5J7HA

Crystal structure of anaplastic lymphoma kinase (alk) bound by brigatinib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
309
structure length
291
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Brigatinib (AP26113), a Phosphine Oxide-Containing, Potent, Orally Active Inhibitor of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords ALK tyrosine kinase receptor
total genus 93
structure length 291
sequence length 309
ec nomenclature
pdb deposition date 2016-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j7hA01
2GHGA 2RG6A 3MB7A 2E9NA 5FM3A 1P14A 2PUNA 2HZNA 1FINA 2R3IA 3MVHA 4BC6A 4BB4A 4I22A 2I0YA 1Q97A 1OITA 1TVOA 4JG6A 4NWMA 2OH4A 3R8UA 4F1TA 4A07A 3LJ0A 3LCDA 3LW0A 2QLQA 3CIKA 3VJOA 3CSVA 4P2KA 5C4KA 4AU8A 2YHVA 5DH3A 4B99A 4IADA 2QO9A 4JDKA 3KXZA 2PHKA 2UW5A 4FVPA 3FZ1A 3GC9A 4HNFA 3D5WA 4IJ9A 4QMTA 2JIUA 5EM7A 5JK3A 4Z7HA 2YZLA 5I5ZA 1IR3A 3R0TA 3G0EA 3KC3A 4IWOA 4XRLA 3RMFA 2C5YA 4UEUA 3PXFA 3L8VA 4MNEA 3OUNB 1WAKA 4O0RA 3RNYA 4S32A 4DH5A 2CCIA 3LOKA 4W4VA 4TZRA 3H4JA 3ORMA 4QMSA 3SAYA 5JMSA 3R21A 5C9CA 4AGCA 3R02A 2XK7A 3E62A 1LP4A 5F9EA 3CCNA 4YGAA 4FV4A 3KQ7A 3KXXA 4FYOA 3BELA 4NFMA 1XJDA 3ZTXA 4EOLA 4ZSGA 4OTDA 2P2HA 3DT1A 3EH9A 4NFNA 3ODYX 4D58A 1P4FA 2C5XA 2I1MA 4C58A 4NCTC 3HVCA 5HX8A 3BGPA 2HXQA 3KXNA 1OIYA 4HPUE 3BI6A 3O0GA 3I60A 2RFSA 4IX6A 4EOMA 4WA9A 4MWHA 4LUEA 2CNVA 3C9WA 4RPVA 4BWKA 4FEUA 5D41A 2JDSA 1MP8A 2R3MA 1QMZA 2FSLX 4BYIA 3FXZA 3LXPA 4IACA 3LMHA 4EEVA 4ZZOA 2RL5A 3QQLA 5CU2A 1BI8A 4IB3A 5HI2A 3AGLA 2QG5A 2WXVA 2CN8A 3E7VA 3NYNA 4RWIA 5DT0A 1W82A 2HK5A 2WOTA 2AYPA 2WTKC 1H01A 4O96A 2O64A 1NT2A 5DR2A 3F88A 3VF8A 3LCSA 3BWFA 2XBAA 3UG1A 1O6KA 3AMAA 2XKFA 3KF7A 4IVAA 4ERWA 2JC6A 4OUCA 5JRQA 2OH0E 3TUDA 4NL0A 1GIIA 1JWHA 3MFTA 4UWCA 4EOSA 1SNXA 3T3VA 5IEXA 5LVNA 4GT5A 2CDZA 2XK8A 2R3HA 3FHRA 3O17A 2J0KA 2X2LA 2JEDA 2X4ZA 2GS7A 2WZJA 3R1SA 5EDRA 4QMMA 5BVNA 4R5SA 4BDAA 2Y9QA 3W2SA 4S33A 5CQUA 5KMIA 3SXFA 4TYHA 2QI8A 1ND4A 4YR8A 4HVDA 4P5ZA 3QRTA 3KMMA 4PDSA 4AE6A 2OIBA 4FA2A 3K2LA 3MPAA 4IWDA 3DFAA 3Q32A 3E5AA 3MPTA 4O0YA 2CKQA 3WIKA 5L2QA 3Q9WA 5EDQA 2WOUA 2V0DA 4N6YA 1ZARA 1BLXA 2G2IA 3CS9A 2VTRA 3BZ3A 3ZO2A 4ANQA 4BWXA 2R5TA 5CENA 2GMXA 4JBOA 5E1SA 3OTUA 4RX7A 5CZIA 5E8XA 5BUEA 1JAMA 3R22A 4QYYA 4EHZA 2QQ7A 3VNTA 1QL6A 3IECA 3UNZA 5HESA 2BZJA 4IZ7A 2FVDA 4HVSA 1OKVA 1H27A 2A19B 2PVLA 3CQWA 3FAAA 4M14A 4AA4A 4CMTA 1OI9A 2VWBA 4UYAA 3VUKA 4A9SA 2OG8A 4DEEA 4EK5A 4GRBA 3AC1A 4J53A 5CSHA 4AOJA 3LPBA 3C4FA 1XH5A 2UUEA 4C3PA 5JEBA 4UMQA 3LFEA 3ZM9A 2R2PA 2BIYA 4KRCA 2W1EA 5AP2A 4FKRA 4ALUA 3OBJA 4BFMA 3VBQA 3NLBA 3VQUA 4UALA 4YBKA 4O0SA 3FE3A 5FUTA 1PYEA 1W83A 4EJ7A 3TEIA 1H0VA 4X2KA 3OF0A 3EYHA 3GCVA 4QPAA 4IBMA 5KMJA 4AACA 4IM2A 5D12A 5FLFA 5DA3A 1DAYA 1ZLTA 4HZSA 2PZ5A 3OHTA 4O6LA 4FNWA 3TNQB 4ZOGA 1YHSA 4L7SA 2GHLA 1JSTA 4L45A 3QTWA 3ET7A 4NSTA 4D55A 4YZBA 3PP0A 4HGLA 3SRVA 4EOJA 4R8QA 2PZIA 1OL5A 5FXQA 4J95A 2XJ2A 5IZFA 3EQDA 3PA3A 2HELA 3E3PA 3FZPA 1R0PA 4E4NA 5IMXA 4FF8A 4E8AA 3BLQA 2FYSA 4C7TA 3HMIA 1MUOA 2A4LA 4RSSA 4DTAA 3TT0A 5A46A 1UVRA 3U87A 1IAJA 4BBMA 3KMWA 1PKDA 4YHFA 3JY9A 3MPMA 2VUWA 3M1SA 4WT6A 1HOWA 4RVKA 2IW8A 2XKCA 4MVFA 2YZAA 4TYHB 4YSMA 1OVEA 3RHXA 1FGKA 2E9VA 2Z2WA 3QFVA 5KCVA 4LGHA 4G6LA 3NRMA 4D0WA 4I0RA 2R9SA 2ZYBA 4R1VA 1KOAA 4X3JA 3PXQA 3EN7A 4R3RA 1WVWA 5BYZA 2CCHA 4C62A 3C0IA 2P55A 4YTHA 3CY3A 3Q9ZA 4TWPA 4B8LA 2UZOA 2ZM3A 4L8MA 5CAOA 4AP7A 4EWQA 4PDOA 1KE5A 4LL0A 5CNOA 4MCVA 3F5GA 1NVSA 2YCQA 2ACXA 4RQVA 4CG9A 4JOAA 4UV0A 4BDFA 3DS6A 5BUIA 5CAVA 3DB8A 4WG3A 1Y6AA 1FVRA 4EOQA 2XJ1A 2WTIA 4X6QC 3PG3A 3COKA 3ZU7A 3R2BA 4AUAA 5DNRA 4D4YA 1A48A 4RX9A 5AR5A 4IZ5A 3UVPA 4MXYA 5ITAA 4EBWA 3A60A 3FLYA 4KWPA 2PVKA 4IVBA 3QKLA 2WIPA 2YIWA 2IZSA 3UZTA 1ZYJA 3VS6A 3MFSA 2NRYA 3QHWA 2ITNA 4XP2A 4GT3A 3LQ8A 4TT7A 4EOOA 2VTIA 3ERKA 2BKKA 2PVYA 3VO3A 3RHKA 3TKUA 5J7HA 2WHBA 3C51A 4D9TA 4E1ZA 2NO3A 3L8XA 3A4PA 3U4WA 2V22A 3GCSA 4A7CA 4PP7A 2QOHA 3PG1A 3QD3A 3QLFA 1TQMA 2XM9A 3NNWA 4K33A 4DA5A 2VWVA 3ALOA 1LPUA 2BAKA 3IQ7A 4WKQA 2R0IA 3QX2A 5HNGA 1ZYDA 2ZDUA 2VGPA 3AT4A 4C02A 2C3JA 3P23A 4MD9E 2UW0A 5HE2A 3G33A 3RNIA 3TDVA 5KO1A 4O91A 2IG7A 3KXGA 3FMMA 4UY9A 4N70A 4B9DA 4FBXA 4MBIA 4I4EA 4Y5HA 4GYGA 1E1XA 1UNHA 3V5PA 3QA8A 2G2FA 2Y4IC 3ORZA 5KUPA 4B6LA 2VNWA 3FC1X 1BL7A 4X21A 5EHLA 5J95A 4E93A 5D10A 3II5A 4MD8E 2VO7A 2RF9A 2KTYA 3CPCA 3UPZA 2BTSA 3ZO4A 5AAEA 3TTIA 3DZQA 4FNYA 5BX0A 5DG5A 4RBLA 3JR1A 3AXWA 2HIWA 4O38A 3NSZA 4Y46A 4BHNA 4RWJA 4ACDA 4XG8A 4ANOA 2QOOA 2YEXA 4PF4A 2BHHA 3KGAA 2X7GA 4FV2A 4E6CA 5M4CA 3DPKA 4XG3A 4DLIA 4PPCA 3QL8A 5HNBA 5K9IA 5L6WL 1G5SA 3PSBA 3DK3A 4DGNA 1GJOA 5IKWA 2IW9A 1KE9A 3MV5A 4QTBA 3PY1A 3ORTA 3WF8A 2OBJA 3AC3A 4M69B 4FTLA 5AR7A 1UKHA 3P0MA 3NUNA 3PY0A 2PMLX 3HV3A 4CFMA 4EZ7A 4ZLOA 2R7BA 4X3FC 3IOKA 1LR4A 2X81A 4I0TA 4FSTA 1V0OA 3TWJA 4BIBA 3KU2A 1W7HA 4E5WA 4R3PA 4AOIA 2QR8A 4RC3A 4WNMA 4CFVA 2Y7JA 3EIDA 4IAYA 2FSMX 2VTSA 5TT7A 3U8WA 2HCKA 3OS3A 1ZWSA 3HV5A 5CVGA 4XG7A 5KZ0A 2XEYA 2YM7A 4I6HA 1IASA 4FIEA 3SV0A 2UZTA 1GZOA 4HJOA 2UZUE 2XCKA 5JGAA 5IA2A 4ZMEA 1ZOGA 1FGIA 2GNIA 3OY1A 3OW4A 2R64A 2Z7LA 3SOAA 2WMWA 4H3PA 3G15A 3TCPA 3KRLA 4FUYA 1YXTA 1YOMA 4J96A 5BQ0A 2W9FB 5EYCA 5DRDA 3F3ZA 3KCKA 2IVTA 3IW8A 3R04A 5LVLA 3OC1A 3ZFMA 3FPQA 1R1WA 2WMSA 3NZ0A 4IDTA 4USEA 4JX3A 2R3JA 3GQIA 5TR6A 5KX8A 4C2VA 4O7VA 2XIZA 5EK7A 3DKGA 3FKLA 3QWKA 3AGMA 4MBJA 4C61A 1KV1A 3BKBA 2C30A 1XH4A 3WILA 4F0IA 3MYGA 4YPDA 2XM8A 4DGGA 3AD4A 4FKQA 5JGDA 3U6HA 2BRNA 4FZ6A 3NVKI 4BKZA 4A06A 3QXOA 4X3FB 4C35A 4GU6A 3OZ6A 4RLLA 4AZVA 3HV4A 4FZFB 2R0UA 4IDVA 4J98A 3UNJA 4YSJA 2WQBA 4J7BA 1UWHA 5HVYA 4YJUA 2QO2A 4DEGA 3TZ9A 3IW6A 3O8PA 4FGRA 2BFYA 2C3IB 3MFRA 4QPSA 4U97A 4U9AA 5JFWA 2F7EE 2WTJA 3MVMA 4Q2AA 4NK9A 3PJ8A 5EM6A 4Z55A 3FI3A 5C4LA 3GEQA 1BMKA 3CBLA 4AZSA 4FIGA 4OTWA 5IF1A 2GTNA 3GU6A 3EFJA 3OCTA 4DLJA 2J5FA 3FL5A 4BCIA 5D11A 4ZY6A 5I9ZA 4XBUA 2PUUA 2J0JA 3W18A 1WFCA 4F4PA 2OZAA 2UW8A 2GU8A 4ZTLA 2PVRA 3UYSA 4ANMA 3UIXA 3NAXA 5A6OA 2PMNX 3ZC6A 2JIVA 3SVVA 3ZSGA 2B52A 4QOXA 4NH1A 2OK1A 4UB7A 5HGIA 3AD5A 3LFQA 2AC3A 3BHUA 3F3TA 3KRXA 4C34A 4CVAA 5M56A 1QCFA 4ZIMA 2YDKA 4IVCA 2ONLA 5ETIA 2F9GA 2Y8OA 3HRCA 2ZV8A 3H9RA 4KBCA 2ETKA 4WD5A 4ZMFA 4RMZA 3OEZA 4LM5A 3AMBA 3NS9A 5FG8A 3Q2MA 4CTCA 4V04A 2GPHA 2OZAB 2VTLA 3HEGA 4U45A 3WF6A 4EYMA 4KABA 4UMPA 4ZTHA 4XG2A 4FK3A 5HTBA 5K5XA 3BGQA 1BX6A 2YA9A 2HENA 3HRBA 5HG9A 3UE4A 2ZJWA 4QMQA 5AFVA 3Q04A 3HGKA 4IWPA 5C03A 4HZRA 2PPQA 3V8TA 1YHWA 4BI2A 1UU9A 2RIOA 4I0SA 3TZMA 3IK3A 3F2NA 4G3GA 4GG5A 5IEYA 2BDFA 3PWYA 4O82A 2VWUA 4JNWA 4LYNA 4WBOA 4DINA 4F0GA 4UN0C 3FMEA 2C6EA 3R1QA 2C4GA 4WO5A 2XNPA 2O5KA 5DT4A 3EQHA 3PJ1A 3OWLA 3ALNA 3W2RA 5BNJA 3EOCA 3W1FA 3UJGA 3R8VA 4H1MA 1JKKA 4EZ5A 5LJJA 4ORKA 4GFGA 3EQRA 2ETMA 4YP8A 3EHAA 1OL1A 5T6KA 4X3FA 2VO0A 4E7WA 4U41A 3ZYAA 5CEKA 1SMHA 4YJNA 5FQDC 4CMOA 4WNKA 4ENXA 2C0IA 3ZXTA 4LRMA 4JXFA 4B4LA 4O1PA 5B2MA 2WTCA 2JDTA 4CYJA 4C38A 5CXZA 5HU3A 5F94A 3K5VA 4ZJIA 3LJ1A 3NGAA 3TN8A 1V0BA 5F1ZA 2WEIA 4WRGA 4G3CA 2YABA 4MQ2A 4XG4A 4B8MA 4K9YA 2PVNA 3EMGA 5EYMA 3NNVA 4RIXA 3QRUA 3DNDA 4IWQA 4ZSJA 4UMRA 2WMUA 3PE1A 3GFEA 2YDIA 5HLNA 3FWQA 4IAKA 4DCEA 5LMBA 3PIYA 2W17A 2RSVA 2AUHA 4FOCA 3QUDA 4YJOA 4QTEA 5EI2A 1U5RA 2UVZA 3A8WA 1YDRE 5ETCA 5E9EA 3C7QA 3EN4A 2OWBA 3ZHPC 5L2WA 2WB8A 3NX8A 4DEBA 2XCHA 3PRIA 2XYUA 4TW9A 4C33A 5J9YA 1Q41A 3HV6A 3QCQA 3D9VA 5AV0A 3R8PA 5IH5A 2A27A 5JT2A 3CQUA 3ZBFA 3FMKA 2C6DA 3QD2B 3CD8A 4FKWA 4O0UA 3F5UA 3QTIA 5KMMA 3TM0A 3D4QA 2UW9A 3CY2A 1PMNA 5HEZA 3S3IA 3W33A 2PL0A 2BRHA 2JKMA 1FVTA 1XH6A 3LFAA 3TV4A 2YERA 3R83A 5E7RA 1UU3A 4IH8A 1M52A 3UP2A 3HMMA 4GS6A 2VWIA 4L53A 1CKIA 4OR5A 4YBJA 2B0QA 2DWBA 3RPOA 4AN3A 1UU7A 1IRKA 4JQEA 3VBTA 3BGZA 3CPBA 1ZZ2A 3IGGA 4V0GB 3ZO1A 3U9NA 5AA9A 4GVAA 3LJ2A 5E92A 4F6UA 3O50A 4R7BA 2DYLA 5DYJA 4DE4A 5DPVA 3PXRA 1IA8A 3OXTA 3E92A 2P4IA 4FG7A 2XNBA 3TI1A 4PY1A 1RDQE 4M67A 2IVVA 1J7IA 2VN9A 4JDJA 5HTIA 5BVOA 5J1WA 4ALVA 3MIYA 1TKIA 4NTSA 1ZRZA 1OKZA 3BBWA 3U55A 2UVXA 2W4OA 4AS0A 2FGIA 2NRUA 3G51A 4OBOA 2XEZA 2QHMA 4MAOA 5AIRA 5HG5A 3Q53A 2R7IA 4FV5A 2X39A 3QKKA 1F3MC 3I1AA 3V5LA 3QU0A 1QPEA 3A7IA 2QURA 2ITYA 1YI4A 1AGWA 3VBXA 2O0UA 4LV8A 3TL8A 3DBDA 1L3RE 5FTGA 4II5A 4ZXTA 2IO6A 2JKKA 2OXXA 5HCYA 3SXSA 4DFNA 5HLWA 2O63A 3KFAA 3R28A 4FSZA 2NNWB 4I6QA 3RZFA 3DQWA 5KBQA 3DCVA 4FKJA 4K1BA 3S4QA 2WQOA 3BU5A 5CEPA 2CJMA 1YRPA 3KXHA 4S30A 2RG5A 5DMZA 2X1NA 4M3QA 4APCA 3FY0A 3W2CA 4D2PA 3A8XA 2XBJA 3QTXA 5E8UA 1Q61A 4ASEA 3P7CA 4HPTE 4KSQA 3A4OX 5GHVA 4Y85A 3MH2A 2WFYA 2YACA 4PPAA 1H1PA 2WTDA 4CFWA 4R78A 4PDPA 4O6EA 5IDPA 4ACMA 3FEGA 3W32A 3ZC5A 4OTPA 5L6PA 3L1SA 1UNLA 5AUTA 3GP0A 4KAOA 1M2PA 3LAUA 3NW7A 3VS2A 4M7IA 3UIUA 2BIKB 3DXQA 2F2CB 5AP6A 1Q8WA 3FSFA 4QYEA 4QP4A 2YCSA 4YTIA 3C4CA 1DI8A 3UQFA 5CVHA 5EM8A 5M07A 1APME 5L4QA 3KF4A 3L9LA 5FP6A 5J87A 3WZUA 4AQCA 3UO4A 5IQHA 2WQMA 2A1AB 3KA0A 3CXWA 3OT8A 4BI0A 5I0BA 1PXLA 2JITA 2OXDA 2UZDA 4RZVA 4X2FA 1UNGA 2OXYA 2KULA 3MH3A 4MF1A 3O7LB 4TYEA 3Q4UA 3F9NA 3MJ2A 3O23A 4HCTA 3RAWA 3JVRA 2PUPA 1Q8YA 4JRVA 5HD7A 4TKSA 4ANLA 4G9CA 5GZAA 4NYEA 2QU6A 3BIZA 4TY1A 3S0OA 3IDBA 4MBLA 2W9ZB 4XX9A 1I09A 3D5XA 4GYIA 1PHKA 2PE0A 3LFNA 1H8FA 2R3LA 5C8NA 2JKQA 4D2VA 4UZHA 4U42A 5DVRA 3FSKA 4IB0A 4EH4A 4FMQA 4BCNA 3HLLA 4QP3A 5IQGA 4NU1A 4NEUA 2GS2A 4DAWA 3FMHA 3ZDUA 5KKRC 1MRUA 4NM3A 4XLVA 5HKMA 1REJA 3GUBA 5LARA 3VF9A 3A7GA 4PV0A 2OF2A 1Z57A 4JDIA 4E6DA 4FL3A 2RKUA 4QMNA 5GINE 5EW8A 1KOBA 1Y91A 4OTHA 4PNIA 4KKGA 3W2OA 1NW1A 1NY3A 1ZY4A 3BE9A 3TUCA 4C0TA 3ZONA 3AC8A 1WBNA 3PLAE 3SRVB 1ERKA 4LI5A 3QUEA 4UYNA 3OG7A 3ZFYA 3QGYA 3KKVA 5IDNA 3F3VA 4I4FA 4JJRA 2OZOA 5I9VA 4D28A 3QC4A 4X7QA 5F20A 5ICPA 1YWRA 3PIXA 4RT7A 3R7VA 4OTGA 4AZFA 4B0GA 2W0JA 4HGTA 3R9DA 4TRLA 3F3WA 5EHOA 4XNEA 4D2TA 4EOKA 1ZMVA 4FV1A 5LCKA 2J51A 3QZGA 5BPYA 5CEMA 3PP1A 3HAMA 1YDTE 1B39A 2JBPA 1FQ1B 3GC0A 4NJ3A 5CU4A 3DK6A 4CZYB 3N4VA 1YKRA 2E9PA 3Q4ZA 2WD1A 1XH8A 2XS0A 3PPJA 4KINA 1Q24A 4LRKA 4F99A 3C0HA 3VW6A 4XP3A 4DH1A 4D1SA 4HOKA 4BN1A 2C6IA 3BHHA 1U5QA 2GDOA 3N4UA 3VW8A 4C4FA 4PL4A 3T3UA 4TTHB 3EL7A 3P86A 5HU9A 4QQJA 1JVPP 3PUPA 3S1HA 3N4TA 3V04A 2FB8A 1SNUA 3DY7A 3MGYA 5HHWA 3UOKA 1ZYCA 4EQCA 4USFA 4BCGA 4XRJA 5FRIA 1H1QA 2B9FA 4J8NA 4O2ZA 1EH4A 2H6DA 1HCLA 3DAKA 5CF6A 4RGJA 3QTQA 4PRJA 5CU6A 3HP5A 4AZWA 5CSPA 3D5UA 5L2IA 1I44A 3HRFA 4RFZA 2VTHA 3VS3A 5C01A 3QYWA 3PIZA 1PRYA 5JN2A 3LXKA 2B9HA 3KCFA 4DBNA 3CR0A 3GU8A 3DNEA 2C6TA 3Q5IA 4DEHA 3IW4A 3VWAA 4ZP5A 4AT5A 2C3LA 2P2IA 3EYGA 3C4WA 4BCMA 1L8TA 3KEXA 3E64A 2J5EA 4X0MA 2ETRA 3PDTA 3VS1A 2OW3A 2VTAA 5E1EA 3BU3A 4FTOA 4RVLA 4YC3A 3LXLA 4EK6A 2WMXA 4AG8A 3VN9A 4O7RA 3EQFA 3I6WA 2ESMA 3RAHA 2QO7A 3ODZX 4DT9A 4FL2A 3HAVA 4JR7A 1Y8GA 4GJ2A 3VS0A 5A4QA 1URWA 2ONLC 3G6GA 2UZBA 3ITZA 4D2SA 3LLAA 5HORA 3IPHA 4LOQA 3I5ZA 3QAME 3TKIA 2PMOX 4LG4A 5AADA 5M06A 2XIRA 4O7SA 2BKZA 4E73A 1KE8A 4GH2A 2Y6OA 3FQEA 5I4NA 1IG1A 3BCEA 4FSQA 2X4FA 2Y4IB 3ZLYA 4HVIA 2OKRA 2Q0NA 3KULB 4Y83A 3R9NA 3TXOA 4CGAA 4W4YA 3V51A 5DEYA 2O2UA 4O2PA 1IAHA 3VBYA 3CE3A 3EQCA 4FI1A 2R3RA 5JZNA 3Q5ZA 3KY2A 3HMPA 4G5JA 1NXKA 4R7IA 1IA9A 3W8LA 3R01A 1SVEA 4O7ZA 3EZVA 3Q96A 2C0OA 2ZAZA 4FTKA 2PU8A 4BI1A 5CTPA 4XUFA 3A2CA 3RCJA 3SC1A 3HX4A 4C4IA 5K4IA 2WU7A 4RA4A 2CPKE 1YOJA 4FEWA 5HCZA 4RIYA 1XKKA 3E8EA 3QTZA 2X9EA 2CGWA 1B6CB 5AV4A 2X6DA 3RP9A 3U4UA 3VIDA 4GVJA 5BVFA 1YQJA 1WZYA 5L8KA 2ZVAA 3TZ7A 5AEPA 4BY9E 1KUTA 4USDA 5AJQA 3ZEWA 5ANIA 3VS4A 1PKGA 4BCJA 1R39A 5LWNA 2X7OA 3ZS5A 1A06A 1H24A 1NVQA 3AG9A 3Q6WA 4R7HA 3V8WA 3BHYA 5J79A 3C4XA 4OLIA 5CF8A 4BDHA 2PSQA 2VTTA 5AP5A 5AAFA 5A9UA 3NUPA 4FTIA 4WHZA 4YHJA 3VRYA 2XIYA 4QMOA 4BL1A 3FY2A 2AC5A 3GC7A 5EQEA 5EHYA 5H9BA 3SW7A 2ZDTA 2C5NA 3NNXA 3KRWA 4L42A 2I0VA 5HCXA 3EQBA 4BWPA 3NAYA 3ID6C 1GY3A 4ZTMA 3ACJA 5EQYA 2BUJA 5HE0A 4TPTA 2OI4X 3S2PA 3PPZA 4QP9A 4FIHA 3TZ8A 3PA4A 4I21A 4D2WA 3F2RA 4LFIA 5M09A 4I5CA 2GS6A 1OM1A 4IAAA 3ULZA 2JGZA 3V8SA 4L9IA 3V5JA 5B7VA 4M0YA 4D4SA 4AXAA 1AQ1A 4UBAA 3VBVA 1UV5A 4ZTSA 3UYTA 4XV2A 3D7TA 3PXYA 4YO6A 4RZWA 3VUTA 5HO7A 1MRYA 3DKOA 2I0EA 1G8SA 4JBPA 4BTKA 5DT3A 3UNKA 5EYKA 2FO0A 3R2YA 1Z9XA 3FZTA 1OIQA 3EN9A 3I0OA 4FUXA 4HYHA 4RA5A 3UQGA 4DFXE 1LUFA 4JQ7A 4FICA 4F6SA 5HLPA 3T9TA 4MXXA 3FZSA 5FXSA 3AOXA 3IW5A 3HA6A 2BAQA 5AV3A 5C8MA 4BTJA 1CKJA 5DEWA 4NW6A 4CFUA 4ZTQA 2BDWA 1S9IA 4YUQA 2PZYA 3W10A 2B4SB 2EU9A 1M2QA 4TXCA 2EXMA 3PWDA 4Q5HA 3F66A 5CYIA 4L43A 1CMKE 3PVBA 4H58A 4CYIA 3R00A 5J9LA 4ASZA 4R1YA 1G8AA 4JL9A 3QBNA 5DR9A 5HBHA 3GU4A 2YDJA 4FT5A 4YTFA 1JNKA 3R9HA 2F57A 4G34A 4FEXA 4ASXA 2XB7A 1WVXA 3D7TB 1NA7A 3K3JA 4KSPA 4CKIA 4GUEA 3F2AA 1DI9A 5EW3A 4ZSLA 5LMAA 3DKCA 3LHJA 4FEVA 3EKKA 2PE1A 4EJNA 4IW0A 3Q60A 2BVAA 4N0SA 5DI1A 4FSMA 5AP4A 4WUAA 3ZSHA 2GNLA 4HW7A 1OKYA 4M15A 3SLSA 3WZKA 1PXKA 2V5QA 5AX3A 3O51A 2UW6A 4E4MA 5LVPA 5EDPA 4D5HA 3WF5A 4KIOA 2J90A 3R9OA 3A62A 2EWAA 2G15A 4HYUA 4WSQA 2VX1A 4JG8A 2ITTA 3CJGA 4YLJA 3OCSA 5HX6A 2P33A 4JRNA 3Q9XA 3DTCA 4FIIA 4FKTA 4FV3A 3MTFA 4DFZE 4AW5A 4NM7A 4BIDA 5JRSA 4ACCA 3TIYA 1W98A 2GNJA 3DJ6A 1OL2A 2J0LA 4MH7A 5EG3A 4DGMA 2HXLA 1WBTA 4JG7A 3WYXA 2OIQA 3UOHA 2QG7A 3IO7A 2PVHA 2W5BA 3NW6A 4K18A 4QMUA 5CLPA 3RAIA 3R73A 5FTQA 1XWSA 5HBJA 4CLJA 1GIHA 3P08A 3KL8A 3C5UA 4FTMA 1MQBA 2PZPA 4IXPA 2OIDA 5FD2A 4FSUA 5FDXA 2WU6A 4J99A 1ZOHA 3E8NA 4OW8A 5KMNA 4WIHA 2G1TA 3VS5A 3RM7A 4MTAA 1ATPE 1J91A 4FTNA 3DAJA 3G0FA 4YHTA 3W2PA 2J4ZA 2JBOA 4OAUC 3SG9A 2HWOA 2R3QA 3IONA 3FJQE 5KKRB 2BHEA 5DBXA 3O71A 5TKDA 5HBEA 5EQPA 4MNFA 3QA0A 3I4BA 2WAJA 4O0WA 5AA8A 4WUNA 4QTCA 2YCFA 3GCQA 4FR4A 4AA5A 4PQNA 1GOLA 1Q99A 2OF4A 3MH0A 3PXKA 2O3PA 3DZOA 4O27B 5J5SA 2UV2A 4HYSA 1RJBA 4NUSA 3A7JA 4BBEA 2GQGA 2YWVA 3IG7A 3MWUA 4K6ZA 5LOHA 2JLDA 4E3CA 5A54A 4L00A 4DG0E 4GKIA 4FEQA 4OGRA 4F7NA 3PE2A 4H3QA 5IA4A 4EUUA 3DXNA 4AGDA 4OAVB 4DN5A 2ITXA 5ETFA 2XK4A 3IOPA 3EFLA 2CSNA 2F49A 4ZTNA 3R9RA 1QPCA 2F4JA 2VX3A 4M12A 4I5HA 3VAPA 3ENMA 1Y57A 4YZ9A 4RJ3A 4UX9A 3RK5A 1ZMUA 3OVVA 4FTRA 4RJ4A 4J1RA 5J5TA 3QUPA 5JSMA 3I81A 2QR7A 4GK4A 5BYLA 3IW7A 2GFSA 2NPQA 4FV9A 1BYGA 5G6VA 3UVQA 1T45A 4ZSAA 4NTTA 1WBVA 2YITA 4AOTA 1V1KA 4HCUA 3ZLXA 2XF0A 3MB6A 3ZZWA 5KMOA 3ZEPA 3CP9A 4BDCA 3QXPA 2ITUA 4IFCA 3LMIA 3RBWA 5B0XA 5I3OA 3ELJA 3U51A 4BGGA 3LCTA 1P2AA 4FTUA 5A4EA 4BDDA 3TV7A 4UMUA 1Q8TA 5DOSA 2QOLA 2X7FA 3FQSA 4MYGA 3F7WA 3MA6A 5CQWA 3OOMA 3FL4A 5K0KA 1SYKA 3VC4A 4GFOA 4D4RA 4BCHA 4AW2A 3DDQA 4I92A 4I6BA 3RK9A 3TNPC 3UODA 3ZO3A 5DHJA 5HE3A 1VYWA 5M4UA 3NVMB 3ZLWA 3NNUA 4YZMA 3QF9A 4I41A 4LL5A 3UO6A 5IA3A 1H00A 2WMQA 2Z8CA 4NIFA 3RTPA 4U5JA 3LM0A 4FIJA 4EBVA 1PF8A 4PL5A 4P7EA 4DC2A 3WZDA 3BBTB 2IW6A 1ZYSA 4KIKA 4XLIA 3ORIA 4DEAA 3FBVA 4MXOA 3GB2A 3UMWA 1UA2A 4QMPA 5DFPA 1CTPE 4LGDA 2WO6A 3FI2A 2XH5A 4LQMA 4BDKA 3QC9A 4D1XA 1FOTA 3C0GA 5BYYA 3EL8A 3OWPA 4GK3A 3JXWA 4EOIA 2CHLA 3B2WA 4GCJA 2OJIA 3VBWA 3VHEA 3IDCA 2B7AA 5AR3A 2OJGA 3RGFA 5IH4A 1RQQA 3CLYA 4FKGA 3ATTA 2EB2A 4UXLA 3HECA 4GV1A 4WNOA 3V6SA 4G6OA 4I5PA 4IZYA 3BYUA 5FWKK 1H4LA 5E8TA 2Q83A 4KKHA 4FNXA 4G3EA 4R77A 4O86A 4X2JA 5AAGA 2JDOA 3B8QA 3VUIA 2CMWA 5ANDA 5K0XA 3CEKA 2OICA 4O21A 2FSOX 3LKMA 2ZMCA 3U54A 5CNNA 5CY3A 5HE1A 2UVYA 3E3BX 4QP2A 4TYGA 3R8ZA 5GJDA 3TKHA 2XRWA 4HVHA 4CRSA 4J52A 4CEGA 1OMWA 3SW4A 4DFYA 5LCJA 4F65A 3G9LX 3CGFA 3H0YA 2FH9A 2WNTA 2OSCA 3DBFA 1OL7A 4XCUA 4FZDB 3FYKX 5E4HA 5M53A 5CSXA 2PUIA 3KK8A 3L9MA 1PMUA 1XBBA 3LFCA 5DLSA 5TF9A 1NVRA 2IWIA 3PA5A 4NCTA 4PMTA 4M84A 3D83A 3QD4A 5HZNA 4L44A 1ZAOA 2J2IB 4D2RA 2W4KA 4O1OA 4QO9A 5EI6A 4F9AA 5C27A 3EB0A 4IC8A 5EM5A 2VU3A 4QPMA 4IE9A 3FQHA 1GZKA 2XJ0A 3THBA 4FKUA 5EYDA 4IM3A 3FDNA 3QGWA 2W06A 4HNIA 3UC4A 3VULA 3F61A 2PTKA 2ZB1A 4FGBA 2C1AA 3QZHA 1E1VA 4EORA 2WMRA 5I9WA 4FKSA 1JQHA 2B55A 2P0CA 1Q8ZA 4U79A 3REPA 3KXMA 3OP5A 4QMVA 4RIYB 1O6LA 3R7EA 5L2TA 4AE9A 4XG9A 1Z5MA 3LQ5A 2H34A 4FG8A 2F7ZE 5KBRA 2CLXA 4FKPA 4LGGA 4EZ3A 3N9XA 2BZKB 3QQHA 4L7FA 3PTGA 4XG6A 4CLIA 1BUHA 2SRCA 5IPJA 4TWNA 4KUJA 5LWMA 1OIUA 4JR3A 5JH6A 1P5EA 4IX4A 5BVKA 4FKVA 5IEVA 3Q4CA 3RPYA 5CAPA 2A2AA 5AM7A 4ACHA 2ITPA 4W8EA 2YISA 4IVDA 2FSTX 4ASDA 4CG8A 4QQ5A 4QD6A 3I79A 4QTAA 2QHNA 5TE0A 4EH9A 5LXMA 4H1JA 4QYGA 4EH7A 4FT0A 3FMDA 5M08A 4K77A 1TQIA 3UGCA 5LQFA 2BR1A 1OL6A 4ZAUA 2C69A 2QOBA 5G1XA 5EOLA 3AD6A 1PMEA 3PVWA 4ITIA 3NMUF 5L3AA 1JSVA 3PYYA 2W5AA 5T3QA 3ULIA 4D1ZA 4F7SA 4O0XA 1GNGA 1XO2B 5HICA 4EK8A 3OY3A 1VEBA 3CGOA 5IH6A 2H8HA 2HOGA 3PSCA 5CI6A 4W4XA 3PZHA 5K4JA 1U54A 2ERKA 3JUHA 1SVHA 3JYAA 3R1YA 4RJ5A 3ANQA 3FI8A 4EQMA 5TO8A 3F6XA 1WBPA 1XHAA 4G6NA 3QX4A 4MXAA 2ZMDA 4U7ZA 3UPXA 3PFQA 2WTWA 2GQRA 5AX9A 3Q6UA 4KNBA 3ZRMA 3RINA 3GCUA 3ZUTA 2FUMA 2VZ6A 3CTHA 3DBEA 4YJTA 4BDJA 2JAVA 4O7YA 4CV9A 4QMWA 3R7UA 4OBPA 3A7HA 4L3PA 5DN3A 5IQDA 3AMYA 4CMUA 3R71A 4RC4A 1W8CA 2G2HA 2X8IA 4JAIA 3RZBA 4ITJA 2JFLA 4FSRA 5CEQA 4AT4A 2YM3A 2YIXA 1XH9A 4G1WA 5ACKA 4YTCA 4NZWB 1O9UA 4JBVA 4EHEA 3L9NA 3I5NA 2X8EA 4A4XA 2NP8A 1LEWA 2A0CX 4AF3A 4A4OA 5GIPE 4JX7A 3DU8A 3UZRA 5A14A 4MF0A 4IFGA 4CQEA 3G90X 4RRVA 4MWIA 2IPXA 3AC5A 2OLCA 3ZRKA 4BRXA 2QKWB 1K3AA 3OW3A 1OB3A 3G9NA 2WGJA 3GC8A 4BYJA 2G9XA 4DHFA 3ZRLA 1H28A 4DT8A 2XIKA 4BCKA 1YHVA 5AP3A 3OD6X 3DTWA 4RIWA 4PWNA 5TOZA 2ITVA 3LZBA 5K3YA 3BX5A 2W1IA 1SZMA 3LVPA 2IVSA 3B8RA 4DF3A 3TJDA 4YC8A 5IQFA 5CXHA 5CU0A 2BMCA 1FMOE 2CGVA 3GCPA 4NT4A 4BIEA 2Q0BA 3PPKA 3LFSA 1U4DA 4GFMA 5CSVA 3L8SA 2WMBA 1PY5A 2XNMA 1PXNA 1REKA 4C8BA 4QQTA 2XP2A 2C0TA 3TJCA 3WF9A 4WBBB 4AAAA 4F1OA 3CKXA 4PPBA 3WI6A 4U0IA 4ZY5A 2ZV7A 4IJPA 5CI7A 5JZJA 5FEQA 5JQ5A 4UMTA 5F4NA 1YWVA 3P1AA 1JLUE 3QLGA 3O8UA 4L46A 5B2KA 4EK3A 1OBDA 2VTNA 3QHRA 3FLWA 3PVGA 3ANRA 4IM0A 3MBLA 3TIZA 4BZDA 1YWNA 2GFCA 4K11A 1VR2A 4RIOA 2BZIB 2ITWA 2Z7QA 3JY0A 3MFUA 4FL1A 4BTFA 4RWKA 3TNHA 3NYOA 4MHAA 3ROYA 4D5KA 2OFUA 3TNWA 4U81A 5H3QA 3A99A 2QOCA 4GKHA 5A4CA 3CJFA 4Z7GA 1CM8A 3FC2A 1O6YA 1OKWA 2GTMA 2GNFA 3LXNA 2CGUA 1KSWA 4GEOA 3VUDA 3QCSA 3HDNA 2Y6MA 2W99B 3LFFA 1STCE 2HY81 1OECA 3KK9A 3HUBA 4M66A 3SXRA 3RVGA 4BDGA 4F08A 2ZM1A 4F70A 2W1DA 2VTPA 1JSUA 2YN8A 3HNGA 4ZS4A 1SVGA 3B2TA 4P4CA 4ZK5A 1YXSA 2E9OA 2HWPA 4F9CA 1Q4LA 3G5DA 3VJNA 4HGEA 4K2RA 3D7ZA 4XBRA 1YXXA 5EKOA 4PX6A 3OXZA 4FVQA 5AR8A 3NUYA 2GQSA 2YAKA 4BCPA 2ERZE 3V5QA 4O81A 2HW7A 2BPMA 4YJPA 3SG8A 5E91A 1ZOEA 4C59A 5BVDA 2YCRA 3GU5A 3MVLA 3Q9YA 3R7GA 3GXLA 4S31A 2P3GX 5ANKA 1KE6A 4EYJA 4M8TA 2PZRA 5AP1A 5GJGA 1WMKA 3EQPA 4CSVA 5H8GA 4BCOA 2QOQA 3HP2A 4GG7A 2CLQA 2XK9A 3JVSA 1YXUA 4RLKA 3WOWA 4NW5A 5CANA 4QP8A 4GW8A 4RX8A 5HOAA 4K8AA 4FSYA 3FKNA 1Q62A 3U6JA 2CKEA 3I6UA 5IU2A 1WVYA 5ANGA 4F7JA 4QP7A 2YJSA 4O7WA 3BHVA 4M68A 4DGLC 4BICA 4L52A 4CFXA 4C4HA 4L67A 4YJQA 4AX8A 2PVJA 3CTQA 3RI1A 2BCJA 2XKEA 2BDJA 2R3PA 4IANA 3UOLA 1BKXA 5M44A 3BLHA 3ETAA 3JS2A 3M2WA 4F1MA 2DUVA 4UWBA 2OJFE 3KN6A 2HZ0A 1CSNA 5DWRA 3BU6A 4D9UA 3SHEA 5C1QB 4XMOA 1Y8YA 3ZMMA 1PYXA 4RWLA 3DFCB 5KE0A 4ERKA 4EONA 5CEOA 2JD5A 3MESA 1A9UA 3O2MA 1U54B 1URCA 3ORKA 4MD7E 4ALWA 5CT0A 2QOIA 3HZTA 2ITOA 4DTKA 1YDSE 3GVUA 4I3ZA 3G2FA 4MXCA 5JKGA 5J7BA 3R6XA 5K5NA 1H1WA 3DOGA 5CVFA 4YJVA 2VO6A 4QYHA 3Q4TA 4FODA 4AW0A 2W1ZA 2CKPA 3O8TA 4EK4A 2XZSA 5BMSA 4YNEA 5M57A 4GK2A 3E7OA 4OT6A 4FSNA 2C1BA 3EN5A 4I24A 1BI7A 4O7NA 4FTAA 3GGFA 4DFBA 3TTJA 3QWJA 4W9WA 4N57A 3BYMA 3KVWA 4APPA 2C47A 2GSFA 3F5PA 4NKAA 3VQHA 4CTBA 3QCYA 4PNKA 1YOLA 2WQNA 4FTTA 3GT8A 4RFYA 4C3FA 1PW2A 5DRBA 3BYOA 2PYWA 1F0QA 5KMLA 3VRZA 3O7LD 4H39A 4U80A 2J6MA 5FTOA 4Z9LA 4LOPA 1H07A 4L6QA 5J1VA 4NKSA 4JAJA 3HKOA 4RJ7A 3QD0A 2YWPA 1CDKA 4N4SA 4U44A 4G16A 4AFJA 4I94A 4BDBA 5JFVA 4RVTA 2O65A 1CKPA 2W7XA 5BVWA 3KRJA 3RPRA 4CRLA 4HYIA 4EL9A 4DH8A 4YC6A 2CNQA 5EKNA 4IB1A 5GNKA 4ACGA 5AUZA 1ZY5A 3QRJA 2XK3A 1ZMWA 3LIJA 2VD5A 3Q52A 1XBCA 4CFNA 2F7XE 4U43A 4E6AA 4Y95A 5HTCA 3VVHA 4UZDA 2I40A 3RJCA 1OBGA 1FVVA 3DXPA 1JKTA 3OWJA 3D2KA 4TYJA 4KRDA 4QT1A 4DFUA 4IHPA 4JLCA 3A61A 4CT1A 2WQEA 2JDVA 4PUZA 4ONAA 1JPAA 1YI3A 4JVGA 3UTOA 4QTDA 5IUIA 3DLSA 2E2BA 4U6RA 4F0FA 3OWKA 3R7IA 2EB3A 3COIA 2IJMA 3E93A 3ZFXA 3MJ1A 2UW4A 4FVRA 1X8BA 3PXZA 4CCBA 4C3RA 3DB6A 4G9RA 1QPDA 4C36A 4H36A 1OPJA 4DTBA 4U3ZA 1RW8A 3DV3A 3E87A 2DS1A 4D4VA 2RFEA 3AC4A 1OGUA 2X9FA 4KIPA 2J50A 1WBOA 3OXIA 4BBFA 4EQUA 5E90A 4KB8A 5IUGA 2W05A 2OJ9A 1Q3DA 3SA0A 3K5UA 5GZ8A 5E8YA 1PXJA 2Z7RA 2BAJA 5GJFA 5BUJA 5IQIA 1ZYLA 1UU8A 3ORXA 5HVJA 4ZLYA 4BHZA 3SGCA 4JT3A 2BILB 2V7OA 5A6NA 4R6VA 3BYVA 3P79A 4ZTRA 3DJ5A 2WIHA 3KRRA 5D1JA 5A3XA 4NM0A 3WE4A 1Y6BA 4GMYA 3MY5A 2BFXA 1U46A 5H8EA 3H3CA 3RALA 2IN6A 3W8QA 5FXRA 3GNIB 3CQEA 2H9VA 1H25A 2BTRA 4JBQA 4W4WA 4A9RA 1Q8UA 1GAGA 4W9XA 4IAZA 4EH3A 4ZY4A 4KIQA 2QLUA 4A9YA 3AC2A 2C6LA 4V05A 1QPJA 2XIXA 3ROCA 1J3HA 2LGCA 2O8YA 2VWWA 4TYIA 2VGOA 3BHTA 3QQFA 3V01A 4F64A 2WMTA 3KULA 5IA5A 4L3JA 3MA3A 2C6MA 4RIWB 3BEGA 3EZRA 4I1ZA 3R8LA 3TDWA 4A9UA 3AQVA 3NUUA 5A4TA 1U59A 1JBPE 3F82A 4GIHA 5CEIA 5CAQA 5D7AA 5HG7A 3GBZA 4JIKA 4TNBA 2W4JA 4F9BA 1S9JA 4DITA 4EHVA 5AUXA 5M51A 5AR4A 2QNJA 3HYHA 5E8WA 1OIRA 2C5VA 2YFXA 3NIEA 5HVKA 3FMJA 2XNOA 3FUPA 3BE2A 2EXEA 5B2LA 2ZOQA 3P5KA 3PJ2A 2V55A 1H08A 5AMNA 1P4OA 3QKMA 4W8DA 4BDIA 4CFFA 5ACBC 1UKIA 3WARA 2PK9A 2XK6A 3E88A 4BGQA 3DGKA 5IQCA 3FPMA 1B38A 2Y4PA 4MEDA 5FEDA 4BKJA 3LQ3A 4EI4A 3BPRA 2VTQA 4O83A 1OUKA 5FBNC 4YLKA 4FG9A 5IUHA 3LM5A 1V0PA 4XHKB 3RWQA 4AFEA 4C4JA 4X2GA 4X6RA 3FYJX 4UWYA 3NYXA 3FKOA 5AWMA 1VZOA 3P78A 4QNYA 3WF7A 1F5QA 4PMMA 4PTEA 5BMMA 3ZLSA 4EKLA 4EUTA 5M4FA 4IAFA 3DBQA 2QVSE 4JDHA 4A4LA 1J1BA 2JIIA 4FT9A 4G3FA 2QOFA 4RQKA 4ITHA 2PWLA 4EWHA 1E9HA 4DG3E 3GOKA 3RPSA 4E20A 2JFMA 4I93A 5HG8A 4ZZMA 4AGUA 4CQGA 4GJ3A 2HAKA 4AW1A 4R3CA 4QMZA 5EFQA 4C2WA 4XH6A 2IVUA 3WBLA 3MVJA 3R8MA 5FP5A 4ARKA 3P9JA 3PSDA 2X2KA 2C6KA 4IX3A 5FBOA 3NEWA 2Z02A 1H0WA 2OGVA 1XH7A 3BQRA 2R3GA 5AM6A 5H2UA 4EH6A 3FI4A 2J0IA 2YLFA 3WZEA 2JAMA 4PMPA 1FBNA 3NUSA 3TNIA 5JGBA 3AT3A 5LMKA 4QP6A 4FV8A 4QQCA 4DBXA 2VO3A 4RJ8A 4C4EA 5ANEA 4E4LA 3BWJA 3MSSA 2V7AA 2B9IA 3UVRA 5AUVA 4EH8A 3GQLA 2XRUA 4PDYA 2PMIA 4JI9A 1FPUA 4OTIA 1LEZA 2GCDA 2OO8X 3QZIA 3SOCA 2IZUA 2IZTA 4FOBA 3MTLA 5FEEA 2I6LA 3I7BA 3R30A 4BZNA 4KS7A 4DEDA 2B53A 3OBGA 2W1HA 3F3UA 1R78A 1T46A 4BCFA 4FZAB 4OTRA 4WNPA 3IKAA 3HV7A 5I9XA 3POZA 4OTQA 4P5QA 3MY1A 3OUKA 1K2PA 3QYZA 4YZCA 5IQEA 3BQCA 2I7QA 4F09A 2YM6A 3BV3A 3MY0A 5FDPA 1J7UA 4AT3A 2X2MA 3D2IA 4Y5QA 4R5YA 4M0ZA 4IAIA 3H9FA 3UIMA 2QODA 3Q3BA 4XS2A 2R3FA 4RC2A 1Q3WA 3QCXA 3GOPA 4PTGA 2XUUA 5EI8A 2EVAA 2YIQA 3MN3A 3FZOA 3D15A 2WTKB 5GZ9A 2EXCX 5LVMA 2QOKA 4CZUA 4HVGA 4YMJA 3RAKA 2WELA 2PY3A 2G01A 4KD1A 3GENA 4Y72A 3LFBA 2ZV2A 4M69A 5T68A 3G6HA 4JQ8A 3HMNA 2WTVA 4Y73A 1PXIA 2Z7SA 4FTJA 4J71A 4RG0A 5AV2A 4G5PA 4L68A 5FGKA 3E8DA 3QRIA 5HO8A 4XEYA 5HIBA 2X8DA 3U9CA 4QNAA 2ZB0A 3V6RA 2QD9A 2REIA 4IIRA 1PXPA 3EKNA 4PTCA 4DH3A 3KREA 4O7LA 1R0EA 3AT2A 3DAEA 3E63A 4YJSA 3T8OA 4M97A 4BCQA 4AGWA 1KV2A 4LMNA 3ZDIA 4WRSA 4WSYA 1M14A 3L9PA 4L3LA 3H10A 3V5WA 5D7VA 3W55A 4ENYA 2VV9A 3QZFA 3UP7A 3NIZA 3T9IA 2W5HA 5HD4A 3GU7A 3D94A 4CV8A 1JKLA 2F2UA 5IG1A 3R7YA 5EOBA 2QCSA 3OOGA 4FV7A 3S00A 2YLEA 3D5VA 4FT7A 2ITQA 5KZIA 2JDRA 1GIJA 4DYMA 4ANBA 2XNEA 3QQGA 3SDJA 4XV3A 4J8MA 3MDYA 2WKMA 3Q2JA 3LE6A 3DK7A 4EH2A 4O0VA 3PJ3A 4NM5A 2ITZA 1XBAA 1OPKA 3SX9A 3FLNC 3RKBA 2VNYA 3EFKA 3D14A 3PY3A 2V62A 4KKEA 3SKCA 3HUCA 5E8ZA 1ZZLA 2R3KA 1GZNA 3UIBA 4F9YA 2UZVA 4DFLA 3F69A 4E5BA 2C6OA 3E8CA 5D9HA 5AP0A 2X0GA 3ORPA 3CTJA 3BRBA 5DR6A 4ANNA 1VJYA 5E8SA 4HCVA 2XYNA 3UO5A 5JQ8A 3HL7A 4TWOA 1YXVA 2ZV9A 2EUFB 2X6EA 5CALA 4KIKB 2IZRA 1G3NA 3UBDA 5KNJA 5L6OA 2CN5A 3OMVA 2C5OA 3C4ZA 2HZIA 3LLTA 3TG1A 3TV6A 3ZOSA 2BRMA 3EJ1A 3ORLA 4NIFB 3LCKA 4F9WA 4PP9A 1OPLA 2R4BA 3NWWA 3UDBA 5JFXA 3NW5A 4RX5A 4TNDA 1SM2A 3RPVA 4ZEGA 2VTMA 3ZBXA 2VWYA 4JS8A 2XNNA 5CF4A 1GZ8A 1TQPA 3NUXA 3H0ZA 2RFDA 3O96A 3UZPA 4LOOA 2QONA 4YJRA 3C5IA 3NCZA 4OTFA 5AP7A 2WMVA 3JPVA 1WBWA 3HDMA 2BALA 4YURA 4IMYA 5CX9A 4M13A 2YJRA 3DJ7A 3K3IA 2YIYA 5DGZA 5AV1A 3BV2A 4NJDA 4BVUA 4RVMA 2UZEA 4ZJJA 3GI3A 2HYYA 5CF5A 2VTJA 4HGSA 5AUUA 5CZHA 4TL0A 4H3BA 3ZUUA 3ENHA 3ZCLA 4PL3A 3FLZA 3QQKA 1XQZA 2GNHA 3VHKA 3ZZEA 1FMKA 2QU5A 5ANJA 4XOZA 3CKWA 4E5AX 4E6QA 1MQ4A 1WBSA 3I7CA 3LMGA 3V5TA 4BR3A 3IDPA 3OTVA 4BGHA 1KWPA 2RFNA 4CKJA 4QP1A 3F7ZA 1H1RA 4MXZA 3OEFX 2QKRA 3P7AA 3VUMA 2RGPA 2BRGA 4KS8A 3COMA 4GT4A 3UG2A 5FM2A 3RM6A 5J8IA 2YM4A 2GNGA 5CWZA 2DQ7X 1W84A 4F7LA 5KHWA 3PVUA 4Q5EA 3FXWA 3H9OA 4FIFA 4RIXB 4V0GA 4B7TA 3BEAA 3MIAA 4OBQA 4GL9A 5CS6A 1W0XC 4J97A 2W1GA 5E8VA 3FHIA 3POOA 4FKOA 4U40A 5IMEA 2XA4A 4YO4A 3TACA 3NDMA 3L8PA 3C1XA 3MW1A 4IB5A 4K0YA 5IQAA 3EQIA 3QALE 3H30A 3QTUA 3I0QA 4XV1A 3VUGA 3KMUA 3QTSA 1H1SA 5J9ZA 1PMVA 3HMOA 5DE2A 2BZHB 1RE8A 4IEBA 3QTRA 4FV0A 3M11A 4UXQA 2XMYA 5EH0A 5I9UA 1VYZA 2J0MB 2XKDA 4E26A 4YNOA 3ZH8A 3VS7A 4EC8A 3F5XA 4OT5A 5HIEA 1DAWA 4O22A 2J7TA 1DS5A 3C13A 3V3VA 4AZTA 3CD3A 3HA8A 4I23A 1M2RA 2BRBA 4FSWA 4U3YA 4FC0A 4E4XA 1PXOA 3ATSA 4GU9A 3RWPA 3FMNA 3DA6A 4I20A 4LRJA 3VUHA 3QQJA 4FNZA 4CT2A 4F6WA 5HNIX 4MQ1A 1J7LA 4O7TA 5IQBA 1KE7A 3EWHA 3DLZA 4CXAA 4FV6A 3D0EA 4IC7A 3SD0A 4XV9A 3OT3A 4QYFA 5LMKC 5AR2A 4S2ZA 3OFMA 2OFVA 4XP0A 4CD0A 1Q5KA 4EHGA 2YM5A 4U8ZA 4P90A 3FXXA 4N6ZA 4ID7A 4TN6A 3DKFA 4BKYA 4BF2A 4DEIA 4EC9A 3FLSA 4Q9ZA 4RJ6A 5M55A 2B1PA 2CGXA 4I6FA 5IA0A 4LV5A 3U6IA 3UQCA 3FMLA 3PZEA 3A7FA 2ZM4A 4X2NA 2W96B 2PVMA 4EOPA 1M7NA 3NPCA 3R63A 1IEPA 3OCGA 4I5MA 1YI6A 5L8JA 4CKRA 5IA1A 3IS5A 3WE8A 3COHA 3GFWA 2Z60A 3C4EA 3R7OA 2GHMA 4AN2A 4DCAA 2UW3A 5CSWA 4QMLA 3S95A 4ZZNA 4KBAA 4ZSEA 5A4LA 3PRFA 1R3CA 1UWJA 2R3NA 5KHXA 3NR9A 4JIAA 4AWIA 4V01A 4S34A 2BROA 4QMXA 3M42A 4G3DA 4MKCA 1J1CA 2UZWE 2B9JA 2XVDA 4XJ0A 5AUYA 2FA2A 4C57A 4CCUA 4RFMA 4GIIA 2WPAA 4AZEA 4CZTA 1JKSA 1K9AA 3FLQA 3QRKA 4FKIA 4DH7A 3IGOA 3K54A 3BYSA 3DQXA 4FKLA 1AD5A 1OUYA 4FTQA 3PJCA 4D0XA 3UOJA 3MI9A 4O84A 4AN9A 4TWCA 5H8BA 1XR1A 4YZNA 4A9TA 5I9YA 1DM2A 2HY0A 4YPSA 2PVFA 5AUWA 4QRCA 3WIGA 4WG4A 3ACKA 3BLRA 4CNHA 5L8LA 4G31A 1M17A 4WG5A 4XOYA 4MK0A 3FV8A 1PJKA 4IX5A 3MS9A 3WZJA 2VRXA 4G17A 3CC6A 3MH1A 4DGOA 3LFDA 1HCKA 4KBKA 4KA3A 4ZS0A 1PXMA 4WOVA 5DIAA 2W1FA 1ZXEA 5C26A 2YM8A 1JOWB 2JKOA 4FX3A 5M4IA 5KMKA 4Q9SA 4FK6A 3WYYA 2VWZA 3NYVA 4F63A 1BL6A 2PE2A 3UC3A 2CNUA 2VAGA 4LUDA 5EW9A 5C8KA 3PLSA 2H96A 2W1CA 3ZM4A 4DG2E 4FTCA 3W2QA 2HZ4A 3KVXA 4Y8DA 5F95A 2WEVA 4YZDA 2LAVA 3DBCA 3W16A 2B54A 4O0TA 3NUAA 1WCCA 4BZOA 5ANOA 3P7BA 4YU2A 5ETAA 3EFWA 5AIKA 4H05A 2UZLA 5HO6A 5IISA 3N51A 4FYNA 4LMUA 3SQQA 2VWXA 3KB7A 5CASA 2YIRA 4QMYA 4GSBA 3LCOA 3OROA 2C3KA 4AA0A 3ZXZA 4ANSA 1YVJA 4ZJVA 5BVEA 4ZLZA 2CKOA 2I0HA 4FE2A 3EN6A 5JFSA 1MRVA 3EQGA 3NCGA 1H26A 3FZRA 2OJJA 3KN5A 5CU3A 4BDEA 3ZSIA 2XNGA 5HIDA 4L01A 2C68A 4Z16A 2UW7A 5HQ0A 4MNEB 3QQUA 4GUBA 5I3RA 3ORNA 2J9MA 1YW2A 2PULA 4C37A 4G2FA 2HW6A 1OZ1A 4BTMA 2UZNA 3P4KA 5L2SA 4Z3VA 2YAAA 4MX9A 4IZAA 2WMAA 4FZ7A 5LVOA 4XYFA 4YLLA 5CAUA 3C50A 2E9UA 2VTOA 3TUBA 1M7QA 3UMXA 2QC6A 3RK7A 4EKKA 4IQ6A 5GIOE 4FT3A 2VX0A 3DDPA 4PMSA 5CT7A 3RCDA 2OU7A 3ZUVA 3OCBA 2Y0AA 2R3OA 3R1NA 4EH5A 4C4GA
chains in the Genus database with same CATH superfamily
2GHGA 2RG6A 3MB7A 2E9NA 5FM3A 1P14A 2PUNA 2HZNA 1FINA 2R3IA 3MVHA 4BC6A 4BB4A 4I22A 2I0YA 1Q97A 1OITA 1TVOA 4JG6A 4NWMA 2OH4A 3R8UA 4F1TA 4A07A 3LJ0A 3LCDA 3LW0A 2QLQA 3CIKA 3VJOA 3CSVA 4P2KA 5C4KA 4AU8A 2YHVA 5DH3A 4B99A 4IADA 2QO9A 4JDKA 3KXZA 2PHKA 2UW5A 4FVPA 3FZ1A 3GC9A 4HNFA 3D5WA 4IJ9A 4QMTA 2JIUA 5EM7A 5JK3A 4Z7HA 2YZLA 5I5ZA 1IR3A 3R0TA 3G0EA 3KC3A 4IWOA 4XRLA 3RMFA 2XALA 2C5YA 4UEUA 3PXFA 3L8VA 4MNEA 3OUNB 1WAKA 4O0RA 3RNYA 4S32A 4DH5A 2CCIA 3LOKA 4W4VA 4TZRA 3H4JA 3ORMA 4QMSA 3SAYA 5JMSA 3R21A 5C9CA 2XARA 4AGCA 3R02A 2XK7A 3E62A 1LP4A 5F9EA 3CCNA 4YGAA 4FV4A 3KQ7A 3KXXA 4FYOA 3BELA 4NFMA 1XJDA 3ZTXA 4EOLA 4ZSGA 4OTDA 2P2HA 3DT1A 3EH9A 4NFNA 3ODYX 4D58A 1P4FA 2C5XA 2I1MA 4C58A 4NCTC 3HVCA 5HX8A 3BGPA 4MUQA 2HXQA 3KXNA 1OIYA 4HPUE 3BI6A 3O0GA 3I60A 2RFSA 4IX6A 4EOMA 4WA9A 4MWHA 4LUEA 2CNVA 3C9WA 4RPVA 4BWKA 4FEUA 5D41A 2JDSA 1MP8A 2R3MA 1QMZA 2FSLX 4BYIA 3FXZA 3LXPA 4IACA 3LMHA 4EEVA 4ZZOA 2RL5A 3QQLA 5CU2A 1BI8A 4IB3A 5HI2A 3AGLA 2QG5A 2WXVA 2CN8A 3E7VA 3NYNA 4RWIA 5DT0A 1W82A 2HK5A 2WOTA 2AYPA 2WTKC 1H01A 4O96A 2O64A 1NT2A 5DR2A 3F88A 3VF8A 4O4EA 3LCSA 3BWFA 2XBAA 3UG1A 1O6KA 3AMAA 2XKFA 3KF7A 4IVAA 4ERWA 2JC6A 4OUCA 5JRQA 2OH0E 3TUDA 4NL0A 1GIIA 1JWHA 2X0OA 3MFTA 4UWCA 1SNXA 3T3VA 4EOSA 5IEXA 5LVNA 4GT5A 2CDZA 2XK8A 2R3HA 3FHRA 3O17A 2J0KA 2X2LA 2JEDA 2X4ZA 2GS7A 2WZJA 3R1SA 5EDRA 4QMMA 5BVNA 4R5SA 4BDAA 2Y9QA 3W2SA 4S33A 5CQUA 5KMIA 3SXFA 4TYHA 2QI8A 1ND4A 4YR8A 4HVDA 4P5ZA 3QRTA 3KMMA 4PDSA 4AE6A 2OIBA 4FA2A 3K2LA 3MPAA 4IWDA 3DFAA 3Q32A 3E5AA 3MPTA 4O0YA 2CKQA 3WIKA 5L2QA 3Q9WA 5EDQA 2WOUA 2V0DA 4N6YA 1ZARA 1BLXA 2G2IA 3CS9A 2VTRA 3BZ3A 3ZO2A 4ANQA 4BWXA 2R5TA 5CENA 2GMXA 4JBOA 5E1SA 3OTUA 4RX7A 5CZIA 5E8XA 5BUEA 1JAMA 3R22A 4QYYA 4EHZA 2QQ7A 3VNTA 1QL6A 3IECA 3UNZA 5HESA 2BZJA 4IZ7A 2FVDA 4HVSA 1OKVA 1H27A 2A19B 2PVLA 3CQWA 3FAAA 4M14A 4AA4A 4CMTA 1OI9A 2VWBA 4UYAA 3VUKA 4A9SA 2OG8A 4DEEA 4EK5A 4GRBA 3AC1A 4J53A 5CSHA 4AOJA 3LPBA 3C4FA 1XH5A 2UUEA 4C3PA 5JEBA 4UMQA 3LFEA 3ZM9A 2R2PA 2BIYA 4KRCA 2W1EA 5AP2A 4FKRA 4ALUA 3OBJA 4BFMA 3VBQA 3NLBA 3VQUA 4UALA 4YBKA 4O0SA 3FE3A 2AEGA 5FUTA 1PYEA 1W83A 4EJ7A 3TEIA 1H0VA 4X2KA 3OF0A 3EYHA 3GCVA 4QPAA 4IBMA 5KMJA 4AACA 4IM2A 5D12A 5FLFA 5DA3A 1DAYA 1ZLTA 4HZSA 2PZ5A 3OHTA 4O6LA 4FNWA 3TNQB 4ZOGA 1YHSA 4L7SA 2GHLA 1JSTA 4L45A 3QTWA 3ET7A 4NSTA 4D55A 3PFYA 4YZBA 3PP0A 4HGLA 3SRVA 4EOJA 4R8QA 2PZIA 1OL5A 5FXQA 4J95A 2XJ2A 5IZFA 3EQDA 3PA3A 2HELA 3E3PA 3FZPA 1R0PA 4E4NA 5IMXA 4FF8A 4E8AA 3BLQA 2FYSA 4C7TA 3HMIA 1MUOA 2A4LA 4RSSA 4DTAA 3TT0A 5A46A 1UVRA 3U87A 1IAJA 4BBMA 3KMWA 1PKDA 4YHFA 3JY9A 3MPMA 2VUWA 3M1SA 4WT6A 1HOWA 4RVKA 2IW8A 2XKCA 4MVFA 2YZAA 4TYHB 4YSMA 1OVEA 3RHXA 1FGKA 2E9VA 2Z2WA 3QFVA 5KCVA 4LGHA 4G6LA 3NRMA 4D0WA 4I0RA 2R9SA 2ZYBA 4R1VA 1KOAA 4X3JA 3PXQA 3EN7A 4R3RA 1WVWA 5BYZA 2CCHA 4C62A 3C0IA 2P55A 4YTHA 3CY3A 3Q9ZA 4TWPA 4B8LA 2UZOA 2ZM3A 4L8MA 5CAOA 4AP7A 4EWQA 4PDOA 1KE5A 4LL0A 5CNOA 4MCVA 3F5GA 1NVSA 2YCQA 2ACXA 4RQVA 4CG9A 4JOAA 4UV0A 4BDFA 3DS6A 5BUIA 5CAVA 3DB8A 4WG3A 1Y6AA 1FVRA 4EOQA 2XJ1A 2WTIA 4X6QC 3PG3A 3COKA 3ZU7A 3R2BA 4AUAA 5DNRA 4D4YA 1A48A 4RX9A 5AR5A 4IZ5A 3UVPA 4MXYA 5ITAA 4EBWA 1TFFA 3A60A 3FLYA 4KWPA 2PVKA 4IVBA 3QKLA 2WIPA 2YIWA 2IZSA 3UZTA 1ZYJA 3VS6A 3MFSA 2NRYA 3QHWA 2ITNA 4XP2A 4GT3A 3LQ8A 4TT7A 4EOOA 2VTIA 3ERKA 2BKKA 2PVYA 3VO3A 3RHKA 3TKUA 5J7HA 2WHBA 3C51A 4D9TA 4E1ZA 2NO3A 3L8XA 3A4PA 3U4WA 2V22A 3GCSA 4A7CA 4PP7A 2QOHA 3PG1A 3QD3A 3QLFA 1TQMA 3W0SA 2XM9A 3NNWA 4K33A 4DA5A 2VWVA 3ALOA 1LPUA 2BAKA 3IQ7A 4WKQA 2R0IA 3QX2A 5HNGA 1ZYDA 2ZDUA 2VGPA 3AT4A 4C02A 2C3JA 3P23A 4MD9E 2UW0A 5HE2A 3G33A 3RNIA 3TDVA 5KO1A 4O91A 2IG7A 3KXGA 3FMMA 4UY9A 4N70A 4B9DA 4FBXA 4MBIA 4I4EA 4Y5HA 4GYGA 1E1XA 1UNHA 3V5PA 3QA8A 2G2FA 2Y4IC 3ORZA 5KUPA 4B6LA 2VNWA 3FC1X 1BL7A 4X21A 5EHLA 5J95A 4E93A 5D10A 3II5A 4MD8E 2VO7A 2RF9A 1G8JA 2KTYA 3CPCA 3UPZA 2BTSA 3ZO4A 5AAEA 3TTIA 3DZQA 4FNYA 5BX0A 5DG5A 4RBLA 3JR1A 3AXWA 4DHIB 2HIWA 4O38A 3NSZA 4Y46A 4BHNA 4RWJA 4ACDA 4XG8A 4ANOA 2QOOA 2YEXA 4PF4A 2BHHA 3KGAA 2X7GA 4FV2A 4E6CA 5M4CA 3DPKA 4XG3A 4DLIA 3TYKA 4PPCA 3QL8A 5HNBA 5K9IA 5L6WL 1G5SA 3PSBA 3DK3A 4DGNA 4QDVA 1GJOA 5IKWA 2IW9A 1KE9A 3MV5A 4QTBA 3PY1A 3ORTA 3WF8A 2OBJA 3AC3A 4M69B 4FTLA 5AR7A 1UKHA 3P0MA 3NUNA 3PY0A 2PMLX 3HV3A 4CFMA 4EZ7A 4ZLOA 2R7BA 4X3FC 3IOKA 1LR4A 2X81A 4I0TA 4FSTA 1V0OA 3TWJA 4BIBA 3KU2A 1W7HA 4E5WA 4R3PA 4AOIA 2QR8A 4RC3A 4WNMA 4CFVA 2Y7JA 3EIDA 4IAYA 2FSMX 2VTSA 5TT7A 3U8WA 2HCKA 3OS3A 1ZWSA 3HV5A 5CVGA 4XG7A 5KZ0A 2XEYA 2YM7A 4I6HA 1IASA 4FIEA 3SV0A 2UZTA 1GZOA 4HJOA 2UZUE 2XCKA 5JGAA 5IA2A 4ZMEA 2AQXA 1ZOGA 1FGIA 2GNIA 3OY1A 3OW4A 2R64A 2Z7LA 3SOAA 2WMWA 4H3PA 3G15A 3TCPA 3KRLA 4FUYA 1YXTA 1YOMA 4J96A 5BQ0A 2W9FB 5EYCA 4DDIA 5DRDA 3F3ZA 3KCKA 2IVTA 3IW8A 3R04A 5LVLA 3OC1A 3ZFMA 3FPQA 1R1WA 2WMSA 3NZ0A 4IDTA 4USEA 4JX3A 2R3JA 3GQIA 5TR6A 5KX8A 4C2VA 4O7VA 2XIZA 5EK7A 3DKGA 3FKLA 3QWKA 3AGMA 4MBJA 4C61A 1KV1A 3BKBA 2C30A 1XH4A 3WILA 4F0IA 3MYGA 4YPDA 2XM8A 4DGGA 3AD4A 4FKQA 5JGDA 3U6HA 2BRNA 4FZ6A 3NVKI 4BKZA 4A06A 3QXOA 4X3FB 4C35A 4GU6A 3OZ6A 4RLLA 4AZVA 3HV4A 4FZFB 2R0UA 4IDVA 4J98A 3UNJA 4YSJA 2WQBA 4J7BA 1UWHA 5HVYA 4YJUA 2QO2A 4LDTA 4DEGA 3TZ9A 3IW6A 3O8PA 4FGRA 2BFYA 2C3IB 3MFRA 4QPSA 4U97A 4U9AA 5JFWA 2F7EE 2WTJA 3MVMA 4Q2AA 4NK9A 3PJ8A 5EM6A 4Z55A 4QDEA 3FI3A 5C4LA 3GEQA 1BMKA 3CBLA 4AZSA 4FIGA 4OTWA 5IF1A 2GTNA 3GU6A 3EFJA 3OCTA 4DLJA 2J5FA 3FL5A 4BCIA 5D11A 4ZY6A 5I9ZA 4XBUA 2PUUA 2J0JA 3W18A 1WFCA 4F4PA 2OZAA 2UW8A 2GU8A 4ZTLA 2PVRA 3UYSA 4ANMA 3UIXA 3NAXA 5A6OA 2PMNX 3ZC6A 2JIVA 3SVVA 3ZSGA 2B52A 4QOXA 4NH1A 2OK1A 4UB7A 5HGIA 3AD5A 3LFQA 2AC3A 3BHUA 3F3TA 3KRXA 4C34A 4CVAA 5M56A 1QCFA 4ZIMA 2YDKA 4IVCA 2ONLA 5ETIA 2F9GA 2Y8OA 3HRCA 2ZV8A 3H9RA 4KBCA 2ETKA 4WD5A 3P5JC 4ZMFA 4RMZA 3OEZA 4LM5A 3AMBA 3NS9A 5FG8A 3Q2MA 4CTCA 4V04A 2GPHA 2OZAB 2VTLA 3HEGA 4U45A 3WF6A 4EYMA 4KABA 4UMPA 4ZTHA 4XG2A 4FK3A 5HTBA 5K5XA 3BGQA 1BX6A 2YA9A 2HENA 3HRBA 5HG9A 3UE4A 2ZJWA 4QMQA 5AFVA 3Q04A 3HGKA 4IWPA 5C03A 4HZRA 2PPQA 3V8TA 1YHWA 4BI2A 1UU9A 2RIOA 4I0SA 3TZMA 3IK3A 3F2NA 4G3GA 4GG5A 5IEYA 2BDFA 3PWYA 4O82A 2VWUA 4JNWA 4LYNA 4WBOA 4DINA 4F0GA 4UN0C 3FMEA 2C6EA 3R1QA 2C4GA 4WO5A 2XNPA 2O5KA 5DT4A 3EQHA 3PJ1A 3OWLA 3ALNA 3W2RA 5BNJA 3EOCA 3W1FA 3UJGA 3R8VA 4H1MA 1JKKA 4EZ5A 5LJJA 4ORKA 4GFGA 3EQRA 2ETMA 4YP8A 3EHAA 1OL1A 5T6KA 4X3FA 2VO0A 4E7WA 4U41A 3ZYAA 5CEKA 4QEBA 1SMHA 4YJNA 5FQDC 4CMOA 4WNKA 4ENXA 2C0IA 3ZXTA 4LRMA 4JXFA 4B4LA 4O1PA 5B2MA 2WTCA 2JDTA 4CYJA 4C38A 5CXZA 5HU3A 5F94A 3K5VA 1ST4A 4ZJIA 3LJ1A 3NGAA 3TN8A 1V0BA 5F1ZA 2WEIA 4WRGA 4G3CA 2YABA 4MQ2A 4XG4A 4B8MA 4K9YA 2PVNA 3EMGA 5EYMA 3NNVA 4RIXA 3QRUA 3DNDA 4IWQA 4ZSJA 4UMRA 2WMUA 3PE1A 3GFEA 2YDIA 5HLNA 3FWQA 4IAKA 4DCEA 5LMBA 3PIYA 2W17A 2RSVA 2AUHA 4FOCA 3QUDA 4YJOA 4QTEA 4AXEA 5EI2A 1U5RA 2UVZA 3A8WA 1YDRE 5ETCA 5E9EA 3C7QA 3EN4A 2OWBA 3ZHPC 3UDTA 5L2WA 2WB8A 3NX8A 4DEBA 2XCHA 3PRIA 2XYUA 4TW9A 4C33A 5J9YA 1Q41A 3HV6A 3QCQA 3D9VA 5AV0A 3R8PA 5IH5A 2A27A 5JT2A 3CQUA 3ZBFA 3FMKA 2C6DA 3QD2B 3CD8A 4FKWA 4O0UA 3F5UA 3QTIA 5KMMA 3KIOC 3TM0A 3D4QA 2UW9A 3CY2A 1PMNA 5HEZA 3S3IA 3W33A 2PL0A 2BRHA 2JKMA 1FVTA 1XH6A 3LFAA 3TV4A 2YERA 3R83A 5E7RA 1UU3A 4IH8A 1M52A 3UP2A 3HMMA 4GS6A 2VWIA 4L53A 1CKIA 4OR5A 4YBJA 2B0QA 2DWBA 3RPOA 4AN3A 1UU7A 1IRKA 4JQEA 3VBTA 3BGZA 3CPBA 1ZZ2A 3IGGA 4V0GB 3ZO1A 3U9NA 5AA9A 4GVAA 3LJ2A 5E92A 4F6UA 3O50A 4R7BA 2DYLA 5DYJA 2NYAA 4DE4A 5DPVA 3PXRA 1IA8A 3OXTA 3E92A 2P4IA 4FG7A 2XNBA 3TI1A 4PY1A 1RDQE 4M67A 2IVVA 1J7IA 2VN9A 4JDJA 5HTIA 5BVOA 5J1WA 4ALVA 3MIYA 1TKIA 4NTSA 1ZRZA 1OKZA 3BBWA 3U55A 2UVXA 2W4OA 4AS0A 2FGIA 2NRUA 3G51A 4OBOA 2XEZA 2QHMA 4MAOA 5AIRA 4LV7A 5HG5A 3Q53A 2R7IA 4FV5A 2X39A 3QKKA 1F3MC 3I1AA 1XMMA 3V5LA 3QU0A 1QPEA 3A7IA 2QURA 2ITYA 1YI4A 1AGWA 3VBXA 2O0UA 4LV8A 3TL8A 3DBDA 1L3RE 5FTGA 4II5A 4ZXTA 2IO6A 2JKKA 2OXXA 5HCYA 3SXSA 4DFNA 5HLWA 2O63A 3KFAA 3R28A 4FSZA 2NNWB 4I6QA 3RZFA 3DQWA 5KBQA 3DCVA 4FKJA 4K1BA 3S4QA 2WQOA 3BU5A 5CEPA 2CJMA 1YRPA 3KXHA 4S30A 2RG5A 5DMZA 2X1NA 4M3QA 4APCA 3FY0A 3W2CA 4D2PA 3A8XA 2XBJA 3QTXA 5E8UA 1Q61A 4ASEA 3P7CA 4HPTE 4KSQA 3A4OX 5GHVA 4Y85A 3MH2A 2WFYA 2YACA 4PPAA 1H1PA 2WTDA 4CFWA 4R78A 4PDPA 4O6EA 5IDPA 4ACMA 3FEGA 3W0NA 3W32A 3ZC5A 4OTPA 5L6PA 3L1SA 1UNLA 5AUTA 3GP0A 4KAOA 1M2PA 3LAUA 3NW7A 3VS2A 4M7IA 3UIUA 2BIKB 3AKKA 3DXQA 2F2CB 5AP6A 1Q8WA 3FSFA 4QYEA 4QP4A 2YCSA 4YTIA 3C4CA 1DI8A 3UQFA 5CVHA 5EM8A 5M07A 1APME 5L4QA 3KF4A 3L9LA 5FP6A 5J87A 3WZUA 4AQCA 3UO4A 5IQHA 2WQMA 2A1AB 3KA0A 3CXWA 3OT8A 4BI0A 5I0BA 1PXLA 2JITA 2OXDA 2UZDA 4RZVA 4X2FA 1UNGA 2OXYA 2KULA 3MH3A 4MF1A 3O7LB 4TYEA 3Q4UA 3F9NA 3MJ2A 3O23A 4HCTA 3RAWA 3JVRA 2PUPA 1Q8YA 4JRVA 5HD7A 4TKSA 4ANLA 4G9CA 5GZAA 4NYEA 2QU6A 3BIZA 4TY1A 3S0OA 3IDBA 4BJJB 4MBLA 2W9ZB 4XX9A 1I09A 3D5XA 4GYIA 1PHKA 2PE0A 3LFNA 1H8FA 2R3LA 5C8NA 2JKQA 4D2VA 4UZHA 4U42A 5DVRA 3FSKA 4IB0A 4EH4A 4FMQA 4BCNA 3HLLA 4QP3A 5IQGA 4NU1A 4NEUA 2GS2A 4DAWA 3FMHA 3ZDUA 5KKRC 1MRUA 4NM3A 4XLVA 5HKMA 1REJA 3GUBA 5LARA 3VF9A 3A7GA 4PV0A 2OF2A 1Z57A 4JDIA 4E6DA 4FL3A 2RKUA 4QMNA 5GINE 5EW8A 1KOBA 1Y91A 4OTHA 4PNIA 4KKGA 3W2OA 1NW1A 1NY3A 1ZY4A 3BE9A 3TUCA 4C0TA 3ZONA 3AC8A 1WBNA 3PLAE 3SRVB 1ERKA 4LI5A 3QUEA 4UYNA 3OG7A 3ZFYA 3QGYA 3KKVA 5IDNA 3F3VA 4I4FA 4JJRA 2OZOA 5I9VA 4D28A 3QC4A 4X7QA 3BL7A 5F20A 5ICPA 1YWRA 3PIXA 4RT7A 3R7VA 4OTGA 4AZFA 4B0GA 2W0JA 4HGTA 3R9DA 4TRLA 3F3WA 5EHOA 4XNEA 4D2TA 4EOKA 1ZMVA 4FV1A 5LCKA 2J51A 3QZGA 5BPYA 5CEMA 3PP1A 3HAMA 1YDTE 1B39A 2JBPA 1FQ1B 3GC0A 4NJ3A 5CU4A 3DK6A 4CZYB 3N4VA 1YKRA 2E9PA 3Q4ZA 2WD1A 1XH8A 2XS0A 3PPJA 4KINA 1Q24A 4LRKA 4F99A 3C0HA 3VW6A 4XP3A 4DH1A 4D1SA 4HOKA 4BN1A 2C6IA 3BHHA 1U5QA 2GDOA 3N4UA 3VW8A 4C4FA 4PL4A 3T3UA 4TTHB 3EL7A 3P86A 5HU9A 4QQJA 1JVPP 1ST0A 3PUPA 3S1HA 3N4TA 3V04A 2FB8A 2A98A 1SNUA 3DY7A 3MGYA 5HHWA 3UOKA 1ZYCA 4EQCA 4USFA 4BCGA 4XRJA 5FRIA 1H1QA 2B9FA 4J8NA 4O2ZA 1EH4A 2H6DA 1HCLA 3DAKA 5CF6A 4RGJA 3QTQA 4PRJA 5CU6A 3HP5A 4AZWA 5CSPA 3D5UA 5L2IA 1I44A 3HRFA 4RFZA 2VTHA 3VS3A 5C01A 3QYWA 3PIZA 1PRYA 5JN2A 3LXKA 2B9HA 3KCFA 4DBNA 3CR0A 3GU8A 3DNEA 2C6TA 3Q5IA 4DEHA 3IW4A 3VWAA 4ZP5A 4AT5A 2C3LA 2P2IA 3EYGA 3C4WA 4BCMA 1L8TA 3KEXA 3E64A 2J5EA 4X0MA 2ETRA 3PDTA 3VS1A 2OW3A 2VTAA 5E1EA 3BU3A 4FTOA 4RVLA 4YC3A 3LXLA 4EK6A 2WMXA 4AG8A 3VN9A 4O7RA 3EQFA 3I6WA 2ESMA 3RAHA 2QO7A 3ODZX 4DT9A 4FL2A 3HAVA 4JR7A 1Y8GA 4GJ2A 3VS0A 5A4QA 1URWA 2ONLC 3G6GA 2UZBA 3ITZA 1W2CA 4D2SA 3LLAA 5HORA 3IPHA 4LOQA 3I5ZA 3QAME 3TKIA 2PMOX 4LG4A 5AADA 5M06A 2XIRA 4O7SA 2BKZA 4E73A 1KE8A 4GH2A 2Y6OA 3FQEA 5I4NA 1IG1A 3BCEA 4I6LA 4FSQA 2X4FA 2Y4IB 3ZLYA 4HVIA 2OKRA 2Q0NA 3KULB 4Y83A 3R9NA 3TXOA 4CGAA 4W4YA 3V51A 5DEYA 2O2UA 4O2PA 1IAHA 3VBYA 3CE3A 3EQCA 4FI1A 2R3RA 5JZNA 3Q5ZA 3KY2A 3HMPA 4G5JA 1NXKA 4R7IA 1IA9A 3W8LA 3R01A 1SVEA 4O7ZA 3EZVA 3Q96A 2C0OA 2ZAZA 4FTKA 2PU8A 4BI1A 5CTPA 4XUFA 3A2CA 3RCJA 3SC1A 3HX4A 4C4IA 5K4IA 2WU7A 4RA4A 2CPKE 1YOJA 4FEWA 5HCZA 4RIYA 1XKKA 3E8EA 3QTZA 2X9EA 2CGWA 1B6CB 5AV4A 2X6DA 3RP9A 3U4UA 3VIDA 4GVJA 5BVFA 1YQJA 1WZYA 5L8KA 2ZVAA 3TZ7A 5AEPA 4DHJA 4BY9E 1KUTA 4USDA 5AJQA 3ZEWA 5ANIA 3VS4A 1PKGA 4BCJA 1R39A 5LWNA 2X7OA 3ZS5A 1A06A 1H24A 1NVQA 3AG9A 3Q6WA 4R7HA 3V8WA 3BHYA 5J79A 3C4XA 4OLIA 5CF8A 4BDHA 2PSQA 2VTTA 5AP5A 5AAFA 5A9UA 3NUPA 4FTIA 4WHZA 4YHJA 3VRYA 2XIYA 4QMOA 4BL1A 3FY2A 2AC5A 3GC7A 5EQEA 5EHYA 5H9BA 3SW7A 2ZDTA 2C5NA 3NNXA 3KRWA 4L42A 2I0VA 5HCXA 3EQBA 4BWPA 3NAYA 3ID6C 1GY3A 4ZTMA 3ACJA 5EQYA 2BUJA 5HE0A 4TPTA 2OI4X 3S2PA 3PPZA 4QP9A 4FIHA 3TZ8A 3PA4A 4I21A 4JMQA 4D2WA 3F2RA 4LFIA 5M09A 4I5CA 2GS6A 1OM1A 4IAAA 3ULZA 2JGZA 3V8SA 4L9IA 3V5JA 5B7VA 4M0YA 4D4SA 4AXAA 1AQ1A 4UBAA 3VBVA 1UV5A 4ZTSA 3UYTA 4XV2A 3D7TA 3PXYA 4YO6A 4RZWA 3VUTA 5HO7A 1MRYA 3DKOA 2I0EA 1G8SA 4JBPA 4BTKA 5DT3A 3UNKA 5EYKA 2FO0A 3R2YA 1Z9XA 3FZTA 1OIQA 3EN9A 3I0OA 4FUXA 4HYHA 4RA5A 3UQGA 4DFXE 1LUFA 4JQ7A 4FICA 4F6SA 5HLPA 3T9TA 4MXXA 3FZSA 5FXSA 3AOXA 3IW5A 3HA6A 2BAQA 5AV3A 5C8MA 4BTJA 1CKJA 5DEWA 4NW6A 4CFUA 4ZTQA 2BDWA 1S9IA 4YUQA 2PZYA 3W10A 2B4SB 2EU9A 1M2QA 4TXCA 2EXMA 3PWDA 4Q5HA 3F66A 5CYIA 4L43A 1CMKE 3PVBA 4H58A 4CYIA 3R00A 5J9LA 4ASZA 4R1YA 1G8AA 4JL9A 3QBNA 5DR9A 5HBHA 3GU4A 2YDJA 4O4BB 4FT5A 4YTFA 1JNKA 3R9HA 2F57A 4G34A 4FEXA 4ASXA 2XB7A 1WVXA 3D7TB 1NA7A 3K3JA 4KSPA 3W0QA 4CKIA 4GUEA 3F2AA 1DI9A 5EW3A 4ZSLA 5LMAA 3DKCA 3LHJA 4FEVA 3EKKA 2PE1A 4EJNA 4IW0A 3Q60A 2BVAA 4N0SA 5DI1A 4FSMA 5AP4A 4WUAA 3ZSHA 2GNLA 4HW7A 1OKYA 4M15A 3SLSA 3WZKA 1PXKA 2V5QA 5AX3A 4AQKA 1G8KA 3O51A 2UW6A 4E4MA 5LVPA 5EDPA 4D5HA 3WF5A 4KIOA 2J90A 3R9OA 3A62A 2EWAA 2G15A 4HYUA 1TZDA 4WSQA 2VX1A 4JG8A 2ITTA 3CJGA 4YLJA 3OCSA 5HX6A 2P33A 4JRNA 3Q9XA 3DTCA 4FIIA 4FKTA 4FV3A 3MTFA 4DFZE 4AW5A 4NM7A 4BIDA 5JRSA 4ACCA 3TIYA 1W98A 2GNJA 3DJ6A 1OL2A 2J0LA 4MH7A 5EG3A 4DGMA 2HXLA 1WBTA 4JG7A 3WYXA 2OIQA 3UOHA 2QG7A 3IO7A 2PVHA 2W5BA 3NW6A 4K18A 4QMUA 5CLPA 3RAIA 3R73A 5FTQA 1XWSA 5HBJA 4CLJA 1GIHA 3P08A 3KL8A 3C5UA 4FTMA 1MQBA 2PZPA 4IXPA 2OIDA 5FD2A 4FSUA 5FDXA 2WU6A 4J99A 1ZOHA 3E8NA 4OW8A 5KMNA 4WIHA 2G1TA 3VS5A 3RM7A 4MTAA 1ATPE 1J91A 4FTNA 3DAJA 4AAYA 3G0FA 4YHTA 3W2PA 2J4ZA 2JBOA 4OAUC 3SG9A 2HWOA 2R3QA 3IONA 3FJQE 5KKRB 2BHEA 5DBXA 3O71A 5TKDA 5HBEA 5EQPA 4MNFA 3QA0A 3I4BA 2WAJA 4O0WA 5AA8A 4WUNA 4QTCA 2YCFA 3GCQA 4FR4A 4AA5A 4PQNA 3BLAA 1GOLA 1Q99A 2OF4A 3MH0A 3PXKA 2O3PA 3DZOA 4O27B 5J5SA 2UV2A 4HYSA 1RJBA 4NUSA 3A7JA 4BBEA 2GQGA 2YWVA 3IG7A 3MWUA 4K6ZA 5LOHA 2JLDA 4E3CA 5A54A 4L00A 4DG0E 4GKIA 4FEQA 4OGRA 4F7NA 3PE2A 4H3QA 5IA4A 4EUUA 3DXNA 4AGDA 4OAVB 4DN5A 2ITXA 5ETFA 2XK4A 3IOPA 3EFLA 2CSNA 2F49A 4ZTNA 3R9RA 1QPCA 2F4JA 2VX3A 4M12A 4I5HA 3VAPA 3ENMA 1Y57A 4YZ9A 4RJ3A 4UX9A 3RK5A 1ZMUA 3OVVA 4FTRA 4RJ4A 4J1RA 5J5TA 3QUPA 5JSMA 3I81A