5J7HA

Crystal structure of anaplastic lymphoma kinase (alk) bound by brigatinib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
309
structure length
291
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALK tyrosine kinase receptor
publication title Discovery of Brigatinib (AP26113), a Phosphine Oxide-Containing, Potent, Orally Active Inhibitor of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 291
sequence length 309
ec nomenclature
pdb deposition date 2016-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j7hA01
4KIOA 3FI3A 3FQSA 5AP0A 4QO9A 3HVCA 4PL4A 4C38A 5CF5A 2XK3A 3SA0A 2WTKC 1OZ1A 2C3KA 4S33A 3W2RA 5A46A 5I9YA 4H3QA 3NS9A 3R9OA 4I5MA 4M8TA 2WMVA 3T9TA 3CY3A 1QPEA 4FC0A 3W16A 4C4JA 3FL4A 4DH8A 3RAIA 1NVSA 3UYTA 3VIDA 3VS6A 4DG3E 2P0CA 4CKJA 2P4IA 2UW9A 3ORPA 5C8NA 1JSVA 1ZYDA 2W1DA 4EZ5A 3B8QA 3W2OA 4TNDA 4FKWA 1M2QA 2NO3A 3FMHA 3POZA 4FIJA 4O0YA 4WNOA 1TQPA 3FPQA 1QCFA 3ROCA 4BBEA 4GT5A 4KBKA 4QQCA 4FIFA 3GU4A 4M15A 4A9UA 5L3AA 5GNKA 3ULIA 2XCHA 1FPUA 3NVKI 4PX6A 4I6FA 2W17A 3TV6A 2HZ0A 4FNZA 4E93A 3R00A 3ORMA 5C26A 4H05A 3H0YA 1XBCA 3K3IA 3TI1A 3GCSA 2BHHA 3LMGA 5HE2A 4YPDA 3DZQA 1UNGA 5E7RA 3WZJA 4FSQA 3D5UA 4FTRA 3IDBA 2BFXA 3MTLA 4CCUA 3KY2A 2PK9A 2VO6A 1URCA 4YC8A 2VTPA 1H0VA 1KOBA 5JT2A 4YLLA 4EQCA 3MDYA 2V22A 3HV6A 3UIUA 5A6NA 3MESA 4OTGA 3RWQA 1YXSA 4IXPA 2JBPA 3DBCA 3KXXA 4X2GA 3WZEA 3GCUA 3ORIA 5KMMA 3I0QA 4OTFA 4CZUA 3IOKA 3P0MA 3ZTXA 3E92A 4RX7A 5BPYA 3EQFA 5ANDA 3KU2A 3UP2A 2X7FA 3FZTA 3VUHA 1ZOEA 4ZMEA 4R78A 1FGKA 4PF4A 4ENYA 3MBLA 2IZRA 3NDMA 3NYVA 3QLGA 4CFWA 1SVHA 1A06A 4ASZA 3E63A 4BDKA 1REKA 4ITJA 4DT9A 4FV6A 3BV2A 5JEBA 4FTJA 5H3QA 3G9NA 4X3FB 2E9PA 3R1SA 3FYKX 1OBDA 3FJQE 2F7EE 3UVQA 3HAVA 1XH9A 4NEUA 1MQBA 3QAME 3AQVA 4B8MA 3JVSA 4L6QA 2DYLA 4NT4A 4QYEA 5I0BA 4C8BA 2ETKA 2XEYA 2UZUE 5FQDC 4YO6A 3V6RA 3P78A 3NMUF 2F57A 2ITWA 3OP5A 5CAQA 4J52A 4BY9E 2VD5A 3E8CA 2R7IA 4BIDA 1H24A 1EH4A 2VTRA 5AUUA 4IX4A 3DTWA 4U45A 4FL3A 2ACXA 2OK1A 4UZDA 4V05A 5HIEA 2PU8A 2W5BA 5IQBA 3FHRA 3FPMA 4EOJA 4ZAUA 1APME 5BVOA 3WF7A 5CXZA 4LL0A 3QCYA 2BDWA 4P4CA 4CFXA 4FZAB 1W7HA 4QMOA 1OITA 5IA0A 1R39A 3EKKA 3R8ZA 2CGUA 3EN9A 4NCTC 4C37A 3HRCA 3AMYA 4YZ9A 3GGFA 2XA4A 1WFCA 2C69A 3B2WA 5FBOA 3PVUA 4AZFA 1B38A 2YA9A 2FO0A 4GT3A 4IVCA 4BC6A 3OBGA 1GZOA 1QL6A 2JDOA 4BGGA 1OL6A 5EG3A 2BRBA 4CYJA 4BTMA 2JITA 1TQMA 5AIRA 2NNWB 3A7JA 5DLSA 5CU0A 3VHKA 1XQZA 2C6EA 1V1KA 3R83A 3C0GA 3GU5A 4OT6A 4K2RA 3HUCA 2JFMA 3KK8A 4X6RA 3C5IA 3KKVA 2Y4IC 4D2RA 4R7IA 2FSTX 4JBQA 3HV3A 4I22A 1OIYA 3HNGA 2B9JA 5DH3A 4ALVA 4D4YA 2ZV9A 3DK3A 4GU9A 1OGUA 4IX5A 4YUQA 4FOBA 4DH7A 4EBWA 1PXPA 2JIVA 4KB8A 1KUTA 4BTJA 4C3PA 1ZAOA 2WTWA 2X9FA 3CY2A 4KSPA 5HO8A 4FTKA 1CKIA 3R0TA 4IAKA 3VULA 2VTJA 3OTVA 4X0MA 3QQLA 2YJRA 4ZP5A 4KRDA 4QMMA 3MH3A 3WI6A 3HDNA 3PFQA 4W9XA 1JNKA 2WMAA 4F1MA 3V8WA 5CASA 4O2PA 4DFUA 4ENXA 4QQTA 4F7NA 3UOHA 4TT7A 3V5QA 3C4EA 3IG7A 1YXVA 2XB7A 3IDPA 3MYGA 4M13A 4U40A 5L6PA 5M4IA 4DE4A 3GNIB 4XP3A 3ZRLA 2E9OA 2WEVA 2IZSA 3O8PA 4I4FA 4BZOA 3GC7A 2W96B 2PY3A 2PZPA 1ZRZA 2R3RA 5AUVA 3DBFA 4K77A 4QTDA 3VF9A 1PMNA 2BZHB 2R3OA 3VNTA 2ZOQA 4XG7A 2PZ5A 1L8TA 4LRKA 4XG3A 3KEXA 4G3EA 2HWPA 4NW6A 3KREA 4C33A 4H3BA 4JAJA 4TWCA 3OXIA 4PRJA 3W18A 5BNJA 3OOMA 1GZNA 5GIOE 4M84A 3WARA 2P33A 2RFDA 4JVGA 2HY81 4NUSA 4FSRA 3PXKA 4MHAA 4X2KA 4NM3A 4TWNA 4R1YA 3F3ZA 3LJ1A 3RHKA 1ZY5A 4J98A 3ZO1A 1O6LA 3ORXA 3KULA 3QL8A 4W4WA 2CHLA 1OUKA 4EONA 4FG9A 5DWRA 3ZLXA 2XS0A 2I40A 4O7VA 1VJYA 2ZV2A 2CN5A 1K9AA 2OJIA 4GK3A 1GY3A 4L43A 3L9MA 4H58A 5FTQA 3I1AA 4ANBA 1BLXA 2WMUA 5CVFA 4F7LA 5JGDA 2GNJA 4TL0A 2Y6OA 3G51A 1UWJA 2OFVA 4WNMA 2HZ4A 4IX6A 4EH6A 5KMKA 2WO6A 1ZWSA 5FXSA 4IWQA 2BRMA 3TCPA 4AW1A 4O7YA 2PWLA 3TZ7A 4Q9ZA 5BVNA 5KCVA 2VX3A 1KOAA 4L45A 1PYXA 4CFNA 4ZTHA 4FBXA 3HV5A 2QODA 3KVWA 4DBXA 3HMOA 4Z7GA 2GHMA 2H6DA 3FLQA 3IK3A 3PY0A 1ZMUA 2CN8A 4FUXA 3C0IA 2R0UA 3IS5A 5HD7A 4HGEA 1U5QA 2OJFE 2XMYA 4UXQA 3FLNC 1RQQA 5I4NA 2B52A 2WEIA 3LJ2A 3CJFA 3FI8A 5EK7A 2QOLA 1M7QA 2QU5A 1JLUE 2F7ZE 2XK4A 3BHHA 3F5UA 3W10A 4ACHA 2C68A 4BWKA 2VZ6A 4RJ8A 4JG6A 2A27A 4TYGA 4AT3A 4IM2A 2YISA 2GTNA 3VUGA 5EI8A 2WOUA 3HYHA 3F66A 3LOKA 3LQ5A 2OF4A 1CTPE 3O7LD 4MKCA 3R8VA 2OJGA 3LHJA 3QXOA 4L52A 4UYNA 4ZTSA 2XNBA 1KE7A 3KFAA 3F2AA 4WIHA 4OR5A 3DXNA 4IB0A 4USEA 2QOKA 4OTPA 5JK3A 2WOTA 4EOSA 4ITHA 4F6SA 5L6OA 3AC3A 2ZVAA 1YI3A 2KTYA 3QX2A 4J8NA 4OTRA 3GP0A 4WO5A 2XCKA 4FVRA 5HLWA 4O7RA 3LCDA 2QLUA 3A8XA 3EQRA 3R8LA 5GZ9A 1XBAA 2NRYA 2W5HA 2BZJA 2J50A 2V55A 4R8QA 1YDTE 5HKMA 4EC8A 3TZ9A 2XNMA 3FZSA 4MQ2A 5L4QA 4W9WA 5BVWA 1M14A 2VWBA 4L53A 4RRVA 5DOSA 3KMUA 4O21A 3ZLYA 1GAGA 2F7XE 3VS2A 4FKPA 4Z9LA 4RLKA 2V5QA 3C13A 2OI4X 4JQ8A 4AGCA 1V0PA 1YXXA 2EXEA 3AG9A 4FT7A 4IJPA 4NM5A 3TUBA 3DQXA 3TG1A 2ITZA 2QURA 2YWPA 4O7SA 3F3WA 3R01A 1CDKA 1FVTA 4U44A 4F64A 3MH2A 1JSTA 3I4BA 3VS4A 2P2HA 2OF2A 3HX4A 5IUHA 3VS0A 4BDFA 2W06A 1Q24A 1FINA 1NVQA 3N4TA 2NP8A 4N57A 2CJMA 2UW7A 3VUIA 1ZMWA 3NLBA 2GHLA 2BPMA 5E8TA 5AV4A 4J97A 5KZ0A 2B9FA 4IE9A 2YM7A 5LWMA 4HPUE 5ETAA 2R3HA 3VBWA 2WZJA 5I5ZA 4RX5A 5CZHA 4ITIA 4ASEA 4YTHA 4ASXA 2B0QA 2HY0A 3RPOA 1UU3A 1K3AA 3OWPA 4FSMA 2GQRA 4G34A 2ZDTA 3BGZA 4O0WA 1OL5A 4DFXE 5HO6A 1XWSA 3Q60A 2XNPA 5B2MA 5EHYA 1TKIA 3D2KA 1XJDA 2BAKA 5F1ZA 4AWIA 5I9VA 1BYGA 2JAVA 5HTIA 2FVDA 5H2UA 4JT3A 2XK8A 1H4LA 3IW4A 4FVQA 5HBJA 3RPRA 3A99A 4CXAA 3E7VA 3ZFMA 4DCEA 3THBA 4CFVA 2R3PA 2J6MA 2ITVA 4EHVA 5CQUA 4WG3A 5CX9A 3H3CA 4EH4A 3OOGA 2OZAA 3E3BX 5HLPA 5CI6A 4HGSA 3N4VA 4MEDA 5HESA 3FWQA 2OXYA 3CTQA 4EZ3A 4JS8A 4MBIA 4TYIA 3CR0A 5KMIA 3Q2JA 4IANA 4E73A 4E8AA 3ZSIA 5IQHA 4XH6A 3PRFA 1OKYA 4YJOA 2YDJA 1Y8YA 4DEGA 4EYJA 4DA5A 3FLZA 3NNVA 4MYGA 4ZEGA 3EL8A 4YHFA 5BVKA 1UNHA 3BHUA 5C4LA 2QQ7A 4CCBA 2BHEA 3FMMA 3DFCB 4I94A 5IH5A 3OTUA 2QOOA 4BZNA 3FY0A 5JFXA 4FGBA 4FT0A 3KGAA 4YZNA 4F0FA 1R0EA 3QX4A 1OPJA 3N51A 4ZS4A 4HYIA 4ZSLA 3FHIA 3WF9A 1E1XA 5GINE 1LR4A 3ZLSA 4CMOA 4FTTA 4BZDA 1AGWA 2BZKB 2CKOA 2DQ7X 5EYMA 4D28A 4DN5A 1W8CA 4B4LA 4YTFA 3UQCA 5J9LA 2HZNA 3PPJA 3RZBA 4ERWA 3R22A 1J91A 5AP7A 5IUGA 4O81A 3OW3A 4WSQA 3UGCA 4KIQA 4AG8A 3QD0A 4IW0A 5EHLA 5EI6A 4RG0A 4O0SA 2QKWB 2W99B 3PA3A 4N6ZA 4YTIA 3COMA 4PPCA 4RJ7A 4DGNA 4EWQA 2PE1A 4A9YA 2BDFA 3E5AA 1PKDA 4AT5A 5JSMA 3TIYA 2YIRA 2YZLA 2WTIA 2QG5A 5IA3A 5AP5A 4FK3A 2AYPA 2YLEA 3BLHA 4FV4A 4IC7A 1J7UA 5J5TA 3DJ6A 2FA2A 4YMJA 4ONAA 4H39A 2EUFB 3RINA 2YM3A 3DDPA 2IVTA 4GU6A 4PL5A 4W8EA 3HMMA 3SXRA 4AOIA 3GUBA 2HIWA 3R71A 4FEXA 3QQGA 2O65A 1XO2B 5CEMA 3FMJA 4YU2A 2OH4A 4NKAA 3PXFA 1BUHA 4LGGA 4HVGA 1M2PA 3BWJA 4FUYA 5H8GA 5IQDA 3HKOA 1V0BA 4AX8A 2HXQA 2X6DA 4RFMA 2AUHA 2CSNA 4LUEA 1Z9XA 4MTAA 3G6GA 5CEPA 3VQHA 2GHGA 2VGOA 2RFSA 4QMYA 1WVXA 3CXWA 3KVXA 4LM5A 4K0YA 3ITZA 4Z55A 4GT4A 4MBJA 4WUAA 5J79A 2WTKB 3EQIA 3LFBA 4WT6A 3EFLA 3UTOA 3ZO3A 5A54A 3OUNB 4MH7A 2O8YA 3C4CA 1OB3A 4TYHA 1HCLA 2C47A 2GNGA 4E6CA 2YDIA 2WQMA 3HRFA 3OXTA 4QMVA 4TPTA 5A9UA 4TTHB 3DBDA 5E91A 2VTLA 2B55A 3JUHA 3GVUA 2QI8A 1H25A 3LQ8A 1XH6A 2A2AA 4DTBA 2YM8A 4G2FA 4KSQA 5D1JA 4B0GA 1ATPE 3QF9A 1J3HA 5I3RA 2BRNA 4ALUA 4JIKA 4EORA 2HZIA 4BB4A 5K0XA 4J95A 4Z16A 3AC4A 2OLCA 4HPTE 4U41A 4I93A 4DFNA 3DJ5A 3P5KA 3MVLA 1IASA 3W2PA 2CGWA 3IONA 3GFWA 4MXOA 3EZRA 1O6YA 3R7GA 4I6HA 2RSVA 4ZLZA 3NRMA 2VO7A 2BKKA 2UZEA 4BCIA 3UPXA 3WOWA 4I1ZA 1LPUA 2A19B 3VAPA 4QQ5A 4GIIA 2BTRA 2VTOA 4WRSA 4QPMA 3LM0A 4DFYA 3LFCA 2WTDA 3AC5A 1RJBA 3TXOA 4EJ7A 3MIAA 3P7AA 4X7QA 3ZOSA 3KCKA 1P5EA 2W5AA 4DGMA 2ZV7A 2GS6A 2ZYBA 4BBMA 5FP5A 4CVAA 5E4HA 2ZM3A 3B8RA 3I6UA 5E8WA 4G9CA 3FXZA 4E4MA 4CSVA 2AC3A 3GC8A 2H9VA 2PE0A 4F6WA 4EKLA 4FKIA 4I0TA 1WBOA 4O0RA 3AC1A 1PMVA 3F5PA 4RIXB 1RDQE 5J7BA 3R21A 5CF6A 4QP8A 3FXWA 1URWA 2QOBA 3P7BA 2LGCA 2YCSA 5T68A 2B4SB 2XKEA 4L3LA 3ZCLA 4K11A 4PL3A 3E3PA 4DLJA 3TL8A 3PP0A 3Q3BA 1H08A 2BALA 3DXQA 1WBSA 4P5ZA 2C5OA 3VRYA 1WMKA 2QOQA 2R2PA 4OT5A 2C1AA 3ALNA 1YI4A 3A7IA 5HE0A 5C01A 3BLQA 5FM3A 1E1VA 4TYJA 3WIKA 4FV0A 4FZ7A 2CGXA 4QP9A 5KX8A 3MFTA 4S31A 3U54A 3PP1A 3RNIA 2Z7SA 3SG9A 4PNKA 3D0EA 4HGLA 2EWAA 5EM8A 2Y9QA 2YEXA 4NFNA 4AE6A 5TF9A 4ASDA 5AWMA 3MJ1A 3KRRA 2X81A 4JDHA 5CVGA 5HICA 4XBUA 1KV1A 3QKLA 3V5LA 4EHGA 3FYJX 3VHEA 3PWYA 3C4XA 2I0EA 3EQBA 3QCXA 4D4RA 2BZIB 4ACCA 4C57A 2CCIA 4R3PA 4IZYA 4V0GB 1IAJA 2C4GA 4FT9A 5HNBA 4KAOA 2H34A 3WBLA 1KE9A 4KKGA 4WSYA 5M4UA 3UP7A 5KMLA 4CGAA 2R5TA 3MGYA 3QZHA 4CG8A 5HBEA 3UOLA 4G17A 2ZMCA 1KWPA 1G8SA 1BL6A 3PZHA 4FTOA 4QYHA 1JAMA 3R04A 5M44A 3IO7A 4U7ZA 4M0YA 5DRBA 5AFVA 1PXNA 1V0OA 2PMOX 3MSSA 4JX3A 3BLRA 2EVAA 4X2FA 2W9ZB 5TOZA 3VBXA 3WZKA 4G16A 2PULA 3EN4A 4JDKA 4DG0E 5CZIA 4CT1A 4EI4A 3UVRA 4L46A 5JFSA 1SYKA 3AD5A 3P79A 4AOJA 4Y95A 4K9YA 3V01A 2FH9A 4D2TA 3EJ1A 4F9YA 3NR9A 4JL9A 3ZO4A 3E87A 4K1BA 2WPAA 4BDHA 3LVPA 3LLAA 2Y4IB 2W05A 3F3TA 4HOKA 2UW3A 3UODA 2ZJWA 4BGQA 3E8EA 3KRWA 4GL9A 3BE9A 3OROA 3DNDA 2O0UA 1P4OA 2HOGA 4FKLA 3QRTA 5FDXA 2YIWA 4EH8A 3U6IA 5J1VA 3UC4A 3Q96A 3GT8A 3O17A 5E8SA 4JR7A 5HBHA 5J7HA 5ANGA 4MCVA 5EQPA 3SXSA 4V01A 1GZ8A 4KD1A 3OS3A 4PMSA 2YM4A 2RGPA 1J7IA 5DFPA 3WE4A 3FMKA 4C4EA 4DTKA 5J9ZA 1CM8A 4U0IA 3ZRMA 2Z7LA 4EK5A 4ZLOA 2VWUA 3UG1A 5J5SA 3MWUA 4OTHA 4DEAA 2FSMX 4O83A 4L42A 4DFZE 1P2AA 2C0IA 2ZB1A 3W8LA 2CKPA 4QP7A 2QONA 1X8BA 4KKEA 3O0GA 3CPBA 4BF2A 3PG3A 4CFUA 4F0GA 3QFVA 2CKQA 5C03A 3TZ8A 3BU3A 1YKRA 3A7FA 3R7EA 4CV8A 3PVWA 2X9EA 5J87A 3ZXTA 3Q32A 1CKPA 3F9NA 3VQUA 4AZWA 3WF6A 5LARA 4S32A 4F1TA 5D7VA 3Q4ZA 4QQJA 1DAYA 1J7LA 3ZRKA 5HNIX 1WZYA 1ZARA 2HENA 1OBGA 4AUAA 3LMIA 2XNOA 5ANOA 4OGRA 3D7TB 3BHVA 3D9VA 5G1XA 2JDSA 3FBVA 4EH5A 5CF8A 3QZGA 3T9IA 4FEUA 5CSHA 3R9NA 1W84A 4IWPA 4DHFA 4Y85A 4JOAA 4EZ7A 5D12A 5JGAA 3NNWA 4HCUA 2RF9A 4RJ6A 4U80A 2JDTA 3VUKA 4BCNA 3EQCA 3QTXA 3BU5A 1DM2A 2W4KA 4R5YA 1LP4A 2VGPA 2WXVA 3BX5A 5M08A 4FV7A 5EQEA 1BKXA 4MBLA 3QHWA 1NY3A 3WZUA 3EB0A 2OBJA 5CVHA 3FY2A 3MN3A 4GKIA 3DBQA 4TYHB 1OPKA 1PJKA 1U54A 1Y91A 4J1RA 3M2WA 4MNEB 4FKQA 1WCCA 1ZXEA 2VTAA 3UIBA 5IUIA 3F2RA 1QMZA 4DGOA 5M56A 2VRXA 3U87A 3ZMMA 4EQMA 5AP6A 4O7ZA 3IDCA 3OWJA 5D11A 3U6JA 3ODYX 3CGOA 4IAIA 5DHJA 3KMMA 3T3UA 4BCHA 4A4LA 2OO8X 2OKRA 2C3LA 3GENA 1Y8GA 3BPRA 4GS6A 4RA4A 4UWCA 3LCOA 4X3JA 3R7VA 4FIHA 4GFOA 5AAEA 3BBTB 4R3CA 3ZLWA 4AACA 5DIAA 5BVEA 1Y57A 1Q8ZA 4BDDA 2J7TA 4CT2A 2BFYA 5A4TA 4GUEA 1M17A 4P7EA 4AU8A 4XG2A 2WHBA 4F4PA 4W4XA 2BUJA 4IZ5A 4I23A 3SHEA 4FTLA 3DAJA 5KHWA 2VWXA 4U6RA 3UIXA 1R3CA 4LMNA 5H8BA 4F70A 3LZBA 3BYUA 4NJ3A 3P7CA 1R1WA 4LGHA 3ZDIA 2WQOA 2R9SA 1UKHA 3PE2A 3L9PA 4AFJA 4Q5HA 3I7CA 4XOYA 3DDQA 4TY1A 2OJ9A 4JI9A 3RI1A 3ZUUA 4OTIA 2X2KA 3ZBFA 4JBOA 3I5ZA 2RFEA 4JIAA 2LAVA 5DR2A 4ALWA 4ZJIA 4AZSA 2VTNA 3H9FA 5EYCA 2RKUA 2PL0A 5HGIA 5BUIA 5I9ZA 4Q5EA 4GG5A 3R28A 4XRJA 5IMEA 4IB1A 2VTQA 3A8WA 5AAGA 3PDTA 2X0GA 1U5RA 5CQWA 1DAWA 4HVIA 4FKOA 2BMCA 3N4UA 3DKOA 3NYOA 4FVPA 4RJ5A 1IR3A 5FEDA 2QR7A 4UMTA 3M42A 4BDIA 5I9UA 2F9GA 2OIQA 4FV9A 4KIKB 2J0LA 2QD9A 4OBOA 3TTIA 4RFZA 5K3YA 2XZSA 2PPQA 2W0JA 3PA5A 3QQKA 2VTTA 4HYSA 3C50A 4WOVA 4L00A 4O0VA 2WMBA 4WRGA 3O50A 3HZTA 5JZJA 4O38A 4WNPA 5EDQA 3PY1A 4C3RA 4D2VA 5A4CA 4IEBA 3F7ZA 5IZFA 4QP4A 3RM7A 1OVEA 3WF8A 5HG5A 3BGQA 3VBQA 4DGGA 5K4IA 4AN9A 2WTCA 3Q9ZA 2IW8A 2ETRA 1WBNA 2FGIA 2R3JA 4G6NA 3C0HA 4ZTNA 1CSNA 2QOHA 3HV4A 3BELA 3PXQA 3KRLA 3R30A 4IVBA 4EOLA 1H8FA 1IG1A 1YDSE 4L44A 2CKEA 2XJ1A 5IDNA 5TE0A 3NW5A 4D2SA 4OAVB 4ZSEA 4QNYA 4DG2E 3OF0A 2PZIA 3FZPA 3MW1A 4YJSA 3MY5A 2X2MA 5LMAA 5IA1A 2ZV8A 3AC2A 4QNAA 5KBRA 3SV0A 4O1PA 4OAUC 3PE1A 3TUDA 3OG7A 5DI1A 4CLIA 2BKZA 3VN9A 3BYMA 4HCVA 5CI7A 5C27A 4DITA 4XLIA 3QQFA 2YN8A 4MAOA 5KBQA 3I7BA 2XKDA 2GS7A 1NW1A 3NWWA 3FZOA 2YJSA 2JLDA 5AP2A 4L9IA 4S2ZA 2YM5A 4UV0A 4M66A 4TRLA 3VS3A 3R02A 4PTEA 2UZNA 2GNIA 4IFCA 4LV5A 3FSKA 5HOAA 3PJCA 2XP2A 3GBZA 5AEPA 2VWVA 4RT7A 4FGRA 4J8MA 4UX9A 1BX6A 1YXTA 4RVTA 4AW2A 4CTBA 4DH3A 5L6WL 5EW9A 4WNKA 4FKSA 2IZTA 1PF8A 4HZRA 2YCFA 1NXKA 4B6LA 1OUYA 5AX9A 5B2KA 1S9JA 1B39A 4FOCA 4E5AX 2HCKA 2XVDA 4PDSA 5A4LA 3LFDA 3ZFYA 5CU3A 2GDOA 2Y6MA 5CLPA 1UU7A 4J99A 5J1WA 4E4LA 3GU8A 1ZY4A 5DA3A 4F6UA 2XKFA 3GI3A 2F2UA 3O7LB 5KUPA 5IA2A 4J96A 5CYIA 4RIWA 2REIA 2V0DA 5DPVA 3ZUTA 5E1SA 4FNYA 1PXLA 3PPKA 1TQIA 4FTNA 1WVWA 1Q3WA 2EU9A 2Y8OA 4XG8A 5ETCA 3ZM9A 3QUDA 1XH5A 5CNOA 2GMXA 4RZVA 4BIEA 2ONLA 3JY0A 4FTUA 4ZTQA 5GJFA 4EKKA 3TTJA 3EWHA 2BCJA 4PUZA 3W33A 4C59A 3ODZX 3TJDA 4AF3A 4TN6A 2F2CB 4YP8A 2R3FA 1U46A 1S9IA 4RQVA 5K0KA 2WIHA 3OT8A 4G31A 4RC3A 4LFIA 4X6QC 5AUTA 4DLIA 5HE1A 3FMNA 4A4OA 5B2LA 2PZRA 1H1RA 3QYZA 3EHAA 3RBWA 3KRXA 4FTMA 4I21A 2P55A 4F9CA 4UMUA 4NW5A 5JQ8A 2CNQA 3DXPA 1FVRA 3PXZA 5DT4A 4GH2A 4NIFA 4YHJA 3GFEA 4DGLC 1YHWA 4QYFA 3ZC5A 4OBPA 4AZTA 4G5JA 4ZSAA 2VO3A 4XMOA 3DOGA 3UBDA 4C36A 2Q83A 3DCVA 4U5JA 4YZCA 4M69A 4QMSA 4FR4A 3RKBA 2X7OA 3V5WA 4Y83A 4U8ZA 3KA0A 4JBVA 5HX6A 3FQHA 3DB8A 4ACDA 4U43A 3A2CA 3C1XA 4YC3A 2Y0AA 2YM6A 4JDIA 4KBCA 5CSXA 4RIYA 4EH7A 3PXRA 3OMVA 4YJRA 5M57A 5ETFA 4C62A 4O96A 3ENHA 1JOWB 2WD1A 2JFLA 1Q4LA 3P86A 4YNEA 5EM5A 5AR3A 3UYSA 3WE8A 4O7TA 2PVFA 3UZPA 3AGLA 1G3NA 2C6LA 3I0OA 4PPAA 3V5PA 3IGOA 2BR1A 3WF5A 4AW5A 1QPCA 2IN6A 1UNLA 3DJ7A 4R3RA 5GJGA 4UWBA 2QR8A 4O82A 3PYYA 3DV3A 3ELJA 3KXNA 2ESMA 1GIHA 2PTKA 3QTUA 4RWKA 5FBNC 3UQFA 5I3OA 4I6QA 1W0XC 3EQPA 3ZC6A 3ZXZA 1XH4A 2G2IA 3K5VA 3NNXA 1PW2A 4RLLA 3UO6A 4CLJA 2XYUA 5IEYA 2PVJA 3KXMA 3SW7A 3HA8A 5KMNA 1OL1A 3BYVA 3AXWA 4G1WA 2VWIA 3REPA 2UW6A 3M11A 4M97A 5IG1A 3FLYA 2G9XA 4O6LA 3F5XA 4L3PA 5FXRA 2HK5A 2IJMA 2UVXA 2WU6A 3OY1A 4LI5A 4F9WA 3NIEA 3UNKA 3EZVA 4CQEA 2G1TA 3ENMA 3FLSA 5L8JA 3U55A 3MH1A 3R8PA 1WBWA 5CAUA 1ZYCA 2R3IA 3QQUA 2CDZA 5EW8A 2I0VA 2IZUA 2YHVA 5L8KA 3H30A 2EB3A 4E7WA 2B53A 4AA0A 3VJOA 2JDRA 3TT0A 1IA9A 4QD6A 2XBAA 4YJUA 4E20A 1P14A 3KMWA 3NW6A 3ORLA 4LRJA 1M7NA 2E2BA 3R1YA 3DKFA 2J4ZA 4XCUA 4QMNA 3NCZA 5LCKA 4W4YA 4ZSJA 5HVYA 4E6QA 2QOIA 1VR2A 3QU0A 3GU6A 5HEZA 3WYYA 1R78A 3CPCA 3C5UA 4P2KA 3FI2A 4JBPA 4U81A 3L1SA 4ZIMA 3PVGA 1DI8A 2ERZE 4H1JA 4L68A 3B2TA 5HU3A 4QMZA 4ZTMA 3RP9A 2WMSA 3QUEA 3VUMA 4AW0A 3NW7A 3QRKA 4PTCA 4QP3A 2AC5A 5AX3A 3NUUA 3FAAA 4E3CA 5DG5A 5EHOA 1SM2A 2W7XA 1PXOA 4XG9A 1OL2A 2H96A 3MS9A 1BL7A 2V7AA 1KE8A 3C4ZA 3D5XA 4M68A 1WBTA 4FV5A 2P2IA 3R7UA 3SX9A 2QNJA 1JVPP 3BQRA 3MVJA 3QTSA 5A4QA 3H9RA 4Y73A 3R9DA 1JKTA 4LOPA 5IH6A 3EYGA 2W1HA 3R2BA 2FSLX 4U42A 4ZY4A 3SXFA 3V8TA 2QO9A 4QMPA 5CENA 3IW7A 4NWMA 4RC2A 2CPKE 3MVHA 4IC8A 3CTHA 4IACA 3G5DA 5ETIA 5H9BA 3Q4UA 3RMFA 2GQSA 4R77A 3QD2B 4L67A 2IPXA 1RE8A 5JN2A 3SKCA 2W1EA 2W9FB 4JNWA 3FE3A 3BHTA 1GNGA 4UB7A 2A4LA 4U97A 4D4VA 1YXUA 2C6TA 2JKMA 3BQCA 3VBVA 2YACA 2WIPA 3MPTA 5CANA 2WMRA 4D0WA 3HLLA 3TNWA 3KXHA 3AT4A 4FZFB 5M51A 3UMWA 1Q62A 3OEFX 3TUCA 3IW8A 3F61A 3A62A 5DVRA 3QCQA 3TACA 4F9AA 2Q0BA 4QP6A 4UY9A 4Y46A 2GFSA 3ZH8A 4ANNA 5EOLA 3VW8A 3TNIA 4YTCA 5HVKA 1GIIA 3RAWA 4QTAA 5BYLA 2PUIA 4FL1A 4UMRA 4QRCA 4ZXTA 5E8ZA 3CQEA 4KKHA 1GZKA 2CMWA 3NPCA 3G90X 1A9UA 3WIGA 4KS7A 3CCNA 1W98A 4IZAA 1P4FA 1U4DA 2OXDA 1FMOE 5HI2A 3CE3A 1ERKA 1WBPA 2HAKA 3EOCA 2Z2WA 2QKRA 5J9YA 3KC3A 3OCBA 4UMPA 4N6YA 4NU1A 2WQBA 3F7WA 5EH0A 2Z8CA 1VEBA 1YWRA 3EQDA 5M4FA 5FM2A 2XIYA 1CKJA 3KULB 3AOXA 5GHVA 2WB8A 4BL1A 3HEGA 3KF4A 2J0KA 4ACGA 2GNLA 4FTIA 4UN0C 5IQCA 4BRXA 2XIKA 2Y4PA 3VUDA 5EKNA 2YAAA 3DTCA 3P1AA 1SVGA 3RWPA 1ND4A 4HNIA 2FUMA 3TM0A 3DFAA 4DCAA 4LRMA 5DR9A 4G6OA 3BE2A 3QYWA 3IPHA 4ANQA 4DYMA 1F0QA 2E9NA 2YDKA 3A4OX 3JR1A 5C8MA 4JR3A 5CXHA 1GOLA 2O64A 3SVVA 1GIJA 1JKSA 3FQEA 2ITYA 1OKVA 3PUPA 3NAYA 1YWVA 4BFMA 5DT3A 4BDBA 2G2HA 3VO3A 5LXMA 4YLJA 4OUCA 2J2IB 1ZOGA 4MVFA 3Q2MA 5AV1A 3QTIA 3SOCA 3C51A 1Z5MA 5ANKA 1JQHA 1OL7A 4FT5A 4NIFB 4OBQA 3HL7A 4J71A 5TR6A 2C5VA 1Q61A 4XV2A 5AJQA 1PMUA 4W4VA 2SRCA 2VTIA 4RC4A 3MA3A 1NT2A 4ZY5A 5FTOA 3ZEWA 4M7IA 4UYAA 2C6OA 2EXMA 2UW5A 4QMTA 5GJDA 5TT7A 2I7QA 3Q9XA 4I5HA 5I9WA 4D9UA 2J0IA 4RWLA 4U79A 3QXPA 4YC6A 5FRIA 5JFWA 4APPA 3W1FA 3RPVA 4G6LA 1Q5KA 1Y6BA 1KSWA 3KCFA 4FZDB 3D14A 1H1PA 4EK8A 2B9IA 2VUWA 4HJOA 4MD8E 5BUJA 4UXLA 4XHKB 4Y72A 4GYGA 3PPZA 3MA6A 1OPLA 4PY1A 4WD5A 3S0OA 4AGUA 3RZFA 4FEVA 1ZMVA 4ZTRA 4C2WA 4ACMA 5AR5A 2HW6A 2OZOA 2XJ2A 4FKJA 4JG7A 4BTFA 2G2FA 3F3VA 5LJJA 3E64A 4EC9A 4N4SA 3O96A 2CLQA 4USDA 1UV5A 3LFAA 4O1OA 3IKAA 4XLVA 4YJNA 4XG6A 2Z7RA 4C02A 4ID7A 5HO7A 4C34A 4TNBA 3P4KA 3OUKA 5IA4A 4IZ7A 5CF4A 2IG7A 4MX9A 3NX8A 4PTGA 4ZZMA 4FEWA 3UZRA 2PHKA 2QU6A 3UOJA 4IAZA 2VX1A 5FDPA 1PYEA 2UZOA 4RWIA 2W4JA 2YERA 2OICA 3LMHA 4IVAA 2BTSA 3AD4A 3EFJA 4K18A 2X6EA 2PVLA 5CT7A 4GFMA 5BYZA 3L9LA 4ZTLA 5HCZA 4GSBA 4UMQA 4MQ1A 2Z02A 2QCSA 5BUEA 4YGAA 4X3FA 4H36A 5I9XA 3UDBA 4PDOA 2JIUA 4JLCA 4PWNA 2FYSA 3RAHA 1SNUA 4YJPA 4KABA 1JBPE 2W1IA 3PG1A 2UZTA 5M06A 2HXLA 3WZDA 2I1MA 3GC9A 2NRUA 2R3GA 3LFFA 3ACKA 5CWZA 3TIZA 2OW3A 3E7OA 3CD8A 5D7AA 3Q53A 4I4EA 2ZM1A 2FSOX 3OCTA 3O8UA 3PVBA 5J8IA 2IW9A 2O3PA 4IM0A 4I92A 4C7TA 5IF1A 4FNXA 3ATTA 4LG4A 3UE4A 3O51A 4R1VA 4PMMA 4B8LA 2CCHA 2QLQA 3O2MA 3QBNA 1BI7A 3GB2A 4IB3A 4M14A 5HVJA 3FKLA 4A06A 5HE3A 4G3CA 3SOAA 2QO7A 4YZMA 4EH9A 4EJNA 4XP0A 4BYIA 1FQ1B 5AUYA 4RIOA 3OXZA 3DK7A 4ZJJA 4OW8A 2CGVA 4YLKA 3SQQA 3CS9A 4QP2A 5ANIA 5FD2A 4ZMFA 5HHWA 3UO4A 1FOTA 4Y5HA 4HZSA 3QA0A 1Q8TA 3CQWA 1OIUA 3I5NA 4CMUA 3Q9WA 2C5NA 2O5KA 3CKXA 3FL5A 2CNUA 3Q6UA 5FXQA 2YAKA 3D5VA 1CMKE 3E93A 1L3RE 3V3VA 2C3JA 4QPSA 4EOMA 3QC4A 3R8MA 2OZAB 3FLWA 3H10A 4G9RA 4JXFA 4P5QA 3OWLA 3UG2A 3SC1A 4ANOA 3A4PA 4BWXA 2UW4A 3NYXA 4FKUA 4G3FA 4F1OA 5HCYA 4A9SA 2PUNA 5E9EA 3TEIA 5LVPA 1YOLA 3VS7A 2YFXA 3NIZA 4X2JA 4C35A 4CZYB 3EN5A 4BVUA 3RALA 3OT3A 5D41A 3RK9A 3PLAE 4YJQA 2YCQA 5CSPA 4I0SA 3IW5A 4YURA 4QTBA 3C4WA 4XG4A 3DKCA 3TV4A 4FSUA 3ATSA 3EFKA 4CRSA 4RVMA 2DS1A 2ONLC 1PXMA 5K4JA 3NNUA 3OC1A 1FGIA 3EQHA 4E6AA 2E9UA 3QHRA 3RK7A 4TWOA 2ITXA 4EYMA 4FSZA 4HVDA 2BAQA 4LQMA 3HMNA 1UU9A 4FV3A 1SNXA 5D9HA 2DUVA 4OTQA 3E8NA 4EEVA 1QPJA 2YITA 1YQJA 2ETMA 3PSCA 5FLFA 3UNJA 3BKBA 3ZDUA 3TNHA 3ZZEA 4E5BA 5DYJA 2OIBA 1YHVA 2XKCA 3PA4A 5HLNA 2UZBA 4BCJA 1RW8A 3MH0A 5T3QA 4F7SA 3U4WA 5FWKK 4LYNA 3TN8A 3ALOA 5F20A 5JRSA 4AN2A 2UV2A 4TXCA 5B7VA 3LE6A 1YDRE 4ZZNA 2R64A 4GVJA 3PZEA 2YIXA 3ANQA 4JDJA 4DC2A 2IVVA 3KF7A 4XV1A 5CSWA 3DLSA 5DE2A 5EI2A 3RCDA 3TNQB 1JWHA 3EMGA 2ZMDA 3HA6A 5E90A 3RVGA 4BDCA 3CKWA 3IECA 4W8DA 2GPHA 3ZUVA 1T46A 2I0YA 3OD6X 3BEGA 4QMQA 4FX3A 1DS5A 3FMEA 5AUZA 5AR8A 3U9CA 4YZDA 4GYIA 4FV2A 5DN3A 1K2PA 1PY5A 5L2SA 4LL5A 4LOQA 3SG8A 3TV7A 5AR4A 4IAYA 4APCA 4QT1A 4PDYA 2WFYA 3E88A 4IQ6A 4EH2A 3UNZA 5BYYA 3HDMA 2RIOA 4FG8A 1UA2A 2YZAA 2B54A 3ID6C 3LFEA 4FEQA 3TKIA 2C6MA 3QGYA 3TKHA 3C4FA 4FTCA 4B99A 4J53A 4II5A 4IVDA 3Q5IA 4L3JA 2J5FA 3OEZA 4EBVA 2OG8A 3E8DA 2JKOA 4FL2A 3LFSA 5IQFA 4JG8A 3QRIA 2XEZA 2R3MA 3MJ2A 4BCQA 4IWOA 1AD5A 4AQCA 4F08A 5TO8A 5FUTA 4CRLA 2Y7JA 2PVHA 3QKKA 1Q97A 1LEWA 4EOOA 3GCVA 4FT3A 3QZFA 4YSJA 1H28A 2KULA 1JKLA 2XJ0A 3T3VA 5DBXA 3SRVA 2ITNA 2YLFA 3DLZA 3PIZA 5CU2A 1W82A 5L8LA 1Q3DA 4KINA 2DWBA 4IADA 4FICA 5EM6A 4DT8A 4QMXA 4JRNA 2X4FA 3ERKA 2J90A 3V6SA 5LMBA 4GRBA 5AUXA 2XBJA 1KE6A 5FG8A 2ZAZA 1KE5A 4V04A 3LXPA 3HGKA 3HAMA 3GEQA 4BDEA 2G01A 3OW4A 3MFUA 4C58A 4XOZA 4AGDA 5AA8A 3BEAA 3D5WA 1Y6AA 5IDPA 4OTDA 2WMWA 3PJ1A 5FTGA 2W1FA 2R3NA 2VTMA 1MUOA 3RPYA 3LPBA 4AZVA 4QTCA 3E62A 3MFRA 3ORZA 4H1MA 2G15A 2QVSE 4LOOA 1F5QA 4BN1A 1I09A 4FZ6A 2GS2A 4WBBB 3QTQA 2XUUA 5F4NA 2UVYA 5F95A 2C30A 3FSFA 3RJCA 5JFVA 3F69A 1MQ4A 4PPBA 4BCMA 4GK2A 5CAPA 3SAYA 3LKMA 1H27A 2X7GA 3Q9YA 3U51A 2QO2A 3UJGA 4C4HA 1FVVA 1SMHA 3KQ7A 4JJRA 1YRPA 2ITQA 2XRUA 5DRDA 4EOPA 4FSNA 1A48A 2PMLX 3CIKA 3JYAA 1BMKA 4PDPA 3FZ1A 4BGHA 1H00A 3D2IA 1F3MC 3HRBA 5EM7A 4NKSA 3P08A 4MD9E 4HYUA 4BHNA 3G15A 3ZHPC 4IM3A 1IEPA 2YCRA 2WMQA 2XK6A 4UZHA 2YIQA 3MI9A 5K5XA 4GG7A 4AA5A 1XH8A 4PMPA 4CEGA 1ZZ2A 1NA7A 3EN7A 5CS6A 3S2PA 5DMZA 5AA9A 3PXYA 3QA8A 5K9IA 5IQIA 1MRVA 2PVMA 3QZIA 5FP6A 2XRWA 2JBOA 4QTEA 4A4XA 2IO6A 3NEWA 4FKVA 2PVKA 3LW0A 3DU8A 3DY7A 3II5A 4P90A 5HG9A 3RHXA 3POOA 2WQEA 2XM8A 3COIA 3FEGA 4CMTA 4DTAA 3FI4A 4NZWB 3VBYA 3PSDA 4AS0A 2EB2A 2R0IA 5K5NA 1PXIA 4CTCA 3Q04A 2VNYA 1H26A 4FSTA 5E8VA 3ZM4A 2BDJA 4IJ9A 4I5CA 4NL0A 2OXXA 4XYFA 5G6VA 4M3QA 5HD4A 4FYOA 5CAOA 2ZM4A 4LMUA 5AAFA 4AFEA 5J95A 4CYIA 5JH6A 3HMIA 3TNPC 3ZEPA 4F0IA 4C0TA 2XM9A 3L9NA 1YI6A 1XR1A 5JZNA 3SGCA 3HUBA 5IA5A 3JPVA 3W32A 3R9RA 4BICA 4I5PA 4B7TA 1DI9A 3QD4A 4GJ3A 4EUTA 2WTVA 3RTPA 3RNYA 4D5HA 1OM1A 4PP7A 1OIQA 4RGJA 3AMBA 3U6HA 2W1GA 1VZOA 3COHA 1U59A 3BRBA 1OI9A 3PTGA 4IDVA 5IKWA 5LVNA 3ORNA 5KHXA 4GCJA 1MRYA 5EQYA 4RPVA 3V5TA 3MVMA 4S34A 3W2SA 4CV9A 1UKIA 1WVYA 4HCTA 5HX8A 3OCSA 2OU7A 3NUNA 4NTTA 2YABA 3GOPA 2C0TA 5HNGA 3Q4TA 3QTWA 5F9EA 3NSZA 3KN6A 4CD0A 2R4BA 5E8XA 3ZFXA 1UWHA 4BCPA 5LMKA 4GK4A 2X2LA 5IU2A 3MB7A 3OBJA 2J0JA 4NH1A 4WA9A 5AR2A 3CBLA 5AV3A 4O84A 4PP9A 3RGFA 4RX9A 1H1QA 3DAEA 3F6XA 5IH4A 3FZRA 3DK6A 4RVKA 4TZRA 4RQKA 4WUNA 3ZSGA 2C0OA 3ETAA 4BKZA 2WKMA 5C1QB 3CP9A 1YWNA 3NUXA 1I44A 3MB6A 2Q0NA 4RBLA 4M12A 4N70A 4PNIA 4YJVA 1E9HA 1B6CB 2WAJA 4FKTA 4E4XA 1G8AA 5KE0A 4EH3A 3GQIA 4L7FA 3QQJA 5EDPA 3VVHA 4C4GA 5LVLA 4D2WA 5HQ0A 5C9CA 3QQHA 4NM0A 4JX7A 4I20A 4CKRA 2C6IA 2JD5A 2GNFA 3UQGA 3PY3A 1PHKA 4BCOA 1HOWA 1UVRA 2JKKA 3ZO2A 5LVOA 1PRYA 4D9TA 5DT0A 3EH9A 3U8WA 4ANLA 4YSMA 4CQGA 4EQUA 4DBNA 2C5YA 3MY1A 4XUFA 3O8TA 2OGVA 4E5WA 2VNWA 2BRGA 1JKKA 2ITUA 3JXWA 3LJ0A 3RCJA 4CNHA 2A1AB 4ANMA 1PXJA 3R7YA 2XIXA 3VW6A 1Z57A 4G3DA 3CD3A 3LCSA 4RZWA 5HG7A 2HYYA 4GV1A 3OFMA 3R1QA 4IB5A 3H4JA 3PJ8A 2OWBA 1WBVA 2UZWE 4FI1A 4BDJA 5BVFA 4EK4A 3PWDA 5KNJA 3MTFA 4G3GA 4OTWA 3R7OA 2J9MA 3NUSA 1U54B 4AT4A 5AR7A 5CAVA 1Q8WA 1OIRA 4FIIA 2JAMA 4BI0A 4KNBA 3KXGA 4ZOGA 2GCDA 3ZYAA 4Q9SA 4DEDA 4BI1A 4BR3A 2OJJA 3A61A 2PZYA 3F5GA 2J0MB 4X3FC 4N0SA 2HW7A 4UALA 1MRUA 5CALA 3F2NA 3LM5A 3BZ3A 3DGKA 4UBAA 5DEYA 3K54A 5IEXA 1J1CA 1PXKA 3SRVB 4MXXA 4MXYA 3SW4A 3C7QA 3MV5A 5GIPE 4AAAA 3QTZA 5EFQA 4RFYA 3HECA 1ZOHA 3QALE 2JIIA 3CJGA 3ORKA 4GJ2A 4L8MA 2QOCA 4USFA 5E1EA 4D1XA 4AN3A 1G5SA 2QC6A 3KB7A 2WELA 5A3XA 4I3ZA 2XF0A 4RSSA 3R7IA 4FYNA 4C4IA 4CG9A 4XS2A 2QHNA 4X2NA 4TKSA 5H8EA 5BMMA 4E6DA 2CNVA 4WBOA 3VUTA 4BWPA 2R3KA 3LQ3A 1W83A 2RFNA 4PQNA 5AIKA 4DAWA 1XBBA 2CLXA 2GSFA 3BYOA 4YJTA 5GZAA 1R0PA 4EOQA 3O71A 3R63A 4J7BA 4S30A 3GXLA 1O9UA 4AOTA 5BVDA 3GCPA 3DQWA 2B1PA 3Q4CA 2XYNA 3LLTA 1QPDA 3QCSA 3VC4A 4G5PA 5LWNA 4C2VA 4D1ZA 5M55A 5KKRB 4ZSGA 2UUEA 2ZB0A 5LCJA 4I6BA 1ZZLA 2VAGA 3KXZA 4ZY6A 3GOKA 3V5JA 4AGWA 4DEHA 4BIBA 4RA5A 4Y8DA 4FE2A 1NVRA 3PIYA 2XH5A 4GFGA 4IAAA 1TVOA 5L2QA 4D0XA 4DH5A 5M4CA 4C4FA 4XEYA 5JKGA 2QOFA 3LAUA 2WNTA 2GFCA 4AP7A 4ORKA 5D10A 4FODA 4XNEA 4MXAA 4RIXA 1Q8YA 4DINA 3CLYA 4GW8A 3W2QA 4F9BA 5AP1A 1PKGA 4HW7A 5KZIA 1SVEA 1O6KA 3KL8A 3MPMA 4JQ7A 4BCGA 5IQEA 2BIYA 4D58A 1YOJA 2IVSA 3R6XA 4F7JA 5HU9A 3FC1X 4RJ3A 2X8EA 3UC3A 2UVZA 3AC8A 3I6WA 3W8QA 4ZZOA 1LEZA 2PUPA 4DH1A 5F94A 3PIXA 4FKRA 2VV9A 3VS5A 5AV0A 2JGZA 3WYXA 2OIDA 3N9XA 3ZZWA 3LFNA 4KUJA 2XNNA 2PYWA 4DF3A 5EW3A 1H1SA 5M53A 4U3ZA 3DBEA 5AV2A 3MIYA 3NGAA 4F65A 3DKGA 2VTHA 4IWDA 4KBAA 3K5UA 2XNEA 2UW0A 3COKA 4IIRA 3M1SA 3R73A 4KIPA 1T45A 2PUUA 2UW8A 5AM7A 1REJA 2I6LA 3Q5ZA 1J1BA 2VX0A 2V62A 4V0GA 4NM7A 5BQ0A 4NCTA 3CEKA 4BKYA 4MXZA 4FIGA 5EOBA 4O91A 4A07A 3HV7A 5C4KA 4XRLA 4O7LA 3QD3A 5HG8A 4MXCA 2XK9A 2BVAA 3OY3A 3JS2A 4QYGA 2WMXA 3W2CA 4C61A 5AUWA 4FF8A 3AT2A 5GZ8A 4FTAA 5FEQA 3Q52A 4QYYA 3G2FA 3VF8A 2VWZA 3EQGA 4AE9A 2FB8A 3L8PA 3TKUA 1UU8A 1H07A 5L2WA 4O7WA 3BIZA 4IDTA 4IBMA 3OZ6A 2VWYA 2GTMA 2O63A 5CEIA 5IMXA 4BCKA 3BGPA 2X1NA 1FBNA 2BILB 3VRZA 5AM6A 4NFMA 4Z7HA 1OKWA 2GQGA 3LXNA 5AADA 3R1NA 2XNGA 4U9AA 3BWFA 3QRUA 3IGGA 4MWHA 3G9LX 3LXLA 3WILA 3T8OA 5L2TA 1VYWA 5M07A 3DS6A 3DNEA 4BKJA 3NUYA 4E1ZA 4YPSA 1JSUA 4EL9A 4DFBA 2J5EA 4ZJVA 3L8XA 2W1CA 4K6ZA 2C5XA 4RIWB 3BYSA 4RMZA 1IAHA 3L8VA 1XKKA 4CZTA 2QHMA 5AP3A 4ZS0A 4BYJA 4EOIA 3FUPA 4MF0A 5CEKA 1WAKA 3GCQA 4U3YA 4PV0A 2WU7A 3F88A 3CQUA 3ORTA 4XX9A 3K3JA 4I24A 3LFQA 1JPAA 1YVJA 2PSQA 4TWPA 4XV9A 2B9HA 3BI6A 4EUUA 4R7BA 2PVNA 1GJOA 1ZYLA 2VO0A 4KWPA 3NUAA 1SZMA 3A7HA 3EL7A 2WQNA 3MFSA 3R2YA 3G0EA 5FEEA 3UZTA 1AQ1A 2PMNX 2W4OA 4H3PA 4RX8A 5A4EA 4GIHA 4BDGA 3D4QA 3D15A 5TKDA 3AT3A 5HZNA 1M2RA 4FA2A 5A14A 3HMPA 3QRJA 5JGBA 3VJNA 1IRKA 2OSCA 4Q2AA 1YW2A 5CTPA 3NVMB 3TDVA 4K8AA 2UZDA 4KS8A 3U4UA 2R3LA 1VYZA 5ICPA 2RG5A 2OFUA 3BU6A 4MNFA 5EKOA 3NAXA 4E4NA 5JRQA 3GU7A 5IQGA 2V7OA 4FNWA 3FC2A 2WTJA 3QLFA 4JRVA 4ZLYA 4M69B 3S00A 3CTJA 4AZEA 2R3QA 3AD6A 4E26A 2X4ZA 1OECA 1KV2A 3EFWA 3BHYA 3QUPA 4RWJA 3D7TA 4HVHA 3KRJA 4RIYB 5ACKA 2Z60A 1IA8A 3KK9A 2PE2A 4K33A 5DNRA 1Q41A 4M0ZA 1ZYSA 2UZVA 4L7SA 4O0UA 4QOXA 4F09A 4BHZA 4I41A 3SD0A 3TZMA 2YWVA 5LQFA 3PRIA 4EHEA 3QKMA 5CY3A 4BI2A 4JQEA 4EHZA 4FV1A 4O0XA 3G33A 4D5KA 5LOHA 4IFGA 3PLSA 5HCXA 2NPQA 4FK6A 5IPJA 4O7NA 5CT0A 3FV8A 4DEBA 3NUPA 3S4QA 4NYEA 2JDVA 4CKIA 4CFFA 1ZLTA 3DT1A 3GQLA 4FG7A 3RK5A 2PMIA 4D2PA 4DEIA 3UO5A 4MNEA 5CSVA 3S1HA 5EYKA 4KRCA 3SDJA 2XIZA 2WGJA 2XK7A 3JY9A 4BCFA 5KKRC 2X39A 1H01A 3Q6WA 3A60A 2A0CX 5ANJA 2BIKB 3DZOA 4O22A 2XIRA 4XV3A 3UOKA 3BCEA 3V04A 4IH8A 4M67A 4GVAA 1M52A 5FGKA 4LV8A 3ET7A 3ZSHA 1STCE 2BRHA 3P23A 4HVSA 1XH7A 2F49A 3PJ3A 4QMUA 4A7CA 4I0RA 5L2IA 3ZU7A 2ZDUA 4L01A 4YHTA 3SLSA 4AXAA 5CU4A 3PJ2A 4D1SA 2BAJA 3JVRA 4O2ZA 3R9HA 4A9RA 3HP5A 3DAKA 4FTQA 5E8UA 2F4JA 2X8DA 3DA6A 4FSWA 2I0HA 3G6HA 4JAIA 3D7ZA 3NZ0A 4UEUA 5IISA 1FMKA 2UZLA 3EIDA 4FV8A 4R6VA 3DB6A 4D55A 3EN6A 5T6KA 3VS1A 2HELA 2OH0E 4D4SA 2BROA 3FKNA 4Z3VA 3QWKA 3CSVA 1BI8A 2R7BA 3FDNA 4HYHA 4NK9A 4R7HA 4RJ4A 4MK0A 3V8SA 4YR8A 3DPKA 3F82A 3I81A 4TW9A 5BMSA 3MY0A 2GNHA 2W1ZA 4AA4A 5CEOA 2RL5A 4UWYA 5IEVA 3OCGA 2P3GX 4FKGA 3LCTA 4Y5QA 5KMJA 5E8YA 5B0XA 3AMAA 4LGDA 3C9WA 5HORA 5KMOA 3UPZA 3PSBA 5DEWA 5ITAA 3I60A 1XHAA 4IMYA 4ARKA 3OWKA 3KN5A 3ACJA 3FMLA 4TYEA 4XBRA 5E92A 3ZBXA 1Q8UA 4F63A 3R8UA 4IHPA 2JKQA 3W55A 2PVRA 4MWIA 4EK6A 4KIKA 3TWJA 4GUBA 4C3FA 4YNOA 4FIEA 4XJ0A 3O23A 4ZK5A 3MPAA 3ANRA 3BBWA 3P9JA 3UMXA 5JMSA 4WG5A 3OVVA 3UVPA 3NCGA 5HTBA 4EK3A 4ERKA 3EYHA 5EYDA 4QMLA 5CEQA 5IQAA 4O27B 4YO4A 3CGFA 4GEOA 3S95A 2ITPA 2JC6A 2RG6A 2ERKA 1ZYJA 4HNFA 3GC0A 4O86A 4DFLA 4A9TA 4BDAA 4KA3A 3EKNA 4NSTA 2IVUA 4IX3A 4FSYA 3NYNA 5HIDA 3VBTA 4WG4A 3QC9A 3VWAA 2H8HA 5DR6A 3FKOA 4B9DA 5C8KA 2QG7A 1MP8A 4YBJA 3TJCA 3K2LA 3CC6A 1YHSA 3FMDA 4YBKA 3UIMA 5BX0A 5HTCA 3LCKA 4OLIA 1LUFA 1YOMA 2GU8A 2Z7QA 4GMYA 2ITOA 5KO1A 3ULZA 3LXKA 3QGWA 3AGMA 2B7AA 2C6DA 3L8SA 4R5SA 2PVYA 5ANEA 2VTSA 3ZONA 4WKQA 5LMKC 5ACBC 1HCKA 2VN9A 5AP4A 2YIYA 3G0FA 1H1WA 2IW6A 3RPSA 3F3UA 4GKHA 2E9VA 3IW6A 4QPAA 3U9NA 5M09A 5HIBA 2C6KA 4YZBA 5AMNA 3OHTA 4IAFA 1PMEA 4F99A 4EWHA 1Q99A 3ROYA 5EDRA 3HP2A 4BTKA 3D94A 4HGTA 5A6OA 2EXCX 4EOKA 5CU6A 4WHZA 1OKZA 2IWIA 4BBFA 3IOPA 3QTRA 4NJDA 3D83A 2HWOA 2WMTA 3IQ7A 2C1BA 5JQ5A 3LIJA 2JEDA 3ZS5A 4X21A 3H9OA 3BV3A 3FXXA 4DEEA 4CFMA 4PMTA 4ANSA 1OMWA 2C3IB 2VU3A 4MF1A 4XP2A 3TDWA 4O0TA 5DGZA 4QMWA 5CNNA 1H0WA 2J51A 3H0ZA 4FMQA 4LUDA 3I79A 4NTSA 4QP1A 3A7GA 2X8IA 3QWJA 3V51A 2VWWA 5LVMA 4O6EA 3S3IA 2ITTA 3RM6A 3RAKA 4RVLA 2O2UA 4MD7E
chains in the Genus database with same CATH superfamily
4KIOA 3FI3A 3FQSA 3UDZA 5AP0A 4QO9A 3HVCA 4PL4A 4C38A 5CF5A 2XK3A 3SA0A 2WTKC 1OZ1A 2C3KA 4S33A 3W2RA 5A46A 5I9YA 4H3QA 3NS9A 3R9OA 4I5MA 4M8TA 2WMVA 3T9TA 3CY3A 1QPEA 4FC0A 3W16A 4C4JA 3FL4A 4DH8A 3RAIA 1NVSA 3UYTA 3VIDA 3VS6A 4DG3E 2P0CA 4CKJA 2P4IA 2UW9A 3ORPA 5C8NA 1JSVA 1ZYDA 2W1DA 4EZ5A 3B8QA 3W2OA 4TNDA 4FKWA 1M2QA 2NO3A 3FMHA 3POZA 4FIJA 4O0YA 4WNOA 1TQPA 3FPQA 1QCFA 3ROCA 4BBEA 4GT5A 4KBKA 4QQCA 4FIFA 3GU4A 4M15A 4A9UA 5L3AA 5GNKA 3ULIA 2XCHA 1FPUA 3NVKI 4PX6A 4I6FA 2W17A 3TV6A 2HZ0A 4FNZA 4E93A 3R00A 3ORMA 5C26A 4H05A 3H0YA 1XBCA 3K3IA 3TI1A 3GCSA 2BHHA 3LMGA 5HE2A 4YPDA 3DZQA 1UNGA 5E7RA 3WZJA 4FSQA 3D5UA 4FTRA 3IDBA 3BL7A 2BFXA 3MTLA 4CCUA 3KY2A 2PK9A 2VO6A 1URCA 4YC8A 2VTPA 1H0VA 1KOBA 5JT2A 4YLLA 4EQCA 3MDYA 2V22A 3HV6A 3UIUA 5A6NA 3MESA 4OTGA 3RWQA 1YXSA 4IXPA 2JBPA 3DBCA 3KXXA 4X2GA 3WZEA 3GCUA 3ORIA 5KMMA 3I0QA 4OTFA 4CZUA 3IOKA 3P0MA 3ZTXA 4DHJA 3E92A 4RX7A 5BPYA 3EQFA 5ANDA 3KU2A 3UP2A 2X7FA 3FZTA 3VUHA 1ZOEA 4ZMEA 4R78A 1FGKA 4PF4A 4ENYA 3MBLA 2IZRA 3NDMA 3NYVA 3QLGA 4CFWA 1SVHA 1A06A 4ASZA 3E63A 2XAMA 4BDKA 1REKA 4ITJA 4DT9A 4FV6A 3BV2A 5JEBA 4FTJA 5H3QA 3G9NA 4X3FB 2E9PA 3R1SA 3FYKX 1OBDA 3FJQE 2F7EE 3UVQA 3HAVA 1XH9A 4NEUA 1MQBA 3QAME 3AQVA 4B8MA 3JVSA 4L6QA 2DYLA 4NT4A 4QYEA 5I0BA 4C8BA 3O5AA 2ETKA 2XEYA 2UZUE 5FQDC 4YO6A 3V6RA 3P78A 3NMUF 2F57A 2ITWA 3OP5A 5CAQA 4J52A 4BY9E 2VD5A 3E8CA 2R7IA 4BIDA 1H24A 1EH4A 2VTRA 5AUUA 4IX4A 3DTWA 4U45A 4FL3A 2ACXA 2OK1A 4UZDA 4V05A 5HIEA 2PU8A 2W5BA 5IQBA 3FHRA 3FPMA 4EOJA 4ZAUA 1APME 5BVOA 3WF7A 5CXZA 4LL0A 3QCYA 2BDWA 4P4CA 4CFXA 4FZAB 1W7HA 4QMOA 1OITA 5IA0A 1R39A 3EKKA 3R8ZA 2CGUA 3EN9A 4NCTC 4C37A 3HRCA 3AMYA 4YZ9A 3GGFA 2XA4A 1WFCA 2C69A 3B2WA 5FBOA 3PVUA 4AZFA 1B38A 2YA9A 2FO0A 4GT3A 4IVCA 4BC6A 3OBGA 1GZOA 1QL6A 2JDOA 4BGGA 1OL6A 5EG3A 2BRBA 4CYJA 4BTMA 2JITA 1TQMA 5AIRA 2NNWB 3A7JA 5DLSA 5CU0A 3VHKA 1XQZA 2C6EA 1V1KA 3R83A 3C0GA 3GU5A 4OT6A 4K2RA 3HUCA 2JFMA 3KK8A 4X6RA 3C5IA 3KKVA 2Y4IC 4D2RA 4R7IA 3W0PA 2FSTX 4JBQA 3HV3A 4I22A 1OIYA 3HNGA 2B9JA 5DH3A 4ALVA 4D4YA 2ZV9A 3DK3A 4GU9A 1OGUA 4IX5A 4YUQA 4FOBA 4DH7A 4EBWA 1PXPA 2JIVA 4KB8A 1KUTA 4BTJA 4C3PA 1ZAOA 2WTWA 2X9FA 3CY2A 4KSPA 5HO8A 4FTKA 1CKIA 3R0TA 4IAKA 3VULA 2VTJA 3OTVA 4X0MA 3QQLA 2YJRA 4ZP5A 4KRDA 4QMMA 3MH3A 3WI6A 3HDNA 2XALA 4QEBA 3PFQA 4W9XA 1JNKA 2WMAA 4F1MA 3V8WA 5CASA 4O2PA 4DFUA 4ENXA 4QQTA 4F7NA 3UOHA 4TT7A 3V5QA 3C4EA 3IG7A 1YXVA 2XB7A 3IDPA 3MYGA 4M13A 4U40A 5L6PA 5M4IA 4DE4A 3GNIB 4XP3A 3ZRLA 2E9OA 2WEVA 2IZSA 3O8PA 4I4FA 4BZOA 3GC7A 2W96B 2PY3A 2PZPA 1ZRZA 2R3RA 5AUVA 3DBFA 4K77A 4QTDA 3VF9A 1PMNA 2BZHB 2R3OA 3VNTA 2ZOQA 4XG7A 2PZ5A 4O4CA 4LRKA 4XG3A 3KEXA 4G3EA 2HWPA 4NW6A 1L8TA 3KREA 4C33A 4H3BA 4JAJA 4TWCA 3OXIA 4PRJA 3W18A 5BNJA 3OOMA 1GZNA 4DDIA 5GIOE 4M84A 3WARA 2P33A 2RFDA 4JVGA 2HY81 4NUSA 4FSRA 3PXKA 4MHAA 4X2KA 4NM3A 4TWNA 4R1YA 3F3ZA 3LJ1A 3RHKA 1ZY5A 4J98A 3ZO1A 1O6LA 3ORXA 3KULA 3QL8A 4W4WA 2CHLA 1OUKA 4EONA 4FG9A 5DWRA 3ZLXA 2XS0A 2I40A 4O7VA 1VJYA 2ZV2A 2CN5A 1K9AA 2OJIA 4GK3A 1GY3A 4L43A 3L9MA 4H58A 5FTQA 3I1AA 4ANBA 1BLXA 2WMUA 5CVFA 4F7LA 5JGDA 2GNJA 4TL0A 2Y6OA 3G51A 1UWJA 2OFVA 4WNMA 2HZ4A 4IX6A 4EH6A 5KMKA 2WO6A 1ZWSA 5FXSA 4IWQA 2BRMA 3TCPA 4AW1A 4O7YA 2PWLA 3TZ7A 3W0NA 4Q9ZA 5BVNA 5KCVA 2VX3A 1KOAA 4L45A 1PYXA 4CFNA 4ZTHA 4FBXA 3HV5A 2QODA 3KVWA 4DBXA 3HMOA 4Z7GA 2GHMA 2H6DA 3FLQA 3IK3A 3PY0A 1ZMUA 2CN8A 4FUXA 3C0IA 2R0UA 3IS5A 5HD7A 4HGEA 1U5QA 2ZFYA 2OJFE 2XMYA 4UXQA 3FLNC 1RQQA 5I4NA 2B52A 2WEIA 3LJ2A 3CJFA 3FI8A 5EK7A 2QOLA 1M7QA 2QU5A 1JLUE 2F7ZE 2XK4A 3BHHA 3F5UA 3W10A 4ACHA 2C68A 4BWKA 2VZ6A 4RJ8A 4JG6A 2A27A 4TYGA 4AT3A 4IM2A 2YISA 2GTNA 3VUGA 5EI8A 2WOUA 3HYHA 3F66A 2IEWA 3LOKA 3LQ5A 2OF4A 1CTPE 3O7LD 4MKCA 3R8VA 2OJGA 3LHJA 3QXOA 4L52A 4UYNA 4ZTSA 2XNBA 1KE7A 3KFAA 3F2AA 4WIHA 4OR5A 3DXNA 4IB0A 4USEA 2QOKA 4OTPA 5JK3A 2WOTA 4EOSA 4ITHA 4F6SA 5L6OA 3AC3A 2ZVAA 1YI3A 2KTYA 3QX2A 4J8NA 4OTRA 3GP0A 4WO5A 2XCKA 4FVRA 5HLWA 4O7RA 3LCDA 2QLUA 3A8XA 3EQRA 3R8LA 5GZ9A 1XBAA 2NRYA 2W5HA 2BZJA 2J50A 2V55A 4R8QA 1YDTE 5HKMA 4EC8A 3TZ9A 2XNMA 3FZSA 4MQ2A 5L4QA 4W9WA 5BVWA 1M14A 2VWBA 4L53A 4RRVA 5DOSA 3KMUA 4O21A 3ZLYA 1GAGA 2F7XE 4LV7A 3VS2A 4FKPA 4Z9LA 4RLKA 2V5QA 3C13A 3W0OA 2OI4X 4JQ8A 4AGCA 1V0PA 1YXXA 2EXEA 3AG9A 4FT7A 4IJPA 4NM5A 3TUBA 3DQXA 3TG1A 2ITZA 2QURA 2YWPA 4O7SA 3F3WA 3R01A 1CDKA 1FVTA 4U44A 4F64A 3MH2A 1JSTA 3I4BA 3VS4A 2P2HA 2OF2A 3HX4A 5IUHA 3VS0A 4BDFA 2W06A 1Q24A 1FINA 1NVQA 3N4TA 2NP8A 4N57A 2CJMA 2UW7A 3VUIA 1ZMWA 3NLBA 2GHLA 2BPMA 5E8TA 5AV4A 4J97A 5KZ0A 2B9FA 4IE9A 2YM7A 5LWMA 4HPUE 5ETAA 2R3HA 3VBWA 2WZJA 5I5ZA 4RX5A 5CZHA 4ITIA 4ASEA 4YTHA 4ASXA 3W0QA 2B0QA 2HY0A 3RPOA 1UU3A 1K3AA 3OWPA 4FSMA 2GQRA 4G34A 2ZDTA 3BGZA 2X0PA 4O0WA 1OL5A 4DFXE 5HO6A 1XWSA 3Q60A 2XNPA 5B2MA 5EHYA 1TKIA 3D2KA 1XJDA 2BAKA 5F1ZA 4AWIA 5I9VA 1BYGA 2JAVA 5HTIA 2FVDA 5H2UA 4JT3A 2XK8A 1H4LA 3IW4A 4FVQA 5HBJA 3RPRA 3A99A 4CXAA 3E7VA 3ZFMA 4DCEA 3THBA 4CFVA 2R3PA 2J6MA 2ITVA 4EHVA 5CQUA 4WG3A 5CX9A 3H3CA 4EH4A 3OOGA 2OZAA 3E3BX 5HLPA 5CI6A 4HGSA 3N4VA 4MEDA 5HESA 3FWQA 2OXYA 3CTQA 4EZ3A 4JS8A 4MBIA 4TYIA 3CR0A 5KMIA 1G8JA 3Q2JA 4IANA 4E73A 4E8AA 3ZSIA 5IQHA 4XH6A 3PRFA 1OKYA 4YJOA 2YDJA 1Y8YA 4DEGA 4EYJA 4AXDA 4DA5A 3FLZA 3NNVA 4MYGA 4ZEGA 2XARA 3EL8A 4YHFA 5BVKA 1UNHA 3BHUA 5C4LA 2QQ7A 4CCBA 2BHEA 3FMMA 3DFCB 4I94A 5IH5A 3OTUA 2AEGA 2QOOA 4BZNA 3FY0A 5JFXA 4FGBA 4FT0A 3KGAA 4YZNA 4F0FA 1R0EA 3QX4A 1OPJA 3N51A 4ZS4A 4HYIA 4ZSLA 3FHIA 3WF9A 1E1XA 5GINE 1LR4A 3ZLSA 4CMOA 4FTTA 4BZDA 4AAYA 1AGWA 2BZKB 2CKOA 2DQ7X 5EYMA 4D28A 4DN5A 1W8CA 4B4LA 4YTFA 3UQCA 5J9LA 2HZNA 3PPJA 3RZBA 4ERWA 3R22A 1J91A 5AP7A 5IUGA 4O81A 3OW3A 4WSQA 3UGCA 4KIQA 4AG8A 3QD0A 4IW0A 5EHLA 5EI6A 4RG0A 4O0SA 2QKWB 2W99B 3PA3A 4N6ZA 4YTIA 3COMA 4PPCA 4RJ7A 4DGNA 4EWQA 2PE1A 4A9YA 2BDFA 3E5AA 1PKDA 4AT5A 5JSMA 3TIYA 2YIRA 2YZLA 2WTIA 2QG5A 5IA3A 5AP5A 4FK3A 2AYPA 2YLEA 3BLHA 4FV4A 4IC7A 1J7UA 5J5TA 3DJ6A 2FA2A 4YMJA 4ONAA 4H39A 2EUFB 3RINA 2YM3A 3DDPA 2IVTA 4GU6A 4PL5A 4W8EA 3HMMA 3SXRA 4AOIA 3GUBA 2AQXA 2HIWA 1TZDA 3R71A 4FEXA 3QQGA 2O65A 1XO2B 5CEMA 3FMJA 4YU2A 2OH4A 4NKAA 3PXFA 1BUHA 4LGGA 4HVGA 1M2PA 3BWJA 4FUYA 5H8GA 5IQDA 3HKOA 1V0BA 4AX8A 2HXQA 2X6DA 4RFMA 2AUHA 2CSNA 4LUEA 1Z9XA 4MTAA 3G6GA 5CEPA 3VQHA 2GHGA 2VGOA 2RFSA 4QMYA 1WVXA 3CXWA 3KVXA 4LM5A 4K0YA 3ITZA 4Z55A 4GT4A 4MBJA 4WUAA 5J79A 2WTKB 3EQIA 3LFBA 4WT6A 3EFLA 3UTOA 3ZO3A 5A54A 3OUNB 4MH7A 2O8YA 3C4CA 1OB3A 4TYHA 1HCLA 2C47A 2GNGA 4E6CA 2YDIA 2WQMA 3HRFA 3OXTA 4QMVA 4TPTA 5A9UA 4TTHB 3DBDA 5E91A 2VTLA 2B55A 3JUHA 3GVUA 2QI8A 1H25A 3LQ8A 1XH6A 2A2AA 4DTBA 2YM8A 4G2FA 4KSQA 5D1JA 4B0GA 1ATPE 3QF9A 1J3HA 1W2FA 2BRNA 4ALUA 4JIKA 4EORA 2HZIA 4BB4A 5K0XA 4J95A 4Z16A 3AC4A 2OLCA 4HPTE 4U41A 4I93A 4DFNA 3DJ5A 3P5KA 3MVLA 1IASA 3W2PA 2CGWA 3IONA 3GFWA 4MXOA 3EZRA 1O6YA 3R7GA 4I6HA 2RSVA 4ZLZA 3NRMA 2VO7A 2BKKA 2UZEA 4BCIA 3UPXA 3WOWA 4I1ZA 1LPUA 2A19B 3VAPA 4QQ5A 4GIIA 2BTRA 2VTOA 4WRSA 4QPMA 3LM0A 4DFYA 3LFCA 2WTDA 3AC5A 1RJBA 3TXOA 4EJ7A 3MIAA 3P7AA 4X7QA 3ZOSA 3KCKA 1P5EA 2W5AA 4DGMA 2ZV7A 2GS6A 2ZYBA 4BBMA 5FP5A 4CVAA 5E4HA 2ZM3A 3B8RA 3I6UA 5E8WA 4G9CA 3FXZA 4E4MA 4CSVA 2AC3A 3GC8A 2H9VA 2PE0A 4F6WA 4EKLA 4FKIA 4I0TA 1WBOA 4O0RA 3AC1A 1PMVA 3F5PA 4RIXB 1RDQE 5J7BA 3R21A 5CF6A 4QP8A 3FXWA 1URWA 2QOBA 3P7BA 2LGCA 2YCSA 5T68A 2B4SB 2XKEA 4L3LA 3ZCLA 4K11A 4PL3A 3E3PA 4DLJA 3TL8A 3PP0A 3Q3BA 1H08A 2BALA 3DXQA 1WBSA 4P5ZA 2C5OA 3VRYA 1WMKA 4O4EA 2QOQA 2R2PA 4OT5A 2C1AA 3ALNA 1YI4A 3A7IA 5HE0A 5C01A 3BLQA 5FM3A 1E1VA 4TYJA 3WIKA 3W0RA 4FV0A 4FZ7A 2CGXA 4QP9A 5KX8A 3MFTA 4S31A 3U54A 3PP1A 3RNIA 2Z7SA 3SG9A 4PNKA 3D0EA 4HGLA 2EWAA 5EM8A 2Y9QA 2YEXA 4NFNA 4AE6A 5TF9A 4ASDA 5AWMA 3MJ1A 3KRRA 2X81A 4JDHA 5CVGA 5HICA 4XBUA 1KV1A 3QKLA 3V5LA 4EHGA 3FYJX 3VHEA 3PWYA 3P5JC 3C4XA 2I0EA 3EQBA 3QCXA 4D4RA 2BZIB 4ACCA 4C57A 2CCIA 4R3PA 4IZYA 4V0GB 1IAJA 2C4GA 4FT9A 5HNBA 4KAOA 2H34A 3WBLA 1KE9A 4KKGA 4WSYA 5M4UA 3UP7A 5KMLA 4CGAA 2R5TA 3MGYA 3QZHA 4CG8A 5HBEA 3UOLA 4G17A 2ZMCA 1KWPA 1G8SA 1BL6A 3PZHA 4FTOA 4QYHA 1JAMA 3R04A 5M44A 3IO7A 4U7ZA 4M0YA 5DRBA 5AFVA 1PXNA 1V0OA 2PMOX 3MSSA 4JX3A 3BLRA 2EVAA 4X2FA 2W9ZB 5TOZA 3VBXA 3WZKA 4G16A 2PULA 3EN4A 4JDKA 4DG0E 5CZIA 4CT1A 4EI4A 3UVRA 4L46A 5JFSA 1SYKA 3AD5A 3P79A 4AOJA 4Y95A 4K9YA 3V01A 2FH9A 4D2TA 4DHIB 3EJ1A 4F9YA 3NR9A 4JL9A 3ZO4A 3E87A 4K1BA 2WPAA 4BDHA 3VONA 3LVPA 3LLAA 2Y4IB 2W05A 3F3TA 4HOKA 2UW3A 3UODA 2ZJWA 4BGQA 3E8EA 3KRWA 4GL9A 3BE9A 3OROA 3DNDA 2O0UA 1P4OA 3UDSA 4O4BB 2HOGA 4FKLA 3QRTA 5FDXA 2YIWA 4EH8A 3U6IA 5J1VA 3UC4A 3Q96A 3GT8A 3O17A 5E8SA 4JR7A 5HBHA 5J7HA 5ANGA 4MCVA 5EQPA 3SXSA 4V01A 1GZ8A 4KD1A 3OS3A 4PMSA 4FRFA 2YM4A 2RGPA 1J7IA 5DFPA 3WE4A 3FMKA 4C4EA 4DTKA 5J9ZA 1CM8A 4U0IA 3ZRMA 2Z7LA 4EK5A 4ZLOA 2VWUA 3UG1A 5J5SA 3MWUA 4OTHA 4DEAA 2FSMX 4O83A 4L42A 4DFZE 1P2AA 2C0IA 2ZB1A 3W8LA 2CKPA 4QP7A 4DDGA 2QONA 1X8BA 4KKEA 3O0GA 3CPBA 4BF2A 3PG3A 4CFUA 4F0GA 3QFVA 2CKQA 5C03A 3TZ8A 3BU3A 1YKRA 3A7FA 3R7EA 4CV8A 3PVWA 2X9EA 5J87A 3ZXTA 3Q32A 1CKPA 3F9NA 3VQUA 4AZWA 3WF6A 5LARA 4S32A 4F1TA 5D7VA 3Q4ZA 4QQJA 1DAYA 1J7LA 3ZRKA 5HNIX 1WZYA 1ZARA 2HENA 1OBGA 4AUAA 3LMIA 2XNOA 5ANOA 4OGRA 3D7TB 3BHVA 3D9VA 5G1XA 2JDSA 3FBVA 4EH5A 5CF8A 3QZGA 3T9IA 4FEUA 5CSHA 3R9NA 1W84A 4IWPA 4DHFA 4Y85A 4JOAA 4EZ7A 5D12A 5JGAA 3NNWA 4HCUA 2RF9A 4RJ6A 4U80A 2JDTA 3VUKA 4BCNA 3EQCA 3QTXA 3BU5A 1DM2A 2W4KA 4R5YA 1LP4A 2VGPA 2WXVA 3BX5A 5M08A 4FV7A 3KIOC 1BKXA 5EQEA 4MBLA 3QHWA 1NY3A 3WZUA 3EB0A 2OBJA 5CVHA 3FY2A 3MN3A 4GKIA 3DBQA 4TYHB 1OPKA 1PJKA 1U54A 1Y91A 4J1RA 3M2WA 4MNEB 4FKQA 1WCCA 1ZXEA 2VTAA 3UIBA 5IUIA 3F2RA 1QMZA 4DGOA 5M56A 2VRXA 3U87A 3ZMMA 4EQMA 3BLAA 5AP6A 4O7ZA 3IDCA 3OWJA 5D11A 3U6JA 3ODYX 3CGOA 4IAIA 5DHJA 3KMMA 3T3UA 4BCHA 4A4LA 2OO8X 2OKRA 2C3LA 3GENA 1Y8GA 3BPRA 4GS6A 4RA4A 4UWCA 3LCOA 4X3JA 3R7VA 4FIHA 4GFOA 5AAEA 3BBTB 1XMMA 4R3CA 3ZLWA 4AACA 5DIAA 5BVEA 1Y57A 1Q8ZA 4BDDA 2J7TA 4CT2A 2BFYA 5A4TA 4GUEA 1M17A 4P7EA 4AU8A 4XG2A 2WHBA 4F4PA 4W4XA 2BUJA 4IZ5A 4I23A 3SHEA 4FTLA 3DAJA 5KHWA 2VWXA 4U6RA 3UIXA 1R3CA 4LMNA 5H8BA 4F70A 3LZBA 3BYUA 4NJ3A 3P7CA 1R1WA 4LGHA 3ZDIA 2WQOA 2R9SA 1UKHA 3PE2A 3L9PA 4AFJA 4Q5HA 3I7CA 4XOYA 3DDQA 4TY1A 2OJ9A 4JI9A 3RI1A 3ZUUA 4OTIA 2X2KA 3ZBFA 4JBOA 3I5ZA 2RFEA 4JIAA 2LAVA 5DR2A 4ALWA 4ZJIA 4AZSA 2VTNA 3H9FA 5EYCA 2RKUA 2PL0A 5HGIA 5BUIA 3UDTA 5I9ZA 4Q5EA 4GG5A 3R28A 4XRJA 5IMEA 4IB1A 2VTQA 3A8WA 5AAGA 3PDTA 2X0GA 1U5RA 5CQWA 1DAWA 4HVIA 4FKOA 2BMCA 3N4UA 3DKOA 3NYOA 4FVPA 4RJ5A 1IR3A 5FEDA 2QR7A 4UMTA 3M42A 4BDIA 5I9UA 2F9GA 2OIQA 4FV9A 4KIKB 2J0LA 2QD9A 4OBOA 3TTIA 4RFZA 5K3YA 2XZSA 2PPQA 2W0JA 3PA5A 3QQKA 2VTTA 4HYSA 3C50A 4WOVA 4L00A 4O0VA 2WMBA 4WRGA 3O50A 3HZTA 5JZJA 4O38A 4WNPA 5EDQA 3PY1A 4C3RA 4D2VA 5A4CA 4IEBA 3F7ZA 5IZFA 4QP4A 3RM7A 1OVEA 3WF8A 5HG5A 3BGQA 3VBQA 4DGGA 5K4IA 4AN9A 4AQKA 2WTCA 3Q9ZA 2IW8A 2ETRA 1WBNA 2FGIA 2R3JA 4G6NA 3C0HA 4ZTNA 1CSNA 2QOHA 3HV4A 3BELA 3PXQA 3KRLA 3R30A 4IVBA 4EOLA 1H8FA 1IG1A 1YDSE 4L44A 2CKEA 2XJ1A 5IDNA 5TE0A 3NW5A 4D2SA 4OAVB 4ZSEA 4QNYA 4DG2E 3OF0A 2PZIA 3FZPA 3MW1A 4YJSA 3MY5A 2X2MA 5LMAA 5IA1A 2ZV8A 3AC2A 4QNAA 5KBRA 3SV0A 4O1PA 4OAUC 2IF8A 3PE1A 3TUDA 3OG7A 5DI1A 4CLIA 2BKZA 3VN9A 3BYMA 4HCVA 5CI7A 5C27A 4DITA 4XLIA 3QQFA 2YN8A 1G8KA 4MAOA 5KBQA 3I7BA 2XKDA 2GS7A 1NW1A 3NWWA 3FZOA 2YJSA 2JLDA 5AP2A 4L9IA 4S2ZA 2YM5A 4UV0A 4M66A 4TRLA 3VS3A 3R02A 4PTEA 2UZNA 2GNIA 4IFCA 4LV5A 3FSKA 5HOAA 3PJCA 2XP2A 3GBZA 5AEPA 2VWVA 4RT7A 4FGRA 4J8MA 4UX9A 1BX6A 1YXTA 4RVTA 4AW2A 4CTBA 4DH3A 5L6WL 5EW9A 4WNKA 4FKSA 2IZTA 1PF8A 4HZRA 2YCFA 1NXKA 4B6LA 1OUYA 5AX9A 5B2KA 1S9JA 1B39A 4FOCA 4E5AX 2HCKA 2XVDA 4PDSA 5A4LA 3LFDA 3ZFYA 5CU3A 2GDOA 2Y6MA 5CLPA 1UU7A 4J99A 5J1WA 4E4LA 3GU8A 1ZY4A 5DA3A 4F6UA 2XKFA 3GI3A 2F2UA 3O7LB 5KUPA 5IA2A 4J96A 5CYIA 4RIWA 2REIA 2V0DA 5DPVA 3ZUTA 5E1SA 4FNYA 1PXLA 3PPKA 1TQIA 4FTNA 1WVWA 1Q3WA 2EU9A 2Y8OA 4XG8A 5ETCA 3ZM9A 3QUDA 1XH5A 5CNOA 5I3RA 2GMXA 4RZVA 4BIEA 2ONLA 3JY0A 4FTUA 4ZTQA 5GJFA 4EKKA 3TTJA 3EWHA 2BCJA 4PUZA 3W33A 4C59A 3ODZX 3TJDA 4AF3A 4TN6A 2F2CB 4YP8A 2R3FA 1U46A 1S9IA 4RQVA 5K0KA 2WIHA 3OT8A 4G31A 4RC3A 4LFIA 4X6QC 5AUTA 4JMQA 4DLIA 3PUFC 5HE1A 3FMNA 3W0MA 4A4OA 5B2LA 2PZRA 1H1RA 3QYZA 3EHAA 3RBWA 3KRXA 4FTMA 4I21A 2P55A 4F9CA 4UMUA 4NW5A 5JQ8A 2CNQA 3DXPA 1FVRA 3PXZA 5DT4A 4GH2A 4NIFA 4YHJA 3GFEA 4DGLC 1YHWA 4QYFA 3ZC5A 5BV3A 4OBPA 4AZTA 4G5JA 4ZSAA 2VO3A 4XMOA 3DOGA 3UBDA 4C36A 2Q83A 3DCVA 4U5JA 4BJJA 4YZCA 4M69A 4QMSA 4FR4A 3RKBA 2X7OA 3V5WA 4Y83A 4U8ZA 3KA0A 4JBVA 5HX6A 3FQHA 3DB8A 4ACDA 4U43A 3A2CA 3C1XA 4YC3A 4I6LA 2Y0AA 2YM6A 4JDIA 4KBCA 5CSXA 4RIYA 4EH7A 3PXRA 3OMVA 4YJRA 5M57A 5ETFA 4C62A 4O96A 3ENHA 1JOWB 2WD1A 2JFLA 1Q4LA 3P86A 4YNEA 5EM5A 5AR3A 3UYSA 3WE8A 4O7TA 2PVFA 3UZPA 3AGLA 1G3NA 2C6LA 3I0OA 4PPAA 3V5PA 3IGOA 2BR1A 3WF5A 4AW5A 1QPCA 2IN6A 4FJVA 1UNLA 3DJ7A 4R3RA 5GJGA 4UWBA 2QR8A 4O82A 3PYYA 3DV3A 3ELJA 4AXFA 3KXNA 2ESMA 1GIHA 2PTKA 3QTUA 4RWKA 5FBNC 3UQFA 5I3OA 3W0SA 4I6QA 1W0XC 3EQPA 3ZC6A 3ZXZA 1XH4A 2G2IA 3K5VA 3NNXA 1PW2A 4RLLA 3UO6A 4CLJA 1TFFA 2XYUA 5IEYA 2PVJA 3KXMA 3SW7A 3HA8A 5KMNA 1OL1A 3BYVA 3AXWA 4G1WA 2VWIA 3REPA 2UW6A 3M11A 4M97A 5IG1A 3FLYA 2G9XA 4O6LA 3F5XA 4L3PA 5FXRA 2HK5A 2IJMA 2UVXA 2WU6A 3OY1A 4LI5A 4F9WA 3NIEA 3UNKA 3EZVA 4CQEA 2G1TA 3ENMA 3FLSA 5L8JA 3U55A 3MH1A 3R8PA 1WBWA 5CAUA 1ZYCA 2R3IA 3QQUA 2CDZA 5EW8A 2I0VA 2IZUA 2YHVA 5L8KA 3H30A 2EB3A 4E7WA 2B53A 4AA0A 3VJOA 2JDRA 3TT0A 1IA9A 4QD6A 2XBAA 4YJUA 4E20A 1P14A 3KMWA 3NW6A 3ORLA 4LRJA 1M7NA 2E2BA 3R1YA 3DKFA 2J4ZA 4XCUA 4QMNA 3NCZA 5LCKA 4W4YA 4ZSJA 5HVYA 4E6QA 2QOIA 1VR2A 3QU0A 3GU6A 5HEZA 3WYYA 1R78A 3CPCA 3C5UA 4P2KA 3FI2A 4JBPA 4U81A 3L1SA 4ZIMA 3PVGA 1DI8A 2ERZE 4H1JA 4L68A 3B2TA 5HU3A 4QMZA 4ZTMA 3RP9A