5J7HA

Crystal structure of anaplastic lymphoma kinase (alk) bound by brigatinib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
309
structure length
291
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords ALK tyrosine kinase receptor
publication title Discovery of Brigatinib (AP26113), a Phosphine Oxide-Containing, Potent, Orally Active Inhibitor of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 291
sequence length 309
ec nomenclature
pdb deposition date 2016-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j7hA01
2I1MA 3DLSA 4HJOA 4M8TA 3T9IA 4EONA 4XP3A 2PMIA 1DAWA 3K3JA 3L9LA 2X0GA 4YTFA 5BUIA 2FGIA 4ZSLA 1WMKA 1KE6A 2WXVA 3A4OX 3GCSA 1PXKA 1UV5A 3H0ZA 4R7IA 4U80A 5IQCA 2BKZA 3FKOA 5EI2A 3FZSA 4EOJA 3OEZA 4ALUA 4BZNA 4C36A 2WU7A 4DA5A 2WTIA 2R3QA 2YLEA 3O7LB 3FC2A 4EOIA 5LWNA 3A61A 4DEAA 2YWVA 3R1SA 4LUDA 4DYMA 5AUZA 2PVJA 4YJRA 5AP3A 5FM2A 5D1JA 5CENA 2QU6A 2W05A 4NSTA 5IQAA 3LM0A 4ANSA 5DG5A 4TYIA 5AUUA 5AUXA 3IO7A 2W5BA 5LMAA 2JLDA 1PMVA 3VUDA 1Q61A 3QLFA 3ZHPC 2WNTA 4WSYA 4QQTA 1HOWA 2YM5A 3AT3A 3P0MA 3BBWA 3L9NA 3PUPA 4I93A 4IZYA 2Q83A 3C1XA 5CZIA 2J2IB 3PPKA 2YCSA 4L68A 4YURA 3GEQA 3BBTB 5M56A 3I4BA 2V22A 3V5WA 4P5QA 4FVRA 5EFQA 2W1FA 3BZ3A 3CSVA 4IAIA 2HY0A 3HECA 3LFCA 3SOAA 3WE4A 3BEAA 2JDSA 3KULA 1KSWA 2O63A 4LL5A 4EC9A 3WBLA 4BHZA 3AGMA 1KE9A 4QT1A 4CFFA 4E5BA 2YIRA 4C3PA 3GXLA 3KMUA 1APME 4ZMEA 1OZ1A 3BGPA 4HGLA 3H10A 4YZCA 5EQEA 1ZLTA 2GTMA 4RIWB 1SZMA 1IRKA 2RFNA 1DM2A 4WNKA 5F4NA 3KMMA 2VD5A 4ZMFA 4AOJA 1OBDA 4BZDA 3R7VA 3OWJA 4BDJA 1HCLA 3QTSA 1WZYA 4LMNA 2J0MB 2RFSA 2HYYA 4S34A 3PRIA 3R7GA 4BL1A 2IW8A 1Y91A 4CFNA 1R0EA 2ITZA 3MSSA 4IVDA 5EM5A 4C35A 4HVDA 5FG8A 1JSTA 2A27A 4TNBA 3AC3A 5AA9A 2G1TA 2OK1A 1SNXA 5DH3A 3OF0A 4AAAA 4ASEA 5BQ0A 1XBBA 3PY3A 2B53A 1ZXEA 3SQQA 5EM6A 4JL9A 4PL5A 2CSNA 4OTGA 1YI6A 3SXRA 5EOLA 2W7XA 2J6MA 4GUBA 3SV0A 2JFMA 4J7BA 3KB7A 5E8WA 3R1NA 3CXWA 5CSHA 4ZIMA 3R71A 3HDMA 3N9XA 3VQUA 3UNJA 4PUZA 4FF8A 3SA0A 2XIZA 3G0EA 3VS7A 3RWPA 2IZUA 5IA1A 2XJ0A 1PW2A 3QKLA 4BYIA 5IMEA 1F3MC 4GK4A 4Y85A 4YLKA 2F4JA 3HMNA 3R02A 4RVTA 4E8AA 2NO3A 3JY0A 4YTIA 3ZFMA 2DS1A 4A06A 4NW6A 2PE1A 5M4IA 3ANQA 3E64A 3I79A 2J0KA 4YJNA 3PXQA 5IUGA 2Y6OA 4GYIA 1PF8A 4WNMA 2XK7A 3FXXA 3K5UA 2OKRA 4DCEA 3ZXZA 3R9RA 4BGQA 2FSOX 3PSCA 1GIJA 4KSQA 4ZJJA 2NNWB 4F1TA 2WMXA 3MESA 3QX2A 5DVRA 2C47A 4C4GA 4H1MA 2YA9A 3FYJX 4L42A 2O3PA 5DE2A 5A54A 2GS6A 1VYWA 1GIIA 3LFBA 4LRKA 1WBSA 1U54B 5LWMA 1O6KA 1H0WA 4NUSA 3OS3A 3UPXA 4E5AX 2XNNA 2R64A 3A7JA 4RMZA 2W1GA 5I9UA 3ZSGA 2XBJA 4CLIA 2WAJA 1Q8WA 2B9FA 3R7YA 4ACMA 4FKQA 5A4TA 1STCE 3GQIA 1GZ8A 4XLVA 4YHTA 3RPSA 3GBZA 4EBWA 3AC5A 3QC4A 4GKHA 4O0UA 4FT5A 3CP9A 3PA4A 4OTFA 1Z57A 5EKOA 4CEGA 3AOXA 2GHMA 1T45A 2QD9A 1J91A 2CNUA 4MEDA 3DBFA 2PULA 4AA4A 4GK3A 3ODYX 1UU8A 4PF4A 4YJPA 4F9BA 3RHKA 3PY1A 2GDOA 3UTOA 3CTQA 5FTGA 4YJUA 2WPAA 2PK9A 2UVYA 4PPCA 5JT2A 1VJYA 4O6LA 2OWBA 4O86A 3F5GA 3HMPA 3DV3A 5BUJA 4LUEA 4E6CA 1G8SA 1NA7A 2Y6MA 3POZA 5HQ0A 4ZZNA 3QTUA 3NMUF 5BVDA 3P7CA 3FZTA 4KA3A 3PVGA 2QOBA 2WTDA 4TYJA 4RX9A 3OVVA 4YZ9A 4EOSA 3DK7A 3NW6A 1DAYA 2OF4A 4Y8DA 4EUTA 2J50A 2ZYBA 4U97A 4MNEA 4NM0A 3PXFA 4S31A 2Z60A 1P5EA 3KC3A 3LLTA 3R1YA 4E1ZA 3NUXA 4PMSA 4RWJA 1XH7A 3A7FA 3PA3A 4M97A 2PY3A 3C0IA 5CZHA 5DRBA 2PMOX 4J1RA 4B7TA 4YLLA 1RE8A 2R3RA 1TQPA 2RSVA 1HCKA 3GI3A 3ORKA 5DYJA 4RJ8A 3UGCA 4RJ6A 5L8KA 3NW5A 2I0HA 1VZOA 2Z7QA 2G2IA 3HRBA 3MS9A 4R5SA 3CY3A 2R3FA 5J7HA 4NM5A 2F2UA 3Q4UA 4O27B 5AP7A 5H3QA 3U54A 2VTNA 3E7VA 4WUNA 4EK5A 4WT6A 5M06A 1Q8UA 1URWA 4C58A 5K4JA 3OW4A 3VBVA 4BDHA 4F08A 4JR7A 1ND4A 5CAPA 4F0FA 4U79A 3AC4A 4QMNA 3BRBA 5AEPA 3R9DA 5IEYA 3ID6C 4BCKA 2GHLA 2UZDA 3QGYA 4CV9A 3CJFA 4I6BA 3G2FA 4RX5A 5A14A 5BVWA 4NM7A 3ORXA 2PVRA 4RIWA 5ETIA 2PZ5A 4FEUA 2QOKA 4I5PA 5KMIA 3DBQA 5A4EA 2UZEA 3PJ1A 4GFGA 2BDFA 3KRLA 1A48A 4OTPA 4QMOA 3GU5A 3OOGA 4YC6A 5AR8A 2XK8A 4ACHA 4GJ2A 4BCGA 2UUEA 2V62A 2JKKA 2HZ0A 3G15A 3RZFA 4I92A 1ZY5A 4FNXA 4L00A 3GQLA 5AR3A 3RAIA 4J96A 4GFOA 3ZONA 5IH5A 2YISA 4M13A 5HCZA 4IB5A 3F82A 3C4WA 5FEQA 5IA2A 3WE8A 3QF9A 1XWSA 4USDA 4FK6A 3CY2A 3FLWA 3R7OA 1UKIA 5AV3A 1BX6A 4U0IA 5BVOA 4RWKA 3FV8A 3MDYA 3DS6A 5L3AA 4NFMA 5CEQA 3C13A 3NPCA 1IASA 4FA2A 2XRWA 1ZMVA 4PTCA 4O6EA 4BCHA 3QTRA 3VBXA 2VTRA 4G6NA 2QOQA 3QD0A 5K5NA 2VTTA 4RWIA 1QCFA 3C4XA 4FOCA 3WF6A 2X4ZA 2YAKA 4FTQA 1IEPA 3UDBA 2PZRA 2BRNA 3TNWA 4I5MA 2UV2A 4ERWA 4XBUA 4QYYA 1O6LA 4BF2A 1B39A 2W9FB 4ACDA 3P1AA 3TDVA 5FEEA 2C1BA 2VWZA 4FKPA 5DNRA 2JBOA 4CQEA 2VRXA 1ZYLA 5EOBA 4X21A 4FKRA 2UZVA 4HYSA 5J9YA 4NWMA 3NCZA 4KKEA 2XNGA 3SRVB 5LCKA 2Y4PA 2I40A 1WVXA 3LOKA 3PA5A 5H9BA 4BCJA 4W8DA 3EN6A 1U59A 3O0GA 3TACA 1H24A 3TKIA 3B8RA 4ANQA 5LMKA 2XIYA 1JKSA 4ZSGA 4IX5A 5JZNA 3Q3BA 3TT0A 4D1ZA 4EH9A 2GNIA 1ZRZA 1MRYA 3DAJA 4D2WA 1OIQA 3ZM9A 2FSMX 5IEVA 3FYKX 4NKAA 3RNIA 3TNQB 3VAPA 4XYFA 1YWVA 5KMJA 3QYWA 3FWQA 3R2BA 3FQEA 2C6IA 4QPAA 3U4WA 2G9XA 3MPMA 4IZ5A 2XF0A 4BICA 4R1VA 5DIAA 3RCJA 2HIWA 4FVQA 4YZBA 2I6LA 4TKSA 4IANA 4G31A 3A8WA 3VBYA 3W2PA 4RC4A 3FY2A 5LARA 3MVLA 4YTCA 3DK6A 4FTLA 4XG4A 5HX8A 3ZO2A 4FL3A 4D55A 4FIIA 4JAJA 3R21A 4F1MA 1CTPE 4XS2A 2B7AA 2W96B 1WAKA 4PP9A 4C33A 1RW8A 3E3BX 3PVBA 3BGQA 2YFXA 3N4VA 2YN8A 4D9UA 4K2RA 2OG8A 4LGDA 4D4SA 1E1VA 2HAKA 4FX3A 3V51A 2VX0A 4JS8A 5L2SA 1REJA 3HMMA 1YWNA 3R6XA 1WCCA 2X7FA 4MX9A 3VF9A 3A62A 2W4OA 3O8PA 3COKA 3PVWA 3FMJA 4CSVA 4UBAA 2OSCA 1Q4LA 3FL4A 4L01A 3ZSIA 2ZV7A 4TYEA 3W55A 4LGHA 4ENXA 1FGIA 2Z7SA 5H2UA 2QOOA 4X6RA 5EDRA 3WF9A 4E20A 4HVIA 2C30A 4ZS4A 4PL4A 3E5AA 3FJQE 3QCSA 1PYEA 3DY7A 1PXMA 3EQDA 2V55A 3NNUA 2X7OA 4FV6A 4GFMA 1R0PA 3LMGA 3ELJA 1MRVA 3FXZA 3HL7A 3KRWA 5DGZA 4XG9A 5CT7A 3MA3A 3NWWA 2C4GA 2JKQA 4PL3A 4XEYA 3VW8A 5D12A 5KKRC 1PRYA 1S9IA 3FI4A 2VUWA 5AWMA 1W8CA 2PVFA 5F95A 3WF5A 4FG8A 5LCJA 3QFVA 5IA5A 4G17A 3N4TA 3QAME 4BI2A 4F63A 3VBTA 4O1PA 5I9ZA 4Q9SA 4AX8A 4KBAA 3ORNA 1YDSE 2FB8A 5IH4A 5CQWA 1FBNA 4RC2A 3VIDA 3GUBA 3ORZA 2XRUA 3LHJA 4F7LA 3R8LA 3WF7A 1FMKA 4U45A 2B1PA 4M7IA 4DT8A 2F57A 2XIXA 3SOCA 3VS5A 4U40A 1OKWA 3P7BA 3FHIA 4JQEA 5C27A 5HNIX 2ZDUA 4WIHA 4C61A 5CU6A 3ZRKA 4FSZA 5EDPA 4ERKA 1J7UA 5HU3A 1Y57A 3UE4A 3QQJA 3QQFA 2VWIA 5DR9A 3F3WA 3SKCA 3W2RA 4ZTHA 3FEGA 2VWUA 3P9JA 2C6LA 2Z7RA 3DDQA 1CDKA 2FO0A 2OIQA 3GCVA 5CI7A 4DEDA 5AP1A 3RJCA 4HVSA 1ZYDA 5LVPA 3Q2MA 3DZQA 4UXLA 2QOCA 2CKQA 1JNKA 3ACJA 5HTCA 1FVRA 2PU8A 4QP8A 1E9HA 3D5WA 4ANMA 4I21A 3LMHA 3RK5A 4N57A 4UYNA 5AR2A 3WF8A 4AXAA 5I5ZA 3P23A 2JAMA 4AE6A 5JFSA 4X3FA 3ENHA 1GNGA 3FI8A 2GNJA 4D4YA 1PHKA 4MXYA 4EK3A 3LCTA 4FV0A 3IECA 4CVAA 3RAKA 2A0CX 4Q5EA 4HW7A 4OTIA 3EN7A 1NW1A 2ITQA 4DFZE 1SM2A 3QKKA 3HAMA 2C0IA 3I0QA 2GFCA 2J7TA 2WELA 4FUYA 4L44A 2E2BA 2PVNA 4M68A 4QYFA 3BHUA 5DMZA 2ACXA 4FIJA 2J0LA 3FHRA 5M08A 2C5OA 1JAMA 3AC2A 4TYHA 4O96A 4MKCA 4G3CA 4X0MA 2CGVA 4PX6A 3FLSA 3AT2A 2BHHA 2JDVA 2VTAA 3O8TA 4MVFA 5C1QB 3ZC5A 3DFAA 2XKDA 3LJ1A 4M66A 2PVHA 5FQDC 4O91A 4CTBA 4KIOA 3Q96A 1ZOHA 3V6RA 2IO6A 2JAVA 5CXHA 1MUOA 3KGAA 4WG4A 3D15A 1T46A 3DBEA 2BILB 4QPSA 3ZSHA 1VR2A 2QODA 4FT0A 5GNKA 5JRQA 3LFDA 4JVGA 1ZZ2A 4G5PA 4CZYB 3TDWA 3P7AA 5HVJA 3HV4A 4NL0A 5CI6A 4JG8A 4RLLA 3Q9YA 3TV7A 4KIPA 4KSPA 4K18A 5EQYA 1OL7A 2EB3A 5BYZA 2C0OA 1XH5A 4BIBA 4FI1A 5D9HA 4QP2A 4O7YA 2J51A 4YMJA 4J95A 1WBTA 1PXLA 4IAAA 5HKMA 3ZH8A 4RLKA 4QRCA 2W1ZA 2W5AA 3TN8A 3SVVA 1IA9A 3BLQA 3UOKA 3V5TA 4DAWA 5TF9A 3VRZA 2REIA 5M53A 3C5IA 3EQFA 1V0PA 4L45A 3PIZA 4II5A 2H6DA 3LXKA 4OAUC 5KMOA 1Y6AA 1OKZA 3P4KA 4L3LA 5EW3A 3AC8A 4EJNA 3EL7A 3QGWA 4A4LA 2IN6A 1SVHA 2JC6A 5HO8A 2OZOA 2ZM1A 4MHAA 5E1SA 3UYSA 4KKGA 3UP7A 3FI2A 3DQXA 2EVAA 3VHKA 4UMUA 3DTWA 2VTHA 4FTNA 5AUWA 4CMOA 5CU0A 1YDRE 2ETMA 3NUYA 5I9VA 3UQFA 3ZFYA 4IAYA 3LFSA 3MY5A 3F2NA 3TV4A 3ZXTA 2CNVA 3CPBA 4RPVA 5BMMA 2X1NA 4M69A 3U8WA 4OT6A 3E8NA 4LV8A 4LI5A 3T8OA 3F5PA 3FQSA 5HBHA 3L8XA 4MCVA 5K0XA 3V01A 4LGGA 5IUHA 4F0GA 4YUQA 4A9SA 3R7UA 4NCTA 3C7QA 3GU4A 4I6QA 2GQRA 2JIIA 2PVMA 4E4NA 4FV9A 3AG9A 3TIZA 4FV2A 4NZWB 3BYVA 4GU6A 5AR5A 2O8YA 2PVYA 4AGUA 5BVFA 5J9ZA 3V5JA 1L8TA 3R22A 2QOHA 3M1SA 4C2VA 1Q8ZA 3U9CA 5K3YA 1OBGA 2UVZA 3MVHA 4R7HA 4EKKA 2PSQA 1M2RA 2NRYA 1W84A 3RPOA 4EQMA 3FMNA 3C9WA 5CANA 3DQWA 2Y0AA 4FNWA 3F3VA 2HELA 5DA3A 2PE0A 3L8PA 3W10A 4ZLYA 3B2WA 3SXFA 1S9JA 2ZB1A 3PXRA 4RIYA 5L6PA 4U81A 5CNOA 4U41A 4FSYA 3ZC6A 2VO0A 3IDBA 4QP4A 2YIWA 4GMYA 3DFCB 1DI8A 5ANKA 5FBOA 3QLGA 2A2AA 4C4JA 5KHWA 1BYGA 2FA2A 3O50A 3KA0A 1H1SA 5EYDA 5M55A 5L2TA 5M57A 4BY9E 5CYIA 4CMUA 4CYIA 3H9RA 5FGKA 1IR3A 5CU2A 4XP0A 3TUDA 2Z7LA 3QUPA 5DT4A 1PYXA 2R3KA 3ZU7A 3VBQA 5C9CA 5CT0A 1XBAA 3G6GA 4AF3A 4MXZA 4B8LA 5CAQA 1H08A 2O0UA 2VTIA 3CQUA 2XB7A 3G9NA 4M3QA 4R3CA 5HZNA 2PUNA 3EZRA 4G34A 4NEUA 2WB8A 2G15A 4WBOA 1R3CA 1R39A 4CG9A 4FR4A 4YHFA 4F99A 3LXLA 3WZKA 3VVHA 4G3EA 3UP2A 3MVMA 2VWYA 4FSMA 4DGGA 5HTBA 4FVPA 3V8SA 3QX4A 3S4QA 5JQ5A 2WMUA 4GSBA 4QPMA 5J95A 2CNQA 2VNWA 4H39A 2UW4A 3ITZA 4I94A 4U3ZA 3TIYA 3TZMA 2WZJA 4ANLA 3OG7A 3TKHA 2XNBA 4D2TA 5KMKA 2HXLA 2VTQA 4QP9A 1SVGA 3UIBA 3V6SA 5A9UA 3BV2A 1M7QA 2UW9A 1H00A 4GIHA 2ZMCA 5T6KA 4E3CA 1JKKA 1JQHA 4JI9A 4PDPA 3FZRA 3ATSA 1TKIA 1UU3A 2V5QA 4I22A 4RQVA 4BCNA 3TL8A 4PY1A 3UPZA 3PJ2A 4I3ZA 2GPHA 3RNYA 3WZJA 4JDHA 4BDKA 4ZEGA 2XM9A 3K3IA 2J9MA 3WZDA 4D1XA 4X2KA 1BI7A 4EOLA 4MBIA 4RWLA 3OOMA 5JGDA 3Q32A 3O8UA 1I09A 3G0FA 2PMNX 1OKYA 2RL5A 4X3FC 2C6TA 3VS6A 1Q97A 5AX9A 3HMOA 4APCA 3AQVA 2XH5A 5T3QA 1A06A 3MFRA 4AT3A 4RJ5A 5JQ8A 5IKWA 2C69A 4U42A 5KKRB 4IZ7A 5GZ8A 4OUCA 1OUKA 4KUJA 1H0VA 1H1WA 4IACA 4U44A 2IPXA 4QP7A 3IK3A 4ZTMA 4JXFA 5E1EA 2RFDA 5FWKK 3F5XA 3EB0A 4BCFA 4AGWA 4K9YA 1QPJA 2UW7A 2QKWB 3B8QA 3QTQA 3QZIA 4DEIA 3R9OA 1W98A 3ZMMA 4K33A 4ANBA 4BDEA 5E8UA 3JS2A 4X2GA 3OROA 2R3NA 4QP3A 2X8IA 2J4ZA 1KV1A 3TI1A 1IAHA 1IG1A 5FLFA 4JBQA 4WRGA 3C51A 4DHFA 2VO6A 2E9OA 2O65A 5C26A 5AP5A 1YOMA 3VQHA 1PXOA 2LAVA 1U5QA 3PWYA 4D0WA 5HLWA 5HHWA 4LL0A 4M15A 3AD4A 3TNPC 4E4MA 5AP2A 3JVRA 2G2HA 1V0OA 2YZAA 2JDOA 1SMHA 4HPUE 3V5LA 1XH6A 5FP6A 2W99B 3FMLA 3MB6A 2WHBA 2BIYA 3MV5A 3QTXA 5HEZA 1FGKA 2F2CB 4A9TA 1J1BA 3ZLWA 2X9EA 4DEBA 2BRGA 3TM0A 4LOPA 5IDPA 3TWJA 2PUUA 1QPDA 1KOAA 2XCKA 4KS8A 5C01A 1FPUA 3D94A 4BKYA 4ZLZA 5AV4A 2X8EA 2EXMA 3F3ZA 2FYSA 3I6UA 3NR9A 1OITA 4F09A 1K9AA 4FV7A 3EFJA 3EFKA 5TE0A 4EOPA 4DFUA 3U4UA 3KRRA 5K5XA 3QRTA 3LZBA 2F7EE 3LKMA 4O7NA 4IJ9A 4F6UA 5KCVA 5KUPA 5TOZA 5ANOA 4JNWA 4YSJA 3GFWA 3QRKA 5C4KA 5AV2A 1YXSA 1GY3A 4K8AA 2VTMA 3BEGA 1CSNA 2WMQA 1OPJA 4IW0A 4LMUA 4MYGA 4AU8A 4EHVA 4O0VA 4F70A 1K3AA 2XP2A 2C68A 5JGAA 4IAKA 5CU3A 4AN9A 4IXPA 3FC1X 2VX3A 3TCPA 4PPBA 4TWNA 3PP1A 5ETFA 3OMVA 3K54A 2CCHA 4XRLA 2WTVA 4LRMA 3FY0A 4M14A 4EZ3A 4GG7A 1H4LA 2YERA 2OFVA 5CEKA 4H3BA 2BAJA 3OT8A 3GCUA 4W9WA 3WARA 4HVHA 3UIUA 3NRMA 5HVKA 3NVMB 4G9CA 4NTSA 4JG6A 5AV0A 4ZJVA 3EQRA 1M17A 4UMTA 2HENA 4CFWA 4JJRA 4O0YA 3AMAA 2C0TA 4FZDB 1XH4A 4L67A 3FMMA 2BKKA 1FMOE 2B9IA 2HZIA 1J3HA 4HZSA 4NW5A 5EI8A 3DKGA 3LCOA 4GUEA 4EYMA 2VTLA 2WKMA 1Q5KA 2IZSA 3CKWA 5HOAA 3R7EA 4O22A 4V0GB 4JRVA 4L8MA 3PIXA 4IB1A 4CFMA 4TWCA 1YW2A 2W17A 5JH6A 2XK9A 4UALA 3KREA 3KL8A 3CC6A 1CM8A 2CMWA 3F61A 3UIMA 4C4IA 4J53A 1E1XA 2B9HA 3RZBA 3VULA 3WYYA 3NIZA 1H27A 4DBXA 4O1OA 4YJQA 5EM8A 3VJOA 5CF6A 4NH1A 4C4HA 3SD0A 4DH1A 2DQ7X 3FZPA 5JFVA 3OWKA 5GZ9A 1UNHA 4PMPA 5M4UA 1P2AA 3M11A 2G01A 2UZLA 4FSWA 1P4FA 5FXSA 4BTKA 5BMSA 5IMXA 4RJ3A 3WYXA 3FUPA 1UA2A 2Y8OA 4BR3A 4U43A 1Q62A 3OCBA 3OP5A 3PG1A 4FL1A 2V7AA 4LOQA 1UWJA 5HE2A 2B9JA 3PRFA 4D1SA 5I0BA 3L1SA 4HYHA 4RA4A 4FKJA 4U6RA 2IW9A 2ZV9A 3OXIA 4E26A 3DXPA 3VS4A 5BVKA 4FEWA 4FICA 5IDNA 3CQEA 4FYNA 3E88A 4JX3A 2OFUA 4FKGA 3VHEA 5JEBA 1TVOA 3HZTA 4FV8A 3RPVA 3SC1A 3LFQA 2X2MA 3PXYA 4MAOA 3CCNA 4ZTSA 3QWKA 3RVGA 3EWHA 3OY3A 3O71A 4C7TA 2QOIA 2ERZE 4ENYA 5C4LA 4FKWA 4FZFB 3R7IA 4XV2A 3E3PA 5IQGA 3F2AA 4EOKA 3JVSA 4GT5A 5BPYA 4EQCA 2BUJA 2Y9QA 5T68A 4GT3A 2VTPA 3NGAA 4AOTA 3LMIA 4EJ7A 3S95A 4IX6A 1LPUA 5E9EA 3FMDA 3E92A 3R8UA 4WOVA 2R3OA 4WRSA 5IEXA 2WQOA 4AZEA 5KO1A 3HRFA 3ZBFA 3NUNA 4EC8A 5A6NA 3BQRA 2OI4X 3DT1A 1FINA 3A7IA 5CF5A 4NKSA 4DFBA 4YHJA 4DLIA 2QKRA 3ZOSA 4KRCA 4ZSJA 4YJSA 2ITWA 4FSUA 5DFPA 4BDIA 3TXOA 4CMTA 3KXZA 4L43A 3UG1A 1YHVA 4FT9A 4F9WA 3ZCLA 1RDQE 1OIYA 2VWVA 4YLJA 5FUTA 5HIEA 4FV5A 4O7TA 4QMPA 2SRCA 2X39A 4DEGA 3HKOA 3BE9A 1JBPE 3QKMA 2A1AB 2OU7A 5AM6A 4WBBB 3FLZA 3ZO3A 1VEBA 4BDAA 3VS2A 2X6DA 4Z3VA 3LVPA 1TQIA 5LVMA 3OXZA 3FLNC 2VU3A 4ZTRA 3CD8A 4KAOA 2JKMA 3I6WA 1M2QA 4EWQA 5J5SA 4K0YA 1BMKA 5CAVA 2B0QA 4BWXA 3PSBA 3DXNA 5AJQA 3HP2A 4HNFA 5DR6A 3E7OA 3KCFA 2J0IA 2XNPA 2YABA 3PJ8A 4MF1A 4QP6A 4QNYA 3BX5A 5CVFA 4AW2A 5CEIA 4O0SA 1GZKA 3IG7A 5E8SA 4QMXA 5ACKA 3EIDA 2PUPA 5TO8A 4BWKA 3HUCA 2XK3A 1RJBA 4JIKA 2PZYA 1OI9A 2BIKB 3A2CA 1KE7A 3ZLYA 5J79A 4O83A 2OO8X 5HBJA 1JSVA 4JBOA 4GEOA 3RKBA 3QWJA 3EH9A 3MY0A 5I4NA 5HD7A 3D4QA 3GB2A 5FRIA 1PMNA 2YIXA 3MY1A 3EOCA 4UWCA 3RALA 3LE6A 5HNGA 5KZIA 2CLQA 4JG7A 3TZ9A 3VRYA 2IWIA 3H0YA 3ZZWA 4BN1A 3OW3A 3QTZA 3ZRMA 3SX9A 3KK9A 3OXTA 5EQPA 4EQUA 4EK6A 3Q6UA 2EB2A 3F7ZA 4FGBA 4YJVA 3OBGA 4E6AA 3DPKA 3MJ2A 4BGHA 3S2PA 3QA8A 3ZEWA 1UWHA 4ASZA 3F7WA 2XA4A 4OGRA 5AA8A 3UJGA 3KF7A 3C4FA 3AXWA 4DG3E 4X6QC 5HIDA 1M2PA 4IFGA 1U54A 4QQJA 1MQ4A 5FD2A 3WILA 3RHXA 3FKLA 1BL6A 3L9PA 3DDPA 2ZV2A 2P33A 3PG3A 4R3RA 2O64A 3QBNA 2X8DA 2RF9A 2UW3A 4ZS0A 4OBQA 2XYNA 4ZY5A 2R3PA 4FV4A 5J5TA 4J8MA 5DLSA 2I0YA 3QHWA 2WTWA 3ZFXA 3KXMA 3U51A 1KOBA 4KD1A 4OTWA 3LAUA 3UODA 3P86A 5JGBA 5B2LA 3EHAA 2JIVA 3HV7A 4FTTA 2R7IA 3M42A 5CAOA 2GNHA 2JITA 4FSQA 4GH2A 4IC8A 3I0OA 3DNEA 4JBPA 3W2CA 1UVRA 4WNOA 1YXVA 2J5FA 3H3CA 3IOPA 3AMYA 2QOFA 2WMRA 4M0ZA 4R8QA 2WU6A 3AD6A 3COHA 3CLYA 3L8SA 4Y73A 2QU5A 4RIXB 2FVDA 4PWNA 3TV6A 2WFYA 2Y4IC 5DPVA 5G6VA 3H4JA 3UNKA 1KUTA 4MXAA 3FI3A 1WVWA 2XEYA 2JD5A 4TN6A 2CPKE 3GC8A 4BIEA 3HAVA 3FBVA 3R2YA 4I24A 4CZTA 1REKA 4X3JA 3BI6A 1OL1A 5L2WA 2YCQA 4N4SA 3NYVA 4OTDA 3NLBA 3D5UA 5FXRA 4Y72A 2YWPA 3GVUA 2WTKC 2QHMA 2VNYA 1MRUA 3F69A 3N51A 3QHRA 4FNZA 4TL0A 3HA6A 3R1QA 4F7SA 3D2IA 3LCKA 3H9FA 4EHGA 3GU6A 4I0SA 5EK7A 2OICA 2HXQA 5EM7A 2CGWA 2FH9A 3GC7A 3BHVA 3LQ3A 4D2RA 5CVGA 3GU8A 4O84A 5IPJA 3KFAA 2QURA 4DCAA 2VWWA 5A4CA 4UYAA 4E6QA 4FV3A 4H1JA 2X4FA 3IW4A 4OLIA 2OJ9A 3O7LD 2CN5A 4MWHA 4NJDA 5IQBA 4AGCA 4ZTLA 4BRXA 4R77A 5LVOA 4QYHA 1M7NA 4XRJA 5E8ZA 3ODZX 4AS0A 4XV9A 4H3PA 4EH6A 4JIAA 5KNJA 3JR1A 1B38A 3O96A 4N0SA 2W1DA 4JT3A 3ROYA 1P4OA 4OAVB 3A4PA 2R3IA 1W83A 4S30A 4EZ7A 4DG0E 1Q3DA 4G9RA 2HWOA 4XOYA 2OBJA 2ZMDA 4RX7A 4HVGA 2XCHA 4I20A 3OUKA 3OTVA 2WIHA 3NZ0A 3FZOA 4QQCA 2X7GA 2UW8A 4KKHA 3CGFA 3RWQA 3IDPA 3T3UA 4AACA 1XR1A 2EUFB 3AC1A 5KMLA 1J7LA 4FKIA 1KE5A 2X9FA 3IGGA 3NX8A 2J5EA 1NVRA 3QQGA 4JX7A 4QMWA 5F1ZA 1FVTA 2R3JA 2Q0BA 5AM7A 1WBWA 4FTMA 4FKLA 4NT4A 2XJ2A 3W1FA 3E93A 4JDKA 4O0TA 4H05A 4A9RA 5IQDA 1A9UA 1W0XC 2ITVA 5AFVA 3MJ1A 4DEEA 5FTQA 5IG1A 5JKGA 4RG0A 1R78A 3CJGA 3DCVA 3GP0A 3R9HA 2IVSA 2ZAZA 3EQPA 3LFEA 4PTGA 2W4JA 4R1YA 4U5JA 4F4PA 3D7TB 2WOUA 1ZZLA 5JN2A 2B54A 4QQ5A 4BCOA 3TTIA 2V7OA 1JPAA 1H1RA 3GC0A 2PHKA 4EOMA 2WGJA 3CTJA 5HE0A 5CSPA 4C3FA 2BDWA 2F49A 1NVSA 3PWDA 3HEGA 5EYMA 3QQUA 5AAFA 5CF4A 4MH7A 2A4LA 2ITYA 3KRJA 5D11A 5E92A 4ARKA 5HICA 3SRVA 5CLPA 1B6CB 2H34A 5AX3A 2R9SA 4ITIA 4BTFA 4A9YA 1YXUA 4BTJA 2CGUA 3HA8A 1AGWA 2NRUA 3R8MA 3GC9A 2BRHA 4I0TA 2WQMA 2P55A 4IVBA 4DGNA 4F0IA 3DLZA 2PL0A 3PLAE 2VTSA 4W4WA 3R73A 4ACCA 2DUVA 2EXCX 1ATPE 2HY81 3BQCA 3V04A 5A3XA 4D58A 4RJ7A 2BTSA 5ANGA 4MD7E 3G51A 3WZUA 4CGAA 4XG6A 4FEVA 5HVYA 4TY1A 5DRDA 3O17A 3Q6WA 4G2FA 4QTBA 5GIPE 5L2QA 5C03A 1U4DA 2R5TA 4GV1A 3A7GA 4MQ2A 4IDTA 4IWOA 1H8FA 3LPBA 5TT7A 2DWBA 3Q9ZA 4QTDA 3VWAA 3FKNA 4YBJA 4FSRA 4JDJA 3QTIA 1FVVA 4BCMA 4UZHA 4N6ZA 2QO2A 4L52A 4ANOA 3DBDA 4BBMA 5ICPA 4W4VA 5CS6A 3EFLA 5J8IA 3U9NA 4IH8A 3UYTA 3DXQA 3KU2A 4GKIA 3KEXA 1SNUA 3SG9A 4QD6A 3KVWA 4TYGA 5BX0A 4TXCA 5FTOA 3LQ5A 5HE3A 4BZOA 4DG2E 1FQ1B 3QRUA 4DFLA 1YHWA 4J52A 5LMKC 5AIRA 2G2FA 3EQIA 3L9MA 4MNFA 4FTIA 2Z8CA 3Q5ZA 3RI1A 3RPRA 3PE2A 3R8ZA 2E9NA 2P2HA 4JLCA 3ZM4A 1NXKA 4BKZA 3DOGA 4WO5A 3NAXA 4O7WA 3BPRA 2BZHB 3NVKI 2R3GA 5IU2A 3W8QA 4YJOA 4EYJA 2Z02A 4XG3A 5HD4A 4ZY4A 1TQMA 4G16A 4EORA 3FDNA 5IF1A 1UKHA 3AMBA 4FL2A 4TTHB 3K2LA 4UEUA 5HG9A 4ZP5A 4AZVA 5E4HA 5KMNA 3VUGA 3PFQA 5EW9A 5LVNA 5HORA 3ORMA 3DKCA 3CS9A 5BYYA 1QPCA 5D10A 3U6IA 5KE0A 2C5NA 2ITOA 2XS0A 1ERKA 1O6YA 3ULZA 4DBNA 3FAAA 4C0TA 3NUSA 3UZRA 1JSUA 1URCA 2AUHA 2C1AA 4IX4A 4P5ZA 4XUFA 2XKFA 4BBEA 5AAGA 2EU9A 2VTOA 3UOLA 4CV8A 1PJKA 3E8DA 1ZY4A 3EL8A 1NVQA 2JDRA 4AA5A 5GHVA 3OZ6A 5CASA 4X2NA 4EOQA 4QMSA 1YQJA 4L53A 4HOKA 5A46A 2EXEA 1YOJA 4KABA 3W2QA 2UW5A 4DT9A 2W9ZB 3FPMA 5BYLA 4FBXA 1M52A 3VW6A 3RTPA 2RIOA 4RRVA 4M12A 2IZRA 3HUBA 3OBJA 3QZGA 4TZRA 5E7RA 4AFJA 2PPQA 4NIFB 4E73A 4B99A 5D7VA 2R0IA 3DK3A 2X2LA 3IKAA 4YPSA 4AW5A 5JSMA 3IOKA 3MFTA 5D41A 3TEIA 2PZIA 1ZYSA 5ANJA 3ATTA 3VBWA 4I41A 3EN9A 4FTUA 4PTEA 1IA8A 3F88A 4GW8A 3VS3A 1BI8A 4PMMA 5IQEA 4PPAA 4KIQA 3BV3A 4GG5A 4RGJA 4JAIA 4I5CA 4V01A 5KHXA 2C5XA 4Y5HA 5EDQA 5KBQA 4FTRA 3RAHA 4YC8A 1BL7A 3C4CA 5IUIA 4QTAA 3QCQA 4FT7A 4O7RA 3RGFA 4E7WA 4ZAUA 2E9VA 2QVSE 3K5VA 3DJ7A 1FOTA 4GS6A 3BGZA 4YGAA 3W33A 1I44A 1UU9A 3C4ZA 4DEHA 4D9TA 2C3IB 5M44A 2YHVA 5FBNC 4ASXA 5HESA 4F6WA 5B2MA 5HGIA 4YZNA 4BVUA 5ACBC 2FSLX 4PDSA 3EQBA 4S33A 4FSNA 4WG5A 2P4IA 3MH3A 3DAEA 3LFAA 4ZTNA 3FSFA 4E5WA 4LG4A 2QHNA 4PDYA 4RZWA 4XJ0A 5CTPA 3GCPA 1JKTA 3O2MA 4QMUA 3PSDA 4EK4A 3MIAA 4I23A 4RFYA 4BYJA 2QR8A 2WMAA 2Y4IB 4ZJIA 4UX9A 5DOSA 3KXNA 4UXQA 3QQLA 1QL6A 3OHTA 5CQUA 3BIZA 2HZNA 3HDNA 3BKBA 2ZB0A 3LM5A 2UZTA 4O2ZA 1MP8A 4DH3A 1MQBA 4IQ6A 4CLJA 2R3MA 3V8TA 2GQSA 1GZNA 5DWRA 3KXXA 2H8HA 2OGVA 5H8GA 3D14A 5B7VA 2WTKB 3UC3A 5KBRA 4MD9E 3PTGA 3RK9A 2XK4A 2PVKA 3KY2A 3SW4A 4I4FA 4U9AA 3TNIA 4F7NA 4QTEA 2YIQA 4Z7HA 3WZEA 3GFEA 4B9DA 3BELA 4BDFA 4CZUA 4F64A 2BR1A 2BTRA 4CT2A 3S00A 3SDJA 3UOHA 4BDDA 2WD1A 5IQHA 4FTAA 1WFCA 2R3HA 3GGFA 4O2PA 3OT3A 1YI3A 2YCRA 5CWZA 5LVLA 4EHZA 2QO7A 3LCDA 2WMSA 4CCBA 3OY1A 2ERKA 4FTOA 4K77A 4DH5A 1KWPA 1ZARA 3POOA 4FOBA 1LEZA 3RK7A 4YC3A 4NFNA 3C0HA 4ZSEA 4ORKA 4MXCA 5IA3A 4DFYA 4I4EA 2OXYA 3RCDA 3SW7A 4FODA 5A4QA 5CALA 4DTAA 5M4CA 5FM3A 2JDTA 3TUBA 3EQGA 3IDCA 3LXNA 4S32A 5F20A 2WMTA 4FG9A 5EYCA 4IB3A 1RQQA 3QUEA 3LXPA 4ALWA 3ZUUA 5JMSA 4QMLA 3SLSA 2I0VA 3FMEA 2YITA 2ITPA 3P78A 2OF2A 4MNEB 4FEQA 3ORLA 1PMEA 4U8ZA 4OW8A 4USEA 3CQWA 3QD3A 4JQ7A 5LQFA 4FTCA 1QMZA 1CKJA 2W4KA 3MH1A 2YEXA 4P90A 2LGCA 4GJ3A 1JVPP 3ZLXA 2OW3A 5J9LA 2BRMA 3ZUTA 3LIJA 5GINE 3NYXA 4C34A 3G5DA 5EI6A 2OIDA 1G3NA 4HCTA 4IM2A 3D5XA 4LQMA 3R8PA 5C8KA 2QG5A 3N4UA 3I5ZA 2UVXA 2GCDA 4AWIA 3PVUA 3P08A 3Q9XA 4IIRA 1YHSA 1J7IA 2RGPA 2C6DA 4FEXA 2KTYA 2I7QA 3MPTA 5BVEA 4O0XA 1OIUA 5HLPA 4IM3A 3E87A 2GMXA 3DU8A 1H26A 4O0WA 4IWPA 3BE2A 3UC4A 3B2TA 2BPMA 2OH0E 5HLNA 3EKNA 3R28A 2GSFA 4PMTA 3VF8A 4L3JA 3NYNA 4OBPA 4UZDA 3VO3A 5AADA 3V5QA 1BLXA 1PKDA 2R3LA 2RFEA 4U3YA 2BALA 2HCKA 4BDGA 4C37A 5KMMA 3Q9WA 4FIHA 4FZ6A 3KCKA 4FE2A 3BU3A 4Y83A 4EZ5A 3PZEA 2YM7A 4NIFA 3ROCA 5L6OA 3QUDA 4MXOA 4XCUA 1Q99A 2OJGA 3Q4CA 3MPAA 2FUMA 3C5UA 3D2KA 3LQ8A 4CRSA 4HZRA 5TR6A 1Z9XA 4ASDA 4YO4A 4EH2A 4RBLA 1H07A 2ITUA 4HYUA 3W16A 4OT5A 4F9AA 5EH0A 2WOTA 3Q53A 3ZLSA 3OEFX 4PDOA 2C3JA 3KKVA 4AGDA 3C50A 2P3GX 4QMQA 5KX8A 3LJ0A 4NCTC 2C6EA 3IQ7A 3E8CA 4CFUA 4RC3A 1YVJA 2JEDA 2ZJWA 3IW8A 3OWPA 2IG7A 1GAGA 4CG8A 4ZZMA 4AUAA 3UOJA 2ZVAA 2XK6A 4A07A 4D28A 1ZMUA 3FPQA 3W32A 4V04A 4YJTA 5CXZA 4PV0A 4QYGA 3ZS5A 4GVAA 3O23A 2O5KA 2AC5A 5DN3A 4NTTA 3EYHA 5CX9A 4GIIA 3A7HA 3THBA 4DGLC 3I1AA 5DR2A 5AUTA 3NIEA 4RVLA 4IWDA 4I0RA 1V1KA 2WMWA 4FKUA 4UN0C 2W06A 3CE3A 2BRBA 3UZPA 3MI9A 4NK9A 3OUNB 2OJFE 4NU1A 4CRLA 4EH5A 2OIBA 3UVRA 4RIOA 3A8XA 5J87A 3VJNA 4OTQA 4DITA 2BCJA 1EH4A 2VAGA 3MGYA 4J98A 3WIGA 2HOGA 2YDIA 4WHZA 4GYGA 2PYWA 4ZK5A 2XVDA 4YP8A 4CFVA 2Z2WA 3LFNA 2VO7A 5DT3A 5FP5A 1XO2B 4IB0A 2VWBA 4BI1A 2GNLA 4AT5A 3COIA 3QQHA 4MD8E 5AR7A 5M4FA 2GQGA 3RAWA 1XJDA 5EKNA 4M84A 3NCGA 4IWQA 4RX8A 1OKVA 2FSTX 2ZM3A 4C38A 4MQ1A 1YKRA 1CKIA 2GS7A 4R6VA 4IAZA 2RG5A 4JQ8A 2OXDA 4ACGA 2F9GA 2OLCA 3ERKA 4IM0A 1Y6BA 4QMYA 4RJ4A 2WMVA 1UNGA 1H01A 1Q8TA 3GNIB 3GT8A 4J99A 2UZBA 2XNEA 1KE8A 5I9XA 4R7BA 3I7BA 1YOLA 3BHTA 2HW7A 4FUXA 3ZO4A 3BHHA 4QP1A 4YZMA 3PE1A 2YCFA 2WQNA 3FLYA 4LOOA 4Z7GA 4FKOA 4X2JA 1PMUA 5DEYA 5DI1A 2UZOA 4DGOA 2JIUA 1LEWA 3ZDUA 4A9UA 4E4XA 1Q3WA 2C5VA 3VUTA 1OPLA 4F6SA 3PZHA 3M2WA 3UG2A 4EH7A 3R8VA 2BZKB 3EZVA 2C6OA 3KQ7A 4AN2A 4Y46A 4DLJA 1XBCA 2PTKA 1YWRA 2JKOA 3CD3A 4FNYA 2GNFA 2P2IA 3NNVA 2DYLA 4KIKB 5CU4A 3TJCA 3KXHA 1Y8YA 3CGOA 5I3OA 4D5KA 3R63A 2OZAB 3DKOA 1XQZA 2XM8A 4IE9A 4TW9A 4B4LA 4I1ZA 2WTCA 5AV1A 4AP7A 5BNJA 2XKCA 3CTHA 1R1WA 1ZWSA 1Q8YA 3QRJA 2E9UA 4L3PA 4EKLA 4PNKA 5EYKA 2PZPA 2IJMA 3HGKA 3OTUA 4M0YA 2JGZA 3ANRA 3SXSA 3F9NA 4OTHA 2J90A 3ZUVA 3TZ7A 3BYSA 4W9XA 2B55A 3COMA 4ZLOA 4IEBA 2XMYA 5KZ0A 4HGTA 2JBPA 5K9IA 5GZAA 3IGOA 3KN5A 1BUHA 1IAJA 4JOAA 4L46A 1G5SA 2H9VA 3IW7A 2XJ1A 3MTFA 2WEIA 5HG5A 4O0RA 2XBAA 2CHLA 4MXXA 5H8BA 1WBPA 2W1CA 3JUHA 4XG7A 3RMFA 4C59A 1OM1A 4IHPA 3ET7A 3PJCA 5AUYA 3PPZA 1ZAOA 5I9YA 4BC6A 4AN3A 4AW0A 5AAEA 3PYYA 3MIYA 3R0TA 2BZJA 2E9PA 4LM5A 3CIKA 4J97A 3AGLA 3EQCA 1YRPA 4UWBA 3UQGA 4USFA 5TKDA 3NAYA 3D7ZA 4O81A 2QOLA 3QD2B 4IVCA 3DB8A 3A60A 3UBDA 2XEZA 2P0CA 3HX4A 4XX9A 4HPTE 2OXXA 2XIKA 5I3RA 4DF3A 4YR8A 4BCIA 3C4EA 5IA4A 2B4SB 3Q04A 1LP4A 2ONLA 2AYPA 2PUIA 2HK5A 2ESMA 2BVAA 4LFIA 5M09A 1ZYJA 1YXTA 3DNDA 3V3VA 2EWAA 4XHKB 4B8MA 4H3QA 4YSMA 4P2KA 1WVYA 4FT3A 4GVJA 4RA5A 4RVMA 3BU6A 3RM7A 4AZSA 4KS7A 4E4LA 4IX3A 3MB7A 4QMVA 3CBLA 4YNEA 2XNOA 3DGKA 1PKGA 3EN4A 4IZAA 4X7QA 3R9NA 4O21A 3MFSA 3SG8A 4MF0A 1H1PA 1OUYA 4C8BA 4X3FB 4XNEA 2J0JA 3QRIA 4R5YA 4FKVA 4L6QA 4KINA 2W0JA 3ACKA 3FZ1A 3H9OA 3KVXA 3UO4A 4BKJA 4EEVA 4YTHA 2C6KA 2YDKA 4KWPA 5LMBA 2BMCA 4RT7A 4V0GA 3REPA 3I60A 1X8BA 3BLRA 5IZFA 2OH4A 4MK0A 4KRDA 3ZBXA 4F65A 4EI4A 1OB3A 5CSWA 4ZSAA 4QMMA 1OGUA 4F9YA 3EYGA 3MH0A 4FKTA 5CEOA 2BAQA 5HG7A 4CKRA 3ZZEA 2VWXA 5CEMA 2W1EA 2W1IA 2QLUA 5L2IA 3PDTA 4YBKA 4TYHB 4N70A 4W4XA 5HNBA 1ZYCA 4BWPA 4TNDA 2QO9A 4KBCA 4EH8A 1KV2A 1YXXA 3KXGA 3NS9A 3RBWA 3GOPA 4OBOA 4Q2AA 3JYAA 2ITNA 3KK8A 1G8AA 5GIOE 3F6XA 5HO7A 2C3KA 1PXPA 3C0GA 4L9IA 5B0XA 2YACA 1QPEA 3D0EA 2WQBA 1F5QA 2BHEA 2HWPA 5B2KA 1OL5A 2X6EA 4R3PA 5DEWA 4G1WA 3QYZA 3BU5A 4WG3A 3W2SA 4A4OA 3MN3A 4AOIA 2GFSA 2QQ7A 3TG1A 3FE3A 4F9CA 2ZOQA 2IVTA 5F9EA 3MWUA 1UNLA 2A19B 2VN9A 4G3FA 1AD5A 4ID7A 3IW6A 4V05A 4U7ZA 4XG2A 4Z9LA 2R7BA 3PLSA 2ETRA 3BLHA 4YU2A 1WBVA 5AMNA 4C3RA 3GOKA 3ORPA 4XG8A 3P5KA 3VS1A 4CD0A 3QZHA 2RKUA 4BHNA 2X81A 3R01A 3MBLA 3MFUA 2CLXA 3D83A 4CCUA 4TRLA 3QQKA 3SGCA 2YM4A 5LOHA 1YDTE 2W5HA 4ZZOA 5EHOA 3LFFA 4PNIA 2UW6A 3NDMA 3DAKA 3Q5IA 3HYHA 2GHGA 3NUPA 4EL9A 1GOLA 1OECA 3DJ6A 4ITJA 4WSQA 4K1BA 5F94A 3JY9A 5J1VA 3DKFA 4JBVA 2PE2A 2WO6A 4KIKA 4NJ3A 1L3RE 2V0DA 4RFMA 3QXOA 1Q24A 4KB8A 4GL9A 5J7BA 2OZAA 2XKEA 3FXWA 4IJPA 4BDBA 5CF8A 4CYJA 3G33A 3IPHA 5FEDA 4OR5A 4DFXE 5M51A 3S1HA 4Q5HA 4HGEA 4RVKA 4IAFA 3T3VA 3LCSA 5CAUA 1JWHA 2QCSA 3WIKA 2UW0A 3NNXA 3IS5A 3QCYA 1GJOA 2B52A 3HVCA 3HV3A 3QTWA 4A7CA 4F1OA 4CNHA 3I5NA 2CCIA 2YM6A 3HRCA 1ZOGA 4HCUA 4JR3A 4FIGA 4Z16A 4M69B 4QYEA 4GU9A 3ZRLA 3O51A 3QALE 3SHEA 5JFWA 3UIXA 4HGSA 1NT2A 3R04A 4DH8A 4FTKA 5IQFA 3PIYA 2NP8A 4ALVA 2XUUA 3ORTA 4BB4A 3D9VA 1SYKA 4J8NA 4BI0A 5ETCA 1H28A 4K11A 4UB7A 4O82A 4GT4A 5JZJA 1PXJA 5E8XA 4HCVA 3VN9A 4EUUA 4L7SA 4O7SA 2HW6A 4C2WA 3S0OA 3QA0A 4IDVA 2OJIA 5EHYA 2QI8A 5GJDA 5CSXA 3PPJA 4ONAA 3KMWA 3JXWA 4FTJA 4EWHA 1YI4A 1XHAA 5D7AA 5L8LA 3HV5A 5E8YA 4NYEA 5E91A 5HCYA 3EQHA 3CPCA 4TT7A 2VTJA 1VYZA 3PXZA 4DFNA 2QLQA 1OIRA 5HI2A 3TTJA 4AFEA 4BGGA 4RIYB 2BZIB 1J1CA 2GS2A 3GENA 4FK3A 2IW6A 3VUHA 3OCTA 1OL6A 3WI6A 3MYGA 3QZFA 1Q41A 3E8EA 3NYOA 3UVQA 3PP0A 5AP0A 4Y5QA 3BYMA 2BFXA 2XIRA 2YJSA 2YM3A 3DA6A 3EN5A 1LUFA 1PY5A 5H8EA 3ALOA 3AT4A 4IBMA 2GNGA 4D4RA 3LW0A 5K4IA 3BHYA 5ANDA 1DS5A 1O9UA 3QU0A 1U46A 3VUKA 4FIFA 4C57A 3UO5A 4LRJA 1F0QA 5ANEA 3UZTA 3IW5A 4I6HA 2C6MA 2XZSA 3F3TA 3Q60A 3QL8A 4FMQA 4QO9A 5HIBA 3U87A 4C62A 4AG8A 2ZM4A 4J71A 4P4CA 1H25A 2IVUA 3KN6A 4XOZA 2PMLX 5EG3A 4XMOA 4Q9ZA 3HNGA 4MTAA 4G6LA 4PP7A 5IH6A 4WNPA 3R00A 2CJMA 5AP4A 4MBJA 3UQCA 3V5PA 1SVEA 4FKSA 5AP6A 3A99A 1M14A 5C8MA 4BBFA 4AW1A 3OD6X 1Y8GA 2R2PA 2WQEA 4D2PA 4O38A 1AQ1A 2XYUA 3OFMA 2BAKA 3R30A 4ZY6A 1K2PA 4EBVA 3II5A 3QCXA 5E8VA 4DINA 2QR7A 4Z55A 1XH8A 4XV3A 4QMTA 3L8VA 5EHLA 4D2SA 2OJJA 2GU8A 4FV1A 5J1WA 1PXNA 4CKJA 5C8NA 2Q0NA 2ONLC 3KRXA 4EH4A 2ITTA 3SAYA 3NEWA 3BWFA 4GCJA 4O7ZA 4PRJA 4R78A 4DH7A 4DN5A 4AQCA 4D5HA 3W2OA 4EOOA 5ANIA 4H58A 2GTNA 4I5HA 4IVAA 3UO6A 2YZLA 3CR0A 4MWIA 2IVVA 4EHEA 4YZDA 2KULA 4YPDA 4JDIA 3GCQA 4RIXA 3F3UA 4L7FA 4W8EA 5E8TA 4AA0A 5HU9A 5I9WA 2C5YA 2QONA 3ORIA 3G9LX 5CY3A 3EMGA 5CEPA 2QC6A 5CVHA 4ANNA 5EW8A 2YAAA 3PJ3A 3DTCA 3R83A 3FSKA 3EFWA 4B0GA 5L6WL 3KF4A 4TWPA 5HG8A 2CDZA 4DTKA 3F5UA 3E62A 3F66A 2PVLA 4WKQA 3NUAA 3FMKA 4QTCA 4IMYA 4ZOGA 3TJDA 3TKUA 3IONA 3ULIA 4AZFA 5IQIA 1LR4A 4KNBA 3U6JA 3TZ8A 4WUAA 3VS0A 3OCGA 2X2KA 3ETAA 3P79A 3ZYAA 4E93A 2BDJA 3MVJA 4GRBA 5GJFA 2R4BA 5M07A 4P7EA 5FXQA 2WEVA 4FG7A 4C4FA 4O7LA 1OMWA 3FLQA 4XH6A 5CNNA 5LXMA 1WBOA 4HNIA 2I0EA 3VC4A 4XV1A 1PXIA 3V8WA 5HX6A 4BIDA 3G6HA 3MTLA 3VUIA 3W8LA 2CKPA 4MBLA 5HCXA 2VX1A 3RM6A 3ZO1A 1U5RA 2BFYA 4LYNA 3MH2A 2ITXA 3S3IA 5LJJA 4EH3A 1GZOA 3ALNA 3RINA 5AIKA 4UWYA 3LLAA 4BFMA 1GIHA 5L4QA 3TNHA 1W7HA 2C3LA 4XLIA 2QG7A 3T9TA 2VO3A 3DBCA 4XP2A 5IISA 3D5VA 1UU7A 3FQHA 2H96A 4OTRA 2WMBA 4O7VA 4FSTA 3KULB 3LJ2A 2YJRA 2UZWE 3Q4TA 4BDCA 1CKPA 3OC1A 3NSZA 4RSSA 4DTBA 1CMKE 5AR4A 4M67A 3Q2JA 2XNMA 3I81A 4G3GA 3ZTXA 3CKXA 3OWLA 3PY0A 4K6ZA 1JKLA 2ZV8A 4A4XA 2RG6A 1OL2A 4C4EA 4D0XA 3F2RA 1ZMWA 2VGOA 4IC7A 2NPQA 2YM8A 4AE9A 3I7CA 3RPYA 1ZOEA 3ZDIA 4IFCA 3BWJA 3UNZA 4UMQA 3PXKA 1H1QA 3DZOA 3QD4A 3NW7A 4XBRA 4X2FA 3VUMA 3Q52A 5FDPA 3HP5A 5HTIA 4BCPA 4WD5A 5BUEA 3D7TA 2JFLA 4FIEA 4CKIA 4RFZA 2ZDTA 5BVNA 1OPKA 1OVEA 2Y7JA 2YIYA 4Y95A 5E90A 5DT0A 3MW1A 4H36A 2WTJA 2YDJA 5DBXA 5K0KA 4QNAA 4ZXTA 3QC9A 3W18A 3GU7A 4G6OA 3HV6A 1XKKA 4GK2A 1W82A 4UY9A 4RZVA 4C02A 4DC2A 4W4YA 2BROA 5A4LA 2IZTA 3UMWA 4I6FA 4TWOA 5A6OA 5HBEA 4EK8A 3OCSA 4QOXA 4FYOA 5JFXA 4PQNA 3Q4ZA 1Z5MA 4DGMA 3FMHA 4FZAB 4FZ7A 5G1XA 4B6LA 2W1HA 4YNOA 2ETKA 4AZTA 3U55A 4F7JA 3U6HA 2O2UA 3BYOA 4HYIA 1BKXA 4RQKA 5HO6A 1V0BA 3ZEPA 4E6DA 5DHJA 4APPA 4D2VA 4CXAA 2QNJA 3G90X 3FL5A 3CEKA 4FC0A 4IADA 1XH9A 4S2ZA 2CKEA 4CFXA 2F7ZE 5HE1A 3BYUA 4JRNA 1P14A 4N6YA 5ETAA 3UVPA 4TPTA 3DB6A 3HMIA 5ITAA 4CQGA 5IA0A 3DJ5A 3BCEA 3EKKA 4G5JA 5AUVA 2R0UA 3HLLA 5CSVA 2PWLA 2UZNA 3MA6A 5JK3A 2WIPA 4QMZA 1NY3A 5JRSA 4AT4A 2VZ6A 4DE4A 1JOWB 5GJGA 2VGPA 4CT1A 3WOWA 2CGXA 4LV5A 2VV9A 4ITHA 1DI9A 2CKOA 2AC3A 3NUUA 2HZ4A 4CTCA 2YLFA 3RP9A 3VNTA 3JPVA 4BCQA 4UMRA 2F7XE 4FGRA 2UZUE 3H30A 4G3DA 4YO6A 4UMPA 4NM3A 3TUCA 3EJ1A 4D4VA 5L8JA 1JLUE 5FDXA 4ZTQA 3ENMA 4AZWA 4BTMA 4UV0A 3NNWA 3E63A 3UMXA 1WBNA 2CN8A 4WA9A 4KBKA 3QXPA 3AD5A
chains in the Genus database with same CATH superfamily
2I1MA 3DLSA 4HJOA 4M8TA 3T9IA 4EONA 4XP3A 2PMIA 1DAWA 3K3JA 3L9LA 2X0GA 4YTFA 5BUIA 2FGIA 4ZSLA 1WMKA 1KE6A 2WXVA 3A4OX 3GCSA 1PXKA 1UV5A 3H0ZA 4R7IA 4U80A 5IQCA 2BKZA 3FKOA 5EI2A 3FZSA 4EOJA 3OEZA 4ALUA 4BZNA 4C36A 2WU7A 4DA5A 2WTIA 2R3QA 2YLEA 3O7LB 3FC2A 4EOIA 5LWNA 3A61A 4DEAA 2YWVA 3R1SA 4LUDA 4DYMA 5AUZA 2PVJA 4YJRA 5AP3A 5FM2A 5D1JA 5CENA 2QU6A 2W05A 4NSTA 5IQAA 3LM0A 4ANSA 5DG5A 4TYIA 5AUUA 5AUXA 3IO7A 2W5BA 5LMAA 2JLDA 1PMVA 3VUDA 1Q61A 3QLFA 3ZHPC 2WNTA 4WSYA 4QQTA 1HOWA 2YM5A 3AT3A 3P0MA 3BBWA 3L9NA 3PUPA 4I93A 4IZYA 2Q83A 3C1XA 5CZIA 2J2IB 3PPKA 2YCSA 4L68A 4YURA 3GEQA 3BBTB 5M56A 3I4BA 2V22A 3V5WA 4P5QA 4FVRA 5EFQA 2W1FA 3BZ3A 3CSVA 4IAIA 2HY0A 3HECA 3LFCA 3SOAA 3WE4A 3BEAA 2JDSA 3KULA 1KSWA 2O63A 4LL5A 4EC9A 3WBLA 4BHZA 3AGMA 1KE9A 4QT1A 4CFFA 4E5BA 2YIRA 4C3PA 3GXLA 3KMUA 1APME 4ZMEA 1OZ1A 3BGPA 4HGLA 3H10A 4YZCA 5EQEA 1ZLTA 2GTMA 4RIWB 1SZMA 1IRKA 2RFNA 1DM2A 4WNKA 5F4NA 3KMMA 2VD5A 4ZMFA 4AOJA 1OBDA 4BZDA 3R7VA 3OWJA 4BDJA 1HCLA 3QTSA 1WZYA 4LMNA 2J0MB 2RFSA 2HYYA 4S34A 3W0PA 3PRIA 3R7GA 4BL1A 2IW8A 1Y91A 4CFNA 1R0EA 2ITZA 3MSSA 4IVDA 5EM5A 4C35A 4HVDA 5FG8A 1JSTA 2A27A 4TNBA 3AC3A 5AA9A 2G1TA 2OK1A 1SNXA 5DH3A 3OF0A 4AAAA 4ASEA 5BQ0A 1XBBA 3PY3A 2B53A 1ZXEA 3SQQA 5EM6A 4JL9A 4PL5A 2CSNA 4OTGA 1YI6A 3SXRA 5EOLA 2W7XA 2J6MA 4GUBA 3SV0A 2JFMA 4J7BA 3KB7A 5E8WA 3R1NA 3CXWA 5CSHA 4ZIMA 3R71A 3HDMA 3N9XA 3VQUA 3UNJA 4PUZA 4FF8A 3SA0A 2XIZA 3G0EA 3VS7A 3RWPA 2IZUA 5IA1A 2XJ0A 1PW2A 3QKLA 4BYIA 5IMEA 1F3MC 4GK4A 4Y85A 4YLKA 2F4JA 3HMNA 3R02A 2IEWA 4RVTA 2NO3A 3JY0A 4YTIA 4E8AA 3ZFMA 2DS1A 4A06A 4NW6A 2PE1A 5M4IA 3ANQA 3E64A 3I79A 2J0KA 4YJNA 3PXQA 5IUGA 2Y6OA 4GYIA 1PF8A 4WNMA 2XK7A 3FXXA 3K5UA 2OKRA 4DCEA 3ZXZA 3R9RA 4BGQA 2FSOX 3PSCA 1GIJA 4KSQA 4ZJJA 2NNWB 4F1TA 2WMXA 3MESA 3QX2A 5DVRA 2C47A 4C4GA 4H1MA 2YA9A 3FYJX 4L42A 2O3PA 5DE2A 5A54A 2GS6A 1VYWA 1GIIA 3LFBA 4LRKA 1WBSA 1U54B 5LWMA 1O6KA 1H0WA 4NUSA 3OS3A 3UPXA 4E5AX 2XNNA 2R64A 3A7JA 4RMZA 2W1GA 5I9UA 3ZSGA 2XBJA 4CLIA 2WAJA 1Q8WA 2B9FA 3R7YA 4ACMA 4FKQA 5A4TA 1STCE 3GQIA 1GZ8A 4XLVA 4YHTA 3RPSA 3GBZA 4EBWA 3AC5A 3QC4A 4GKHA 4O0UA 4FT5A 3CP9A 3PA4A 4OTFA 1Z57A 5EKOA 4CEGA 3AOXA 2GHMA 1T45A 2QD9A 1J91A 2CNUA 4MEDA 3DBFA 2PULA 4AA4A 4GK3A 3ODYX 1UU8A 4PF4A 4YJPA 4F9BA 3RHKA 3PY1A 2GDOA 3UTOA 3CTQA 5FTGA 4YJUA 2WPAA 2PK9A 2UVYA 4PPCA 5JT2A 1VJYA 4O6LA 2OWBA 4O86A 3F5GA 3HMPA 3DV3A 5BUJA 4LUEA 4E6CA 1G8SA 1NA7A 2Y6MA 3POZA 5HQ0A 4ZZNA 3QTUA 3NMUF 5BVDA 3P7CA 3FZTA 4KA3A 3PVGA 2QOBA 2WTDA 4TYJA 4RX9A 3OVVA 4YZ9A 4EOSA 3DK7A 3NW6A 1DAYA 2OF4A 4Y8DA 4EUTA 2J50A 2ZYBA 4U97A 4MNEA 4NM0A 3PXFA 4S31A 2Z60A 1P5EA 3KC3A 3LLTA 3R1YA 4E1ZA 3NUXA 4PMSA 4RWJA 1XH7A 3A7FA 3PA3A 4M97A 2PY3A 3C0IA 5CZHA 5DRBA 2PMOX 4J1RA 4B7TA 4O4CA 4YLLA 1RE8A 2R3RA 1TQPA 2RSVA 1HCKA 3GI3A 3ORKA 5DYJA 4RJ8A 3UGCA 4RJ6A 5L8KA 3NW5A 2I0HA 1VZOA 3UDSA 2Z7QA 2G2IA 3HRBA 3MS9A 4R5SA 3CY3A 2R3FA 5J7HA 4NM5A 2F2UA 3Q4UA 4O27B 5AP7A 5H3QA 3U54A 2VTNA 3E7VA 4WUNA 4EK5A 4WT6A 4QDVA 5M06A 1Q8UA 1URWA 4C58A 5K4JA 3OW4A 3VBVA 4BDHA 4F08A 4JR7A 1ND4A 5CAPA 4F0FA 4U79A 3AC4A 4QMNA 3BRBA 5AEPA 3R9DA 5IEYA 3ID6C 4BCKA 2GHLA 2UZDA 3QGYA 4CV9A 3CJFA 4I6BA 3G2FA 4RX5A 5A14A 5BVWA 4NM7A 3ORXA 2PVRA 4RIWA 5ETIA 2PZ5A 4FEUA 2QOKA 4I5PA 5KMIA 3DBQA 5A4EA 2UZEA 3PJ1A 4GFGA 2BDFA 3KRLA 1A48A 4OTPA 4QMOA 3GU5A 3OOGA 4YC6A 5AR8A 2XK8A 4ACHA 4GJ2A 4BCGA 2UUEA 2V62A 2JKKA 2HZ0A 3G15A 3RZFA 4I92A 1ZY5A 4FNXA 4L00A 3GQLA 5AR3A 3RAIA 4J96A 4GFOA 3ZONA 5IH5A 2YISA 4M13A 5HCZA 4IB5A 3F82A 3C4WA 5FEQA 5IA2A 3WE8A 3QF9A 1XWSA 4USDA 4DDGA 4FK6A 3CY2A 3FLWA 3R7OA 1UKIA 5AV3A 1BX6A 4U0IA 5BVOA 4RWKA 3FV8A 3MDYA 3DS6A 5L3AA 4NFMA 5CEQA 3C13A 3NPCA 1IASA 4FA2A 2XRWA 1ZMVA 4PTCA 4O6EA 4BCHA 3QTRA 3VBXA 2VTRA 4G6NA 2QOQA 3QD0A 5K5NA 2VTTA 4BJJB 4RWIA 1QCFA 3C4XA 4FOCA 3WF6A 2X4ZA 2YAKA 4FTQA 1IEPA 3UDBA 2PZRA 2BRNA 3TNWA 4I5MA 2UV2A 4ERWA 4XBUA 4QYYA 4AAYA 1O6LA 4BF2A 1B39A 2W9FB 4ACDA 3P1AA 3P5JC 5FEEA 3TDVA 2C1BA 2VWZA 4FKPA 5DNRA 2JBOA 4CQEA 2VRXA 1ZYLA 5EOBA 4X21A 4FKRA 2UZVA 4HYSA 5J9YA 4NWMA 3NCZA 4KKEA 2XNGA 3SRVB 5LCKA 2Y4PA 2I40A 1WVXA 3LOKA 3PA5A 5H9BA 4BCJA 4W8DA 3EN6A 1U59A 3O0GA 3TACA 1XMMA 1H24A 3TKIA 3B8RA 4ANQA 5LMKA 2XIYA 1JKSA 4ZSGA 4IX5A 5JZNA 3Q3BA 3TT0A 4D1ZA 4EH9A 2GNIA 1ZRZA 1MRYA 3DAJA 4D2WA 4DHZA 1OIQA 3ZM9A 2FSMX 5IEVA 3FYKX 4NKAA 3RNIA 3TNQB 3VAPA 4XYFA 1YWVA 5KMJA 3QYWA 3FWQA 3R2BA 3FQEA 2C6IA 4QPAA 3U4WA 2G9XA 3MPMA 4IZ5A 3W0RA 2XF0A 4BICA 4R1VA 5DIAA 3RCJA 2HIWA 4FVQA 4YZBA 2I6LA 4TKSA 3ML1A 4IANA 4G31A 3A8WA 3VBYA 3W2PA 4RC4A 3FY2A 5LARA 3MVLA 4YTCA 3DK6A 4FTLA 4XG4A 5HX8A 3ZO2A 4FL3A 4D55A 4FIIA 4JAJA 3R21A 4F1MA 1CTPE 4XS2A 2B7AA 2W96B 1WAKA 4PP9A 4C33A 1RW8A 3E3BX 3PVBA 3BGQA 2YFXA 3N4VA 2YN8A 4D9UA 4K2RA 2OG8A 4LGDA 4D4SA 1E1VA 2HAKA 4FX3A 3V51A 2VX0A 4JS8A 5L2SA 1REJA 3HMMA 1YWNA 3R6XA 1WCCA 2X7FA 4MX9A 3VF9A 3A62A 2W4OA 3O8PA 3COKA 3PVWA 3FMJA 4CSVA 4UBAA 4DDIA 2OSCA 1Q4LA 3FL4A 4L01A 3ZSIA 2ZV7A 4TYEA 3W55A 4LGHA 4ENXA 1FGIA 2Z7SA 5H2UA 2QOOA 4X6RA 5EDRA 3WF9A 4E20A 4HVIA 2C30A 4ZS4A 4PL4A 3E5AA 3FJQE 3QCSA 1PYEA 3DY7A 2X0OA 1PXMA 3EQDA 2V55A 3NNUA 2X7OA 4FV6A 4GFMA 1R0PA 3LMGA 3ELJA 1MRVA 3FXZA 3HL7A 3KRWA 5DGZA 4XG9A 5CT7A 3MA3A 3NWWA 2C4GA 2JKQA 4PL3A 4XEYA 3VW8A 5D12A 5KKRC 1PRYA 1S9IA 4AXEA 3FI4A 2VUWA 5AWMA 1W8CA 2PVFA 5F95A 3WF5A 4FG8A 5LCJA 3QFVA 5IA5A 4G17A 4O4DA 3N4TA 3QAME 4BI2A 4F63A 3VBTA 4O1PA 5I9ZA 4Q9SA 4AX8A 4KBAA 3ORNA 1YDSE 2FB8A 5IH4A 5CQWA 1FBNA 4RC2A 3VIDA 3GUBA 3ORZA 2XRUA 3LHJA 4F7LA 3R8LA 3WF7A 1FMKA 4U45A 2B1PA 4M7IA 4DT8A 2F57A 2XIXA 3SOCA 3VS5A 4U40A 1OKWA 3P7BA 3FHIA 4JQEA 5C27A 5HNIX 2ZDUA 4WIHA 4C61A 5CU6A 3ZRKA 4FSZA 5EDPA 4ERKA 1J7UA 5HU3A 1Y57A 3UE4A 3QQJA 3QQFA 2VWIA 5DR9A 3F3WA 3SKCA 3W2RA 4ZTHA 3FEGA 2VWUA 3P9JA 2C6LA 2Z7RA 1ST4A 3DDQA 1CDKA 2FO0A 2OIQA 3GCVA 5CI7A 4DEDA 5AP1A 3RJCA 4HVSA 1ZYDA 5LVPA 3Q2MA 3DZQA 4UXLA 2QOCA 2CKQA 1JNKA 3ACJA 5HTCA 1FVRA 2PU8A 4QP8A 1E9HA 3D5WA 4ANMA 4I21A 3LMHA 3RK5A 4N57A 4UYNA 5AR2A 3WF8A 4AXAA 5I5ZA 3P23A 2JAMA 4AE6A 5JFSA 4X3FA 3ENHA 1GNGA 3FI8A 2GNJA 4D4YA 1PHKA 4MXYA 4EK3A 3LCTA 4FV0A 3IECA 4CVAA 3RAKA 2A0CX 4Q5EA 4HW7A 4OTIA 3EN7A 1NW1A 2ITQA 4DFZE 1SM2A 3QKKA 3HAMA 2C0IA 3I0QA 2GFCA 2J7TA 2WELA 4FUYA 4L44A 2E2BA 2PVNA 3KIOC 4M68A 4QYFA 3BHUA 3TMOA 5DMZA 2ACXA 4FIJA 2J0LA 3FHRA 5M08A 2C5OA 1JAMA 3AC2A 4TYHA 4O96A 4MKCA 4G3CA 4X0MA 2CGVA 4PX6A 3FLSA 3AT2A 2BHHA 2JDVA 2VTAA 3O8TA 4MVFA 5C1QB 3ZC5A 4DHIB 3DFAA 2XKDA 3LJ1A 4M66A 2IF8A 2PVHA 5FQDC 4O91A 4CTBA 4KIOA 3Q96A 1ZOHA 3V6RA 2IO6A 2JAVA 5CXHA 1MUOA 3KGAA 4WG4A 3D15A 1T46A 3DBEA 2BILB 4QPSA 3ZSHA 1VR2A 2QODA 4FT0A 5GNKA 5JRQA 3LFDA 4JVGA 1ZZ2A 4G5PA 4CZYB 3TDWA 3P7AA 5HVJA 3HV4A 4NL0A 5CI6A 4JG8A 4RLLA 3Q9YA 3TV7A 4KIPA 4KSPA 4K18A 5EQYA 1OL7A 2EB3A 5BYZA 2C0OA 1XH5A 4BIBA 4FI1A 5D9HA 4QP2A 4O7YA 2J51A 4YMJA 4J95A 1WBTA 1PXLA 4IAAA 5HKMA 3ZH8A 4RLKA 4QRCA 2W1ZA 2W5AA 3TN8A 3SVVA 1IA9A 3PFYA 3BLQA 3UOKA 3V5TA 4DAWA 5TF9A 3VRZA 2REIA 5M53A 3C5IA 3EQFA 1V0PA 4L45A 3PIZA 4II5A 2H6DA 3LXKA 4OAUC 5KMOA 1Y6AA 1OKZA 1G8JA 3P4KA 4L3LA 5EW3A 3AC8A 4EJNA 4AXCA 3EL7A 3QGWA 4A4LA 2IN6A 1SVHA 2JC6A 5HO8A 2OZOA 2ZM1A 4MHAA 5E1SA 3UYSA 4KKGA 3UP7A 3FI2A 3DQXA 2EVAA 3VHKA 4UMUA 3DTWA 2VTHA 4FTNA 5AUWA 4CMOA 5CU0A 1YDRE 2ETMA 3NUYA 5I9VA 3UQFA 3ZFYA 4IAYA 3LFSA 3MY5A 3F2NA 3TV4A 3ZXTA 2CNVA 3CPBA 4RPVA 5BMMA 2X1NA 4M69A 3U8WA 4OT6A 3E8NA 4LV8A 4LI5A 3T8OA 3F5PA 3FQSA 5HBHA 3L8XA 4MCVA 5K0XA 3V01A 4LGGA 5IUHA 4F0GA 4YUQA 4A9SA 3R7UA 4NCTA 3C7QA 3GU4A 4I6QA 2GQRA 2JIIA 2PVMA 4E4NA 4FV9A 3AG9A 3TIZA 4FV2A 4NZWB 3BYVA 4GU6A 5AR5A 2O8YA 2PVYA 4AGUA 5BVFA 5J9ZA 2X0PA 3V5JA 1L8TA 3R22A 2QOHA 3M1SA 4C2VA 1Q8ZA 3U9CA 5K3YA 1OBGA 2UVZA 3MVHA 4R7HA 4EKKA 2PSQA 1M2RA 2NRYA 1W84A 3RPOA 4EQMA 3FMNA 3C9WA 5CANA 3DQWA 2Y0AA 4FNWA 3F3VA 2HELA 5DA3A 2PE0A 3L8PA 3W10A 4ZLYA 3B2WA 3SXFA 1S9JA 2ZB1A 3PXRA 4RIYA 5L6PA 4U81A 5CNOA 4U41A 4FSYA 3ZC6A 2VO0A 3IDBA 4QP4A 2YIWA 4GMYA 3DFCB 1DI8A 5ANKA 5FBOA 3QLGA 2A2AA 4C4JA 5KHWA 1BYGA 2FA2A 3O50A 3KA0A 1H1SA 5EYDA 5M55A 5L2TA 5M57A 4BY9E 5CYIA 4CMUA 4CYIA 3H9RA 5FGKA 1IR3A 5CU2A 4XP0A 3TUDA 2Z7LA 3QUPA 5DT4A 2XANA 1PYXA 2R3KA 3ZU7A 3VBQA 5C9CA 5CT0A 1XBAA 3G6GA 4AF3A 4MXZA 4B8LA 5CAQA 1H08A 2O0UA 2VTIA 3CQUA 2XB7A 3G9NA 4M3QA 4R3CA 5HZNA 2PUNA 3EZRA 4G34A 4NEUA 2WB8A 2G15A 4WBOA 1R3CA 1R39A 4CG9A 4FR4A 4YHFA 4F99A 3LXLA 3WZKA 3VVHA 4G3EA 3UP2A 3MVMA 2VWYA 4FSMA 4DGGA 5HTBA 4FVPA 3V8SA 3QX4A 3S4QA 5JQ5A 2WMUA 4GSBA 4QPMA 5J95A 2CNQA 2VNWA 4H39A 2UW4A 3ITZA 4I94A 4U3ZA 3TIYA 3TZMA 2WZJA 4ANLA 2XAMA 3OG7A 3TKHA 2XNBA 4D2TA 5KMKA 2HXLA 2VTQA 4QP9A 1SVGA 3UIBA 3V6SA 5A9UA 3BV2A 1M7QA 2UW9A 1H00A 4GIHA 2ZMCA 5T6KA 4E3CA 1JKKA 1JQHA 4JI9A 4PDPA 3FZRA 3ATSA 1TKIA 1UU3A 2V5QA 4I22A 4RQVA 4QEBA 4BCNA 3TL8A 4PY1A 3UPZA 3PJ2A 4I3ZA 2GPHA 3RNYA 3WZJA 3AKJA 4JDHA 4BDKA 4ZEGA 2XM9A 3K3IA 2J9MA 3WZDA 4D1XA 2AQXA 4X2KA 1BI7A 4EOLA 4MBIA 4RWLA 3OOMA 5JGDA 3Q32A 3O8UA 1I09A 3G0FA 2PMNX 1OKYA 2RL5A 4X3FC 2C6TA 3VS6A 1Q97A 5AX9A 3HMOA 4APCA 3AQVA 2XH5A 5T3QA 1A06A 3MFRA 4AT3A 4RJ5A 5JQ8A 5IKWA 2C69A 4U42A 4MUQA 5KKRB 4IZ7A 5GZ8A 4OUCA 1OUKA 4KUJA 1H0VA 1H1WA 4IACA 4U44A 2IPXA 4QP7A 3IK3A 4ZTMA 4JXFA 5E1EA 2RFDA 5FWKK 3F5XA 3EB0A 4BCFA 4AGWA 4K9YA 1QPJA 2UW7A 2QKWB 3B8QA 3QTQA 3QZIA 4DEIA 3R9OA 1W98A 3ZMMA 4K33A 4ANBA 4BDEA 5E8UA 3JS2A 4X2GA 3OROA 2R3NA 4QP3A 2X8IA 2J4ZA 1KV1A 3TI1A 1IAHA 1IG1A 5FLFA 4JBQA 4WRGA 3C51A 4DHFA 2VO6A 2E9OA 2O65A 5C26A 5AP5A 1YOMA 3VQHA 1PXOA 2LAVA 1U5QA 3PWYA 4D0WA 5HLWA 5HHWA 4LL0A 4M15A 3AD4A 3TNPC 4E4MA 5AP2A 3JVRA 2G2HA 1V0OA 2YZAA 2JDOA 1SMHA 4HPUE 3V5LA 1XH6A 5FP6A 2W99B 3FMLA 3MB6A 2WHBA 2BIYA 3MV5A 3QTXA 5HEZA 1FGKA 1VLRA 2F2CB 4A9TA 1J1BA 3ZLWA 2X9EA 4DEBA 2BRGA 3TM0A 4LOPA 5IDPA 3TWJA 2PUUA 1QPDA 1KOAA 2XCKA 4KS8A 5C01A 1FPUA 3D94A 4BKYA 4ZLZA 5AV4A 2X8EA 2EXMA 3F3ZA 2FYSA 3I6UA 3NR9A 1OITA 4F09A 1K9AA 4FV7A 3EFJA 3EFKA 5TE0A 4EOPA 4DFUA 3U4UA 3KRRA 5K5XA 3QRTA 3LZBA 2F7EE 3LKMA 4O7NA 4IJ9A 4F6UA 5KCVA 5KUPA 5TOZA 5ANOA 4JNWA 4YSJA 3GFWA 3QRKA 5C4KA 5AV2A 1YXSA 1GY3A 4K8AA 2VTMA 3BEGA 1CSNA 2WMQA 1OPJA 4IW0A 4LMUA 4MYGA 4AU8A 4EHVA 4O0VA 4F70A 1K3AA 2XP2A 2C68A 5JGAA 4IAKA 5CU3A 4AN9A 4IXPA 3FC1X 2VX3A 3TCPA 4PPBA 4TWNA 3PP1A 5ETFA 3OMVA 3K54A 2CCHA 4XRLA 2WTVA 4LRMA 3FY0A 4M14A 4EZ3A 4GG7A 1H4LA 2YERA 2OFVA 5CEKA 4H3BA 2BAJA 3OT8A 3GCUA 4W9WA 3WARA 4HVHA 3UIUA 3NRMA 5HVKA 3NVMB 4G9CA 4NTSA 4JG6A 5AV0A 4ZJVA 3EQRA 1M17A 4UMTA 2HENA 4CFWA 4JJRA 4O0YA 3AMAA 2C0TA 4FZDB 1XH4A 4L67A 3FMMA 2BKKA 1FMOE 2B9IA 2HZIA 1J3HA 4HZSA 4NW5A 5EI8A 3DKGA 3LCOA 4GUEA 4EYMA 2VTLA 2WKMA 1Q5KA 2IZSA 3CKWA 5HOAA 3R7EA 4O22A 4V0GB 4JRVA 4L8MA 3PIXA 4IB1A 4CFMA 4TWCA 1YW2A 2W17A 5JH6A 2XK9A 4UALA 3KREA 3KL8A 3CC6A 1CM8A 2CMWA 3F61A 3UIMA 4C4IA 4J53A 1E1XA 2B9HA 3RZBA 3VULA 3WYYA 3NIZA 1H27A 4DBXA 4O1OA 4YJQA 5EM8A 3VJOA 5CF6A 4NH1A 4C4HA 3SD0A 4DH1A 2DQ7X 3FZPA 5JFVA 3OWKA 5GZ9A 1UNHA 4PMPA 5M4UA 1P2AA 3M11A 2G01A 2UZLA 4FSWA 1P4FA 5FXSA 4BTKA 5BMSA 5IMXA 4RJ3A 3WYXA 3FUPA 1UA2A 2Y8OA 4BR3A 4U43A 1Q62A 3OCBA 3OP5A 3PG1A 4FL1A 2V7AA 4LOQA 1UWJA 5HE2A 2B9JA 3PRFA 4D1SA 5I0BA 3L1SA 4HYHA 4RA4A 3O5AA 4FKJA 4U6RA 2IW9A 2ZV9A 3OXIA 4E26A 3DXPA 3VS4A 5BVKA 4FEWA 4FICA 5IDNA 3CQEA 4FYNA 3E88A 4JX3A 2OFUA 4FKGA 3VHEA 5JEBA 1TVOA 3HZTA 4FV8A 3RPVA 3SC1A 3LFQA 2X2MA 3PXYA 4MAOA 3CCNA 4ZTSA 3QWKA 3RVGA 3EWHA 3OY3A 3O71A 4C7TA 2QOIA 2ERZE 4ENYA 5C4LA 4FKWA 4FZFB 3R7IA 4XV2A 3E3PA 5IQGA 3F2AA 4EOKA 3JVSA 4GT5A 5BPYA 4EQCA 2BUJA 2Y9QA 5T68A 4GT3A 2VTPA 3NGAA 4AOTA 3LMIA 4EJ7A 3S95A 4IX6A 1LPUA 5E9EA 3FMDA 3E92A 3R8UA 4WOVA 2R3OA 4WRSA 5IEXA 2WQOA 4AZEA 5KO1A 3HRFA 3ZBFA 3NUNA 4EC8A 5A6NA 3BQRA 2OI4X 3DT1A 1FINA 3A7IA 5CF5A 4NKSA 4DFBA 4YHJA 4DLIA 2QKRA 3ZOSA 4KRCA 4ZSJA 4YJSA 2ITWA 4FSUA 5DFPA 4BDIA 3TXOA 4CMTA 3KXZA 4L43A 3UG1A 1YHVA 4FT9A 4F9WA 3ZCLA 1RDQE 1OIYA 2VWVA 4YLJA 5FUTA 5HIEA 4FV5A 4O7TA 4QMPA 2SRCA 2X39A 4DEGA 3HKOA 3BE9A 1JBPE 3QKMA 2A1AB 2OU7A 5AM6A 4WBBB 3FLZA 3ZO3A 1VEBA 4BDAA 3VS2A 2X6DA 3W0NA 4Z3VA 3LVPA 1TQIA 5LVMA 3OXZA 3FLNC 2VU3A 4ZTRA 3CD8A 4KAOA 2JKMA 3I6WA 1M2QA 4EWQA 5J5SA 4K0YA 1BMKA 5CAVA 2B0QA 4BWXA 3PSBA 3DXNA 5AJQA 3HP2A 4HNFA 5DR6A 3E7OA 3KCFA 2J0IA 2XNPA 2YABA 3PJ8A 4MF1A 4QP6A 4QNYA 3BX5A 5CVFA 4AW2A 5CEIA 4O0SA 1GZKA 3IG7A 5E8SA 4QMXA 5ACKA 3EIDA 2PUPA 5TO8A 4BWKA 4QDEA 3HUCA 2XK3A 1RJBA 4JIKA 2PZYA 1OI9A 2BIKB 3A2CA 1KE7A 3ZLYA 5J79A 4O83A 2OO8X 5HBJA 1JSVA 4JBOA 4GEOA 3RKBA 3QWJA 3EH9A 3MY0A 5I4NA 5HD7A 3D4QA 3GB2A 5FRIA 1PMNA 2YIXA 3MY1A 3EOCA 4UWCA 3RALA 3LE6A 5HNGA 5KZIA 2CLQA 4JG7A 3TZ9A 3VRYA 2IWIA 3H0YA 3ZZWA 4BN1A 3OW3A 3QTZA 3ZRMA 3SX9A 3KK9A 3OXTA 5EQPA 4EQUA 4EK6A 3Q6UA 2EB2A 3F7ZA 4FGBA 4YJVA 3OBGA 4E6AA 3DPKA 3MJ2A 4BGHA 3S2PA 3QA8A 3ZEWA 1UWHA 4ASZA 3F7WA 2XA4A 4OGRA 5AA8A 3UJGA 3AKKA 3KF7A 3C4FA 3AXWA 4DG3E 4X6QC 5HIDA 1M2PA 4IFGA 1U54A 4QQJA 1MQ4A 5FD2A 3WILA 3RHXA 3FKLA 1BL6A 3L9PA 3DDPA 2ZV2A 2P33A 3PG3A 4R3RA 2O64A 3QBNA 2X8DA 2RF9A 2UW3A 4ZS0A 4OBQA 2XYNA 4ZY5A 2R3PA 4FV4A 5J5TA 4J8MA 5DLSA 3UDZA 2I0YA 3QHWA 2WTWA 3ZFXA 3KXMA 3U51A 1KOBA 4KD1A 4OTWA 3LAUA 3UODA 3P86A 5JGBA 5B2LA 3EHAA 2JIVA 3HV7A 4FTTA 2R7IA 3M42A 5CAOA 2GNHA 2JITA 4FSQA 4GH2A 4IC8A 3I0OA 3DNEA 4JBPA 3W2CA 1UVRA 4WNOA 1YXVA 2J5FA 3H3CA 3IOPA 3AMYA 2QOFA 2WMRA 4M0ZA 4R8QA 2WU6A 3AD6A 3COHA 3CLYA 3L8SA 4Y73A 2QU5A 4RIXB 2FVDA 4PWNA 3TV6A 2WFYA 2Y4IC 5DPVA 5G6VA 3H4JA 3UNKA 1KUTA 4MXAA 3FI3A 1WVWA 2XEYA 2JD5A 4TN6A 2CPKE 3GC8A 4BIEA 3HAVA 3FBVA 3R2YA 4I24A 4CZTA 1REKA 4X3JA 3BI6A 1OL1A 5L2WA 2YCQA 4N4SA 3NYVA 4OTDA 3NLBA 3D5UA 5FXRA 4Y72A 2YWPA 3GVUA 2WTKC 2QHMA 2VNYA 1MRUA 3F69A 3N51A 3QHRA 4FNZA 4TL0A 3HA6A 3R1QA 4F7SA 3D2IA 3LCKA 3H9FA 4EHGA 3GU6A 4I0SA 5EK7A 2OICA 2HXQA 5EM7A 2CGWA