UV2A 3B2TA 2JDRA 3ET7A 4FEUA 1OL5A 1YOMA 5AP2A 3OWLA 1UVRA 3GC0A 4RFZA 5E1EA 5TKDA 3O2MA 3VS1A 1BL6A 2BRBA 5CQWA 2J5EA 2VTJA 3FLQA 2EXEA 3HGKA 4RJ8A 3TZ8A 2WQBA 4HGLA 1PXIA 2QQ7A 4L3JA 4WNKA 4R1YA 5HE1A 1CM8A 3KK8A 3C4FA 3NAYA 2PY3A 4CZUA 4Q2AA 2YN8A 1ZZ2A 5K9IA 1OZ1A 2OF2A 3W16A 4DN5A 3CKWA 3TL8A 3HMOA 4YPSA 4J98A 2WTIA 3NYVA 4JIAA 4V01A 3VAPA 4CFMA 4NCTA 4O1OA 5JKGA 3SW7A 3KK9A 4IWQA 3WIGA 3PJ2A 5HVYA 3G6GA 4EH5A 4C4FA 4I24A 2W96B 4MAOA 3LE6A 4OBOA 3MY5A 3W10A 1YVJA 4YJQA 2YIWA 3C5UA 4K9YA 3NUSA 3PXFA 5E8WA 5H2UA 2X1NA 3UBDA 3VS5A 4BDDA 1JKSA 4IAFA 3PXRA 4UBAA 1XKKA 4H58A 4XG3A 3OROA 4X7QA 5IA5A 3LVPA 4IHPA 4NKSA 3RGFA 4CV8A 4EOJA 3G51A 3UMWA 2YJSA 5CLPA 3I5ZA 4KKEA 2FA2A 4ACHA 4KBAA 3DFCB 3Q04A 3DKCA 3GQIA 3FPMA 2BR1A 3QD3A 3UMXA 3DY7A 4F9CA 4QP9A 2GQSA 4IM0A 4QP2A 3NPCA 1ZOHA 4L46A 3VS4A 3IDPA 4MXAA 4WOVA 5JT2A 2V7OA 3LM5A 2VTIA 2OWBA 3QTZA 3F3UA 4L67A 3FUPA 3D5WA 3W32A 3R0TA 5E92A 5FUTA 3LMHA 3FQSA 3EMGA 4MCVA 4YC8A 4IADA 3OXIA 4GRBA 4ZTRA 3LFQA 4RJ6A 3JPVA 4FSRA 4BZNA 5J7HA 3FMLA 1UKIA 2Z7SA 3QA0A 3GEQA 3D7TB 4R3CA 5CNOA 1U5RA 3MJ1A 3FDNA 5AUYA 2PZYA 3MPAA 3FY2A 4FT0A 5DT4A 5CU6A 1JAMA 4ZJJA 3W2SA 2WTCA 2Z7QA 2H34A 2VTQA 4LQMA 2WMVA 2E9VA 2W9ZB 3VUKA 4RQVA 5EDPA 2BAKA 3CCNA 4Y46A 1Q4LA 2ZM3A 3EN5A 4DH7A 3U6HA 4NM0A 2YDIA 5AFVA 2QO2A 1GIIA 3PVGA 1V0BA 4GEOA 4M8TA 3PUPA 5D1JA 4BDCA 3LJ0A 2OICA 4YPDA 5KMNA 3EWHA 4FV3A 2HW7A 4G3CA 3VW6A 5CF5A 4BCMA 3MWUA 3MPTA 3GOPA 3WF9A 1NVQA 2O65A 4IB3A 4CYJA 3FC2A 3QC9A 2H9VA 3FE3A 4FTRA 4C2VA 1SNXA 3C0HA 3O17A 5D7AA 3HDMA 3WZJA 4Q5HA 4Y5HA 2IG7A 4LRMA 2CN5A 4JXFA 3S95A 5ACKA 3PJCA 4L42A 3E92A 3OD6X 3BYMA 3FI3A 3MVHA 4RFMA 3T9IA 5M44A 2C5OA 2X6DA 3NUPA 4FVRA 1W84A 3VBQA 3BZ3A 5D9HA 1K3AA 2ITNA 2J5FA 1E9HA 4AZSA 5CANA 2E9OA 4FKIA 5M51A 4XEYA 2OH0E 4RFYA 3FWQA 3UG2A 5AM6A 3IGOA 4D2RA 4FVPA 5M09A 2R3GA 1GY3A 2JD5A 2ONLC 2UW5A 5HU3A 3ZFXA 1CKIA 4TWCA 5LVNA 2P2IA 4G2FA 3GU5A 4O7LA 2VWBA 2WOUA 2YISA 3KRWA 1MRYA 1QPCA 4JDJA 4WHZA 2BZIB 3KMUA 2VNYA 3D2KA 4M66A 3IDBA 4USDA 2FVDA 3AMAA 3NNUA 4I22A 5C8NA 5KO1A 2W1HA 4F9BA 2R3JA 5K5NA 5FM3A 4QP6A 3DBDA 4KSPA 3Q96A 1JOWB 4Y8DA 5M56A 3EQBA 3H9OA 1YRPA 2OJFE 3OC1A 5AR3A 2W1IA 3LCTA 2B0QA 4XLIA 4MKCA 5DFPA 2C30A 4ZS0A 1PF8A 2QG5A 3A7GA 4BBMA 4P5ZA 2X9FA 4O22A 1ZMUA 3ZO2A 2A4LA 4IANA 2OXYA 5AR8A 1JKLA 3LCOA 3PIYA 4KKHA 4EQUA 2C0TA 3BELA 2VTAA 4DFUA 2C47A 4C7TA 2HIWA 2B9JA 5ANEA 3V6RA 2F57A 5EYDA 4EOOA 1PXNA 2OSCA 1KE7A 1ZYCA 3MA3A 1OKYA 3TEIA 4DGLC 4E4NA 3MIYA 4XV3A 3CEKA 3UVRA 2GNLA 4F6UA 2NRUA 2QOFA 2WPAA 4RIYB 3GC8A 4G6NA 2FGIA 3LQ8A 3MTFA 2GMXA 4UV0A 4A07A 2YIXA 3FZTA 4WUNA 5CVFA 4IE9A 4XG6A 4OTGA 3CJGA 5DE2A 4FTOA 2I0HA 1PKDA 4YZNA 5EYKA 3VIDA 4QD6A 3F9NA 4UX9A 4CEGA 3R2BA 4FYNA 4FTMA 3JY0A 3PVWA 4AZTA 4EK6A 4UMUA 4AW5A 1W0XC 2HW6A 4CFWA 5L2IA 3Q9XA 3I7BA 4QRCA 4ENXA 4B7TA 4L52A 3C0IA 1KWPA 3EN7A 4F63A 3DZOA 1OIUA 5GIPE 2PZRA 1L8TA 2RGPA 4BVUA 4EHGA 1OPLA 1SZMA 1ZXEA 2X8DA 3FXXA 3P78A 4F1TA 4U45A 3UDBA 1MUOA 3FHIA 1XH6A 5JGBA 3R9RA 3HUCA 2WMWA 4J1RA 4BBFA 3EL7A 3HECA 1OVEA 3I79A 4G1WA 1WBNA 4IX4A 2IW6A 4EOPA 1KOBA 2WQMA 3EN9A 4OLIA 1W7HA 1YHVA 4I6BA 4TWNA 5AR7A 5HE3A 4BDHA 3P7AA 1V0OA 2NO3A 3L8SA 4XNEA 4HJOA 3ATSA 4CRSA 2WU6A 4HVIA 3RZFA 1H8FA 4IWDA 4UYAA 5FDPA 5HTCA 3BKBA 5K4JA 3VN9A 1Q97A 5J87A 2UW7A 3E87A 3LZBA 1B39A 4YHTA 2XCKA 4DH5A 4F09A 3ZXTA 5ETFA 3KCKA 4IAIA 3EQFA 4QPSA 1IASA 2ITPA 3RK5A 1HCLA 4IAKA 1WZYA 4CV9A 2XJ2A 3QZGA 5DPVA 1YWRA 2W5BA 4AOIA 3TV7A 2HZNA 2C5XA 3ERKA 2R5TA 3H0YA 1ZY5A 5F1ZA 3MH2A 3W8LA 2WTDA 2RFSA 4BC6A 4TWPA 3KXNA 1PXPA 1YOJA 5L8JA 1QMZA 3LFNA 3D5UA 2F4JA 4RSSA 2ZMDA 5CSWA 4L7FA 5HLNA 1REKA 2ZMCA 5L6OA 3OS3A 4DBNA 1NXKA 3TTIA 2GU8A 1DM2A 5B2KA 3EKNA 3WF8A 1IR3A 4QMUA 2ERZE 2QG7A 3HMNA 2YCQA 4EHVA 3C5IA 2H6DA 3BHVA 4FGBA 4M67A 4DEEA 5IDPA 5LMKC 2X4FA 4X2JA 5HORA 5DIAA 2OIQA 4LOPA 1ERKA 2QO9A 3OT8A 3Q3BA 5AAFA 3PG1A 1UA2A 3CPBA 3KQ7A 1ZZLA 4RRVA 1IA9A 2C0IA 1REJA 3FL4A 4EBVA 2VWVA 4USFA 3F6XA 1YXVA 1I09A 4XV9A 3TNIA 1H1QA 3SOCA 3ZSIA 4BB4A 4ZZNA 2IZUA 3ZOSA 3FPQA 2XVDA 4YZDA 3TZ7A 5IISA 3HA8A 2XNNA 4LMNA 4PMTA 3D15A 4BTJA 3V01A 4O86A 2C5NA 3R7UA 3V5TA 5DA3A 4ALWA 1A48A 4MWIA 3UYTA 3KULB 3CGOA 4G9CA 4JAIA 3PA5A 5AV2A 2GNIA 2YCSA 4FIGA 5FXSA 2JIVA 4FEQA 3SXRA 1RQQA 2QVSE 2NRYA 1MRVA 3AOXA 4B8MA 2HY0A 4EHEA 5KUPA 4GG5A 1NVSA 3DNDA 2XKFA 3DXQA 5L8KA 5CXHA 4BI2A 2OK1A 4XUFA 1RJBA 3PYYA 1XHAA 2HENA 4IC7A 4FX3A 3F5PA 3OEFX 4S32A 3A8XA 3WI6A 5IQAA 2BRGA 3SGCA 3QZIA 4BKYA 3OW4A 3MB7A 3E7OA 3R30A 2ZV2A 3HV5A 1H28A 4EYJA 1OUYA 3GGFA 4XYFA 2IN6A 5ETIA 1EH4A 2I1MA 2ZM4A 3Q32A 4FICA 3VHEA 2GNFA 2DS1A 5IQBA 2UZBA 2CCIA 3CQUA 3EN4A 3LXLA 2VUWA 4N6YA 5EI2A 5HNIX 2PUNA 1URCA 3P23A 3FLYA 3QXPA 1PXJA 1WBTA 4JQ7A 5LMBA 3KFAA 3DK6A 4RWLA 1GNGA 5FTOA 4G3FA 4R78A 4QTAA 2V62A 3R02A 4HPTE 4F99A 4PF4A 2CNUA 4D2WA 2YCRA 3DTCA 3KU2A 1M2QA 3CD3A 2UW9A 4X3FB 5EH0A 2EB3A 4AZFA 4EBWA 5BVOA 2XNEA 1JSVA 2P4IA 3DAEA 5CEQA 4G6OA 2Y7JA 5L6WL 3G5DA 4QO9A 2Q0NA 3TCPA 3NRMA 5ACBC 3VS7A 5I4NA 4GYIA 4M69A 4AWIA 1OECA 3FZPA 4IEBA 4FG8A 4TNDA 3ZM4A 1KE8A 4QT1A 4FBXA 2GCDA 4O91A 2CLQA 1YI4A 4I4FA 4YGAA 3BLQA 4J53A 1H4LA 4NJ3A 4RX8A 5JK3A 3CQWA 3F5GA 3LW0A 1PMEA 4BCQA 1OKZA 1ZYJA 4BDGA 3OY1A 4GIIA 4OR5A 5IEVA 3G15A 3VBTA 3TIYA 3VC4A 4F6SA 3E64A 3VS3A 4D0WA 3MFUA 3VF9A 1OI9A 4H3QA 4OTDA 5HCYA 3MSSA 4UN0C 3MDYA 2OZAA 2G1TA 5EKOA 3NVKI 4KWPA 5J5TA 4JRNA 3R8VA 1Q99A 4HCTA 3TNWA 4BDEA 4CCUA 2Y6OA 1YKRA 4C02A 1TVOA 4L00A 5CU2A 1STCE 3KXZA 4DGGA 5JQ5A 4O7YA 3OUNB 3DLZA 5AWMA 4FKPA 3WE4A 3ZFMA 2XNMA 4ZK5A 3FYJX 4CZYB 3QU0A 3IGGA 5LVMA 4U5JA 1FMOE 5TT7A 2QOCA 4TRLA 5AV1A 4OTIA 1YXXA 5AUZA 4BCPA 2VTRA 3WIKA 4IC8A 1PY5A 3Q5ZA 4FSMA 3QKLA 3PE2A 4YJSA 4AN3A 4IVCA 3R21A 4XV1A 2RIOA 3ROYA 3V5JA 4DINA 1YHWA 2VWZA 4ZY5A 4B9DA 5JZJA 3LFCA 4QNAA 2WEVA 2P33A 3BU5A 2GHGA 4YC6A 4TKSA 3ZH8A 2BKZA 5I9XA 1OL1A 2X9EA 4P5QA 4R3RA 1XQZA 3QLFA 4YLJA 3F3VA 4EK4A 4FEXA 4JOAA 2PHKA 3UC3A 2C3JA 4G34A 4JIKA 3AGMA 1UV5A 2ITQA 4RVKA 5FG8A 3EFWA 5JRQA 2HZIA 1J7UA 4U80A 5E8ZA 5CEIA 5JH6A 4X6QC 3LFSA 2C69A 4K33A 4EK5A 4MD7E 4I3ZA 3QUDA 1LEWA 2BALA 4YZMA 4F70A 5KHWA 3U54A 4EH8A 4TT7A 2ITOA 2UUEA 4UXLA 3ALOA 3AGLA 4F0FA 1JNKA 3LHJA 2WTKB 4ID7A 3W2CA 3DB8A 3ORNA 3MH0A 1H0WA 1L3RE 4DGNA 1FQ1B 2B1PA 5BMSA 3NVMB 4NSTA 1GOLA 3BV2A 2R3PA 4FK3A 2XJ1A 2XS0A 3MPMA 3V04A 4C35A 3V5QA 3SXFA 2EVAA 1UNGA 3F3ZA 1X8BA 3M42A 4FV5A 4RVLA 4DGOA 5F94A 5JEBA 5AR5A 3IKAA 2CGXA 3FI4A 4W4XA 3FQHA 5FD2A 5CZIA 4NFNA 2CDZA 3AG9A 4XLVA 4FA2A 4YJTA 3U51A 4X3JA 2I6LA 4IFCA 2G15A 2R7BA 3PSDA 5IQDA 3KRXA 4MQ1A 4OAVB 3M11A 2R4BA 3MA6A 5FBNC 3SHEA 3ULZA 3MIAA 4EH4A 3UPZA 3Q4ZA 4N57A 4ITHA 2F7ZE 3G33A 5C01A 2R0UA 4AUAA 3BYVA 5I9WA 2GS6A 2YACA 3POZA 3VBVA 4FV2A 3ZC6A 2YM7A 3JVRA 2WTWA 2PZIA 4TYEA 4Y5QA 3UP2A 2FSOX 4QP8A 4UWYA 5KMMA 1UNHA 3SV0A 3LXPA 3QA8A 4QMOA 2QU5A 1LEZA 2BCJA 1HOWA 2H8HA 2VRXA 4I5MA 5DEWA 2YIRA 3R73A 1QCFA 2BRNA 2FSLX 3QZFA 4IZ5A 3FQEA 3QCYA 1QL6A 4U7ZA 2BZHB 3RAWA 3DFAA 4A06A 4AA4A 1M52A 5HLWA 4L43A 4PQNA 4ORKA 4DBXA 2PMOX 4OTHA 3R6XA 5HCZA 2OH4A 3HYHA 4M15A 4QOXA 4E93A 1J1BA 3BE9A 3EQGA 5B0XA 5F9EA 1WBWA 4TY1A 3OW3A 4XBRA 1KOAA 1P4FA 5E1SA 4KB8A 4KKGA 4QMWA 1CKJA 3GNIB 5EYMA 4XP0A 3UZPA 2YEXA 5HOAA 3DA6A 4D9UA 2J0KA 4CG8A 4FG9A 2PU8A 3NCZA 4U3ZA 2OU7A 5HESA 3R22A 3DK3A 4B8LA 2XIXA 2R3RA 4FKJA 4O7RA 4AT4A 3GCPA 3E8DA 3FXWA 4IX6A 3HRBA 3BEGA 3RKBA 4R5YA 3L9MA 2W5HA 3DXNA 1QPJA 3NYNA 4F9YA 1Q24A 4KS7A 3HEGA 3P7BA 3QLGA 2J2IB 3OMVA 3THBA 4JS8A 2GFCA 4FKUA 2PE1A 4YJRA 3DBCA 4TL0A 2CKQA 1KE9A 5ICPA 5LMAA 4X2NA 4R7BA 1VJYA 2XK3A 2CKPA 3EH9A 3PWDA 5GHVA 2GS7A 4RIOA 3WF7A 3QL8A 4FR4A 4JJRA 4CGAA 5KBRA 3F66A 2QURA 1H1RA 5JGDA 4ANSA 2PWLA 3L9LA 4FZDB 4CKIA 4LGHA 2AC3A 3UODA 1Z57A 4ZAUA 5J9YA 1ZYLA 3MH1A 4YZ9A 5M08A 5KCVA 3N4UA 3Q6WA 4LMUA 1OPJA 5AMNA 5HVKA 4BL1A 5ANDA 4RWIA 2E9PA 5BX0A 4S30A 1BLXA 3W2RA 3P5KA 3R9DA 5IMXA 3AC5A 5DEYA 2QHMA 3ANQA 3BQRA 4L53A 5FM2A 2OIDA 4N70A 5I5ZA 3EQIA 5D41A 4KS8A 4GMYA 4U8ZA 2AC5A 2PTKA 2QR7A 4YBKA 5HEZA 2Z2WA 2GFSA 4BI1A 4YURA 2PUPA 4FKWA 3RJCA 1U5QA 4PP9A 4KRDA 4LM5A 4YTIA 3RTPA 4C4EA 5AV3A 4ZSEA 4ZLOA 1LR4A 1WMKA 4NH1A 4D5KA 2ETKA 1H27A 1SYKA 3B8QA 1OL7A 1OB3A 3I0QA 4WBOA 4EH6A 2CMWA 3GI3A 2B52A 2WQEA 2XM9A 5CSHA 1R39A 5HU9A 2IVVA 2OJ9A 4O0SA 4FZ7A 2FH9A 5G1XA 4CRLA 4NFMA 2REIA 4RJ5A 2J0IA 4X0MA 5KNJA 1PYEA 3LFFA 3KL8A 3QX2A 4QMSA 4CG9A 4EH2A 1JSUA 3OUKA 2PVHA 3BEAA 3EQDA 4WO5A 4FV0A 1M14A 5IQFA 4V0GB 2QHNA 1Y57A 3ORXA 4ZSJA 3RM7A 5EQEA 4PPAA 3HVCA 4XX9A 4BYIA 3NMUF 2YWVA 3KN6A 3WZUA 4EZ7A 3ID6C 4CLJA 1FVRA 2Q0BA 3KF4A 2H96A 4IWOA 4AN2A 3A4PA 3O23A 4QNYA 5E8XA 2BFYA 3VQUA 4DLJA 2W1CA 2WQNA 5JFSA 2XMYA 4D0XA 1BI8A 5M4IA 4CTCA 2OKRA 5HO7A 4BRXA 3A61A 3QFVA 1YWVA 2HCKA 4HVHA 3LQ3A 1YDSE 2RFEA 3TUBA 2O5KA 4IJ9A 4A9YA 4WNMA 5JFWA 5BVEA 2WAJA 4AGWA 3EFJA 3DNEA 5IA3A 4WUAA 4Z3VA 2Z7LA 4K18A 4S34A 3C50A 1BL7A 2XYNA 2ACXA 3OBGA 4OBPA 5EYCA 3MBLA 4AS0A 4PNKA 3WZEA 2ZV9A 4F6WA 3F2AA 4YBJA 2X2KA 4WT6A 3DU8A 1UU7A 3BV3A 4K6ZA 4GL9A 2WIPA 3P08A 2OO8X 4FZAB 1OKWA 4GUBA 2OXDA 3C4ZA 4JX3A 1ZOGA 4I21A 4H1JA 4DF3A 2C68A 1UU8A 4CFXA 4HCUA 5K5XA 2WO6A 3TJDA 3HZTA 3H4JA 4WRGA 3NYXA 4PMMA 1RW8A 3PXYA 2QKWB 3SRVA 4ACCA 4OTPA 4HGTA 5FXQA 2O64A 5CSXA 5HG8A 2IZTA 5A4TA 3ANRA 3MVJA 2JFLA 1E1XA 5FXRA 1ATPE 3D9VA 3R8ZA 2YZAA 2JKKA 1YW2A 3M1SA 4A9TA 5CT7A 2PVFA 4QTDA 3PE1A 4BTFA 4FUXA 3NWWA 3R01A 2XCHA 3CTJA 5A14A 4J7BA 1G8AA 3QHRA 4FMQA 4XG2A 5AP1A 2VO0A 2C1BA 4L45A 4DHFA 4ZJVA 5IQCA 4EJ7A 4F9WA 2IO6A 5GZAA 3U6IA 4RBLA 3C7QA 3TWJA 4K2RA 1OUKA 4LI5A 2JIUA 4HCVA 1GZKA 4HYHA 4KA3A 5CU4A 5BYZA 1JBPE 4M12A 3TACA 2X39A 4CMTA 3PZEA 3T9TA 3ZSHA 5IUHA 3TZ9A 4O83A 3R1SA 2HWOA 5KX8A 2GS2A 2XKCA 2ITVA 3CIKA 3BPRA
chains in the Genus database with same CATH superfamily
4LV8A 2QOIA 4ZSAA 3FKNA 4PTCA 2XH5A 4XG8A 1T46A 2XNOA 4O1PA 2G9XA 2X8EA 4AT3A 2DWBA 2Y9QA 3ODZX 4HGEA 4G5PA 5EOBA 3GXLA 1ZARA 4FKQA 3TTJA 3U55A 3T3VA 5AP3A 4FV6A 4DCEA 2J0LA 4JLCA 5EM8A 1PRYA 4BCJA 2XK6A 4NIFB 3ZS5A 5B7VA 4FTTA 4E6CA 4ZEGA 4E3CA 4BDKA 1J1CA 4AQCA 3IOPA 2R0IA 3QQUA 3QUEA 3KMMA 5TOZA 4QMVA 3QZHA 3KF7A 4EOLA 1GIJA 5AUWA 4H3BA 2RG6A 2ZDTA 4UXQA 3RHKA 5M53A 5HHWA 2B9FA 4ACMA 1AQ1A 4ASDA 1H1SA 3ML1A 4P90A 4JG6A 5M4FA 5A54A 1FMKA 3MS9A 5DN3A 1BYGA 1PXKA 3Q52A 2QOLA 3L8PA 3DAJA 3WZKA 5DLSA 5T68A 3O71A 1OBGA 2Z02A 4EWHA 5ANOA 5H3QA 4GVAA 4M14A 5C1QB 2VNWA 3BYSA 1GZNA 3KXXA 3UC4A 1YWNA 1H26A 2UZLA 1WVWA 3IDCA 2A19B 3ORLA 4AA5A 3F7ZA 4FIJA 4NKAA 3PY0A 4WG5A 4XV2A 2O2UA 4GUEA 4QMXA 5L8LA 3OFMA 1UKHA 4OT5A 2G2IA 3PXQA 3G2FA 3GC9A 2ZOQA 3NYOA 4L3LA 5F95A 5GZ9A 3CSVA 2XA4A 3FI2A 3D94A 3FL5A 3NGAA 1G8SA 1ZYSA 2QOOA 1XH4A 4FT7A 5HG7A 3R9NA 5CEKA 4OAUC 2W99B 3TNPC 1YDRE 4NM7A 2BFXA 2CSNA 3SA0A 2C0OA 3VUHA 1UU3A 3F2RA 2GSFA 2YCFA 4GG7A 4QQ5A 5L4QA 4HNFA 3FMJA 4BY9E 5E91A 3LLAA 2I0VA 1ST0A 4DDIA 1R1WA 3MN3A 3QTUA 3VRYA 3AC8A 1PMNA 4YJOA 4I20A 4FL1A 1FVVA 2Y4IB 4CFFA 1YQJA 2C3IB 3PVBA 2XBAA 4C2WA 5LARA 3R1NA 4ALVA 3VF8A 3NCGA 5A46A 2OJIA 3ZEPA 2XK9A 3ZO4A 4PL4A 3C9WA 1KSWA 3OTVA 4C33A 2VV9A 4R7IA 2BDFA 2HOGA 3NZ0A 2PE2A 1JKKA 2BILB 1XH8A 2LGCA 3V51A 4FTJA 4LL5A 2GQGA 3DBQA 5FDXA 3R8UA 4I92A 5ANJA 5J9ZA 2VX3A 3FLZA 2SRCA 3CY3A 3MY1A 3W2PA 1YDTE 5K3YA 4A4OA 4RJ7A 4D4RA 3R7IA 3RZBA 4Y95A 5M57A 4DFLA 4UB7A 4FKRA 1JVPP 2P3GX 4MF1A 4Y85A 4PDPA 5F4NA 3VUIA 3W0SA 3BGPA 5H8EA 3S4QA 1V1KA 2PVYA 4O84A 4FTQA 5AUXA 3WBLA 4IWPA 4UYNA 3QKMA 2ITXA 1PYXA 2JAMA 3UGCA 4HNIA 4KIKA 2R9SA 4RC3A 3NUAA 2GTNA 3CXWA 3F61A 5HIDA 5B2LA 4IMYA 1FGKA 5BPYA 4DITA 4IVAA 3V3VA 2WZJA 4M69B 3AT3A 3O8UA 3I6UA 4RT7A 5H8GA 4RPVA 3UP7A 5AUUA 5LCJA 3P86A 3OEZA 3R8LA 4RIWB 1TKIA 3NFFB 2VO7A 5GINE 2BIKB 4MF0A 4UWCA 3GB2A 5KMIA 4CLIA 4S31A 3ULIA 4C3PA 3C13A 3RHXA 3VUDA 1Q3WA 3O96A 3GQLA 1BX6A 4FK6A 1Q3DA 3U87A 4XOYA 3I7CA 3EQCA 4EQMA 3KY2A 5FGKA 2XRWA 4FSNA 4NW5A 3CY2A 4RIXB 1OMWA 4EKKA 4FKSA 3E3BX 5HI2A 4DT9A 2OZAB 2HYYA 5KKRB 3U9CA 2R3HA 3NLBA 4MH7A 3PRFA 3TNQB 2QO7A 4ITIA 4MVFA 2G2FA 4HZRA 5HIEA 2HXLA 3DJ6A 3FZRA 3VO3A 3IG7A 4NK9A 3NW7A 1WVYA 3QTWA 4YZCA 3SXSA 4QTEA 4ZMEA 2GTMA 3SVVA 1ZLTA 3G0EA 3BI6A 4IXPA 3MY0A 2X4ZA 3ZEWA 2YLFA 5J95A 4DYMA 2VGOA 2XJ0A 1H01A 4ZSGA 3PP0A 4E4XA 3NEWA 3AT4A 4ACDA 2UW6A 4GYGA 5HTIA 3GC7A 3ALNA 4QMNA 3F3TA 4GK4A 4ENYA 3ZUVA 2PMNX 3MV5A 4FTAA 5JFXA 2OLCA 1VR2A 3DKOA 2X8IA 5CAOA 5EKNA 1PMUA 1RDQE 2C6MA 3VW8A 4ASEA 1JPAA 2C5VA 4I6FA 5I9UA 3RNIA 3TI1A 5CAQA 5IG1A 4B0GA 2X0QA 4MEDA 1XBAA 3BBTB 4IW0A 4NZWB 4W8EA 3SW4A 4FTCA 2GDOA 3FZOA 4S33A 4DLIA 4TYHA 4ZTMA 2XIRA 2XIZA 4BHZA 4DTKA 4JR3A 4V05A 4QMLA 3RWQA 3TXOA 4YR8A 2OJGA 3D7TA 3TYKA 4GKIA 2W7XA 4JAJA 4FVQA 2VX0A 2W1FA 2I0EA 4WNOA 1WFCA 4LGGA 1GZ8A 3B8RA 5AJQA 4DA5A 3OT3A 2FYSA 3O7LD 1H08A 2OFVA 3U6JA 4AP7A 2VTNA 3U4WA 5EW8A 2GPHA 4DFYA 3C4WA 1IAHA 2BRHA 2NYAA 3QQLA 5HTBA 4UALA 3AC2A 5BVFA 5HD4A 4GFOA 4EOKA 3I1AA 2WOTA 2BAQA 3BQCA 4LGDA 2WD1A 4HGSA 3GCVA 4FKLA 4J96A 5DT0A 5L2QA 3R7VA 1OPKA 3G9LX 3Q4UA 3FKOA 4RC2A 3ROCA 3P7CA 4C62A 3LLTA 3QTSA 4YNEA 3VHKA 4E5AX 5EHLA 1ZMWA 2W9FB 4C58A 3K54A 2UW3A 3WYYA 4LUEA 5ITAA 4NJDA 4O2ZA 1Z5MA 2VWWA 4E5BA 4QEBA 4AE6A 3H9FA 1SNUA 5HO6A 3EKKA 1XMMA 5C8KA 1MP8A 5CU3A 3Q9WA 4EKLA 5B2MA 3FV8A 3PG3A 4BWXA 3EJ1A 1R3CA 3DBEA 3DKGA 4PTGA 4TXCA 1NT2A 4YNOA 4BIEA 3DKFA 2YIQA 5J7BA 1Y8GA 3RAIA 5AV0A 3D4QA 4PRJA 4YO6A 4JBOA 3II5A 4JBVA 4Z7HA 5HE2A 4I1ZA 5EQYA 4A9SA 4AXAA 2UVZA 5J5SA 4W4VA 3W8QA 4LV7A 4X3FC 1W83A 1WBSA 3KVXA 3QD0A 3BL7A 5BUIA 1UWHA 1XH9A 4O0WA 4O0VA 5AUTA 3HMIA 3LKMA 4ZTSA 2ITWA 2ONLA 1H07A 4I5HA 4PUZA 3TV4A 2W0JA 5AA8A 5CF4A 5IMEA 1JWHA 3CLYA 2BROA 3OBJA 4FZ6A 3QTRA 3UJGA 2ITTA 3BCEA 4DGMA 4JBQA 4YHFA 3LCSA 4G3EA 1H1PA 2J7TA 3FMDA 3MVMA 4JI9A 4OTRA 5DWRA 4CMUA 5L2WA 4O0TA 2CGVA 1OKVA 5DNRA 3MGYA 4MBJA 5I3RA 5KMJA 4YSMA 3C4CA 3ENMA 5AR2A 3H10A 4IBMA 4JDHA 2ETMA 2G2HA 4RVTA 1WBVA 3DQWA 4I93A 4K1BA 3UVQA 4ANQA 5HG9A 3CKXA 3HV7A 3QRTA 4IFGA 3TZMA 5LQFA 2PYWA 3SG9A 5HVJA 3L8VA 3NW5A 2R2PA 4APPA 2EWAA 3QYZA 4RX5A 2VTPA 4GJ2A 1H24A 3ZONA 2F2CB 3BGQA 3ZXZA 4PY1A 3E8CA 2AUHA 5E8UA 1OGUA 3RINA 1ZMVA 1WVXA 4KBCA 3UQCA 2X7OA 3ORTA 4YLLA 5IH6A 2RFDA 3PJ1A 3BHTA 3RPYA 3RP9A 5CTPA 4YC3A 3JUHA 4EUTA 4HVSA 3VS6A 3A99A 4GSBA 3A62A 4OGRA 4OTWA 3PLSA 2RSVA 2XIYA 1CDKA 5EI8A 3OTUA 2XM8A 5KHXA 4FT3A 5L2SA 2CKEA 3O51A 3RNYA 3UOLA 2ZB1A 3AQVA 1J3HA 4FSUA 1QPEA 3TN8A 3HMMA 2B7AA 4D1XA 3AD5A 2F7EE 2BTSA 3D5XA 3HUBA 5LVPA 5DMZA 1FOTA 1IG1A 2C4GA 4JQEA 2WMRA 5HG5A 3MFTA 3TJCA 5BUJA 4D58A 4MNEA 5J8IA 4JX7A 3TNHA 2BDWA 3SKCA 2C6TA 3I81A 3EB0A 4YO4A 3BE2A 2Y8OA 5G6VA 3D7ZA 5IQHA 4LOQA 1ZYDA 3C4EA 3LJ1A 3OHTA 3KVWA 3UNKA 2YFXA 2YM6A 4QTCA 4RZWA 3ZRMA 4YJNA 2HXQA 4EEVA 2J0JA 2WTKC 4NTSA 3ZLSA 2JLDA 4ZY6A 3LXKA 2IZRA 5GNKA 4X6RA 3LQ5A 3RMFA 3OCBA 5M4UA 2ZVAA 3P4KA 5ANGA 2AEGA 4PPBA 2QR8A 4M68A 4EONA 4CYIA 4HW7A 4IX3A 3TIZA 1J7LA 2C1AA 2ETRA 2OJJA 4U3YA 2C6OA 3KMWA 3AD6A 4ZZMA 2JC6A 3LM0A 2Z8CA 4O4EA 3PY3A 4A7CA 1PHKA 2J51A 5IKWA 4BWKA 4FV4A 3LOKA 3TG1A 3PA4A 4UEUA 4M0YA 5ETAA 1BKXA 2W1DA 3QQHA 4FTLA 3IECA 3MFRA 5JRSA 1RE8A 2E2BA 4N6ZA 3COKA 2Y0AA 2YABA 3BHHA 4D55A 2WMBA 4O7TA 3EFLA 1PKGA 3S00A 4FV8A 3W0MA 5EM5A 5IH5A 5EOLA 3QRJA 5I0BA 5KE0A 4QDEA 2ESMA 3Q6UA 5LJJA 2XANA 3PRIA 5EW3A 1TQMA 5A4LA 4S2ZA 4B6LA 4BGHA 5L2TA 2X0GA 4NCTC 5E8YA 5DR6A 5TF9A 4PV0A 2HELA 4K77A 4LOOA 4BHNA 2QOHA 4XBUA 5IA1A 3WF6A 1YXUA 2WQOA 3ORIA 4E4MA 4QMYA 4QP7A 3DQXA 3EN6A 4MQ2A 2YLEA 3R9HA 3CE3A 4BTKA 4Q9ZA 3FLSA 3MJ2A 1DAYA 2GNHA 2RKUA 2BAJA 3M2WA 2FO0A 4MYGA 1Y6AA 2JAVA 5LMKA 5M07A 3A2CA 3UPXA 3EL8A 2E9UA 4OUCA 4XG4A 2W05A 4XMOA 2AYPA 4M13A 4WG3A 4BFMA 2JEDA 2RL5A 1YOLA 2XRUA 2XNPA 3V8WA 3HV4A 4TN6A 2ZJWA 5GJGA 1APME 3NUXA 4MXZA 2UZTA 3QF9A 3EZVA 4ZTQA 5GJDA 4Z55A 2WMQA 2VTTA 4ZOGA 3VULA 3OXTA 2PZ5A 5LWMA 3QGWA 3LXNA 4FL2A 1E1VA 5CX9A 4PP7A 3KRLA 4F9AA 2R3FA 4MNFA 4QQJA 5BVNA 4O7NA 4FIHA 4RQKA 4FNZA 5AM7A 3NUNA 3A7FA 2W17A 3O8PA 4BCOA 2A98A 3EYHA 2A2AA 4TPTA 3ZMMA 2JGZA 3KRJA 3UO4A 5HICA 4CT1A 5A4QA 2VZ6A 2VX1A 4ZMFA 4I23A 5A9UA 4MXYA 3OVVA 2J9MA 2JDVA 4BGGA 5KZIA 3TKIA 5CYIA 3R8PA 2UZEA 3NSZA 4AN9A 2JKQA 3DB6A 2WEIA 5A3XA 4R77A 1Z9XA 5AX9A 3L1SA 2J50A 3VQHA 3POOA 2ZB0A 4EH3A 3SOAA 5GIOE 2ZAZA 4EC9A 1CMKE 4UZDA 4XG9A 1F5QA 2A1AB 5IA0A 4AW2A 3LIJA 3RALA 3IONA 1U4DA 4XP2A 3HL7A 5E8VA 3DGKA 3CBLA 3HAMA 3ENHA 3QYWA 4FEWA 3UDZA 5EFQA 2VU3A 3KEXA 4IVBA 3DBFA 1G8JA 2PPQA 2J6MA 4FOCA 3REPA 3DTWA 5BVDA 4E4LA 3QUPA 3C1XA 3FJQE 3PWYA 3SC1A 3FC1X 3WE8A 2ZDUA 3QCQA 3EZRA 3WOWA 4ZTHA 2ZM1A 3ODYX 3VVHA 3VONA 4QMTA 5EHYA 3JXWA 3Q4TA 4FNYA 4QQCA 5M06A 3BLRA 4EYMA 2VO6A 4U6RA 5E7RA 3ORPA 5AX3A 4CFNA 2UZUE 2C6KA 2XZSA 4LL0A 5CI7A 5FP6A 1ZWSA 4D4SA 4DHIB 3DV3A 4JDIA 2QD9A 2Y4PA 2UZDA 5HGIA 3V5PA 4MD9E 2YAKA 2JKMA 3NUYA 2ZV7A 2VN9A 3VJNA 3UG1A 4AW1A 3OCGA 2RG5A 4JDKA 4I0RA 4A4LA 4CQEA 4FSYA 5CF6A 4DEIA 1UNLA 4EH9A 1KUTA 4C59A 1R0EA 1PXOA 3QQJA 5GZ8A 5FRIA 4CKRA 4KINA 4LV5A 4O0YA 2NNWB 4QMMA 3DJ5A 1PXMA 2YDJA 3UIBA 4AGUA 4BDAA 2BHEA 2C5YA 3GFWA 4AAAA 3UQFA 1PW2A 4IAZA 3ZM9A 2F7XE 2BIYA 4CTBA 1TQPA 1VYZA 4AZWA 3FXZA 2UZNA 3FZ1A 1BMKA 1PMVA 4R1VA 2ZFYA 5JSMA 3A4OX 4ANOA 2VWUA 4CFVA 5BVKA 5EM6A 5HNBA 2UW4A 2QKRA 4BCGA 5EHOA 2B4SB 4G17A 3UZTA 4FV9A 3BLAA 2UW8A 3CD8A 3FMHA 1G5SA 3IW5A 5LOHA 4XS2A 3FSKA 3VRZA 3OWJA 3K5UA 3BWJA 3OY3A 3RCJA 2UW0A 4FYOA 4FKOA 3QTIA 1WCCA 2GHMA 1OIYA 3PY1A 5AIKA 3I0OA 4CZTA 5D7VA 5M4CA 2AQXA 4DFNA 1VZOA 3KCFA 4XCUA 2WTJA 3Q60A 1IAJA 5LCKA 4ANBA 2CNVA 4AACA 4BI0A 4OT6A 3L9NA 4IH8A 4MWHA 4NT4A 3QRUA 4QTBA 3QHWA 3PTGA 2W06A 3EQRA 2VO3A 4TWOA 5DR2A 5I3OA 3PJ8A 3GCSA 4F78A 4FF8A 3R8MA 4NU1A 4W9WA 4GK3A 5IZFA 3O5AA 4FGRA 3IW8A 4LDTA 4PDOA 3R7EA 4I0SA 1DS5A 2HAKA 2WHBA 2XUUA 2FSTX 4BYJA 1GJOA 3IW7A 4E8AA 3GU7A 5DVRA 4BIDA 4U81A 3C0GA 5HD7A 4EUUA 5BYYA 4KIKB 4HZSA 2OG8A 5HQ0A 2B54A 5CQUA 3S2PA 3GUBA 3H0ZA 4U97A 3EIDA 5AA9A 4EH7A 4FI1A 4KUJA 4XP3A 5AAGA 1XMLA 2W1GA 4UMQA 2YERA 4KIOA 4C34A 2JDSA 3LPBA 4ZTLA 3MB6A 1AD5A 4I5CA 3TUCA 2R3QA 3VBWA 4AW0A 2W1EA 3PSCA 3QD4A 3D2IA 4LYNA 3F69A 1BUHA 1F3MC 3MI9A 2R3LA 5D10A 1U54A 2WMXA 4KIQA 3GT8A 3HKOA 2RFNA 4R3PA 3A8WA 2A27A 2VTMA 4J8MA 4G9RA 4GT3A 5C27A 5K0XA 5CSPA 3LFAA 2O63A 3NAXA 3QXOA 3E88A 5DHJA 1MQBA 3QCXA 5IH4A 1FPUA 4XH6A 3O0GA 4JBPA 1LP4A 4G3DA 4IQ6A 1ZRZA 2F2UA 3Q4CA 2R3OA 3JS2A 2F49A 3ZBXA 4C38A 1JQHA 3ZCLA 5C03A 4H1MA 5DBXA 3ZZWA 3PSBA 4GJ3A 4J52A 4O96A 5FQDC 4TW9A 5HZNA 3R28A 3A7HA 2QOKA 3GBZA 4H05A 1Y91A 2BZKB 3WZDA 3K3IA 3QRKA 2WKMA 3EYGA 4OBQA 3PFQA 3H30A 4D9TA 3V8SA 2KULA 4LRJA 4UWBA 2V22A 3UDTA 3IK3A 4CQGA 3OP5A 5HBHA 4BF2A 3WF5A 3OG7A 5DRDA 3BWFA 5HBEA 3RAKA 4G6LA 4Q5EA 3P1AA 5HBJA 3S3IA 2DYLA 4RMZA 2OBJA 4U42A 4YTCA 3QWJA 5AEPA 2X7FA 1H00A 4FZFB 2NPQA 2QOBA 2WMUA 4HYUA 5DG5A 4IM3A 4Z7GA 1R0PA 3ACJA 2IEWA 4FSTA 3VWAA 5LVLA 5EK7A 5CEPA 4TYHB 1CSNA 3QRIA 4C37A 3NDMA 4DDGA 3WYXA 3O50A 1VEBA 3QQGA 5AUVA 4GFGA 2PVMA 5EDRA 4EWQA 4E20A 2YITA 4BDFA 3TMOA 4O6LA 4KSQA 4FL3A 4L44A 2O0UA 2YM5A 4BCHA 3BU6A 4UMTA 2XYUA 2Z7RA 2OZOA 3UYSA 3COMA 3P9JA 3QALE 5FLFA 3D5VA 1QPDA 3F82A 2LAVA 1Q62A 4DG3E 5L6PA 1VYWA 3F5UA 2WTVA 5CY3A 1K2PA 4BCKA 3EOCA 5JGAA 2C3KA 2JFMA 5JN2A 1H0VA 4M84A 4RA5A 4Y83A 4FT9A 4FEVA 4FUYA 3RPSA 2OXXA 4AAYA 4Z16A 1P4OA 5CNNA 2Y4IC 4APCA 4V04A 5E90A 3F3WA 2QLQA 4HYSA 4O4CA 4F0GA 2OIBA 4BCNA 4JVGA 3ZBFA 4I94A 2ITYA 4FNWA 4BWPA 3T8OA 4D2SA 2UVYA 3BHUA 2IW8A 3QQFA 4RZVA 3W33A 3FLWA 4BR3A 3NS9A 4XJ0A 2WELA 1OM1A 5A4EA 2WXVA 4IIRA 5CI6A 3CPCA 4IB1A 5ANKA 4O0UA 1Q61A 3E93A 4Z9LA 4AE9A 4KD1A 2ITUA 3KGAA 1GZOA 3JY9A 3HP2A 1KV1A 5C8MA 5A6OA 5J9LA 5CXZA 3RWPA 3KXHA 4GVJA 2A0CX 4RX7A 3WARA 5JQ8A 4NW6A 5JFVA 3TT0A 1J91A 3AC1A 1U46A 2QOQA 4V0GA 4ZP5A 3BIZA 4NM5A 3E62A 3FYKX 4AZVA 4BIBA 4AGCA 4C0TA 3UDSA 4RA4A 3HP5A 4ZIMA 4ZS4A 4QYFA 5EM7A 4A9RA 4BTMA 2HWPA 3PP1A 4RGJA 3UVPA 3IW6A 1YXTA 4WRSA 3IS5A 4UMPA 1NVRA 2IWIA 3IPHA 3OOMA 3R63A 1URWA 2BVAA 3D14A 4FE2A 2I40A 2GNJA 2IJMA 3FSFA 2V0DA 3CTHA 4LUDA 3EFKA 1IRKA 4IAYA 5CZHA 4ASXA 2HZ4A 2PK9A 3UNZA 3ITZA 5IEXA 3FZSA 2XKDA 3CR0A 3KC3A 4H36A 4JL9A 4F1OA 2XK4A 3D0EA 1CTPE 4O21A 5HNGA 1JKTA 3KRRA 4WBBB 4YHJA 5CVGA 4NYEA 2QNJA 4E5WA 5LVOA 2EXCX 2ERKA 4TYJA 2W5AA 3PUFC 1SMHA 2QI8A 3QTXA 2HZ0A 3ZSGA 2X81A 2JBPA 3ZC5A 4NM3A 4R5SA 4C8BA 1K9AA 3P79A 3T3UA 4CVAA 4IM2A 4DHZA 3COIA 3ELJA 2B9IA 1FVTA 3GENA 5TE0A 1P5EA 4AFEA 4FSZA 2PUUA 2CJMA 5C9CA 1J7IA 3PXZA 4FV1A 3PPZA 2JBOA 4R8QA 3KXMA 3UIXA 4CT2A 5KKRC 2XAOA 1SVHA 3GP0A 3F5XA 2BUJA 4J71A 1MQ4A 1Q8TA 4QMPA 4CNHA 4QP4A 2FUMA 2HK5A 3LFEA 3LJ2A 3R7OA 4HVGA 2IVUA 2IZSA 2XNGA 3DZQA 3E8EA 4XRLA 3ZYAA 4O6EA 2Z60A 3R71A 5FBOA 4C4GA 4ZXTA 4ANMA 1OBDA 3ORKA 2BMCA 3ATTA 1B6CB 3N9XA 5CSVA 4DTBA 4AF3A 4JT3A 5AP7A 3ZFYA 3PZHA 3DJ7A 3AKJA 3UOKA 3AT2A 4IJPA 2QLUA 3FY0A 4AOTA 4CD0A 2JIIA 3C51A 4F65A 1CKPA 1OL6A 4I6HA 4MX9A 4ALUA 4J97A 3RPVA 4BICA 4RJ3A 4CMOA 2BKKA 5J1WA 3FMKA 5IF1A 5AP4A 2P55A 3HV3A 4GU9A 2XEYA 3QC4A 2V7AA 3LFDA 3AMYA 5BMMA 5EI6A 3V8TA 4BGQA 2OI4X 5DR9A 2YM8A 4EL9A 5EG3A 4JRVA 1F0QA 1ND4A 4H3PA 4U79A 2P0CA 4CKJA 5LXMA 4F08A 3TDWA 3G90X 4MNEB 4ZLZA 4JNWA 1M7NA 2C6EA 5DI1A 5HLPA 4AX8A 3QKKA 4DEDA 4GU6A 4LG4A 2WMSA 2XEZA 2VTOA 3BGZA 3Q53A 4IZAA 3KXGA 4EORA 2CKOA 3L8XA 4GW8A 5HX8A 3PFYA 4QP1A 1W98A 3R1QA 2J4ZA 3HRCA 5HKMA 4FIEA 3ZRKA 5IDNA 3W18A 4BZDA 3RCDA 3COHA 2P2HA 3OWPA 3LCDA 5CVHA 2EUFB 4CFUA 4EOMA 4F64A 4GCJA 5FTGA 3ZUTA 4JQ8A 4C4JA 1Q5KA 4E1ZA 2JDTA 4NIFA 1B38A 3NR9A 4XOZA 2F9GA 2R7IA 2CGUA 2W4KA 4EQCA 5BQ0A 3S1HA 1H1WA 3AC4A 5CAUA 2YM3A 4FKTA 4LFIA 2J0MB 4I4EA 1KE6A 4D2TA 3Q2JA 3ZU7A 4PDSA 4NTTA 4MXCA 1FINA 3CC6A 4IAAA 3SDJA 3HAVA 2C6DA 3FMEA 3LAUA 2XNBA 3PA3A 5JMSA 4QPAA 3F2NA 3GVUA 4U9AA 3OOGA 1NY3A 3K2LA 4ACGA 5HCXA 3VJOA 3TDVA 3U8WA 3ORMA 2R64A 1XO2B 3QGYA 5J1VA 5AR4A 4DH3A 3JVSA 3C4XA 1BI7A 1XBCA 3LMGA 2PULA 1A06A 1XH5A 1Y6BA 4X21A 4M7IA 4L3PA 5JZNA 2VTHA 4GT5A 4II5A 3R9OA 3R1YA 3ZLXA 4IDVA 4MD8E 3RPOA 4AU8A 2B9HA 4PX6A 3HA6A 4PNIA 4XRJA 4GFMA 4UMRA 4L68A 5DRBA 4FODA 1AGWA 3HMPA 1IEPA 1GAGA 3BRBA 5BYLA 1FGIA 4PWNA 4C3RA 5IEYA 3FKLA 4USEA 1I44A 2BRMA 4GIHA 3E8NA 4YMJA 3BYUA 3AKKA 4FKVA 3ZZEA 1Q41A 4NWMA 2WGJA 3NIZA 4M0ZA 4FSQA 2PSQA 4FTIA 4WKQA 3W2QA 3MFSA 3VUTA 3BYOA 4D2VA 4HYIA 3MW1A 4OTFA 4FIIA 3PDTA 1YI6A 5IQEA 4O2PA 5E8SA 3ZO1A 5CU0A 3OWKA 3FLNC 4JR7A 5CASA 2YWPA 4FTNA 3RVGA 4RX9A 4BDJA 4JMQA 3FBVA 4BBEA 3SX9A 4FV7A 3FEGA 3ETAA 1O6KA 4WIHA 4WD5A 3UIMA 3R7YA 3W1FA 4AA0A 4QQTA 3BHYA 4J8NA 2WU7A 2CGWA 4RVMA 3Q5IA 2VTSA 4P2KA 4HVDA 2PVKA 5IQGA 1R78A 2EU9A 3R04A 4F1MA 2PZPA 4YU2A 4GS6A 4IX5A 2YAAA 3PIZA 4QYGA 4F0IA 2OW3A 3AC3A 1G3NA 3ZTXA 5T6KA 3SAYA 3IOKA 4K0YA 4BDBA 4UY9A 4C36A 4GK2A 3MH3A 1UU9A 1Q8WA 1S9JA 4ZTNA 1M2RA 3DPKA 1O9UA 2XK7A 5IUGA 4PMPA 4AGDA 4O7VA 2CCHA 2WMTA 2PE0A 1SVGA 5E9EA 3AMBA 4A4XA 4O0XA 3ACKA 3ZDUA 3RM6A 3UQGA 3ZLYA 4N4SA 4J95A 4YZBA 3QTQA 3MTLA 2PVNA 4RIYA 4E6AA 2IVTA 3K5VA 3NW6A 4C61A 4DEAA 2X2LA 5C4KA 1DI9A 2B55A 4JG7A 4QYHA 5AIRA 4DFZE 3ZUUA 1LUFA 4YJUA 2UZWE 4ASZA 4DEBA 3RBWA 4O81A 2YA9A 3GCUA 2V5QA 4C3FA 1T45A 4D5HA 3KB7A 5AAEA 3O7LB 4TNBA 3KKVA 2C6IA 4G31A 3BLHA 4C4IA 4F4PA 4DCAA 4RLLA 4ERWA 4U40A 4IDTA 3R2YA 3MYGA 3VS2A 2XB7A 4ANLA 4X2FA 5K4IA 1PXLA 2YM4A 3CQEA 4L8MA 5FEEA 4FTKA 4RIWA 5KMOA 3KN5A 3NNVA 3H9RA 3V6SA 3QX4A 2CPKE 2G01A 4YJVA 1MRUA 2ZYBA 3G6HA 3CJFA 2VAGA 3PVUA 3HX4A 3OXZA 1YHSA 4ZSLA 4DFBA 3O8TA 3V5WA 2W4JA 2XKEA 4TTHB 4U41A 2PVLA 5I9VA 1OIRA 2CHLA 4RIXA 2C6LA 5H8BA 5BNJA 3G0FA 3KREA 5DOSA 1GIHA 3UO6A 3W55A 4RWKA 4O7ZA 4DTAA 4QP3A 5IPJA 1Q8YA 4L9IA 5FWKK 3NUUA 2VWXA 4TYIA 3OZ6A 5IU2A 4D1SA 2GHLA 3CP9A 3EHAA 2PMLX 4FT5A 4F7NA 3P0MA 3QWKA 3W0NA 3HV6A 4QYEA 3PPKA 4CXAA 5TR6A 4O27B 5CT0A 3DS6A