2X9FA

Ephb4 kinase domain inhibitor complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
281
structure length
265
Chain Sequence
KEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 3: Identification of Non-Benzodioxole-Based Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 265
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x9fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x9fA01
5FBNC 3CE3A 3EYHA 4GJ3A 1PXIA 4CZTA 4YNOA 3DAJA 3FI4A 4ZTSA 3VS7A 4QP4A 4XS2A 1KOBA 5TOZA 4CXAA 2UZVA 3P5KA 4ALVA 2GSFA 3PE1A 3F61A 3UPXA 2YHVA 3R6XA 4U42A 2IJMA 3UP2A 3ZFMA 4BIBA 4BGQA 4QP8A 3ORZA 5LQFA 5CAVA 5M4IA 2YIXA 2B0QA 3ZO4A 2Z02A 3WILA 5CAOA 1SNXA 3GCQA 4DN5A 1QMZA 1WBTA 2E9VA 4GJ2A 3OXIA 4EH5A 2ZM3A 1JKKA 2UZDA 5JFSA 3H4JA 4X3FA 3CD3A 4E73A 2YIWA 2C3KA 5C27A 3KXGA 2PL0A 2VZ6A 3U9NA 2J0MB 3ORMA 4EI4A 2WTJA 4F9YA 1L8TA 5HIBA 4FV3A 1BI7A 2OZAA 1OIUA 2X2LA 3RI1A 5L2WA 4TYHA 3R2YA 3FQHA 3BGZA 4J98A 5J9ZA 3VUTA 2GQGA 2R3NA 5HCYA 4GIIA 4ZTRA 4HYIA 2XNOA 4RWLA 3ZMMA 2XKDA 4AZEA 2RFEA 5F20A 4DTKA 4OTGA 3GB2A 2HYYA 3CTQA 1YXSA 3P4KA 5TR6A 5AAGA 4O21A 3DXQA 3U87A 1BLXA 3BYOA 1R3CA 4QOXA 4YZCA 5HG9A 2OF4A 4BYJA 3BCEA 3FXWA 2FB8A 4NM3A 5F95A 4QMQA 4FT9A 3FLYA 3PXQA 2B53A 2W1HA 4E5BA 1PKDA 3KULA 3W2SA 5IUIA 4D5HA 1PYXA 2VO6A 3O8PA 1ZXEA 1NVSA 2W1IA 1FOTA 3CJGA 5FEQA 4AW2A 4D0WA 4HVHA 4NW5A 2BFYA 4MYGA 1LP4A 2HAKA 3R8LA 4DLIA 1H0WA 3PG3A 4I6QA 3UVPA 4CQGA 3W1FA 1H1RA 4PDYA 3QTUA 4E4NA 3Q60A 3NAXA 4FL3A 3Q5IA 4OBQA 4YSJA 4Z3VA 2BZIB 3EJ1A 2C3JA 3NVKI 5LJJA 5M08A 2W4JA 4C34A 2QO9A 5H8BA 3GCPA 3VBXA 4MBJA 5A14A 1B6CB 4IC7A 3TZMA 1JSVA 4BDHA 4FSZA 3N4TA 1M7QA 3D2IA 3DS6A 1TQIA 4EH3A 3NUPA 4CG8A 3QXOA 4X6QC 1SYKA 1XH7A 1M2QA 2AUHA 2WMUA 2OJFE 3DDQA 3NLBA 1A9UA 2PUUA 4FSYA 5I9XA 3LCKA 4OTIA 5E4HA 3HL7A 5HE2A 2AC3A 3MB6A 4D2RA 4Y95A 4RC3A 4UWBA 2ZJWA 2OWBA 4AGDA 3EB0A 3AC4A 4FEVA 2ITQA 2FUMA 4H3PA 4IVAA 5CSWA 3LCOA 4JR3A 4NTTA 4YJTA 2GHLA 3UVRA 5AV4A 4NU1A 3WZKA 4PPCA 5IA4A 3FHRA 2Q83A 3IS5A 1JSUA 3BU3A 2PVRA 1U59A 1UNGA 4OTHA 2I1MA 3TI1A 4ASXA 1Y57A 3D7TA 5E8WA 4AGWA 4E5WA 1YXVA 1GIHA 2XKEA 4BI2A 3FEGA 2QLUA 4XV1A 4Q9SA 4EOPA 4O0WA 2B55A 3NYXA 3AT4A 3E93A 2VTQA 4I24A 2HY0A 5HCZA 2PVLA 4IB3A 3ZLSA 4RVMA 3A4PA 4XV9A 5E8VA 3V5TA 5A6OA 4IW0A 3I1AA 4FKOA 4A4XA 4CTCA 2IVVA 3ORNA 3CXWA 4MWHA 2XMYA 4QNAA 3SX9A 4B99A 3LFBA 4TKSA 3HGKA 5EOBA 4FV4A 5DR2A 3VQHA 2A4LA 3S0OA 4FEQA 4XJ0A 3UIMA 3OC1A 3RZFA 3HZTA 4EH7A 4YO6A 4U6RA 3GEQA 1MP8A 5DRDA 3KRJA 2ZMDA 5G6VA 2UW4A 4FTKA 3UE4A 1ZRZA 5AMNA 2RFSA 4GU9A 5D1JA 1KV1A 3ZHPC 1FPUA 2W7XA 1FVTA 2WFYA 4IEBA 2C69A 5EW3A 3TV6A 3OVVA 4ACCA 3ZM9A 2WMRA 2YM4A 5JZJA 3T3VA 3LM0A 2I0VA 3R7IA 4OTPA 2V62A 3Q4UA 5HNIX 2XF0A 5M51A 5CF8A 4JBVA 5CS6A 3DTWA 3WE8A 4MBLA 4RIYA 5M06A 4WBOA 1P14A 4BWXA 3CCNA 3L9LA 4XG2A 3HYHA 1ZMWA 3Q52A 1STCE 4HGLA 3E92A 3W8QA 1JBPE 4DH5A 4DFBA 4EK8A 2WTCA 3GGFA 1H26A 4FKQA 4FBXA 3H9OA 3FXXA 4FTCA 4X3FB 5DT4A 5IZFA 4FEUA 3ID6C 3EQRA 2C6TA 2IWIA 3QALE 4RIXA 4L43A 3P9JA 2EB3A 2W9FB 4JRVA 4DGNA 4EOJA 3NIEA 4WG3A 4OAVB 4KUJA 3ZYAA 5CENA 3BHHA 4HZSA 4U7ZA 2BMCA 2CKQA 2GFCA 2JKMA 3KMUA 3WI6A 3AMYA 1FGKA 3C0GA 4IAFA 4KINA 4O0UA 5FGKA 4GKHA 4DT8A 3IDBA 1ZYLA 3QUEA 3RPRA 4BL1A 5IA5A 5J5TA 1O6LA 4EHEA 4HW7A 2VNWA 3ZFYA 2JIIA 4LOPA 2PMLX 3V8WA 2F2UA 4A9UA 3ZZWA 2ETKA 4CFMA 5I9VA 4ANLA 2SRCA 1CKPA 5E8UA 1IA8A 1ATPE 4G3GA 2LAVA 4FTQA 4CVAA 2QOOA 3MB7A 4OTWA 4FT5A 3WF8A 3EQDA 3BGQA 4DE4A 4YR8A 2X81A 3DLSA 3LE6A 4OUCA 3WYXA 3R30A 5DIAA 4AOTA 4BCMA 4DGOA 5IEVA 3KC3A 3HUCA 4RQVA 3HV6A 5HESA 1H01A 1YI6A 5BUIA 2J4ZA 2XRUA 3BPRA 1O6KA 4W9WA 5E92A 5AUYA 4QP7A 2YAKA 4FKWA 5T6KA 4MEDA 3FMDA 4F70A 4ZTNA 5IMXA 2PYWA 2A19B 3IGGA 5IPJA 1JKSA 3R9DA 1UKIA 2VWWA 4AA5A 2DQ7X 2QOHA 2DYLA 2IZUA 3RWPA 3ZRMA 3Q2JA 1LPUA 3DKOA 1WBNA 4TT7A 3MFTA 2GNGA 3Q53A 1YVJA 2X7OA 3UDBA 4D2SA 4UYNA 5EQPA 2P2HA 3DZOA 4MBIA 2C0TA 3Q04A 4X0MA 3Q5ZA 2GQSA 3HV3A 4OLIA 4YJQA 4NCTA 5HGIA 4EBVA 1J7LA 3FKOA 3MH1A 3SC1A 3F5XA 4FIEA 2IG7A 3U51A 4B9DA 1GZOA 3L8XA 4CT2A 5AFVA 5GINE 4TXCA 3M11A 5GIOE 4RC2A 3FPQA 3H30A 1PXPA 1IAHA 3CJFA 3CS9A 5M57A 2FO0A 3MYGA 3QHWA 4IZ5A 3VC4A 1JAMA 4KIPA 1I09A 1PYEA 3P7AA 1G8AA 3LJ1A 2F49A 3HMIA 1BKXA 2B9IA 4FUXA 4TWOA 5GNKA 3PJCA 4IX4A 4M69A 5IISA 5A4LA 4MK0A 5HICA 5DYJA 4M97A 2BHEA 3MDYA 3DBEA 5BVEA 3BIZA 4TW9A 5KZIA 2DWBA 3W16A 3M2WA 2CDZA 3PYYA 3K54A 5B0XA 3Q96A 3MH0A 4CV8A 1TVOA 2OW3A 3A60A 5FEEA 4EH6A 3LM5A 2AYPA 3EQCA 5CZIA 3NUAA 3F7ZA 5A4EA 3UPZA 5HZNA 3EKNA 2HWOA 4Q2AA 4R3CA 4TN6A 2HOGA 3MA3A 3ORLA 5FDPA 2ITNA 2HENA 3PXZA 3NUSA 1AGWA 4FV8A 5L6WL 2C5XA 2R3FA 3E7VA 3BWFA 3LQ5A 4M66A 3SDJA 3AC2A 3GP0A 3DU8A 4YNEA 3VBTA 4F4PA 3A7FA 2B1PA 4W4XA 3PY3A 2A27A 4S2ZA 2GNFA 2PZYA 4K2RA 1WAKA 2Y6OA 4Q5HA 3RINA 2WTDA 3O8TA 4LI5A 3VUMA 4CFUA 2V55A 3UC3A 3U4WA 4AN9A 1JKTA 3MI9A 3K3JA 3TJDA 3ATTA 3COHA 2XB7A 3UJGA 1QPCA 2BRGA 3G33A 2ZV7A 1BL7A 4UYAA 4ASDA 5JKGA 4B0GA 3MWUA 3REPA 3HDNA 2Z60A 3ACKA 5AWMA 1MRYA 3EZVA 3KN6A 1OPJA 4BDEA 3PE2A 3DBCA 4HGEA 2QD9A 3QTSA 4HNFA 3ORKA 3O51A 4FTIA 5CI6A 5AV1A 5JFVA 3EWHA 2C6EA 4JLCA 3UYTA 4FSMA 2VTSA 3P86A 4JS8A 4RG0A 5M07A 3KKVA 4BCGA 2C0OA 5K4IA 4IVBA 4GS6A 4FTAA 4DH3A 2QO2A 3UG2A 4ZTLA 3PDTA 4QMYA 3I0QA 4C59A 1I44A 2J9MA 2OGVA 4RLLA 1GZ8A 4QTBA 2XBAA 4D4SA 3OWLA 5D12A 4EHZA 5IEXA 3GVUA 2XS0A 4O7WA 4UWYA 5CSVA 5A9UA 5HX6A 5CYIA 3LJ2A 4JJRA 2XNBA 3PXKA 4L3JA 5EM7A 3H0YA 3EFJA 5DOSA 3SD0A 5CEMA 3QCSA 5KBQA 4O0VA 3TN8A 4D4YA 2PU8A 5AM6A 3AD4A 4FKIA 3BU6A 5CAQA 5BYZA 4R77A 2REIA 5B7VA 2C6DA 1XBAA 4ZSGA 1KE7A 3DAKA 4D58A 1Q62A 4R5YA 4NEUA 4F0IA 4C4EA 3RK9A 2HELA 3BV2A 5HU9A 3OEZA 1DI9A 3E64A 4IQ6A 4BCOA 1UU9A 4WG5A 5CZHA 3GQIA 2GNHA 3QFVA 1APME 4EK3A 3F9NA 1U5RA 2R9SA 4ZLZA 2UW7A 2YJRA 3TKIA 4BY9E 3R9HA 4KBKA 1Z57A 3E8EA 3ZO3A 4MD8E 5KBRA 2W05A 3VVHA 1YKRA 4WUAA 2ZOQA 4C61A 4FG8A 2X6EA 2OJJA 2PVHA 2OLCA 5DPVA 2FSLX 4IMYA 4RWIA 2QOIA 1Q97A 4HJOA 4CFVA 4D4VA 5KHWA 1HCKA 3A7IA 3SOAA 3L1SA 4AG8A 2CKPA 2IPXA 4U45A 4J96A 4W4WA 4EBWA 4DGGA 2VTAA 5FLFA 4AE9A 4XCUA 4PMPA 3EFWA 4JIAA 4ZY5A 4C4JA 2UZWE 3CEKA 1BUHA 5LWNA 5IKWA 2RL5A 4DEHA 5HD4A 2HXLA 4KRDA 3C0IA 1FVVA 5CI7A 2OJ9A 3MJ1A 4DEBA 4CV9A 1ZYCA 4FKTA 3G51A 3QC9A 4R7BA 3BLQA 2VWIA 3MVLA 2BIYA 2VTPA 2RSVA 4YHJA 2IN6A 4ZJIA 4EOQA 3KREA 4RGJA 3MY1A 1M14A 4CLIA 3OUNB 2JDRA 3BBTB 2R0IA 3SW4A 3DBQA 2J5FA 2ZYBA 2C6KA 4M69B 3W10A 4A9YA 5FBOA 4OGRA 4O83A 4BDBA 5IH4A 4ZOGA 2JFMA 2E9UA 1ZYSA 5JRSA 4EORA 5KKRB 4B6LA 2ZM1A 3IW6A 2H8HA 4FKJA 4HYSA 4KAOA 5CU6A 4GVAA 3VF8A 3HRFA 2XIKA 2CGWA 5B2KA 4UALA 2PZPA 5DVRA 4C02A 4C4IA 4DFXE 5H8EA 5LWMA 3H0ZA 3HP5A 2W99B 3QKMA 4XG7A 4DITA 4CCBA 3QUDA 5TF9A 4DCEA 3TTIA 5M09A 3C5IA 3GENA 4FT3A 4QMLA 5J9LA 2JIUA 2QR8A 1Q8WA 2XEYA 4XBRA 4ZZMA 2J51A 3AQVA 3PPJA 4O2PA 2O5KA 2QODA 4YBJA 5DWRA 1CSNA 4FKGA 3R7OA 3SRVA 3ZBFA 5AM7A 3RNIA 4QMZA 5CLPA 4E93A 4R1YA 1LEWA 2OIDA 1H1SA 2YFXA 3CTHA 4IWQA 3ENMA 2C6LA 2LGCA 1OB3A 3QYZA 4WD5A 3GT8A 1WVYA 5AR8A 5EH0A 3V8SA 3RGFA 3A7GA 3C51A 1URWA 2G2HA 4K6ZA 5L8JA 2HXQA 4JRNA 4HVSA 4FNWA 4I6HA 4TYGA 4W4YA 3ZSIA 3FHIA 2W17A 3PY0A 4E7WA 2GFSA 3KCKA 4CNHA 2PZ5A 4AOIA 3ANQA 3LVPA 4FG9A 4C38A 5DT3A 4KIKA 5ANGA 5C4LA 1YHWA 3QTQA 4IX6A 2X8IA 4N57A 1G3NA 4GRBA 3ZUUA 2YLEA 2BILB 4R3PA 3TG1A 5BUJA 2WMVA 5BNJA 3PSCA 3RPSA 3ZUTA 1YI4A 2J0IA 3KXZA 1F0QA 1T46A 1WZYA 2ITXA 3R1NA 2YABA 5BQ0A 3O23A 4MKCA 4C57A 4PNIA 3TNIA 4EQUA 4C4HA 4BCPA 4J97A 4R78A 3KVXA 2F7XE 3PTGA 5JQ8A 4EEVA 4APPA 4OW8A 1XHAA 4YSMA 4J8NA 2H9VA 4FIGA 3U9CA 5HO6A 4C35A 1MQBA 5BVWA 1J1CA 4PPAA 4X6RA 2O8YA 4MXCA 1K9AA 4EH2A 4DFLA 3T3UA 2A1AB 4G34A 4U81A 3ULIA 4BDFA 4C2WA 2ONLA 1R0EA 3Q6UA 2F4JA 4U80A 4C4GA 4FK6A 4EL9A 4JIKA 1VYZA 5H9BA 1OUKA 2OG8A 3PVUA 4KB8A 2IW6A 1NT2A 4I5PA 5E8TA 1OPLA 3O7LB 3QD3A 5GJFA 4ZSLA 4C33A 4KWPA 2ITTA 4RFYA 2PE2A 2G15A 1J1BA 3PG1A 3W32A 3R8PA 1UU3A 1G8SA 1W7HA 3IOPA 4WSYA 1S9JA 5HVYA 3IO7A 3V01A 4EC8A 4BDGA 4O91A 4RC4A 4AZSA 2JBPA 3WF7A 2W5BA 5FG8A 5HE1A 5JFWA 4O2ZA 4L44A 1WFCA 2V7AA 3BHUA 3K5UA 4U8ZA 3R8UA 4HVDA 5ITAA 3RZBA 4E5AX 3QF9A 4JL9A 2XKFA 2GHMA 3KQ7A 1VR2A 3RAWA 3JVSA 2YITA 4D2WA 4FC0A 3RBWA 4CKRA 3F6XA 4BDKA 4ANOA 2XIRA 3FXZA 2W4KA 1M7NA 3DJ5A 4JVGA 2VGPA 3HX4A 3LLAA 4I94A 1M2RA 4O82A 3R9OA 4H3QA 3L8VA 4DEDA 2G9XA 2G01A 3EH9A 3GOKA 4NUSA 3FC1X 4A9TA 5DR6A 4EYJA 2RFNA 1OECA 2B4SB 5L2QA 1DAWA 3LMGA 4FV1A 5C01A 4PX6A 3TM0A 3OXZA 1OL2A 5FP6A 4FGBA 3N4VA 2B9JA 4M7IA 5HHWA 1O6YA 5HO8A 5HTIA 4A07A 3E8CA 1NXKA 5I3RA 4O0TA 4O6LA 2E2BA 4G6NA 5K3YA 3LW0A 4GT3A 4RLKA 2CNUA 2JAVA 5E9EA 4NM7A 2WTKB 2XNEA 4MNEB 2WQBA 2YAAA 4IFCA 4MXZA 4BBFA 1Z5MA 2GU8A 2VWBA 4RJ4A 5ICPA 5HG8A 4HZRA 2JITA 2PMOX 5HX8A 3L8SA 2VTLA 5E8XA 3F7WA 3TZ7A 4AF3A 4EOIA 4CRLA 2ERKA 4PTEA 2VX1A 2ETRA 4EK5A 5BPYA 5CT7A 1VEBA 1XQZA 1DS5A 1GOLA 3TKHA 2UZEA 2QCSA 5EDQA 5AP3A 5GJGA 1U54B 4P5ZA 5KO1A 3HRBA 4NM0A 1XH6A 4FNZA 3OS3A 5CSXA 3QQLA 4TY1A 4ACMA 5AEPA 2QHMA 3GU4A 4FV0A 4IANA 5AP5A 4UX9A 4EWQA 2EVAA 5HG7A 2A2AA 3VUHA 5EOLA 4QP9A 1F5QA 3HP2A 5IG1A 3IQ7A 3NYOA 2I6LA 4AT3A 3QAME 4BKJA 5IQFA 1ERKA 4FV7A 2GNJA 3P1AA 1S9IA 3AGMA 4P4CA 4YHTA 3C0HA 3CP9A 3QKLA 5A4QA 4DBXA 3HMPA 5IUHA 4LV8A 1P4FA 4FTMA 3HV5A 4EZ5A 3PLAE 1ZMUA 2WQMA 3FAAA 2WKMA 4FNXA 1JQHA 4JBPA 5IQAA 5FXRA 5HE0A 4AZWA 3FMEA 3NW6A 3AT3A 3QQKA 4PMSA 3LXKA 5LVOA 3H9FA 3DXPA 3C7QA 3ZSHA 3ZRKA 4I21A 2VTRA 4Z16A 1OIRA 5K5XA 2XM9A 4AE6A 2YM7A 5E90A 1PY5A 2XK6A 2BR1A 3OT8A 3ZFXA 4QQCA 3W55A 1JKLA 4ZJJA 5EM6A 4ALWA 3DK7A 4P5QA 2ITZA 1RQQA 4YPSA 3FY0A 3BGPA 2BAKA 4XG3A 3PPZA 1Q24A 1WCCA 3VO3A 2PSQA 1SZMA 4GKIA 3NCZA 1WBSA 2GNIA 5FUTA 2JBOA 4JAJA 5KMMA 4CZYB 3QZHA 4IC8A 5M4UA 1GIJA 2FH9A 4E4LA 5C8KA 5IQEA 4O0RA 3QZGA 3BHTA 4F0FA 4G9RA 1L3RE 1H1WA 2PVJA 4JG8A 3MSSA 3MTLA 2ONLC 4BGGA 3G9NA 2PVYA 2XK7A 5GZ8A 2FGIA 3OCGA 5JGBA 1FMKA 3D5XA 2R3IA 5DI1A 2ITWA 1RE8A 3PWDA 3G0EA 4BCFA 4MD7E 5HEZA 5L2SA 2JAMA 2P33A 3EQGA 4JQ7A 4YC8A 2PTKA 2ZV2A 3KMWA 5AX9A 1REJA 3O8UA 3PZEA 4BCJA 4O84A 2CN5A 2PMIA 3UNKA 2J0KA 4YJRA 3ZU7A 3EKKA 4IAAA 2B7AA 3D15A 2FSOX 2ITPA 3WF9A 3DB8A 3EOCA 1YHSA 3IW5A 4IAZA 2YEXA 3HMMA 3NNVA 3HLLA 4CD0A 2C6MA 1KE8A 1T45A 2ZDTA 3TNPC 5AAEA 4RX5A 3CY2A 4XV2A 5D11A 2VO3A 5EYMA 4YURA 1H1PA 2WTVA 3WF6A 4YLJA 4M13A 3ORPA 4OTDA 1UVRA 4OR5A 3ZEPA 1GZKA 2XNMA 3KA0A 3R73A 3F69A 3ORIA 3QTIA 3R04A 2Z7SA 2I0EA 1H0VA 3AD5A 4FTOA 3VRYA 1OKYA 4JQ8A 2Y4PA 1VYWA 4WOVA 3QRIA 4KS7A 4EZ7A 2O2UA 3LFQA 5DG5A 3TUBA 1KUTA 3NNWA 2Z8CA 4BIEA 1OIQA 4HPUE 5JGAA 5KE0A 1YWRA 4EYMA 1QCFA 5DHJA 3TUCA 3FI3A 1H27A 4YTCA 4FTNA 3QA0A 3F82A 2UW8A 4IB1A 4O38A 2CNQA 4JDIA 4F99A 4OTQA 4PV0A 4M0YA 5EDRA 2W0JA 4A06A 2YIQA 5FXQA 3R2BA 4O96A 4LMUA 4MF1A 2KTYA 4H58A 4Z9LA 5E8ZA 4QMNA 4BDDA 2WMSA 1H08A 4PMTA 2R7IA 5HE3A 4IWDA 3D9VA 4OTRA 4BYIA 5AR7A 5M44A 1J3HA 4IVDA 3KXXA 3FSFA 2BRMA 1JOWB 1YOLA 3C50A 1R1WA 3GC7A 4QRCA 3LCSA 4B8LA 5HVKA 3BYVA 5CEIA 2X39A 4D9UA 5FTGA 3HV4A 3OEFX 4KSPA 3PIYA 5C4KA 3LCTA 2H34A 2PK9A 4EK4A 5HTBA 3AOXA 4OTFA 3FE3A 4R5SA 4CZUA 2BZJA 5J7HA 4MH7A 4LOOA 3DKGA 3EHAA 4NIFB 4H1JA 3UIXA 3RTPA 3HA8A 5CXHA 5IQIA 3EL7A 4G9CA 5EI8A 3QX2A 1JNKA 1K3AA 3VBVA 3VULA 3GU7A 3AC5A 3F2NA 4QPSA 1Q4LA 4WSQA 3R7EA 1NW1A 3JXWA 4XEYA 3BKBA 2OXDA 3ODYX 4F09A 3FZ1A 3FMJA 5AP2A 2VWVA 4I41A 3V6SA 2XJ1A 3R7GA 3FMHA 3OROA 4IM2A 4ID7A 4ZTMA 5J7BA 4FSQA 5IQCA 3DKFA 2ESMA 3RAIA 2RF9A 3IG7A 3ENHA 4QMOA 1KV2A 4ZTHA 4PY1A 3VUKA 5EYDA 3F5GA 3M1SA 1UU7A 4L3PA 3L9PA 1PMEA 3QCYA 5IF1A 3QZFA 3NUUA 1Q3WA 4QYGA 3PA5A 2PVMA 3F3TA 4NFNA 2JLDA 4EOOA 1CKIA 3C4ZA 3NCGA 2WMQA 4WKQA 3H3CA 4D2VA 4WG4A 4U40A 2C5NA 2WMXA 4LYNA 3GCSA 3BELA 4PL5A 5CNNA 4D55A 2C3LA 4BI1A 2JEDA 4O27B 3GC8A 1DAYA 3EQBA 4XMOA 1J7IA 3FI2A 2VTNA 4RZWA 3O2MA 3HV7A 4GK4A 2GNLA 3F3VA 4FT7A 1JVPP 4NK9A 5L8LA 1Q41A 4H39A 4K18A 1WVWA 3DBFA 5CQUA 2B54A 2C3IB 3E5AA 1XH4A 2AC5A 3OTVA 4GYGA 4JDHA 4JXFA 2CKOA 3POOA 5CAUA 1YDRE 3OUKA 3BHVA 3A7HA 5LVNA 1M52A 3OD6X 4AX8A 4BB4A 4EUTA 3I7CA 4UXLA 4X3FC 3UMWA 2GQRA 4F08A 4I6BA 3ALNA 1PXLA 3RM6A 3MA6A 2R3PA 4ASEA 4YC6A 4DFNA 3FLWA 4CQEA 2BDFA 2NP8A 2P3GX 4ANQA 1SMHA 1E1XA 3FMLA 3GXLA 5JQ5A 1ZOGA 2V5QA 5AR2A 4MAOA 3HAMA 3DOGA 3OOGA 2ITVA 2QLQA 2OH0E 4YJPA 4YC3A 4DF3A 4EOKA 4E4MA 3DFAA 4G3EA 4K33A 3CR0A 4HOKA 2WB8A 4IJPA 5ACKA 3QQUA 3I6WA 4F7SA 2JDTA 1B38A 5EG3A 3PIZA 4IB0A 4PRJA 4DEAA 5FTOA 2J0LA 4EH4A 2C1BA 1UU8A 5EKOA 4ERKA 2OFVA 3EIDA 3FQSA 2YACA 3PVGA 3ZC5A 3QYWA 2XKCA 4DCAA 4APCA 5CU2A 3D2KA 3OFMA 2Y4IB 4P2KA 3KXNA 4X3JA 3PRIA 2OH4A 2XYNA 1Z9XA 2R3GA 2VTTA 2B52A 3O7LD 2HCKA 4NKAA 4QD6A 4JAIA 4BCHA 3OF0A 4O1OA 5J5SA 4FZ6A 4CGAA 3DDPA 4XHKB 2EXEA 4W8DA 3S00A 4LOQA 4BC6A 2GTNA 2QOCA 1XR1A 5KMLA 3T8OA 4DFYA 5IA0A 3A61A 4IE9A 3HKOA 5M53A 2CNVA 4HNIA 5HQ0A 1XH9A 3HNGA 4JQEA 3ET7A 4KABA 4LGGA 3ZXZA 3WOWA 2YERA 4IHPA 3CBLA 3O96A 2QC6A 3C5UA 3POZA 3W2QA 4A4OA 4PWNA 1LEZA 2YCRA 5LXMA 5AUWA 3NEWA 4ZSAA 4EH8A 2W1ZA 4GCJA 4E3CA 2WD1A 2I0YA 3PA3A 3V6RA 3BZ3A 5HORA 4ANMA 2WOTA 2OKRA 3ZH8A 3QGYA 4PPBA 2PMNX 4L45A 3RHXA 4M84A 4FZDB 4C3PA 4ACHA 3Q32A 4Y5QA 3ZM4A 4BCNA 2QG5A 4YJOA 4KKHA 5EFQA 3W2RA 3R00A 2YZAA 3NRMA 4L01A 2XBJA 1Q61A 2QURA 5AP1A 3WZDA 1OIYA 3MN3A 3W33A 5EDPA 4QQ5A 5ANIA 5J87A 5TO8A 5HU3A 4RZVA 2UZOA 4AP7A 2UZTA 3OHTA 4RPVA 3EZRA 4MQ1A 4NFMA 4TPTA 3UOLA 3JS2A 3CQUA 3LXLA 4X21A 3IW7A 5CX9A 3V5LA 5D41A 3EL8A 5KCVA 1OBGA 3I7BA 3CKWA 3F5PA 4RA4A 4Y73A 4BTMA 4DYMA 5CXZA 3VQUA 4ZXTA 1KWPA 5AV2A 3WZJA 3FZPA 1YDSE 3UGCA 5AA9A 4GT4A 4NJ3A 4QMMA 3DLZA 2WNTA 2BDJA 2RKUA 3TZ8A 5JK3A 4E4XA 3TUDA 5CEQA 2QKRA 4UMQA 2ZVAA 2FVDA 5FM3A 2XIXA 4WNMA 3UOKA 3QRUA 5CSPA 3G6GA 3R7YA 2NRYA 4DLJA 2I40A 2OBJA 2BAJA 3PUPA 4X7QA 4ZJVA 5IA1A 4BDAA 4S30A 4PDPA 4RIWA 3I6UA 3UQFA 2WMBA 4CFFA 2YDJA 3UIBA 2VTJA 1UWHA 5AADA 4O86A 1Q8YA 4PQNA 3TCPA 4I5HA 3FPMA 4IDTA 3GC9A 1PRYA 2BDWA 4A9SA 4B7TA 3NWWA 3QXPA 4LUDA 3P7CA 3EQHA 4FSRA 4YLKA 5L6PA 2QG7A 4C62A 3CC6A 4JT3A 4FV9A 4IX5A 1ZY4A 4FTLA 4QP6A 5CNOA 5IEYA 2OJGA 3PZHA 4L8MA 3VS6A 4K8AA 1IRKA 5EW9A 3PFQA 1Y8YA 4XG6A 2BROA 2GS7A 5E7RA 3EN6A 4AN3A 3KL8A 4Z7HA 4ONAA 3OWKA 4FE2A 2RFDA 3SW7A 4C36A 4ZZNA 5K5NA 2YISA 4BZNA 4FEWA 3AT2A 4D2PA 2CGVA 2UZBA 3ZOSA 3DAEA 5I9ZA 3MESA 4G16A 3WE4A 3IOKA 5IMEA 4BCQA 4I5CA 1PMVA 3QWJA 2C4GA 4U97A 3VUGA 3HRCA 4C8BA 4HYUA 3O0GA 5E8SA 1YHVA 2BZKB 1U46A 3E3PA 3QRKA 5DBXA 3TV7A 5A4TA 5BX0A 4QTCA 3K2LA 4O7SA 2X6DA 5CU0A 3Q9WA 4JBQA 2YDIA 2VTOA 3JYAA 4I20A 4J53A 3V5QA 2PUPA 3DV3A 4UMRA 4MXOA 3BU5A 4BI0A 2WAJA 3MGYA 4YZNA 4IJ9A 5EQYA 2XCHA 4A4LA 2J6MA 2ETMA 2CKEA 5HBJA 1OGUA 3QTWA 5ANDA 2X2KA 1PXKA 2Y8OA 3BYUA 4IVCA 3ANRA 3ATSA 1MRVA 2WU7A 5ETIA 5H8GA 1SVEA 4FA2A 1V0BA 2VN9A 4AGUA 4GV1A 1H28A 2WMTA 4IWPA 4HVIA 4IZAA 3BLHA 4QMVA 3BE2A 4NCTC 3QTXA 5I9WA 4FSNA 3UC4A 2OI4X 1Y6BA 4XYFA 5M55A 1YOJA 2BAQA 3OTUA 2YIRA 4RVTA 3PJ3A 5KZ0A 3LXPA 4DFZE 4O7YA 4HVGA 3MVHA 3PLSA 4BCIA 4EZ3A 3AC3A 2QOFA 3PIXA 2OJIA 2W1CA 1IEPA 4Y83A 5IQGA 2F9GA 4F9BA 4I92A 4RQKA 4UZDA 3V5PA 4W9XA 4NKSA 5EYKA 5IDPA 5DN3A 4WNKA 4N6YA 4R7IA 3DJ7A 1CKJA 2OU7A 2O63A 3VS1A 4KKEA 4G31A 3KRLA 5DT0A 3RVGA 5LMKA 4YUQA 2WOUA 4ANNA 2X7GA 3R83A 1A06A 3SOCA 3U4UA 3UIUA 4BKZA 2VWZA 4D5KA 3LCDA 3VBQA 5KKRC 4FTRA 4ERWA 3CD8A 1PKGA 2JDSA 4U3ZA 4MNEA 5AP0A 2OIBA 4CCUA 5IQDA 2VTIA 1OL5A 3LXNA 3RPYA 2XRWA 4IAYA 4AN2A 3IDPA 4PMMA 2X9EA 3JY0A 4QYEA 4BHZA 4FOCA 3R28A 3WYYA 2CMWA 1BX6A 2VWYA 4XNEA 3IGOA 1JPAA 5BVKA 3VWAA 5DFPA 3VHEA 4AFJA 4AW5A 2GCDA 1Q3DA 3FLQA 3KCFA 4D4RA 4V05A 4BIDA 4M0ZA 2UW9A 4PL4A 4V0GB 1U54A 3NZ0A 1NA7A 2IO6A 4NJDA 4Y8DA 4DC2A 5I9YA 5E91A 3LFFA 2HZ0A 2VO0A 4TWPA 3TZ9A 4DEGA 2C47A 2ERZE 5BVDA 4E20A 3BYSA 3N51A 3Q9ZA 3VW6A 5HLNA 3BLRA 1E1VA 2IVTA 3V04A 5L8KA 4RJ3A 2XK8A 2QNJA 2PUNA 2OFUA 3QQJA 5FQDC 3CSVA 3QD4A 4F1OA 1YRPA 4PUZA 4RIWB 3FWQA 3QHRA 2BKZA 3ZLWA 4WHZA 4AW1A 2V7OA 3PJ8A 4FV2A 3SXRA 5CEOA 4YJNA 3E7OA 3AXWA 2XNGA 4R8QA 5CQWA 4R3RA 2YJSA 1U4DA 4JR7A 1OPKA 4GT5A 4H05A 4QTEA 5CF4A 4CMTA 3GOPA 4M8TA 1W82A 4L6QA 4HYHA 2UW5A 4BKYA 3DB6A 4ZSJA 1YI3A 3JPVA 4FGRA 5BMMA 2ZMCA 3ZLYA 4DA5A 3QZIA 2UW6A 4QMPA 1URCA 1OKVA 3EYGA 3COMA 5E1SA 2C1AA 3THBA 4I6FA 4YBKA 3C1XA 4WIHA 5CAPA 1IG1A 2Y0AA 3MV5A 3PWYA 1Y6AA 4M68A 5ANKA 3QCXA 3I60A 3DNDA 4V01A 1AQ1A 5LARA 5I5ZA 3QKKA 4GVJA 3FMKA 3LAUA 5G1XA 3CKXA 4FX3A 3FV8A 4UMPA 1KE6A 4YTHA 3TXOA 3IPHA 4K1BA 4M14A 1K2PA 2GS2A 4LRJA 3VS4A 2X8DA 4AA4A 3D4QA 3E8DA 1FQ1B 5E8YA 4XV3A 1OITA 3K3IA 2C30A 1GY3A 5AP4A 3BI6A 5A3XA 3FLZA 4Z55A 4HPTE 4RJ7A 4UMUA 2XNPA 3RHKA 3QGWA 4Y46A 3V3VA 4F7LA 3ZXTA 4NSTA 4O1PA 3SAYA 1M17A 1QPJA 1R0PA 3B2WA 4BICA 3O17A 1FVRA 4KIOA 4MNFA 3DNEA 4PDOA 3LMHA 3D83A 4TYJA 2P55A 4O0YA 5EKNA 3KXHA 3ZO1A 3AC1A 4GUEA 3LPBA 4FVPA 3PSDA 1R78A 1TQMA 3D14A 2VTHA 3C4FA 3LJ0A 4FG7A 5FDXA 5IA2A 2VNYA 3BWJA 3VF9A 3F3UA 4RJ8A 5KMNA 3O71A 4ACDA 3VJOA 2BFXA 4KIQA 1XBBA 3CPCA 1KE5A 3VBYA 3LIJA 1J91A 5IQHA 2P0CA 5EYCA 4E8AA 1WBOA 5CVFA 4YJUA 1PF8A 1H07A 2CN8A 2XK3A 3OBGA 5AAFA 4ASZA 3QTRA 5CF6A 3WZEA 2RIOA 4XRJA 4XX9A 4EHGA 3I81A 3AGLA 3FZSA 3UG1A 5A6NA 4CG9A 2CCHA 3ZCLA 3OZ6A 3VHKA 2QI8A 3TIYA 2PE1A 4FV5A 4UB7A 2EXMA 3OBJA 2VUWA 4UN0C 2YWVA 2W4OA 5EQEA 2XK9A 3GBZA 4FIIA 1V1KA 3QRTA 3KK8A 4XH6A 4BHNA 5I9UA 2UZNA 2XCKA 3H10A 4BZDA 4EUUA 3NR9A 5LCKA 4KNBA 2Z7RA 1H25A 2QU6A 4QO9A 1SM2A 4N4SA 3EMGA 5EW8A 5JMSA 3BQRA 5EM8A 3N9XA 5LMKC 4EJ7A 3R7UA 3JUHA 5AV0A 3F3ZA 3EN9A 5AUZA 5BYLA 4EOMA 4G6OA 3EFKA 2E9OA 4K11A 5F9EA 3ELJA 1Q8ZA 3NGAA 2OSCA 3QWKA 4J52A 2WTKC 2XH5A 4RBLA 4YO4A 4O7ZA 4FZAB 4DG2E 5CU4A 3PY1A 3HUBA 3OW4A 2YN8A 2Q0BA 4L52A 5CTPA 4QMXA 5LVLA 3P79A 2J90A 4IWOA 4NTSA 5FP5A 4WNOA 4IM3A 3V5WA 4E6DA 3NVMB 4NZWB 3KY2A 4BDIA 4YP8A 4C2VA 4XUFA 3IDCA 5AIRA 5BVOA 3NMUF 4Z7GA 5JH6A 3SG9A 2XIZA 1XH8A 4FI1A 3MY5A 3U6HA 5JSMA 2WMWA 4NIFA 2BUJA 4H1MA 4IZ7A 4RVKA 4CYJA 5DH3A 4S31A 3NYNA 4GFGA 3FKNA 2GHGA 3A7JA 2UZUE 1ZYJA 4WRGA 4UBAA 3RAHA 1ZAOA 2E9NA 2CJMA 4LGHA 2IW9A 4F65A 4IIRA 2UW3A 1W83A 4YZ9A 1IA9A 2JC6A 5D7AA 5KMIA 3LFCA 2QOQA 5AP7A 4BF2A 2YLFA 4FKUA 1Y91A 1CTPE 2WQEA 5HD7A 1TKIA 1UKHA 3COKA 2UV2A 3DK6A 5JZNA 5DEYA 4I4EA 2UUEA 3MBLA 2QQ7A 5IH6A 2X7FA 3ZSGA 1QPDA 4YTFA 3QUPA 4M15A 4GK3A 2UZLA 3A62A 4IM0A 3FLSA 5HNGA 5F4NA 3NYVA 3LKMA 4O7VA 4ZY6A 2OF2A 3A8WA 3D5WA 4DGLC 4XOZA 4F1TA 4I1ZA 3TNHA 4GH2A 4MHAA 4BZOA 5EHLA 4L7SA 3W8LA 3O50A 4FKPA 4WUNA 4O6EA 3FLNC 2W96B 5AIKA 2EB2A 4II5A 3QQHA 3EQIA 3MIAA 5B2MA 3NW5A 4HCVA 1PHKA 4G5JA 2ZV9A 3CLYA 4JX3A 2Y7JA 5BMSA 3FI8A 3LFDA 4O22A 4WT6A 5AJQA 4J7BA 3GCUA 4U44A 4GIHA 4ZTQA 3PP0A 5JT2A 4LV5A 5KMOA 2XM8A 5AUUA 3GUBA 4XG9A 4YMJA 3U8WA 4NYEA 4D0XA 4PDSA 5I4NA 4F9WA 5A4CA 3R9NA 1H00A 3DGKA 4PP9A 4I23A 4Y85A 1YXXA 4DH8A 3OWJA 5IA3A 4JOAA 2XA4A 5D10A 2CPKE 1A48A 1JLUE 2C68A 4AU8A 4QQTA 4MXAA 3UQCA 1ZZ2A 1P4OA 3R8MA 4AXAA 3C4EA 4BTKA 4IADA 3I4BA 4QQJA 4UZHA 3D5UA 5CALA 3CIKA 1RJBA 4LG4A 1X8BA 1HOWA 4F6WA 3Q4TA 1KSWA 4JX7A 3KVWA 5DLSA 4FF8A 2R3OA 2X9FA 4QYFA 3V8TA 1Q8TA 4L46A 5IUGA 2OICA 4CEGA 4R6VA 3LQ3A 3F5UA 3TNWA 4AGCA 4U41A 4EOSA 3S3IA 3JY9A 3CY3A 4P90A 5I3OA 3QX4A 4KKGA 3QLGA 5ANEA 2WPAA 5FTQA 5FD2A 2XJ2A 4X2FA 2WTWA 2C6IA 3NNUA 3UZRA 3NNXA 5EHOA 3R0TA 4FUYA 2HY81 4XLVA 2QU5A 2ZV8A 3QL8A 3I5NA 4M12A 4AZTA 4FYOA 1XBCA 1OM1A 1YDTE 2CCIA 3MH3A 3WIGA 5JGDA 3VNTA 4AAAA 3F88A 5J9YA 3Q4ZA 4UWCA 2WQOA 3FSKA 4KRCA 5J95A 4AZFA 4MD9E 4U5JA 4IDVA 4TL0A 5CANA 3DZQA 5GZ9A 3LLTA 4HGTA 4NT4A 2EU9A 4ENXA 5LVPA 3CGOA 4YHFA 4X2GA 2ZDUA 4IFGA 3MH2A 3MVMA 4FNYA 2J7TA 3A4OX 3R7VA 4RX7A 4EC9A 2W5HA 3IW4A 3ZZEA 3KK9A 3KF4A 4CSVA 2DS1A 3OWPA 3TL8A 4S33A 3EN5A 4R7HA 3KRXA 4AZVA 4E6CA 3GU6A 3UO6A 5LCJA 4W8EA 4CFNA 5FXSA 2FSMX 3AD6A 3ERKA 3QQGA 2PULA 2VWXA 3AMBA 3FY2A 4PL3A 4YLLA 4ZLOA 4F6SA 3FL4A 3R71A 5HG5A 3OCTA 3RALA 1E9HA 2VU3A 4L42A 1WBPA 4OBPA 2CGXA 4UXQA 3PVBA 3ROCA 2JKQA 3COIA 2PHKA 1YXUA 3R63A 4H36A 4MXXA 3RNYA 5AR5A 5AP6A 1REKA 4GG5A 5HVJA 4JDKA 3TT0A 4LQMA 3ULZA 4CFXA 3TWJA 1P2AA 2BHHA 4BCKA 2A0CX 2R3QA 1ZMVA 2VWUA 3ZUVA 2XUUA 3HECA 3EQPA 3V5JA 2NPQA 4GFOA 1NVRA 1V0OA 2CHLA 3MTFA 2P4IA 3RPOA 5BYYA 4FZ7A 4V04A 5DGZA 4ITJA 4L7FA 2ZM4A 5CWZA 4BDJA 2ZB0A 4NH1A 4QP1A 4N0SA 2HK5A 3ALOA 4FODA 3SQQA 1OUYA 4RSSA 3LFSA 4I0TA 4KD1A 4FEXA 3PSBA 5C9CA 5L3AA 3R9RA 3MVJA 4LUEA 4I93A 3SV0A 2Z7LA 5GZAA 5KHXA 2JDVA 2V0DA 4L3LA 3L9MA 3AMAA 2PZIA 1PMNA 4FOBA 4RWJA 4ARKA 4J71A 3VS0A 5HNBA 4AUAA 3ZS5A 3DT1A 2W1DA 2OIQA 3FJQE 4F6UA 4FIJA 2IVUA 4JG7A 2QOLA 4FL1A 1M2PA 4I3ZA 5C1QB 3NIZA 4ZP5A 1SNUA 5J1VA 3HMNA 4LRKA 1IASA 5GHVA 3TJCA 4L53A 4ACGA 3DY7A 1H4LA 3P7BA 4BWPA 4DEEA 4QYHA 5CVHA 1ZYDA 4QMTA 3C4XA 4XLIA 1UA2A 3B8RA 3WBLA 4AQCA 4Q9ZA 3UO5A 4AFEA 5IU2A 2JKOA 5AR3A 5FRIA 3H9RA 3KB7A 5EI2A 3QC4A 4U3YA 3UNJA 4CYIA 3ZRLA 2OZAB 4NWMA 2W1FA 3G5DA 3GFEA 3R02A 4TYHB 5HCXA 4ZEGA 4E6AA 3R1YA 2PWLA 3MFUA 5AUXA 3DBDA 3Q6WA 3R01A 2KULA 5ANJA 3NPCA 2PUIA 5TKDA 1WMKA 2ITUA 5K0KA 5J8IA 4ZLYA 4J8MA 5AA8A 1GAGA 4HCTA 3BHYA 5K0XA 4WO5A 1BL6A 3CQWA 2WTIA 3OXTA 4RIOA 4BDCA 1G5SA 2ACXA 3PXFA 1ZOEA 4WNPA 4YTIA 4IACA 4XP3A 5I0BA 4DINA 4XOYA 3DK3A 5ETCA 5L4QA 3F66A 1FGIA 4B8MA 3LOKA 3HMOA 3KULB 2WEVA 2GMXA 4ZMFA 3SKCA 3DTCA 4NL0A 3UQGA 3F2RA 4CLJA 4UY9A 2VTMA 4MVFA 4JNWA 4FKVA 4GUBA 4L67A 1GNGA 2WIPA 4BVUA 5DRBA 4DTAA 5DMZA 2R64A 3EN4A 3P08A 4TNBA 4J99A 5F94A 4C3RA 3B8QA 3BE9A 4AA0A 3FUPA 2Y4IC 4QTDA 4YZDA 4F9CA 2H96A 3WF5A 2JIVA 4EKLA 3MPMA 4NW6A 4Q5EA 4FSUA 2J5EA 5C03A 5HI2A 3D0EA 4FR4A 2BVAA 4YGAA 4B4LA 1FBNA 5HLWA 4MTAA 2R3MA 3QRJA 4ZMEA 2JD5A 3UODA 4KSQA 1GIIA 2GTMA 4AS0A 2Y9QA 4O81A 2X2MA 4TYIA 4ZS0A 3UTOA 1CMKE 2UVZA 1FINA 1XKKA 5DE2A 1F3MC 4IBMA 1W84A 4WA9A 3PP1A 3V51A 3QQFA 4RVLA 3EQFA 4MQ2A 2CGUA 2YM8A 3ROYA 2C5VA 4Y72A 3WARA 5KNJA 5CY3A 5CEKA 5DR9A 3OP5A 1YWVA 3VRZA 1HCLA 4D9TA 4I4FA 1QPEA 2VGOA 3R8VA 3ODZX 5EHYA 2EXCX 2X4ZA 3F2AA 3OT3A 3D7TB 4OT6A 2UW0A 3KN5A 3MY0A 3R8ZA 3ZDUA 5KX8A 5K4JA 3WIKA 4I22A 4P7EA 2XIYA 3VUDA 3LQ8A 1P5EA 4OAUC 2O3PA 2BKKA 1OL1A 3ZDIA 3PPKA 3Q2MA 3BQCA 5EK7A 4D1SA 2E9PA 4XG4A 1NVQA 1RDQE 2RGPA 2B9FA 4UV0A 2XNNA 2XEZA 3DCVA 3W18A 1ZWSA 1SVHA 3OY1A 3JVRA 2YA9A 1MQ4A 3HVCA 4QMSA 4BBMA 3UOJA 2XVDA 4LL5A 4V0GA 3OY3A 4GEOA 4D1XA 3PXYA 3OG7A 4I0RA 3GNIB 2B9HA 3DFCB 5M56A 4CMUA 3DKCA 3B2TA 3MW1A 1OMWA 3NUYA 4CTBA 4TRLA 4M67A 3UZTA 3OOMA 2ITYA 3C4CA 4H3BA 3G15A 3U54A 2WELA 1DM2A 3E88A 3G9LX 2PY3A 4EQCA 4BTFA 4TWCA 4C3FA 2F57A 2PVNA 4RIYB 5EI6A 3OMVA 3RAKA 4BFMA 1GJOA 4O7RA 4XP0A 2WEIA 4F7NA 1W0XC 5BVNA 2FYSA 2BRBA 2YCQA 3A99A 2I0HA 4XRLA 3RMFA 4ENYA 4BN1A 3FZOA 5HKMA 2HZIA 4ZS4A 4PF4A 3CQEA 4FZFB 4RIXB 5FEDA 5CEPA 1BI8A 2WMAA 3I79A 1KOAA 3VJNA 1YW2A 4G2FA 3D5VA 2QR7A 4BTJA 2QONA 3BX5A 4C7TA 1OL6A 4KA3A 4U79A 3BYMA 4LGDA 4D2TA 2NO3A 3G0FA 3RWQA 2R5TA 4FMQA 3NW7A 2HZ4A 2ZB1A 4LMNA 4OT5A 4USDA 2GDOA 3KMMA 3ZONA 4EONA 1V0PA 3NX8A 2CLXA 2VD5A 3BEAA 5EM5A 1OZ1A 2IW8A 4ANSA 3OCBA 3BBWA 3UP7A 5GIPE 1J7UA 2YCFA 4XP2A 2OZOA 3QD0A 2XYUA 3NAYA 4BR3A 2W06A 4GFMA 4QMWA 4AT5A 3ITZA 3P23A 3RCJA 3A8XA 3II5A 4IH8A 4RWKA 2UVXA 4EH9A 3K5VA 4K9YA 3G6HA 1PXJA 3TDWA 4KBCA 4CMOA 4AOJA 3ORTA 3ZTXA 3T9TA 3Q9XA 4TTHB 3TTJA 4ZIMA 2G1TA 3RK7A 1SVGA 3LZBA 4FT0A 5HOAA 4S34A 4DH1A 2QVSE 5CT0A 5E1EA 4D1ZA 1EH4A 4QP3A 3DQXA 4C58A 2JDOA 3CPBA 1XWSA 3ZEWA 4GSBA 3AG9A 4AWIA 4O7NA 1LUFA 2PE0A 3R1QA 4PTCA 5HBHA 2C0IA 3QBNA 3SHEA 4L9IA 1TQPA 2YIYA 2WIHA 4A9RA 4YZMA 4O7LA 2EWAA 3QA8A 2X1NA 2QOKA 3FC2A 3EFLA 4E6QA 1WBWA 1B39A 1PJKA 3C4WA 3VS5A 3ZLXA 3RM7A 5J1WA 5ETAA 1LR4A 5HIEA 1PMUA 2X0GA 4UEUA 4FTUA 4QMUA 4EK6A 4W4VA 3DA6A 1BMKA 3LFNA 4PTGA 2YWPA 5JEBA 2IZSA 4CKIA 3D7ZA 4QYYA 5AV3A 3GU8A 3VS2A 1XJDA 1CDKA 2QKWB 4I0SA 1UV5A 2YM6A 4MWIA 4QNYA 4IX3A 1WBVA 3QLFA 2IZRA 1H1QA 3DJ6A 4WRSA 5HIDA 4FYNA 4DHFA 4FKRA 1UWJA 4CT1A 2GS6A 3HDMA 4S32A 3RPVA 1MRUA 4FSTA 4ALUA 2P2IA 3TV4A 4EHVA 3R22A 2BALA 3MFSA 4KBAA 4D28A 3LFEA 4BBEA 3FBVA 2O64A 1OKZA 2Z7QA 5FM2A 3IK3A 4RX9A 4ZSEA 3VW8A 4FIHA 2HZNA 5IH5A 2W9ZB 4FIFA 5IQBA 5T68A 4YZBA 5D9HA 2QOBA 4IAKA 3L9NA 1PW2A 3GFWA 4ITIA 3Q3BA 1JWHA 5ETFA 1PXOA 3FMNA 3F3WA 2W1EA 4G5PA 4FSWA 4GMYA 4GYIA 4IZYA 4M3QA 3T9IA 4TWNA 4ZAUA 3S1HA 4FKSA 1OL7A 3TACA 2HIWA 2WQNA 4YJSA 5AUTA 1IAJA 4BWKA 2YM5A 3E87A 3KRRA 3LHJA 3NUNA 3VN9A 2R3KA 1UNLA 3MPTA 4USFA 4IB5A 3FYKX 3UNZA 1ZY5A 4DG0E 5A46A 3TDVA 2HWPA 2R2PA 4LRMA 5H3QA 4X2NA 2UVYA 2W1GA 2BIKB 1H24A 2G2IA 4FK3A 3SXSA 3W2CA 5L6OA 2IVSA 3R21A 3PXRA 4O0SA 3S4QA 4BGHA 4EQMA 4GK2A 5JFXA 5KMJA 4HGSA 2R0UA 2IZTA 4K0YA 4DG3E 4GL9A 4N70A 3DPKA 2VX0A 4MF0A 3SVVA 3UVQA 1UNHA 5C8MA 5JRQA 3VAPA 3SG8A 2WZJA 2WU6A 3ZO2A 3FQEA 3U6JA 2QHNA 3ORXA 4ZZOA 3GI3A 4TNDA 5GJDA 5H2UA 4DT9A 2HW7A 2YDKA 5AUVA 5L2TA 4G6LA 4QP2A 3E8NA 3S95A 4EOLA 3IECA 1R39A 4RA5A 1ZOHA 4F0GA 3AC8A 1AD5A 2J2IB 3VBWA 4ORKA 2PVKA 3CGFA 2FSTX 4F1MA 2OK1A 4MCVA 5D7VA 2V22A 3ZBXA 3IW8A 2X4FA 3KF7A 2J0JA 3Q9YA 4FKLA 4RFMA 3N4UA 3FZTA 3MFRA 2RG5A 3VUIA 3IONA 4AACA 1WVXA 5LVMA 4F64A 4C37A 3CTJA 4DTBA 4GW8A 3U55A 4EKKA 4EWHA 3KU2A 3ETAA 2BZHB 3BV3A 4YPDA 4FTTA 3MS9A 3TNQB 3UYSA 3MPAA 3I5ZA 5IDNA 4UMTA 4FVQA 2VO7A 4RT7A 4ZY4A 4GG7A 2GPHA 2VV9A 2R3HA 2OO8X 2YM3A 3HEGA 4RRVA 1QL6A 4JG6A 2FA2A 3DQWA 4YJVA 4FVRA 4F7JA 4IAIA 3KFAA 4R1VA 3VS3A 4DEIA 5DNRA 5KUPA 2R3JA 4RJ6A 4C0TA 3M42A 3MJ2A 1RW8A 4JDJA 2WXVA 3R1SA 3I0OA 3FL5A 3C13A 3NSZA 4AT4A 5AX3A 4BRXA 4O7TA 5DEWA 2F7ZE 3E3BX 2R4BA 4ANBA 4FICA 5CVGA 2XZSA 2C6OA 5A54A 1KE9A 2VRXA 1YWNA 4FTJA 1XH5A 2EUFB 5HTCA 4X2KA 2OXXA 4K77A 2R3RA 3FKLA 4FV6A 3TKUA 5CSHA 2Y6MA 5LMAA 2PZRA 2JKKA 2Z2WA 4QTAA 2ITOA 4DAWA 4RFZA 1ND4A 3W2OA 1GZNA 4TYEA 2DUVA 5HLPA 4DH7A 4RX8A 3L8PA 5B2LA 2X8EA 5C8NA 4L68A 2QO7A 3LMIA 3HA6A 2BRHA 3DXNA 2F2CB 3PRFA 4J1RA 4DBNA 1NY3A 4F63A 5M4FA 2XK4A 1O9UA 2PVFA 3P0MA 3QTZA 1Y8GA 3A2CA 2RG6A 2NRUA 5CF5A 5LMBA 3BEGA 4DFUA 2HW6A 4U43A 4CRSA 3GCVA 4O0XA 1DI8A 3UOHA 4ZK5A 3FZRA 3GC0A 3MIYA 5HO7A 3SLSA 3GQLA 1Q5KA 3G2FA 4NM5A 4PP7A 4Y5HA 4CKJA 4KS8A 2R3LA 2O65A 2PPQA 1ZARA 4CFWA 1W98A 3NDMA 5KMKA 5ACBC 3RJCA 1JSTA 4PNKA 5CASA 3FYJX 4JBOA 3SA0A 2C5YA 4HCUA 2JFLA 3FMMA 4G3DA 5FWKK 5TE0A 3VIDA 4EJNA 4E26A 3Q4CA 3KRWA 4YU2A 1W8CA 2CLQA 4FL2A 5F1ZA 2F7EE 2NNWB 3TIZA 3OCSA 4USEA 2I7QA 2O0UA 2G2FA 4C4FA 2YZLA 1YXTA 3KGAA 5LOHA 1ZZLA 3SXFA 4DGMA 1YOMA 1MUOA 3G90X 1PXMA 4IXPA 4MX9A 4AW0A 1VZOA 2BCJA 4L00A 1BYGA 1ZLTA 4G3CA 2Q0NA 3U6IA 4QT1A 2YCSA 3PA4A 3SRVB 5JN2A 3RCDA 3IKAA 4WBBB 2H6DA 3FDNA 4F9AA 1OKWA 2R7BA 3NUXA 4E1ZA 5BVFA 1Q8UA 1VJYA 3QCQA 4LL0A 3KEXA 3QU0A 4RJ5A 3RK5A 3UBDA 3ACJA 1OI9A 5C26A 5BUEA 3RP9A 4QPAA 3QD2B 3W2PA 4TZRA 3LFAA 1CM8A 2BPMA 5ANOA 1IR3A 3OW3A 1FMOE 2OXYA 4OBOA 4GU6A 2C5OA 3JR1A 5AR4A 4LFIA 4RMZA 4LM5A 1U5QA 1YQJA 3UO4A 3C9WA 5M4CA 3BRBA 4A7CA 3D94A 3PJ1A 2BRNA 4KIKB 5HBEA 2XP2A 4J95A 3NS9A 3E63A 2W5AA 3EN7A 2JGZA 3KXMA 3PJ2A 3SGCA 3WZUA 1PXNA 4MXYA 5L2IA 3HAVA 3ZC6A 5CU3A 4X2JA 1OVEA 2CSNA 3UMXA 4XBUA 1H8FA 3RKBA 5T3QA 4G17A 4U0IA 5J79A 3PVWA 5DA3A 4G1WA 4QPMA 4JI9A 3UZPA 2WHBA 2ZAZA 3TEIA 1OBDA 1XO2B 2XJ0A 4I5MA 4U9AA 5K9IA 4G3FA 2WGJA 3P78A 1Q99A 2BTRA 2VX3A 4XG8A 2J50A 3GU5A 3E62A 2BTSA 4N6ZA 2WO6A 3S2PA 4ITHA 2VAGA 5TT7A
chains in the Genus database with same CATH superfamily
5FBNC 3CE3A 3EYHA 4GJ3A 1PXIA 4CZTA 3W0QA 4YNOA 3DAJA 3FI4A 4ZTSA 3VS7A 4QP4A 4XS2A 3ML1A 1KOBA 5TOZA 4CXAA 2UZVA 3P5KA 4ALVA 2GSFA 3PE1A 3F61A 3UPXA 2YHVA 3R6XA 4U42A 2IJMA 3UP2A 3ZFMA 4BIBA 4BGQA 4QP8A 3ORZA 5LQFA 5CAVA 5M4IA 2YIXA 2B0QA 3ZO4A 2Z02A 3WILA 5CAOA 1SNXA 3GCQA 4DN5A 1QMZA 1WBTA 2E9VA 4GJ2A 3OXIA 4EH5A 2ZM3A 1JKKA 2UZDA 5JFSA 3H4JA 1OGYA 4X3FA 3CD3A 4E73A 2YIWA 2C3KA 5C27A 3KXGA 2PL0A 2VZ6A 3U9NA 2J0MB 3ORMA 4EI4A 2WTJA 4F9YA 1G8JA 5HIBA 4FV3A 1L8TA 1BI7A 2OZAA 1OIUA 2X2LA 3RI1A 5L2WA 4TYHA 3R2YA 3FQHA 3BGZA 4J98A 5J9ZA 3VUTA 2GQGA 2R3NA 5HCYA 4GIIA 4ZTRA 4HYIA 2XNOA 4RWLA 3ZMMA 2XKDA 4AZEA 2RFEA 5F20A 4DTKA 4OTGA 3GB2A 2HYYA 3CTQA 1YXSA 3P4KA 5TR6A 5AAGA 4O21A 3DXQA 3U87A 1BLXA 3BYOA 1R3CA 4QOXA 4YZCA 5HG9A 2OF4A 4BYJA 3BCEA 3FXWA 2FB8A 4NM3A 5F95A 4QMQA 4FT9A 3FLYA 3PXQA 2B53A 2W1HA 4E5BA 1PKDA 3KULA 3W2SA 5IUIA 4D5HA 1PYXA 2VO6A 3O8PA 1ZXEA 1NVSA 2W1IA 1FOTA 3CJGA 5FEQA 4AW2A 4D0WA 4HVHA 4NW5A 2BFYA 4MYGA 1LP4A 2HAKA 3R8LA 4DLIA 1H0WA 3PG3A 4I6QA 3UVPA 4CQGA 3W1FA 1H1RA 4PDYA 3QTUA 4E4NA 3Q60A 3NAXA 4FL3A 3Q5IA 4OBQA 4YSJA 4Z3VA 2BZIB 3EJ1A 3TYKA 2C3JA 3NVKI 5LJJA 5M08A 2W4JA 4C34A 2QO9A 5H8BA 3GCPA 3VBXA 4MBJA 5A14A 1B6CB 4IC7A 3TZMA 1JSVA 4BDHA 4FSZA 3N4TA 1M7QA 3D2IA 3DS6A 1TQIA 4EH3A 3AKLA 3NUPA 4CG8A 3QXOA 4LDTA 4X6QC 1SYKA 1XH7A 1M2QA 2AUHA 2WMUA 2OJFE 3DDQA 3NLBA 1A9UA 2PUUA 4FSYA 5I9XA 3LCKA 4OTIA 5E4HA 3HL7A 1TZDA 5HE2A 2AC3A 3MB6A 4D2RA 4Y95A 4RC3A 4UWBA 2ZJWA 2OWBA 3PUFC 4AGDA 3EB0A 3AC4A 4FEVA 2ITQA 2FUMA 4H3PA 4IVAA 5CSWA 3LCOA 4JR3A 4NTTA 4YJTA 2GHLA 3UVRA 5AV4A 4QEBA 4NU1A 3WZKA 4PPCA 5IA4A 3FHRA 2Q83A 2XALA 3IS5A 1JSUA 3BU3A 2PVRA 1U59A 1UNGA 4OTHA 2I1MA 3TI1A 4ASXA 1Y57A 3D7TA 5E8WA 4AGWA 4E5WA 1YXVA 1GIHA 2XKEA 4BI2A 3FEGA 2QLUA 4XV1A 4Q9SA 4EOPA 4O0WA 2B55A 3NYXA 3AT4A 3E93A 2VTQA 4I24A 2HY0A 5HCZA 2PVLA 4IB3A 3ZLSA 4RVMA 3A4PA 4XV9A 5E8VA 3V5TA 5A6OA 4IW0A 3I1AA 4FKOA 4A4XA 4CTCA 2IVVA 3ORNA 3CXWA 4MWHA 2XMYA 4QNAA 3SX9A 4B99A 3LFBA 4TKSA 3HGKA 5EOBA 4FV4A 5DR2A 3VQHA 2A4LA 3S0OA 4FEQA 4XJ0A 3UIMA 3OC1A 3RZFA 3HZTA 4EH7A 4YO6A 4U6RA 3GEQA 1MP8A 5DRDA 3KRJA 2ZMDA 5G6VA 2UW4A 4FTKA 3UE4A 1ZRZA 5AMNA 2RFSA 4GU9A 5D1JA 1KV1A 3ZHPC 1FPUA 2W7XA 1FVTA 2WFYA 4IEBA 2C69A 5EW3A 3TV6A 3OVVA 4ACCA 3ZM9A 2WMRA 2YM4A 5JZJA 3T3VA 3LM0A 2I0VA 3R7IA 4OTPA 2V62A 4DHZA 3Q4UA 5HNIX 2XF0A 5M51A 5CF8A 4JBVA 5CS6A 3DTWA 3WE8A 4MBLA 4RIYA 5M06A 4WBOA 1P14A 4BWXA 3CCNA 3L9LA 4XG2A 3HYHA 1ZMWA 3Q52A 1STCE 4HGLA 3E92A 3W8QA 1JBPE 4DH5A 4DFBA 4EK8A 2WTCA 3GGFA 1H26A 4FKQA 4FBXA 3H9OA 3FXXA 4FTCA 4X3FB 5DT4A 5IZFA 4FEUA 3ID6C 3EQRA 2C6TA 2IWIA 3QALE 4RIXA 4L43A 3P9JA 2EB3A 2W9FB 4JRVA 4DGNA 4EOJA 3NIEA 4WG3A 4OAVB 4KUJA 3ZYAA 5CENA 3BHHA 4HZSA 4U7ZA 2BMCA 2CKQA 2GFCA 2JKMA 3KMUA 3WI6A 3AMYA 1FGKA 3C0GA 4IAFA 4KINA 4O0UA 5FGKA 4GKHA 4DT8A 3IDBA 1ZYLA 3QUEA 3RPRA 4BL1A 5IA5A 5J5TA 1O6LA 4EHEA 4HW7A 2VNWA 3ZFYA 2JIIA 4LOPA 2PMLX 3V8WA 2F2UA 4A9UA 3ZZWA 2ETKA 4CFMA 5I9VA 4ANLA 2SRCA 1CKPA 5E8UA 1IA8A 1ATPE 4G3GA 2LAVA 4FTQA 4CVAA 2QOOA 3MB7A 4OTWA 4FT5A 3WF8A 3EQDA 3BGQA 4DE4A 4YR8A 2X81A 3DLSA 3LE6A 4OUCA 3WYXA 3R30A 5DIAA 4AOTA 4BCMA 4DGOA 5IEVA 3KC3A 3HUCA 4RQVA 3HV6A 5HESA 1H01A 1YI6A 5BUIA 2J4ZA 2XRUA 3BPRA 1O6KA 4W9WA 5E92A 5AUYA 4QP7A 2YAKA 4FKWA 5T6KA 4MEDA 3FMDA 4F70A 4ZTNA 5IMXA 2PYWA 2A19B 3IGGA 5IPJA 1JKSA 3KIOC 3R9DA 1UKIA 2VWWA 4AA5A 2DQ7X 2QOHA 2DYLA 2IZUA 3RWPA 3ZRMA 3Q2JA 1LPUA 3DKOA 1WBNA 4TT7A 3MFTA 2GNGA 3Q53A 1YVJA 2X7OA 3UDBA 4D2SA 4UYNA 5EQPA 2P2HA 3DZOA 4MBIA 2C0TA 3Q04A 4X0MA 3Q5ZA 2GQSA 3HV3A 4OLIA 4YJQA 4NCTA 5HGIA 4EBVA 1J7LA 3FKOA 3MH1A 3SC1A 3F5XA 4FIEA 3BLAA 2IG7A 3U51A 4B9DA 1GZOA 3L8XA 4CT2A 5AFVA 5GINE 4TXCA 3M11A 5GIOE 4RC2A 3FPQA 3H30A 1PXPA 1IAHA 3CJFA 3CS9A 5M57A 2FO0A 3MYGA 3QHWA 4IZ5A 3VC4A 1JAMA 4KIPA 1I09A 1PYEA 3P7AA 1G8AA 1TFFA 3LJ1A 2F49A 3HMIA 1BKXA 2B9IA 4FUXA 4TWOA 5GNKA 3PJCA 4IX4A 4M69A 5IISA 5A4LA 4MK0A 5HICA 1G8KA 5DYJA 4M97A 2BHEA 3MDYA 3DBEA 5BVEA 3BIZA 4TW9A 5KZIA 2DWBA 3W16A 3M2WA 2CDZA 3PYYA 3K54A 5B0XA 3Q96A 3MH0A 4CV8A 1TVOA 2OW3A 3A60A 5FEEA 4EH6A 3LM5A 2AYPA 3EQCA 5CZIA 3NUAA 3F7ZA 5A4EA 3UPZA 5HZNA 3EKNA 2HWOA 4Q2AA 4R3CA 4TN6A 2HOGA 3MA3A 3ORLA 5FDPA 2ITNA 2HENA 3PXZA 3NUSA 1AGWA 4FV8A 5L6WL 2C5XA 2R3FA 3E7VA 3BWFA 3LQ5A 4M66A 3SDJA 3AC2A 3GP0A 3DU8A 4YNEA 3VBTA 4F4PA 3A7FA 2B1PA 4W4XA 3PY3A 2A27A 4S2ZA 2GNFA 2PZYA 4K2RA 1WAKA 2Y6OA 4Q5HA 3RINA 2WTDA 3O8TA 4LI5A 3VUMA 4CFUA 2V55A 3UC3A 3U4WA 4AN9A 1JKTA 3MI9A 3K3JA 3TJDA 3ATTA 3COHA 2XB7A 3UJGA 1QPCA 2BRGA 3G33A 2ZV7A 1BL7A 4UYAA 4ASDA 5JKGA 4B0GA 3MWUA 3REPA 3HDNA 2Z60A 3ACKA 5AWMA 1MRYA 3EZVA 3KN6A 1OPJA 4BDEA 3PE2A 3DBCA 4HGEA 2QD9A 3QTSA 4HNFA 3ORKA 3O51A 4FTIA 5CI6A 5AV1A 5JFVA 3EWHA 2C6EA 4JLCA 3UYTA 4FSMA 2VTSA 3P86A 4JS8A 4RG0A 5M07A 3KKVA 4BCGA 2C0OA 5K4IA 4IVBA 4GS6A 4FTAA 4DH3A 2QO2A 3UG2A 4ZTLA 3PDTA 1XMLA 4QMYA 3I0QA 4C59A 1I44A 2J9MA 2OGVA 4RLLA 1GZ8A 4QTBA 2XBAA 4D4SA 3OWLA 5D12A 4EHZA 5IEXA 3GVUA 2XS0A 4O7WA 4UWYA 5CSVA 5A9UA 5HX6A 5CYIA 3LJ2A 4JJRA 2XNBA 3PXKA 4L3JA 3UDSA 5EM7A 3W0SA 3H0YA 3EFJA 5DOSA 3SD0A 5CEMA 3QCSA 5KBQA 4O0VA 4AAYA 3TN8A 4D4YA 2PU8A 5AM6A 3AD4A 4FKIA 3BU6A 5CAQA 5BYZA 4R77A 2REIA 5B7VA 2C6DA 1XBAA 4ZSGA 1KE7A 3DAKA 4D58A 1Q62A 4R5YA 4NEUA 4F0IA 4C4EA 3RK9A 2HELA 3BV2A 2XARA 5HU9A 3OEZA 1DI9A 3E64A 4IQ6A 4BCOA 1UU9A 4WG5A 5CZHA 3GQIA 2GNHA 3QFVA 1APME 4EK3A 3F9NA 1U5RA 2R9SA 4ZLZA 1W2FA 2UW7A 2YJRA 3TKIA 4BY9E 3R9HA 4KBKA 1Z57A 3E8EA 3ZO3A 4MD8E 5KBRA 2W05A 3VVHA 1YKRA 4WUAA 2ZOQA 4C61A 4FG8A 2X6EA 2OJJA 2PVHA 2OLCA 5DPVA 2FSLX 4IMYA 4RWIA 2QOIA 1Q97A 4HJOA 4CFVA 4D4VA 5KHWA 1HCKA 3A7IA 3SOAA 3L1SA 4AG8A 2CKPA 2IPXA 4U45A 4J96A 4W4WA 4EBWA 4DGGA 2VTAA 5FLFA 4AE9A 4XCUA 4PMPA 3EFWA 4JIAA 4ZY5A 4C4JA 2UZWE 3CEKA 1BUHA 5LWNA 5IKWA 2RL5A 4DEHA 5HD4A 2HXLA 4KRDA 3C0IA 1FVVA 5CI7A 2OJ9A 3MJ1A 4DEBA 4CV9A 1ZYCA 4FKTA 3G51A 3QC9A 4R7BA 3BLQA 2VWIA 3MVLA 2BIYA 2VTPA 2RSVA 4YHJA 2IN6A 4ZJIA 4EOQA 2XAOA 3KREA 4RGJA 3MY1A 4QDEA 1M14A 4CLIA 3OUNB 2JDRA 3BBTB 2R0IA 3SW4A 3DBQA 2J5FA 2ZYBA 2C6KA 4M69B 3W10A 4A9YA 5FBOA 4OGRA 4O83A 4BDBA 1ST4A 5IH4A 4ZOGA 2JFMA 2E9UA 1ZYSA 5JRSA 4EORA 5KKRB 4B6LA 2ZM1A 3IW6A 2H8HA 4FKJA 4HYSA 4KAOA 5CU6A 4GVAA 3VF8A 3HRFA 2XIKA 2CGWA 5B2KA 4UALA 2PZPA 5DVRA 4C02A 3BL7A 4C4IA 4DFXE 5H8EA 5LWMA 3H0ZA 3HP5A 2W99B 3QKMA 4XG7A 4DITA 4CCBA 3QUDA 5TF9A 4DCEA 3TTIA 5M09A 3C5IA 3GENA 4FT3A 4QMLA 5J9LA 2JIUA 2QR8A 1Q8WA 2XEYA 4XBRA 4ZZMA 2J51A 3AQVA 3PPJA 4O2PA 2O5KA 2QODA 4YBJA 5DWRA 1CSNA 4FKGA 3R7OA 3SRVA 3ZBFA 5AM7A 3RNIA 4QMZA 5CLPA 4E93A 4R1YA 1LEWA 2OIDA 1H1SA 2YFXA 3CTHA 4IWQA 3ENMA 2C6LA 2LGCA 1OB3A 3QYZA 4WD5A 3GT8A 1WVYA 5AR8A 5EH0A 3V8SA 3RGFA 3A7GA 3C51A 1URWA 2G2HA 4K6ZA 5L8JA 2HXQA 4JRNA 4HVSA 4FNWA 4I6HA 4TYGA 4W4YA 3ZSIA 3FHIA 2W17A 3PY0A 4E7WA 2GFSA 3KCKA 4CNHA 2PZ5A 4AOIA 3ANQA 3LVPA 4FG9A 4C38A 5DT3A 4KIKA 5ANGA 5C4LA 1YHWA 3QTQA 4IX6A 2X8IA 4N57A 1G3NA 4GRBA 3ZUUA 2YLEA 2BILB 4R3PA 3TG1A 5BUJA 2WMVA 5BNJA 3PSCA 3RPSA 3ZUTA 1YI4A 2J0IA 3KXZA 1F0QA 1T46A 1WZYA 2ITXA 3R1NA 2YABA 5BQ0A 3O23A 4MKCA 4C57A 4PNIA 3TNIA 4EQUA 4C4HA 4BCPA 4J97A 4R78A 3KVXA 2F7XE 3PTGA 5JQ8A 4EEVA 4APPA 4OW8A 1XHAA 4YSMA 4J8NA 2H9VA 4FIGA 3U9CA 5HO6A 4C35A 1MQBA 5BVWA 1J1CA 4PPAA 4X6RA 2O8YA 4MXCA 1K9AA 4EH2A 4DFLA 3T3UA 2A1AB 4G34A 4U81A 3ULIA 4BDFA 4C2WA 2ONLA 1R0EA 3Q6UA 4AQKA 2F4JA 4U80A 4C4GA 4FK6A 4EL9A 4JIKA 1VYZA 5H9BA 1OUKA 2OG8A 3PVUA 4KB8A 2IW6A 1NT2A 4I5PA 5E8TA 1OPLA 3O7LB 3QD3A 5GJFA 4ZSLA 4C33A 4KWPA 2ITTA 4RFYA 2PE2A 2G15A 1J1BA 3PG1A 3W32A 3R8PA 1UU3A 1G8SA 1W7HA 3IOPA 4WSYA 1S9JA 5HVYA 3IO7A 3V01A 4EC8A 4BDGA 4O91A 4RC4A 4AZSA 2JBPA 3WF7A 2W5BA 5FG8A 5HE1A 5JFWA 4O2ZA 4L44A 1WFCA 2V7AA 3BHUA 3K5UA 4U8ZA 3R8UA 4HVDA 5ITAA 3RZBA 4E5AX 3QF9A 4JL9A 2XKFA 2GHMA 3KQ7A 1VR2A 3RAWA 3JVSA 2YITA 4D2WA 4FC0A 3RBWA 4CKRA 3F6XA 4BDKA 4ANOA 2XIRA 3FXZA 2W4KA 1M7NA 3DJ5A 4JVGA 2VGPA 3HX4A 3LLAA 4I94A 1M2RA 4O82A 3R9OA 4H3QA 3L8VA 4DEDA 2G9XA 2G01A 3EH9A 3GOKA 4NUSA 3FC1X 4A9TA 5DR6A 4EYJA 2RFNA 1OECA 2B4SB 5L2QA 1DAWA 3LMGA 4FV1A 5C01A 4PX6A 3TM0A 3OXZA 1OL2A 5FP6A 4FGBA 3N4VA 2B9JA 4M7IA 4FJVA 5HHWA 1O6YA 5HO8A 5HTIA 4A07A 3E8CA 1NXKA 5I3RA 4O0TA 4O6LA 2E2BA 4G6NA 5K3YA 3LW0A 4GT3A 4RLKA 2CNUA 2JAVA 5E9EA 4NM7A 2WTKB 2XNEA 4MNEB 2WQBA 2YAAA 4IFCA 4MXZA 4BBFA 1Z5MA 2GU8A 2VWBA 4RJ4A 5ICPA 5HG8A 4HZRA 2JITA 2PMOX 5HX8A 3L8SA 2VTLA 5E8XA 3F7WA 3TZ7A 4AF3A 4EOIA 4CRLA 2ERKA 4PTEA 2VX1A 2ETRA 4EK5A 5BPYA 5CT7A 1VEBA 1XQZA 1DS5A 1GOLA 3TKHA 2UZEA 2QCSA 5EDQA 2XAMA 5AP3A 5GJGA 1U54B 4P5ZA 5KO1A 3HRBA 4NM0A 1XH6A 4FNZA 3OS3A 5CSXA 3QQLA 4TY1A 4ACMA 5AEPA 2QHMA 3GU4A 4FV0A 4IANA 5AP5A 4UX9A 4EWQA 2EVAA 5HG7A 2A2AA 3VUHA 5EOLA 4QP9A 1F5QA 3HP2A 5IG1A 3IQ7A 3NYOA 2I6LA 4AT3A 4AXEA 3QAME 4BKJA 5IQFA 1ERKA 4FV7A 2GNJA 3P1AA 1S9IA 3AGMA 4I6LA 4P4CA 4YHTA 3C0HA 3CP9A 3QKLA 5A4QA 4DBXA 3HMPA 5IUHA 4LV8A 1P4FA 4FTMA 3HV5A 4EZ5A 3PLAE 1ZMUA 2WQMA 3FAAA 2WKMA 4FNXA 1JQHA 4JBPA 5IQAA 5FXRA 5HE0A 4AZWA 3FMEA 3NW6A 3AT3A 3QQKA 4PMSA 3LXKA 1W2CA 5LVOA 3H9FA 3DXPA 3C7QA 3ZSHA 3ZRKA 4I21A 2VTRA 4Z16A 1OIRA 5K5XA 2XM9A 4AE6A 2YM7A 5E90A 1PY5A 2XK6A 2BR1A 3OT8A 3ZFXA 4QQCA 3W55A 1JKLA 4ZJJA 5EM6A 4ALWA 3DK7A 4P5QA 2ITZA 1RQQA 4YPSA 3FY0A 3BGPA 2BAKA 4XG3A 3PPZA 1Q24A 1WCCA 3VO3A 2PSQA 1SZMA 4GKIA 3NCZA 1WBSA 2GNIA 5FUTA 2JBOA 4JAJA 5KMMA 4CZYB 3QZHA 4IC8A 5M4UA 1GIJA 2FH9A 4E4LA 5C8KA 5IQEA 4O0RA 3QZGA 3BHTA 4F0FA 4G9RA 1L3RE 1H1WA 2PVJA 4JG8A 3MSSA 3MTLA 2ONLC 4BGGA 3G9NA 2PVYA 3W0OA 2XK7A 5GZ8A 2FGIA 3OCGA 5JGBA 1FMKA 3D5XA 2R3IA 5DI1A 2ITWA 1RE8A 3PWDA 3G0EA 4BCFA 4MD7E 5HEZA 5L2SA 2JAMA 2P33A 3EQGA 4JQ7A 4YC8A 2PTKA 2ZV2A 3KMWA 5AX9A 1REJA 3O8UA 3PZEA 4BCJA 4O84A 2CN5A 2PMIA 3UNKA 2J0KA 4YJRA 3ZU7A 3EKKA 4IAAA 2B7AA 3D15A 2FSOX 2ITPA 3WF9A 3DB8A 3EOCA 1YHSA 3IW5A 4IAZA 2YEXA 3HMMA 3NNVA 3HLLA 4CD0A 2C6MA 1KE8A 1T45A 2ZDTA 3TNPC 5AAEA 4RX5A 3CY2A 4XV2A 5D11A 2VO3A 5EYMA 4YURA 1H1PA 2WTVA 3WF6A 4YLJA 4M13A 3ORPA 4OTDA 1UVRA 4OR5A 3ZEPA 1GZKA 2XNMA 3KA0A 3R73A 3F69A 3ORIA 3QTIA 3R04A 2Z7SA 2I0EA 1H0VA 3AD5A 4FTOA 3VRYA 4LV7A 1OKYA 4JQ8A 2Y4PA 1VYWA 4WOVA 3QRIA 4KS7A 4EZ7A 2O2UA 3LFQA 5DG5A 3TUBA 1KUTA 3NNWA 2Z8CA 4BIEA 1OIQA 4HPUE 5JGAA 5KE0A 1YWRA 4EYMA 1QCFA 5DHJA 3TUCA 3FI3A 1H27A 4YTCA 4FTNA 3QA0A 3F82A 2UW8A 4IB1A 4O38A 2CNQA 4JDIA 4F99A 4OTQA 4PV0A 4M0YA 5EDRA 2W0JA 4A06A 2YIQA 5FXQA 3R2BA 4O96A 4LMUA 4MF1A 2KTYA 4H58A 4Z9LA 5E8ZA 4QMNA 4BDDA 2WMSA 1H08A 4PMTA 2R7IA 5HE3A 4IWDA 3D9VA 4OTRA 4BYIA 5AR7A 5M44A 1J3HA 4IVDA 3KXXA 3FSFA 2BRMA 1JOWB 1YOLA 3C50A 1R1WA 3GC7A 4QRCA 3LCSA 4B8LA 5HVKA 3BYVA 5CEIA 2X39A 4D9UA 5FTGA 3HV4A 3OEFX 4KSPA 3PIYA 5C4KA 3LCTA 2H34A 2PK9A 4EK4A 2IF8A 5HTBA 3AOXA 4OTFA 3FE3A 4R5SA 4CZUA 2BZJA 5J7HA 4MH7A 4LOOA 3DKGA 3EHAA 4NIFB 4H1JA 3UIXA 3RTPA 3HA8A 5CXHA 5IQIA 3EL7A 4G9CA 5EI8A 3QX2A 1JNKA 1K3AA 3VBVA 3VULA 3GU7A 3AC5A 3F2NA 4QPSA 1Q4LA 4WSQA 3R7EA 1NW1A 3JXWA 4XEYA 3BKBA 2OXDA 3ODYX 4F09A 3FZ1A 3FMJA 5AP2A 2VWVA 4I41A 3V6SA 2XJ1A 3R7GA 3FMHA 3OROA 4IM2A 4ID7A 4ZTMA 5J7BA 4FSQA 5IQCA 3DKFA 2ESMA 3RAIA 2RF9A 3IG7A 3ENHA 4QMOA 1KV2A 4ZTHA 4PY1A 3VUKA 5EYDA 3F5GA 3M1SA 1UU7A 4L3PA 3L9PA 1PMEA 3QCYA 5IF1A 3QZFA 3NUUA 1Q3WA 4QYGA 3PA5A 2PVMA 3F3TA 4NFNA 2JLDA 4EOOA 1CKIA 3C4ZA 3NCGA 2WMQA 4WKQA 3H3CA 4D2VA 4WG4A 4U40A 2C5NA 2WMXA 4LYNA 3GCSA 3BELA 4PL5A 5CNNA 4D55A 2C3LA 4BI1A 2JEDA 4O27B 3GC8A 1DAYA 3EQBA 4XMOA 1J7IA 3FI2A 2VTNA 4QDVA 4RZWA 3O2MA 3HV7A 4GK4A 2GNLA 3F3VA 4FT7A 1JVPP 4NK9A 5L8LA 1Q41A 4H39A 4K18A 1WVWA 3DBFA 5CQUA 2B54A 2C3IB 3E5AA 1XH4A 2AC5A 3OTVA 4GYGA 4JDHA 4JXFA 2CKOA 3POOA 5CAUA 1YDRE 3OUKA 3BHVA 3A7HA 5LVNA 1M52A 3OD6X 4AX8A 4BB4A 4EUTA 3I7CA 4UXLA 4X3FC 3UMWA 2GQRA 4F08A 4I6BA 3ALNA 1PXLA 3RM6A 3MA6A 2R3PA 4ASEA 4YC6A 4DFNA 3FLWA 4CQEA 2BDFA 2NP8A 2P3GX 4ANQA 1SMHA 2IEWA 1E1XA 3FMLA 3GXLA 5JQ5A 1ZOGA 2V5QA 5AR2A 4MAOA 3HAMA 3DOGA 3OOGA 2ITVA 2QLQA 3UDTA 2OH0E 4YJPA 4YC3A 4DF3A 4EOKA 4E4MA 3DFAA 4G3EA 4K33A 3CR0A 4HOKA 2WB8A 4IJPA 5ACKA 3QQUA 3I6WA 4F7SA 2JDTA 1B38A 5EG3A 3PIZA 4IB0A 4PRJA 4DEAA 5FTOA 2J0LA 4EH4A 2C1BA 1UU8A 5EKOA 4ERKA 2OFVA 3EIDA 3FQSA 2YACA 3PVGA 3ZC5A 3QYWA 2XKCA 4DCAA 4APCA 5CU2A 3D2KA 4DDIA 3OFMA 2Y4IB 4P2KA 3KXNA 4X3JA 3PRIA 2OH4A 2XYNA 1Z9XA 2R3GA 2VTTA 2B52A 3O7LD 2HCKA 4NKAA 4QD6A 4JAIA 4BCHA 3OF0A 4O1OA 5J5SA 4FZ6A 4CGAA 3DDPA 4XHKB 2EXEA 4W8DA 3S00A 4LOQA 4BC6A 2GTNA 2QOCA 1XR1A 5KMLA 3T8OA 4DFYA 5IA0A 3A61A 4IE9A 3HKOA 5M53A 2CNVA 4HNIA 5HQ0A 1XH9A 3HNGA 4JQEA 3ET7A 4KABA 4LGGA 3ZXZA 3WOWA 2YERA 4IHPA 3CBLA 3O96A 2QC6A 3C5UA 3POZA 3W2QA 4A4OA 4PWNA 1LEZA 2YCRA 5LXMA 5AUWA 3NEWA 4ZSAA 4EH8A 2W1ZA 4GCJA 4E3CA 2WD1A 2I0YA 3PA3A 3V6RA 3BZ3A 5HORA 4ANMA 2WOTA 2OKRA 3ZH8A 3QGYA 4PPBA 2PMNX 4L45A 3RHXA 4M84A 4FZDB 4C3PA 4ACHA 3Q32A 4Y5QA 3ZM4A 4BCNA 2QG5A 4YJOA 4KKHA 5EFQA 3W2RA 3R00A 2YZAA 3NRMA 4L01A 2XBJA 1Q61A 2QURA 5AP1A 3WZDA 1OIYA 3MN3A 3W33A 5EDPA 4QQ5A 5ANIA 5J87A 5TO8A 5HU3A 4RZVA 2UZOA 4AP7A 2UZTA 3OHTA 4RPVA 3EZRA 4MQ1A 4NFMA 4TPTA 3UOLA 3JS2A 3CQUA 3LXLA 4X21A 3IW7A 5CX9A 3V5LA 5D41A 3EL8A 5KCVA 1OBGA 3I7BA 1VLRA 3CKWA 3F5PA 4RA4A 4Y73A 4BTMA 4DYMA 4O4CA 5CXZA 3VQUA 4ZXTA 1KWPA 5AV2A 3WZJA 3FZPA 1YDSE 3UGCA 5AA9A 3O5AA 4GT4A 4NJ3A 4QMMA 3DLZA 2WNTA 2BDJA 2RKUA 3TZ8A 5JK3A 4E4XA 3TUDA 5CEQA 2QKRA 4UMQA 2ZVAA 2FVDA 5FM3A 2XIXA 4WNMA 3UOKA 3QRUA 5CSPA 3G6GA 3R7YA 2NRYA 4DLJA 2I40A 2OBJA 2BAJA 3PUPA 4X7QA 4ZJVA 5IA1A 4BDAA 4S30A 4PDPA 4RIWA 3I6UA 3UQFA 2WMBA 4CFFA 2YDJA 3UIBA 2VTJA 1UWHA 5AADA 4O86A 1Q8YA 4PQNA 3TCPA 4I5HA 3FPMA 4IDTA 3GC9A 1PRYA 2BDWA 4A9SA 4B7TA 3W0RA 3NWWA 3QXPA 4LUDA 3P7CA 3EQHA 4FSRA 4YLKA 5L6PA 2QG7A 4C62A 3CC6A 4JT3A 4FV9A 4IX5A 1ZY4A 4FTLA 4QP6A 5CNOA 5IEYA 4F78A 2OJGA 3PZHA 4L8MA 3VS6A 4K8AA 1IRKA 5EW9A 3PFQA 1Y8YA 4XG6A 2BROA 2GS7A 5E7RA 3EN6A