2X9FA

Ephb4 kinase domain inhibitor complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
281
structure length
265
Chain Sequence
KEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 3: Identification of Non-Benzodioxole-Based Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 265
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x9fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x9fA01
4EUTA 3L8VA 4I5HA 4FYNA 3HV6A 3LJ1A 4QD6A 4L7FA 1QPDA 4G1WA 3ZXTA 5JEBA 4ZAUA 3GB2A 4UY9A 2BFXA 5DA3A 3TACA 3NCGA 4I5CA 4BBMA 3E63A 4LOQA 2OH4A 2W5HA 4YSJA 4ACCA 2C6TA 1OKYA 5A4QA 5JN2A 4D2VA 3CJGA 3ZC5A 4I22A 4DT8A 2WQMA 2WQOA 3DBDA 4C3PA 4JR3A 5CI6A 4I4EA 1OIRA 4KNBA 5CVFA 3VF8A 4FSZA 3CKWA 3C4CA 2C5XA 3ETAA 3FHIA 4GT4A 4IAFA 5DVRA 1WBVA 3LM0A 5HNIX 4Y72A 4TYIA 3MBLA 2WOUA 5IQIA 3DOGA 2WQEA 1PXMA 4L9IA 2YISA 2R3NA 2YZAA 4FKIA 1JSVA 2ETRA 4DGLC 3FLSA 3SDJA 2CGXA 2UW5A 3R71A 2FB8A 3RM6A 2Y4PA 4LV5A 4LL5A 5K5NA 3UPZA 3LQ3A 2X2LA 3TTIA 3UJGA 3EFLA 1DAYA 4J53A 4CG8A 1JSUA 4GU9A 3PE2A 4ANLA 2VWXA 3GOKA 3LQ5A 5AP1A 5IUHA 3QUPA 3LFSA 3NIZA 5CU3A 5L2SA 4HYHA 5DPVA 4C3RA 4USEA 3DB8A 3QX2A 5BPYA 2ZYBA 4LGGA 4XH6A 5EM7A 1ZYCA 3S3IA 4DT9A 3R28A 3TV6A 4CNHA 5B0XA 4NZWB 4FSYA 2HY0A 1JSTA 2HZIA 4FSUA 4PL4A 4XV3A 4KRDA 5I4NA 4R8QA 4PWNA 5IQDA 5B2KA 4U5JA 2OJIA 5FP5A 3C4ZA 3MVHA 5AA8A 5HTIA 5D10A 3I7BA 2G2FA 4DITA 4B8LA 3LCOA 4RRVA 1APME 3Q52A 2JIUA 5CVHA 3RK5A 3SV0A 4ACDA 2ETMA 4YJRA 2PPQA 2E9PA 3CXWA 4D55A 4ASXA 3FEGA 3AGMA 1ZY4A 5E8ZA 4OT5A 2OU7A 3V5LA 2I40A 1OL6A 2VTNA 4NCTC 3QAME 2XK8A 2BMCA 2XF0A 3ENHA 5HE3A 3LZBA 2HZNA 5CLPA 3P7BA 4J8MA 2OF4A 4BKYA 4EZ3A 5FLFA 2UW0A 4IWOA 2I7QA 1T45A 2C30A 3FY2A 3O7LB 2OK1A 4IVAA 3OTVA 3HV4A 3VRYA 2H9VA 3TL8A 4QP2A 1OKZA 3RHKA 5LVLA 4AW1A 3K5UA 4R77A 2GTNA 4DEGA 4NIFA 4NIFB 2ESMA 2XJ1A 4WKQA 1FVRA 3BBWA 3RBWA 4IADA 1YOJA 5GZAA 1BX6A 5HTBA 2WTWA 3ORTA 4EH7A 5BUJA 4YZBA 1WFCA 4V0GB 2OJJA 4QTDA 2IW8A 4F0GA 3SC1A 3AG9A 5LMBA 5CSVA 3BHTA 3QWKA 5L2WA 5DGZA 2EXCX 2OJ9A 4BGHA 3MVLA 1U5QA 3KK9A 4S31A 4DH5A 4BC6A 4EWHA 3OXTA 2VWZA 1GIHA 3LFNA 4DBXA 2PZYA 5AM6A 3QTRA 4WSYA 4IC7A 5I3RA 4J99A 3ORIA 4FYOA 3EN7A 4EJ7A 2JDTA 4OAVB 3UMWA 1P2AA 2HK5A 2YITA 5EM8A 3RJCA 2PVYA 5J5SA 4MXYA 4FIHA 4AWIA 5BMMA 5HZNA 3RNIA 3SRVA 2UZUE 2WEVA 3LFBA 1Y8YA 2FSTX 4XOZA 4YO6A 5CEQA 4EL9A 4I21A 4DFUA 2OI4X 4D2SA 4HW7A 4I0SA 5A54A 4JRNA 5HO7A 4IZYA 3ATSA 3A7HA 3R1SA 3W2CA 4C61A 1VZOA 1ZAOA 3DBCA 2QU5A 3GEQA 5DNRA 3A8WA 3ULIA 2VX3A 3KCFA 5TOZA 1CKPA 4X3FA 4CLIA 2F9GA 4X2NA 4ZXTA 2BIYA 3QD3A 3LFFA 3MYGA 4I23A 2WMRA 5JGAA 3VQUA 2R4BA 3UVRA 3AMAA 4IM2A 1UU3A 2OICA 2R3FA 3NGAA 3SXRA 1SNXA 3E87A 5CAOA 3M2WA 3TZMA 4KKGA 4NT4A 3QXPA 5B2MA 3A7JA 5KX8A 1OGUA 4XP0A 2JFMA 1H28A 3I6WA 5HG9A 5HOAA 3HV7A 3FLZA 5C1QB 4AA5A 2OWBA 3KXXA 3UMXA 3GU7A 2C5YA 2NPQA 3FLWA 3QX4A 4IJ9A 2PVNA 2V55A 4KA3A 4EHEA 2DWBA 4B0GA 2VO3A 3NUAA 4EOKA 4Z55A 1H1WA 4AS0A 4YLJA 3BV3A 3I60A 2ZM4A 3QALE 3R63A 5E8SA 3ZLYA 4DLIA 3C0HA 2VD5A 5HVJA 5CF5A 2W1EA 3OBJA 2WMXA 4ORKA 4E5WA 1ZY5A 3MFSA 3UPXA 2Z7LA 5L4QA 2BHEA 3SAYA 5HLPA 3FXZA 3CE3A 5HD4A 1CTPE 3A4OX 4QP8A 4XV9A 2VWWA 3Q2MA 4UYNA 2X9FA 3PJ8A 3RWQA 2V7OA 3NLBA 3FMNA 4O96A 5CEPA 4P7EA 4CZUA 4MXXA 5ANDA 2OF2A 1SNUA 4EUUA 4HVDA 2XH5A 2C6EA 2VTQA 3KN6A 4FG8A 4AX8A 5EQEA 4MD7E 2B53A 3HA8A 2PUPA 2ITOA 2XNPA 2FSMX 3QZIA 3SLSA 3SXFA 3AC2A 4EK3A 4FGRA 3LHJA 2JAVA 3NZ0A 2P2IA 4E3CA 3NW5A 4RIXB 4BDDA 3HRCA 4I24A 1H1RA 2SRCA 3PZHA 2XK3A 4UMTA 4YTCA 2PE2A 2GHGA 4U97A 3VUKA 5IH5A 4TYGA 3EQIA 2UZLA 2XZSA 3GP0A 3OROA 5AP2A 2IWIA 2PZPA 1RQQA 2VTSA 3F6XA 3BHHA 1FBNA 4GVAA 1GNGA 2PTKA 3KMUA 4O7ZA 3U4UA 3NDMA 2CN8A 3LCTA 3LFQA 1UWHA 4FMQA 2GHMA 2XYNA 2YM4A 4L43A 4UMUA 3ZFXA 4Z16A 3F2RA 3KF7A 5CAVA 5IEYA 3HMPA 4FTKA 4OT6A 3CD3A 2RG6A 1MRYA 4GIIA 4MEDA 1YW2A 3SW4A 2C6DA 4W4XA 3SX9A 2QHNA 3K3JA 3R1YA 3ZH8A 3C13A 4FKSA 4F08A 3C50A 4FEVA 1CSNA 1KE6A 4RC4A 3AD6A 3FMLA 3FXXA 3NUPA 2WTKB 2WMUA 2J4ZA 4EOSA 1XH5A 4QYGA 4KIQA 5AUTA 4IDVA 4GS6A 4MD8E 2VTRA 3NNWA 4IE9A 3ZHPC 3KK8A 2Z7QA 4QMSA 3QTQA 4X2GA 2WD1A 2XEYA 4I5MA 2BZHB 1O6KA 4ENYA 2X39A 5FM3A 3R30A 4P2KA 2IVUA 5HG8A 3HV3A 2G01A 4PDOA 4LRJA 4BI2A 4BTMA 4Q2AA 1RE8A 2XNNA 5BUEA 5FXSA 2YM6A 1TQPA 2VWVA 1DI9A 4TWCA 1G5SA 3F69A 4W8EA 1GZOA 2NRUA 4CKIA 3L8SA 2YACA 4JX3A 3R01A 2GHLA 3N4UA 3D9VA 4PP9A 5IUGA 2J0LA 4RJ4A 4AE9A 3G15A 4U0IA 3ZS5A 5C4LA 4BGQA 4IAYA 4JDHA 3T3VA 5K0XA 2XIRA 2R3LA 5CANA 1PYXA 2ZMDA 3MA3A 2FA2A 4RGJA 3MTLA 3RKBA 3MIAA 2GDOA 2EVAA 2GQGA 3CR0A 3O96A 5HVYA 4KBAA 5GZ9A 5C8MA 2F2CB 1M7NA 3KKVA 3QGYA 3HRBA 2UZOA 2B7AA 3QTIA 3ZONA 5L8JA 1Q24A 4HNFA 5CT0A 1KV1A 3HYHA 3PRIA 5I3OA 5AA9A 2B9HA 3CQWA 4X21A 4DEIA 2XIYA 1AQ1A 4FL2A 1VYZA 4L53A 4AUAA 4ZTHA 1KUTA 2X7GA 3PLSA 4L8MA 3AMYA 3VUGA 3KXNA 3GU5A 4X6QC 4JQEA 2GMXA 1ZMVA 4EZ7A 5AP6A 3U9CA 4FSRA 3KGAA 3RK7A 3GCUA 4A9UA 4FV5A 3A7IA 5KCVA 3QQGA 3BCEA 1G8AA 4RC2A 2BDJA 4D2RA 3U6IA 5M44A 3ZZEA 3A61A 3LQ8A 2YABA 3VBWA 3QKLA 2CCIA 3O50A 4S2ZA 3NAXA 3NUSA 4ZTQA 1NVQA 1OBGA 5EYKA 1GIJA 4F7SA 1FMKA 4M97A 5H9BA 2J51A 1W83A 4FTOA 3OMVA 4I6BA 3QQFA 4WG3A 4O86A 2GPHA 3PY3A 4XYFA 2XM9A 4BIDA 5I9ZA 5AAEA 1CDKA 2DUVA 3VAPA 4ACHA 1GZ8A 1E1XA 4FKTA 3FL4A 4O83A 3DKCA 4W9WA 5AP5A 2QURA 3FKOA 3MV5A 4BTKA 4FSTA 3LXNA 4RVKA 3V8TA 3UZTA 2XB7A 1OPJA 4BF2A 3WF6A 2UZEA 3OXZA 4QQ5A 3BRBA 4C33A 4DG2E 4FSQA 4CRSA 4FK3A 2XK6A 4BYJA 5DHJA 3LXPA 3Q2JA 3IO7A 2PZIA 4BHNA 5M4IA 3ANQA 4KIKB 3TNPC 3WF5A 3R0TA 1OL7A 3GU6A 2ONLA 4EZ5A 5F9EA 4APCA 4E6QA 4M68A 4BDCA 4IVDA 4I92A 3VW6A 4ZS4A 5DYJA 1PHKA 1LEWA 4RVMA 1MQBA 2Y7JA 3L9MA 1U46A 5CTPA 1W0XC 4G34A 3ID6C 4YC3A 3R83A 3B2TA 3NVKI 1F3MC 2X6EA 2X81A 3E8CA 3U6JA 3GU8A 4FKUA 4XG4A 3R8VA 4HOKA 4C4JA 1RDQE 1XBCA 4K1BA 5JK3A 5DR2A 4QMQA 3CTQA 2ITZA 2X7FA 4O0YA 3NNUA 3V51A 3EWHA 4DGNA 2Y0AA 4PMMA 3UO4A 4KS8A 4YO4A 3ROCA 4XG2A 5TF9A 2FSOX 4LUDA 4O0WA 4U40A 4XBRA 3DXPA 5KHWA 3NNVA 1OBDA 3QQKA 4MXOA 5A46A 3CEKA 4D2PA 5IA0A 4TY1A 3DPKA 1XH7A 3PVBA 4AN3A 3SVVA 4MXAA 4RWLA 3FE3A 2X1NA 3GCSA 5E8UA 1PXJA 2X8IA 3R8LA 3VS7A 4E93A 3ZUUA 1WBNA 1Q61A 4S30A 1GZNA 5ACBC 4FX3A 5HE0A 1PRYA 3PJCA 5CEIA 3OC1A 1JPAA 3WILA 4E6CA 5FXQA 5FTGA 3BGZA 4FIJA 2EUFB 2VGOA 2IN6A 3W10A 2LGCA 2ZM1A 4HGEA 4GG7A 2IPXA 4J7BA 3SKCA 2RKUA 3GFWA 3IONA 4I4FA 4QMTA 4F6SA 3DXNA 2P3GX 1VEBA 4N6ZA 5J95A 1YXSA 3EYGA 2PVLA 3OWLA 5KMKA 2F49A 5EYMA 2WMWA 5KKRC 3C1XA 3RALA 3ZSHA 4ZY4A 2ITYA 3D4QA 4EH6A 5AUUA 2UW9A 4ENXA 1ZYSA 3COMA 5IEXA 3FKNA 3LMGA 5AP0A 5F1ZA 5L6WL 3JVRA 3FZTA 3R7EA 5DIAA 4C2WA 4G3DA 4J95A 3F66A 4O0RA 5IDPA 3IG7A 1M52A 2WMAA 3AD4A 5DH3A 3HMIA 3H9FA 3Q9WA 1PMEA 4HPTE 3ZM9A 3PJ1A 4RIYB 4C59A 5EM6A 4XG6A 3PPZA 4QYFA 4FK6A 4FOBA 4IZ5A 4OTHA 3THBA 2YM3A 2C6IA 5FBOA 4PQNA 3MTFA 3RPVA 3DBEA 3OP5A 2B9JA 4QMPA 4IM3A 4GUEA 3PWDA 3TG1A 2IO6A 3R2YA 3F2NA 2O65A 2ZVAA 5GHVA 3QYWA 3FZOA 5AX3A 3FZRA 3QCXA 5JZJA 3AC4A 3OY1A 5LWNA 5DOSA 3Q3BA 5L8KA 4HCTA 2A0CX 2C1AA 4LV8A 4AACA 4UZDA 5DT0A 4NFMA 3DBFA 3UIBA 5DMZA 4M67A 1BLXA 4CYIA 2O3PA 1Z57A 4QTAA 5J79A 2Z02A 4AZSA 2ERKA 2B55A 3ENMA 3TKUA 3EMGA 4C34A 2C3IB 3D5VA 3KA0A 4NJ3A 4Y8DA 4E6DA 4I94A 4USDA 1WBWA 5E8WA 3UGCA 4IACA 4IX5A 5AR7A 5JRSA 2P55A 5BVFA 4FTQA 1YHSA 2F7XE 2E9UA 4L7SA 4JBQA 3ZXZA 1Q41A 4C4GA 4DYMA 3DTWA 3DNDA 4EONA 1I44A 4RPVA 5CQWA 4DFZE 2YHVA 3QA0A 4G5PA 4NCTA 5CXHA 2W5BA 3ALNA 3QQUA 4F4PA 4TNBA 2H34A 4D4SA 1VR2A 3ITZA 2WTDA 2ZV2A 3V8SA 5ICPA 3HNGA 4UMPA 3UDBA 4HVGA 2BIKB 1B38A 5M4CA 3V5QA 1DI8A 4O6LA 4ZSEA 4BI1A 3G2FA 5KMJA 2RFNA 2XK4A 4R3CA 4Y73A 3AC3A 2VTAA 2FYSA 3OT8A 4ZTLA 2BRNA 5J7HA 4LRMA 3F82A 3FPQA 3ZO4A 3GXLA 4AW2A 3I6UA 4XX9A 2FVDA 4D1SA 4L68A 2JKKA 5FBNC 1ZMWA 1U54B 3ATTA 1XBBA 5A9UA 4TWOA 2HXQA 4LL0A 4GT5A 4FIIA 4QMVA 5M57A 2PULA 3QC4A 4YJUA 1LR4A 3UC3A 2UUEA 2CKEA 3U9NA 4CFFA 5LJJA 4D5KA 4BCOA 3ORZA 3OTUA 4IWDA 1ZZ2A 4DG3E 2O8YA 3GQLA 3ACJA 2F7ZE 4CSVA 4FV1A 2QVSE 2JLDA 3AC5A 4G16A 1YVJA 4G6LA 2DYLA 2YAAA 3KRLA 4IAAA 1T46A 4AGDA 3R00A 5EM5A 2O2UA 4EH5A 2HOGA 4U7ZA 2IZRA 1CKJA 2R3JA 2WIPA 4EORA 1YHWA 4CEGA 1S9IA 4JRVA 5J87A 1OUKA 2J0JA 4CTBA 4FEQA 3NS9A 2GFCA 2CGVA 4AOJA 5AV2A 4CCBA 1MRVA 1H26A 4OTPA 4YZMA 3TDWA 3E8DA 4BCKA 1UU8A 3TNIA 5HX6A 3LMHA 4CD0A 5ANJA 2HENA 2WTVA 3D83A 4ARKA 2WMVA 3UOKA 3P0MA 4ZZNA 4BVUA 3G9NA 5H2UA 2JDRA 2WTIA 4ZTNA 3OCGA 3IW5A 5BVDA 2UW8A 4YJTA 3AC1A 3EKNA 3V5PA 3IOPA 2J5FA 1REJA 4FIEA 2UZBA 3VBQA 4RG0A 1Q97A 5IH4A 4XCUA 4BZOA 4WNMA 3OWJA 4M66A 3OCTA 4EOQA 4NTTA 3E88A 4IX4A 2W96B 4YHFA 4QMOA 1PY5A 4AZTA 3BELA 3EQFA 3QU0A 3COIA 4ACGA 3RPYA 3ZO3A 3PYYA 5K9IA 4B99A 3UQGA 1CMKE 3LOKA 4M69A 5I0BA 5AADA 3Q96A 3LVPA 4UX9A 4NL0A 1DM2A 3Q9XA 4WRGA 1W82A 2CN5A 2YEXA 3UNZA 5DR6A 4ANOA 1YRPA 4O22A 2CGUA 2PMIA 3G0EA 4RBLA 2EXEA 3WYYA 2I0EA 4JXFA 5M08A 4WBBB 2REIA 3QHWA 3I5ZA 1IAJA 4QMNA 4NSTA 3E7OA 4FTIA 4KKHA 1AGWA 3A2CA 4OBQA 4R7HA 4FTCA 4BCIA 4FKGA 4GK2A 3EL8A 5EYCA 1R39A 4RFYA 1OVEA 1SVHA 1FQ1B 3O0GA 3QCQA 3A62A 2R3HA 4BBEA 4YUQA 4AT3A 4O7VA 3F2AA 3BQRA 4FV7A 4YBKA 5DT3A 2C0TA 5HHWA 3T8OA 3VW8A 3U51A 3MB6A 1PXNA 3JYAA 5M53A 2YFXA 1JKKA 2UVZA 4KIOA 3VS3A 4U79A 3U4WA 4DN5A 2PUIA 1P14A 1FVTA 3MH0A 3LE6A 3T3UA 3MVJA 1YHVA 4MQ1A 4W9XA 3MGYA 4G9RA 2BRGA 4UMQA 5ANGA 4AF3A 5BVOA 2BAJA 3FI8A 5IPJA 4I1ZA 5CAUA 5EI2A 4HYUA 3UBDA 5CAQA 3TUCA 3G33A 3RTPA 3ZBXA 5C26A 5CNNA 4G6NA 1KE8A 3GQIA 2C68A 2B1PA 4KBKA 4WD5A 5DR9A 4X2KA 3WZEA 2QC6A 2W7XA 5AIKA 4ERKA 1IAHA 2HIWA 2A1AB 2PL0A 3OWKA 5GNKA 1GOLA 5IA1A 3PUPA 3REPA 4PDPA 3TKHA 2J2IB 4O0UA 2QHMA 4JQ8A 3MIYA 5LVNA 3MI9A 3F7WA 1X8BA 2VTMA 3PIZA 3QC9A 5D7VA 2XKCA 3U55A 3D94A 2ITWA 2R3IA 4RQVA 4HGSA 5A3XA 2OBJA 4WUAA 4E4MA 3O71A 4BDAA 4BN1A 5I9YA 2YCQA 5EKNA 4YZDA 5TKDA 4BIEA 3TM0A 1I09A 4ALWA 4FICA 4DCAA 1KE9A 5DE2A 3BLQA 3F61A 4IAKA 4I0TA 4OTGA 3TV4A 1IA8A 1WCCA 3R7YA 1V0OA 2B54A 4FZFB 4OAUC 3MJ1A 3TEIA 3DJ7A 1BL6A 2CPKE 2WKMA 3DU8A 3MH2A 4G17A 4E4LA 4FV2A 5TE0A 3OG7A 1OKVA 5CSWA 5L6PA 2H6DA 2YDJA 1LEZA 4WOVA 2R64A 4A06A 2VTPA 1Q8YA 4YJOA 1YWRA 4WO5A 4EOMA 3VIDA 1H24A 4L00A 3QLFA 3V8WA 3ACKA 3QQJA 4QYYA 1M7QA 1PMNA 3CY3A 1XR1A 2XVDA 1URWA 2F4JA 4PPCA 5JFSA 4Z3VA 1JKSA 4FKQA 3HUBA 3R8ZA 1NA7A 4QTBA 1JBPE 4PL3A 2J6MA 4GK3A 2OSCA 2PMLX 3CD8A 3KC3A 4UWYA 4A4LA 4C4EA 3S4QA 4OTQA 2O63A 2BRHA 2VNWA 3R8MA 3DKGA 4YBJA 4FSWA 1ZRZA 5LMKC 3MB7A 4DCEA 2C0OA 4AZFA 5CSHA 2BKKA 5K4JA 3IDPA 4FG7A 4D2TA 3P7CA 4FIGA 4H58A 2WU7A 3K54A 2P4IA 4EWQA 3CQUA 1OUYA 3VUHA 4BKZA 2R3MA 3U87A 3MSSA 3D5WA 2J7TA 2Z2WA 4M14A 4YSMA 2P33A 4HVHA 3KXZA 5IEVA 4Q9ZA 1HCLA 4FKLA 2GTMA 1OKWA 2W9ZB 3NAYA 4JIKA 3C0IA 3LXKA 4Y95A 2G1TA 3V5WA 4IZAA 4BWPA 2ACXA 3Q9ZA 3HAMA 4HGTA 1MP8A 3FY0A 3S00A 2UW7A 4JAJA 4CTCA 5B7VA 4BY9E 4JVGA 5DG5A 4H3QA 2Y6MA 3F3WA 1KE7A 4DH7A 3OEZA 1UNGA 4ANNA 3NCZA 1W84A 4IB1A 5M4FA 3TNQB 3V01A 3SRVB 5HICA 4GEOA 3WIGA 3O17A 2QONA 4RIWA 3UZPA 4FT3A 3LAUA 3F5XA 4IAIA 1TKIA 2BCJA 4U3ZA 4XV1A 3E8EA 4ZIMA 5HE1A 5IISA 4ZS0A 4PTCA 2UZWE 4BDKA 3C51A 4D58A 2W0JA 4O2PA 4AW5A 3QBNA 4C8BA 3FPMA 3D7TA 4DFXE 3RINA 2EB3A 1UNHA 2GSFA 4K9YA 4FKRA 5IQFA 3D2IA 1B39A 3CSVA 4WNPA 4FNYA 3FI4A 4X3FB 2NNWB 4L52A 4C4HA 3IECA 3PPJA 2C3LA 2VTIA 2ZAZA 4W4YA 5KBQA 2ZV9A 3F9NA 4IWPA 4M13A 3C4WA 4MNEA 5AUXA 3ZC6A 4YR8A 2ZOQA 5AP7A 5AEPA 3QF9A 5CF8A 5E8YA 1BI7A 2XEZA 4IANA 3FZSA 1J3HA 5DEYA 5CENA 2E9NA 2QD9A 2XYUA 2BUJA 2JDVA 3FWQA 4PPAA 3L8PA 3EOCA 5FD2A 4AZVA 1H1QA 4PY1A 3PXRA 4DGOA 5C8NA 4M0ZA 3L9PA 3QZHA 5CVGA 3PXKA 3KF4A 3NMUF 4ITJA 4CV8A 1QL6A 2YIRA 2BVAA 4USFA 2Y4IC 4CZYB 1LPUA 5FDPA 2PMOX 4K0YA 4GL9A 4WNOA 1YQJA 3L1SA 5TO8A 5A4EA 5BVWA 3P86A 5HE2A 4I6QA 5KZIA 4KSPA 4APPA 1WVWA 4D0WA 5I9UA 4FKPA 5C8KA 2I6LA 3NYNA 4BTFA 3O7LD 4DEBA 3M11A 1ZMUA 4RLLA 3I4BA 2JDOA 2A27A 1H0WA 3VS6A 3KRXA 4L01A 3WBLA 2ERZE 3QD2B 4AT5A 2OJGA 3KEXA 3PXYA 5E8VA 3UOJA 5F20A 1IASA 5AUZA 4C62A 4O7NA 3NYXA 4O38A 5CYIA 3VJNA 4EK4A 4NYEA 4OTRA 1LUFA 2CGWA 2W1HA 3UTOA 3DAKA 4WBOA 4N70A 3TZ7A 2UZNA 4FI1A 4YJSA 2VTHA 3ODYX 1H4LA 4NM3A 4XG7A 5HLWA 2A2AA 2IJMA 3EFWA 3ERKA 1S9JA 4DINA 5KHXA 4KWPA 4AN9A 4G5JA 4IZ7A 4LRKA 1PMUA 4UV0A 2YAKA 5A4TA 1URCA 4XV2A 3V3VA 2BZJA 4TKSA 4BCGA 2BTRA 1BUHA 2W9FB 2XRWA 4TWPA 2C0IA 5EHLA 4ZSLA 4EH3A 5M07A 3E92A 1R78A 4RX7A 4Z7GA 2VTLA 3E3PA 3QRTA 5GJDA 1IA9A 1P4FA 3OF0A 3VJOA 4FEUA 4A4OA 2OZAA 2OZAB 3NUXA 2IVVA 4M0YA 5FEQA 1IRKA 4I5PA 4ZY5A 2PE0A 3HVCA 4C3FA 1GIIA 2JBOA 5ETAA 1UKHA 4F1TA 3R2BA 3WOWA 2ITNA 2YCSA 3WI6A 2XBJA 4TYEA 4UYAA 3D15A 5LVOA 3CGFA 1U4DA 3BPRA 5BVNA 4YZ9A 4L3LA 3QRUA 1SVEA 4XP3A 4FTLA 5F94A 4R7IA 1YXTA 2IVTA 4AW0A 4FVPA 5E91A 4LGDA 3FBVA 1GJOA 3TCPA 2HYYA 4D9UA 3G0FA 5CU2A 5BVEA 3Q5ZA 3V04A 3CPBA 5LOHA 3AOXA 3JXWA 4HZSA 5KMIA 2XK7A 1KE5A 3KB7A 1ZOGA 2WO6A 3FL5A 5HVKA 4G3FA 4L3PA 4QMYA 4WHZA 4MTAA 3H4JA 3ULZA 4FT5A 1UKIA 1NW1A 4GK4A 4N57A 2VGPA 3AT2A 2GU8A 4FV0A 4ZJJA 3N51A 5ACKA 4KAOA 1JLUE 5HX8A 4XLIA 1BYGA 4P5QA 3IGGA 3PXZA 5BVKA 2CSNA 3E62A 3D5XA 5EKOA 3ORXA 3DKFA 3PIYA 3PSCA 5KMMA 5JSMA 4HGLA 5FDXA 5IQGA 1PMVA 2HW7A 5HCYA 5JZNA 3PP0A 5J8IA 4ANMA 5ANOA 2CDZA 2JD5A 3EFJA 2KTYA 3EJ1A 4O82A 2RL5A 1IEPA 3E5AA 3VBXA 3WF9A 3QRIA 5D9HA 4D4VA 4A07A 3TJCA 4U3YA 4AFEA 2QOFA 4RA5A 4QP9A 2G15A 2W1DA 3Q4CA 2VWBA 3K3IA 1GZKA 2VO6A 5IQHA 3RMFA 1XHAA 4FZ6A 4BZDA 1A9UA 4MF0A 1H00A 3FLNC 4S33A 4E20A 2F7EE 4XUFA 4BR3A 4DTAA 1WBTA 4IH8A 1E9HA 4DH8A 2NP8A 2QOIA 3B2WA 5CAPA 5D12A 4JQ7A 4EHZA 4F9YA 2Q83A 3PA3A 3KN5A 3VC4A 3F5GA 4KABA 5EG3A 3V5JA 3GCVA 3V5TA 5A4CA 4J97A 4WT6A 3S0OA 3K5VA 1XH9A 1KWPA 4QMMA 5AUWA 5E92A 4EK8A 2UV2A 1M17A 1PKGA 4JDIA 3WE8A 1Q4LA 3GU4A 4J71A 1Q62A 3W18A 2B4SB 4D0XA 4HVSA 2ITTA 3OD6X 3R6XA 3VN9A 4WRSA 2NRYA 3A8XA 3ORKA 5L3AA 3O51A 2VZ6A 4KKEA 3VULA 4EKLA 5I5ZA 3WZKA 4GCJA 2CCHA 3ZEWA 2QNJA 3H0ZA 2UW4A 4L6QA 4HCVA 1M2PA 3FI2A 4OTFA 4TN6A 5EHYA 4DEEA 4F1MA 4BCMA 3FC2A 5IA3A 3QKMA 2CLXA 3G9LX 3RAWA 4E8AA 4QTEA 4M3QA 5F4NA 4BWXA 3GC7A 3UOHA 3R7GA 1Z5MA 3RVGA 1CM8A 1NY3A 1YI4A 4Z9LA 4E6AA 4ID7A 5EYDA 5D1JA 3CBLA 3JPVA 4JI9A 2WOTA 3I5NA 3JR1A 3MFRA 4KUJA 1ATPE 3FZ1A 2WMTA 3VHKA 3VQHA 2OXXA 1SYKA 4FKVA 3LM5A 2WEIA 2YM8A 3DA6A 3G6GA 3RK9A 2O0UA 3U54A 4X7QA 1H0VA 3AT3A 1LP4A 4C58A 1UU9A 3ORPA 4EK5A 4ZK5A 1ZYLA 2Z8CA 3PE1A 1AD5A 2XNEA 4YU2A 2B9IA 3H0YA 5M4UA 4TT7A 2ZMCA 4D28A 4O0TA 4DG0E 4F65A 3R1NA 3WF8A 4BBFA 3L9NA 4GIHA 4QT1A 5E8TA 3OWPA 1Q99A 1MUOA 4L3JA 2NO3A 3NPCA 1IG1A 4BICA 5FP6A 4BL1A 3F3UA 3AXWA 1OB3A 3O8TA 3EL7A 4D2WA 3DJ6A 4AU8A 1XWSA 5AV1A 2W1CA 3FQEA 4IFGA 3LPBA 4GFMA 4DEHA 2X0GA 4GH2A 5HNGA 4B6LA 5JKGA 4AA0A 5L2QA 1V0PA 4YJPA 3RAKA 3NVMB 3FUPA 4O84A 3R7VA 2Z7SA 4UBAA 4QMXA 2PYWA 3CIKA 2P2HA 4J96A 3M1SA 3AQVA 4EYJA 4FSNA 3MY1A 1UVRA 5EFQA 4CT1A 4FNZA 3WZUA 1M2RA 1NVSA 4X3FC 5JT2A 3QGWA 3UO5A 3A60A 3I0QA 4IBMA 4TW9A 4ALUA 3QRJA 5CX9A 4A9SA 4C02A 4BCJA 4Z7HA 5I9VA 2GNFA 2ITVA 4HYIA 3LMIA 3R7IA 3DJ5A 3QUEA 4KD1A 4IDTA 3EZRA 3I79A 5J9YA 2JKQA 4RZWA 4K33A 3DV3A 3P78A 3OOGA 4J98A 3LKMA 3OCBA 4DFYA 3MY5A 3A7GA 5AIRA 4FODA 2JIVA 3HMOA 1QCFA 3PSBA 3TTJA 1OZ1A 2QCSA 3UVPA 3QKKA 4C57A 3COKA 3GI3A 3PVWA 2CKOA 2PVKA 3PXFA 3IPHA 1PF8A 3TJDA 4YC6A 5BYLA 2UZTA 2YWPA 3CKXA 5TT7A 3UNJA 3ROYA 4U8ZA 1NT2A 3A7FA 2RFSA 4MF1A 2E9VA 5BQ0A 2R3QA 5CU0A 4KSQA 4EOLA 2CJMA 1WAKA 3HEGA 2QOKA 5FEDA 4IX3A 2AC3A 4E7WA 2PVMA 2GNHA 2WHBA 1TQIA 4D9TA 3ZBFA 1WZYA 3DKOA 3DAJA 4JT3A 3NYOA 3BYSA 3WE4A 4DHFA 3DAEA 4KRCA 2VRXA 4NFNA 4UN0C 1Q8WA 2OFVA 4LMUA 5EHOA 4F9BA 3FMDA 3QCYA 4EHGA 2CMWA 3KFAA 3E93A 1Q8ZA 4FBXA 1XKKA 3VBVA 4EQUA 3BYOA 3COHA 4AN2A 4FV3A 5DWRA 5IZFA 3VUTA 4GFGA 2PMNX 5C9CA 4JS8A 4QNAA 3UQFA 3H3CA 2Q0NA 4JNWA 4LUEA 4QTCA 2OFUA 5HIEA 3KU2A 4NTSA 2OXYA 3W2PA 4DFLA 3T9TA 2IZTA 3HV5A 3SXSA 3ZFMA 3C5IA 5GJGA 5EW8A 1OECA 4RVTA 4BDIA 1WVYA 3CLYA 4WSQA 2XKEA 4RWIA 3SA0A 3PFQA 4C38A 2OG8A 2QR7A 3DFCB 1PKDA 4I6HA 4QPSA 4XS2A 2W1FA 1O6YA 4CMUA 4FE2A 2BRMA 3BWFA 5JRQA 3QLGA 3VS2A 3MDYA 2YIXA 3ZDIA 2UVYA 4FNWA 4LM5A 3ZYAA 5HU3A 2JEDA 3ZLWA 2W4OA 3FLYA 4RFMA 4AQCA 4TYHA 4PUZA 4YMJA 2XMYA 4XBUA 5DRBA 4FTNA 4MD9E 3LFEA 5HO6A 1VYWA 1J7IA 2JBPA 1R3CA 3NX8A 4IXPA 4TYJA 3HZTA 4CRLA 3VWAA 4QRCA 4YNOA 4EOPA 3B8QA 3RGFA 3IGOA 3G6HA 3DCVA 5H3QA 5C4KA 4S34A 4CG9A 5A6OA 2XNOA 3TIYA 5DFPA 3F5UA 3NR9A 4HYSA 4O27B 5EDRA 2QOQA 1IR3A 5J5TA 5K5XA 5KMNA 4O7RA 4IQ6A 4QP4A 4O81A 3D7ZA 2KULA 2PY3A 5LQFA 2WTKC 4PMTA 3CTHA 3GBZA 5IA4A 3OW4A 5LMKA 3CCNA 3Q6WA 4FUXA 2QOCA 2W99B 4I93A 4ZTMA 4DA5A 3P79A 1H27A 3VHEA 4ZTRA 4OTIA 2Z7RA 2XS0A 4CT2A 4PDSA 2ETKA 2O64A 1G8SA 3BGPA 4HCUA 2R2PA 3TZ8A 2PVJA 2PSQA 4ITIA 2G2HA 4WIHA 3HECA 3CC6A 4RJ8A 5M06A 3MPAA 4F9WA 5ETFA 4AGWA 1QMZA 4YZNA 2YDIA 2EB2A 3ZRLA 1QPEA 4NH1A 2BR1A 1CKIA 4BTJA 2GNJA 5EW3A 2XK9A 3MS9A 3L9LA 2FH9A 4O2ZA 2OIDA 1F5QA 2GQRA 3MPMA 3QTXA 3PY0A 4H3BA 3RZBA 1NVRA 3OBGA 4MYGA 1WBSA 2VV9A 5KO1A 2GNIA 4MCVA 1FVVA 4G3GA 4V05A 5HEZA 5E1SA 4G2FA 1OIQA 5JGDA 2OIQA 4V01A 2BDFA 1FOTA 1G3NA 4IIRA 5HO8A 5A14A 5FG8A 2X8EA 5CF6A 2VN9A 3KULA 2YA9A 2OH0E 1FGKA 1STCE 3P08A 3QUDA 2C5VA 5HKMA 3W16A 5HESA 3PLAE 4IAZA 4R1YA 4J52A 2CHLA 1PXIA 4F0IA 5CU4A 4DE4A 3RCJA 3WIKA 5AAGA 1FMOE 3C0GA 2WFYA 4PX6A 1OL5A 3IW4A 4CCUA 4CKJA 5CY3A 2XIKA 3P4KA 2WMSA 3LFAA 4TXCA 3QD4A 1L3RE 3GFEA 5AX9A 1Q3WA 3MFTA 3OZ6A 2J0IA 3EQCA 3LCKA 4IB5A 4BCFA 5AJQA 4BRXA 5FTOA 4MQ2A 1UNLA 1OL2A 4ZLZA 3OFMA 4JDKA 5T68A 4DH3A 4U81A 3U8WA 3UO6A 3FAAA 3BQCA 2LAVA 4AP7A 1XH6A 3FDNA 4I3ZA 4DTKA 2XCHA 2YN8A 3SOAA 4RX5A 1OM1A 4O91A 4YHTA 3NRMA 5AR4A 2C3KA 3Q4TA 4A9TA 3BU5A 3MFUA 2HCKA 3F7ZA 4EH2A 4M69B 3PG3A 4PMSA 4U44A 5T6KA 5GZ8A 2CNVA 4P4CA 5AV3A 4EQMA 4RJ3A 2ZB1A 3LXLA 5DLSA 5ANKA 3VBTA 4EI4A 3MJ2A 3DGKA 1XH8A 1WMKA 2C3JA 2ZV7A 1REKA 3RAIA 1R1WA 3GC0A 4IEBA 3R7UA 2C47A 2YLEA 4BKJA 5JQ8A 4MWHA 5C01A 2QLQA 4LG4A 4F7LA 2X7OA 5KMOA 3AT4A 3BU3A 4FKWA 3MPTA 4RMZA 5K3YA 3RM7A 5AV0A 1P5EA 4EH9A 3TI1A 4F9AA 5H8EA 4MX9A 5EDPA 5IU2A 4BB4A 4IB3A 2EXMA 2ITXA 3F3ZA 4FT7A 4ASEA 5BYYA 3S1HA 3D2KA 4ZZOA 2HZ0A 2ZV8A 3ZM4A 3LFCA 4WG5A 4JX7A 4CMOA 2FO0A 4ZY6A 4HPUE 1U5RA 3EZVA 4BIBA 4R5SA 2PZ5A 4IFCA 3ORMA 2Z60A 4CFUA 4CFMA 3H9RA 3UIXA 3KXHA 3GT8A 3D0EA 2YIYA 4ASDA 3EN6A 4U41A 3BU6A 4H1MA 3EQHA 2C5OA 5AUVA 5CEMA 3PRFA 3DNEA 3OW3A 3BHVA 3KRJA 3POOA 4RJ5A 5HI2A 5A6NA 3ZSIA 2OZOA 5HCZA 4C37A 3FYKX 4NKAA 2R5TA 3FMHA 1XO2B 4GW8A 4XRLA 5CS6A 4ACMA 2J90A 3F88A 5I9XA 3OY3A 4G6OA 1H1SA 3EFKA 4PMPA 3PXQA 1OMWA 2A4LA 4AG8A 4ASZA 2Y8OA 2WQNA 4NW5A 4O0SA 2VWUA 3BHUA 3II5A 4PP7A 4HJOA 5CXZA 4PTGA 5AMNA 2CLQA 4JJRA 3H10A 4FOCA 3JS2A 1H01A 4ZEGA 3R9DA 3W2OA 4NWMA 3ZDUA 1B6CB 3I7CA 3KQ7A 3P9JA 4M12A 2C6MA 5EK7A 2CKPA 4CVAA 2W1ZA 4YPDA 3U6HA 3UVQA 4F99A 4FSMA 5J9ZA 5HBHA 3Q60A 4MHAA 2G2IA 2WZJA 3H30A 3HP2A 5CF4A 4K8AA 3VS1A 3C7QA 5IQEA 1JWHA 3DQWA 4I6FA 4P90A 2QO9A 3O23A 2XJ2A 4GKHA 2GNGA 5FGKA 4DFBA 2VU3A 1K3AA 3UE4A 3K2LA 4N4SA 1PYEA 2ZDTA 2WU6A 3ZTXA 4YJNA 3FYJX 5LARA 4GT3A 4UXQA 1SZMA 2YJRA 2PK9A 3RPOA 3MH1A 4KB8A 1A48A 4RFZA 2GQSA 1K9AA 4UXLA 4X0MA 3WZJA 4JG8A 2W4KA 2J5EA 1JQHA 2QOHA 4R1VA 5BYZA 4OTDA 1M14A 1ZZLA 3ZEPA 5FXRA 1V0BA 1O6LA 3PY1A 5HIBA 4ITHA 4C7TA 2X6DA 1JOWB 3VNTA 2W17A 2WTJA 2BKZA 5CEOA 3KY2A 5CI7A 3EKKA 5EI6A 4CFXA 2V5QA 4LI5A 4B7TA 1TQMA 4CQGA 3LIJA 5CASA 5JFVA 3CP9A 4GSBA 3PZEA 4DGGA 2HWPA 1J1CA 3T9IA 5E1EA 4QMUA 2CNUA 5AAFA 2ZM3A 3E8NA 4CGAA 1PW2A 2Y6OA 1H25A 5FRIA 1L8TA 3NW7A 3PJ2A 5LWMA 2BAKA 5M55A 4GYGA 5CU6A 5IA5A 4TZRA 3HRFA 1R0EA 3EN5A 3R9HA 4DEAA 3KMMA 2WPAA 3QHRA 4JR7A 3O8UA 2BRBA 5J1WA 1XQZA 4QYHA 4P5ZA 3RAHA 3ZUVA 3DLZA 3R9OA 1H08A 4JIAA 4CFWA 4E1ZA 1OIUA 3I0OA 4YTFA 2HXLA 3A4PA 3FV8A 3RPSA 2H96A 5FTQA 4IVCA 3N4TA 3ORLA 4IM0A 4AXAA 2WMBA 2HZ4A 4H36A 4U6RA 3QTZA 5D11A 3LJ0A 4LGHA 4V0GA 3PJ3A 5CNOA 4HZRA 2PU8A 3NW6A 4YPSA 3QWJA 4RWKA 4RIWB 4JBOA 1SVGA 1YXXA 2XA4A 3W8LA 5HU9A 2WAJA 3BLHA 3CTJA 4NW6A 3TDVA 4I20A 3FC1X 5JFWA 5KMLA 3BYMA 1FGIA 2PWLA 4QYEA 5GIOE 4RWJA 3RHXA 3D7TB 4F6UA 5FEEA 1YI6A 2E9OA 1W8CA 3PA4A 4XOYA 1H07A 2R0UA 1BMKA 4ANSA 3QZGA 2EU9A 4F0FA 4FNXA 4XJ0A 4D4YA 4A9YA 4DC2A 4QQTA 3QZFA 4BDHA 3QCSA 4BHZA 3IDCA 5ETIA 5KZ0A 4O7SA 1OI9A 4RZVA 3RI1A 3H9OA 3F5PA 4MNEB 4RJ6A 2J0MB 4H39A 3RZFA 4EC8A 3POZA 4EOOA 5DEWA 3VS4A 2QO7A 3PA5A 4AGCA 5KUPA 3G5DA 4DGMA 1J1BA 2YLFA 4IJPA 3ZOSA 2C6OA 5IMEA 2WQBA 2UW3A 4WG4A 2VX1A 5HGIA 4QP6A 4Q5EA 4ZLOA 4ZSJA 3DT1A 5F95A 1JVPP 5KNJA 1MRUA 2ZB0A 2IW6A 5D41A 2W1GA 1VJYA 4FT0A 2BZIB 4XNEA 5HD7A 2JFLA 2AC5A 4IWQA 1Q8TA 4NKSA 3UODA 3DLSA 4A7CA 4EH8A 4NEUA 2R3GA 3SG8A 3P5KA 4CZTA 2X9EA 2OW3A 3HKOA 4JAIA 1YDRE 5AR8A 4DLJA 2VX0A 3FSKA 1M2QA 3BZ3A 2RIOA 5IKWA 4F9CA 1KOBA 3GOPA 2WELA 3R02A 3W1FA 3W55A 4BCPA 2XNGA 4D1ZA 1Y8GA 3NUYA 4CLJA 4FTMA 3QD0A 3QRKA 4DFNA 3FXWA 1OL1A 4MBJA 4OGRA 4UZHA 4EC9A 4E4NA 2BALA 4ERWA 3UQCA 2RF9A 1OITA 2B9FA 4FF8A 4DF3A 1EH4A 4F6WA 3SGCA 3SD0A 3SW7A 5DBXA 3VUMA 3ZMMA 3I1AA 4TPTA 4TL0A 4CV9A 2HW6A 2IZSA 4RX8A 3EQRA 4O7LA 2PVHA 4RQKA 1RW8A 4CQEA 4FZAB 2OGVA 5J1VA 5M09A 3S2PA 4BCNA 3KRRA 5HTCA 5ITAA 3PSDA 4PNIA 1BL7A 5KKRB 4ZMFA 1KOAA 4K2RA 5C27A 4AE6A 4FTRA 2Q0BA 5IDNA 5K4IA 3P7AA 4MH7A 4YTHA 5G1XA 3RP9A 3BE2A 2WMQA 3GGFA 5CZHA 2OLCA 3ANRA 5HG7A 4RX9A 5EOLA 4MAOA 1ZOHA 4D5HA 3TN8A 2QOOA 5LXMA 3TNHA 3DFAA 2X4ZA 5DN3A 4F63A 1JNKA 2W05A 1W7HA 5EQPA 2JITA 1GY3A 2J50A 4H05A 5AWMA 4NUSA 4OBOA 4ZJVA 4ONAA 3IW8A 3DK7A 2YZLA 2YIQA 1YOMA 3L8XA 4B8MA 4RIXA 3HLLA 3PVUA 1U59A 4F7NA 3HMMA 2BHHA 3QQHA 1Q5KA 4AA4A 4BCHA 3R22A 3DY7A 3FKLA 5ANIA 3EB0A 5CWZA 3TUDA 1Q8UA 3SHEA 3NEWA 3F3VA 3DZOA 4BI0A 3HUCA 2BROA 3ZLXA 4ZJIA 5CSXA 1YXVA 4K77A 2BPMA 4JL9A 3DXQA 3W33A 5LCJA 3C4XA 3MA6A 2JGZA 3Q4UA 4HNIA 4W4VA 1O9UA 5L8LA 3IKAA 2BFYA 4ZZMA 3ZSGA 3C4EA 5J9LA 1NXKA 2IVSA 2IW9A 3FZPA 4FV6A 4TNDA 4WA9A 4B4LA 4FKOA 3UYSA 3DK3A 3R04A 3ZRMA 4BZNA 3GCPA 3AC8A 2EWAA 3W8QA 4IX6A 4QMWA 3MY0A 2PVFA 4XRJA 4G31A 3IS5A 2G9XA 5FQDC 3FHRA 3DZQA 3HA6A 3TNWA 5BX0A 2AYPA 3DDPA 3WZDA 2XBAA 3VUIA 2C5NA 5BNJA 3TIZA 2B52A 4XP2A 4BDFA 4FL3A 3ZO2A 2XKDA 3KRWA 1UWJA 5K0KA 4B9DA 3R1QA 1YI3A 3SOCA 5H8BA 1Y91A 3HDMA 3GC8A 4H1JA 4KBCA 3FLQA 3V6SA 4ALVA 2QOLA 3CGOA 4UB7A 1HCKA 4ZTSA 4PTEA 5E9EA 3DS6A 3PG1A 5JFXA 2E2BA 3FQSA 3HAVA 3LCSA 3KXMA 4XG3A 4FUYA 2R3OA 4R3RA 4F64A 5L2TA 4NU1A 3HGKA 1E1VA 5EH0A 3TUBA 1DAWA 3P23A 4GYIA 3PPKA 5ANEA 5T3QA 3LCDA 4RVLA 4R5YA 1ZWSA 3QXOA 4FVQA 4IW0A 3UG2A 2RG5A 1J7LA 5JH6A 2YJSA 3MH3A 3OUNB 4QP1A 3E7VA 1YXUA 4LYNA 3CY2A 4QMZA 4BYIA 4CFVA 2JC6A 4FEWA 3AMBA 2R3PA 4E5AX 4X2JA 4L46A 3EQBA 3NNXA 4EQCA 2BILB 4QP3A 4KS7A 4WNKA 3W2SA 5HQ0A 3BHYA 3PIXA 3QQLA 1YDSE 2QI8A 3DK6A 3E64A 4QNYA 3KVXA 2W4JA 1PXPA 3Q5IA 3R7OA 4YLLA 5EOBA 3QYZA 4C2VA 5CALA 2YWVA 3OCSA 3OVVA 1RJBA 2QOBA 3BYUA 3DTCA 4LOPA 5CSPA 4JDJA 3Q04A 4W4WA 2UW6A 3QTSA 3PP1A 3ZFYA 2W06A 4OUCA 4S32A 4YTIA 3ODZX 3BE9A 4C35A 3RWPA 2OIBA 3KL8A 1YDTE 2DS1A 3MW1A 3MWUA 3DB6A 2DQ7X 2XRUA 3KVWA 4G3EA 4J8NA 1HOWA 5GIPE 2HY81 4D4RA 5C03A 4RJ7A 2JKMA 5EW9A 5IA2A 3UP2A 3FI3A 1ZARA 2XCKA 3QL8A 5ETCA 1ZLTA 2XUUA 4GKIA 3GVUA 4FZDB 2WGJA 2JIIA 3I81A 4V04A 1PXLA 2XIXA 1PJKA 2BTSA 2C69A 4EKKA 4U45A 2X4FA 4R6VA 3C9WA 3IQ7A 4OW8A 4JOAA 3BGQA 4UALA 2V0DA 5JGBA 5IQBA 3FMJA 3WF7A 4XMOA 2OO8X 2VNYA 2YERA 4PDYA 4NK9A 4BDEA 2VWYA 4L45A 5JMSA 3EH9A 4XLVA 4JBPA 3GC9A 1Y57A 4NM0A 3NSZA 3BV2A 4C4FA 2RFDA 5KBRA 4L44A 1R0PA 2VTJA 2B0QA 4QOXA 4E26A 4GJ2A 4OLIA 3MESA 1OIYA 4DH1A 3Q6UA 4AFJA 4KIKA 4Q9SA 2GS6A 2XM8A 4EOJA 3NWWA 2YCFA 5M56A 3BIZA 1KV2A 3DQXA 1DS5A 2YM5A 5D7AA 3UIUA 4NJDA 5HG5A 4TRLA 5AR5A 2FGIA 4N0SA 4JG6A 4CXAA 2R0IA 5BUIA 1BI8A 1YWNA 4YURA 4TWNA 1ERKA 1Y6BA 4JLCA 4X6RA 3ZU7A 2XP2A 2BDWA 2XIZA 4UMRA 4MXCA 2O5KA 3R8PA 4FVRA 4AOIA 4FA2A 5B2LA 3CQEA 4KINA 4O1OA 3VS5A 2GFSA 4FR4A 4E5BA 4O7YA 1PXKA 2IZUA 4XG9A 4W8DA 3Q9YA 4A4XA 4R78A 4K11A 2WB8A 3HMNA 4YNEA 5M51A 2W5AA 3RPRA 1YOLA 3LJ2A 3O2MA 4YZCA 5JQ5A 2R3KA 2I0VA 4LOOA 2J0KA 3WARA 3C5UA 5KE0A 4EOIA 2WTCA 3FMEA 1W98A 2YDKA 3N9XA 3EQPA 4M15A 3W32A 4AZEA 4C4IA 1J91A 1JAMA 3FMMA 4FKJA 1A06A 4YJVA 2HWOA 4OTWA 5L6OA 3HDNA 4YP8A 4FL1A 2QU6A 3JVSA 3OXIA 4FV8A 4RSSA 5A4LA 5LVPA 2PVRA 3QA8A 3W2QA 2GCDA 4QO9A 3VVHA 2QG5A 2C1BA 5HCXA 4KIPA 4LMNA 2F57A 3RCDA 4U43A 4BDGA 1V1KA 3BYVA 3DBQA 3C4FA 3FMKA 1TVOA 4GU6A 4Y46A 2XKFA 4BFMA 4DAWA 3TZ9A 4ANQA 4RA4A 5E90A 5IG1A 3R9NA 4O7WA 3MVMA 3PVGA 4MBLA 3D5UA 4RLKA 3G51A 2PUNA 2RGPA 4M84A 3JY9A 3DDQA 4IC8A 2VO0A 4XEYA 4FTTA 4ZSGA 2QLUA 3NUNA 5AR3A 2I0YA 4DTBA 4MVFA 2R7IA 3IK3A 4AZWA 2HAKA 4FIFA 4O7TA 2IG7A 2ITPA 4X3JA 4MK0A 4QQJA 4MNFA 5GJFA 5EI8A 5IMXA 1UA2A 3ALOA 3F3TA 4AT4A 2UVXA 2ZDUA 4MBIA 2WIHA 2CKQA 2R9SA 4F1OA 4U80A 5IQAA 4DBNA 2GNLA 1P4OA 2VTTA 2VAGA 4YGAA 2H8HA 2BAQA 4YC8A 1ZYDA 5AV4A 5CT7A 3VBYA 2BZKB 4UEUA 3OHTA 4RC3A 1Q3DA 3QFVA 5HBJA 4TYHB 5FWKK 1H8FA 1KSWA 4RIYA 2CNQA 2JDSA 4TTHB 5HNBA 2C4GA 3LLTA 3UG1A 4EJNA 2WXVA 2FUMA 2VO7A 3EQGA 4PL5A 5DRDA 5IUIA 4E4XA 4HVIA 3PDTA 2W1IA 3NYVA 4ZSAA 3NIEA 3A99A 4PNKA 1Y6AA 5G6VA 3VS0A 3BI6A 3GUBA 3OOMA 3UIMA 4O0XA 3IOKA 4OBPA 4BDBA 2VWIA 2JAMA 1UU7A 4PF4A 4BWKA 4GV1A 1UV5A 2PHKA 2QQ7A 3VUDA 4BDJA 4LQMA 2HELA 2I1MA 5AM7A 3KREA 3D14A 3UOLA 2GS2A 4C36A 4AOTA 4G3CA 3AD5A 4F7JA 2VUWA 3AGLA 3OUKA 4DEDA 4GFOA 3HP5A 1YWVA 3GNIB 5BMSA 4R3PA 1FPUA 3ELJA 5J7BA 3IDBA 4GVJA 2X8DA 3O8PA 5LVMA 2JKOA 5EDQA 4X2FA 4XHKB 5CZIA 4ZMEA 3OEFX 4Q5HA 5AFVA 5AUYA 4PPBA 4FTUA 3FQHA 5FUTA 2C6LA 4L42A 4FEXA 2QODA 4EYMA 1BKXA 4C0TA 4M8TA 1OPKA 3EIDA 3TT0A 4EBVA 1ZOEA 4ANBA 4RT7A 5HIDA 2Y9QA 2YIWA 3GENA 4RIOA 5AR2A 4BCQA 4K6ZA 5IQCA 1WBPA 4F09A 4UWCA 3TWJA 2OKRA 5HLNA 2V7AA 2P0CA 3R9RA 3ZLSA 1U54A 4IMYA 1QPJA 4CMTA 4PRJA 3BLRA 4EH4A 3EN9A 4O6EA 3HL7A 3BEGA 3BBTB 3EN4A 3KULB 4NM7A 2ITQA 4ZLYA 5I9WA 3CPCA 2V22A 1XH4A 1JKLA 5AP3A 1WVXA 2QKRA 4FTJA 4BGGA 2F2UA 4F70A 1WBOA 4YLKA 3BX5A 3NUUA 3RNYA 4UWBA 5L2IA 5E4HA 3GCQA 3R8UA 4OR5A 4EK6A 1ND4A 4U42A 4Y85A 2FSLX 2PZRA 5DI1A 3UP7A 2VTOA 2RFEA 2I0HA 1JKTA 2PE1A 3EQDA 4M7IA 3W2RA 4CKRA 1F0QA 2V62A 2XJ0A 3EYHA 4GUBA 4FT9A 4L67A 4Y83A 3EHAA 5LCKA 4K18A 5IF1A 4FZ7A 1J7UA 3IW6A 4MKCA 4MXZA 2OXDA 3QTUA 4EEVA 3VO3A 3VRZA 3VF9A 3ZRKA 4JBVA 3S95A 1K2PA 2GS7A 4H3PA 5FM2A 3CS9A 2QKWB 2C6KA 3LFDA 3ET7A 3IW7A 3BWJA 5GINE 2YCRA 1MQ4A 3SG9A 4II5A 3ZO1A 5CQUA 3M42A 4QPAA 3TXOA 5LMAA 4GRBA 4FTAA 4JG7A 1QPCA 2OJFE 4R7BA 2AUHA 2J9MA 2QR8A 1XBAA 2Y4IB 3HX4A 4FV9A 4U9AA 4QQCA 3OS3A 5HBEA 4E73A 4PV0A 2PUUA 4AGUA 4EBWA 4NM5A 2X2MA 5EQYA 3UYTA 1XJDA 3Q4ZA 4O1PA 4Y5QA 3WYXA 2R7BA 4N6YA 3B8RA 1Z9XA 4ZP5A 4FG9A 3TV7A 3FJQE 4Y5HA 4MWIA 3Q32A 2XNBA 3UNKA 2WNTA 2QG7A 3N4VA 4FV4A 3BEAA 4AAAA 3FSFA 5AP4A 2ONLC 4IHPA 4I41A 4GJ3A 4QPMA 4IB0A 4YHJA 3TKIA 4XG8A 4CYJA 2UZVA 3QTWA 1YKRA 2UZDA 3BKBA 5E8XA 3PTGA 1H1PA 5TR6A 3LW0A 3OT3A 4YJQA 5CEKA 2ITUA 3E3BX 3KMWA 3KXGA 1SM2A 1OPLA 4FGBA 5H8GA 4FC0A 2RSVA 4I0RA 2R3RA 4ZOGA 3CJFA 1ZXEA 2XNMA 4CFNA 1ZYJA 3LLAA 2X2KA 4D1XA 4QMLA 3UC4A 4IVBA 4QP7A 1PXOA 3KCKA 2A19B 4LFIA 3JY0A 4O21A 5DT4A 3V6RA 3G90X 3JUHA 4A9RA 5HORA 3P1AA 3ORNA 4GG5A 4J1RA 3R73A 4G9CA 4GMYA 3ZCLA 3SQQA 1SMHA 3Q53A 4O0VA 3MN3A 3PWYA 1GAGA 3ZZWA 4WUNA 2ZJWA 4EHVA 1FINA 5E7RA 3ZUTA 5IH6A 3R21A 3UZRA 2QO2A 2YM7A
chains in the Genus database with same CATH superfamily
4EUTA 3L8VA 4I5HA 4FYNA 3HV6A 3LJ1A 4QD6A 4L7FA 1QPDA 4G1WA 3ZXTA 5JEBA 4ZAUA 3GB2A 4UY9A 2BFXA 5DA3A 3TACA 3NCGA 4I5CA 4BBMA 3E63A 4LOQA 2OH4A 2W5HA 4YSJA 4ACCA 2C6TA 1OKYA 5A4QA 5JN2A 4D2VA 3CJGA 3ZC5A 4I22A 4DT8A 4FRFA 2WQMA 2WQOA 3DBDA 4C3PA 4JR3A 5CI6A 4I4EA 1OIRA 4KNBA 5CVFA 3VF8A 4FSZA 3CKWA 3C4CA 2C5XA 3ETAA 3FHIA 4GT4A 4IAFA 5DVRA 1WBVA 3LM0A 5HNIX 4Y72A 4TYIA 3MBLA 2WOUA 5IQIA 3DOGA 2WQEA 1PXMA 4L9IA 2YISA 2R3NA 2YZAA 4FKIA 1JSVA 2ETRA 3NFGB 4DGLC 3FLSA 3SDJA 2CGXA 2UW5A 3R71A 2FB8A 3RM6A 2Y4PA 4LV5A 4LL5A 5K5NA 3UPZA 3LQ3A 2XAMA 2X2LA 3TTIA 3UJGA 3EFLA 1DAYA 4J53A 4CG8A 1JSUA 4GU9A 3PE2A 4ANLA 2VWXA 3GOKA 3LQ5A 5AP1A 5IUHA 3QUPA 3LFSA 3NIZA 5CU3A 5L2SA 1XMLA 4HYHA 5DPVA 4C3RA 4USEA 3DB8A 3QX2A 5BPYA 2ZYBA 4LGGA 4XH6A 5EM7A 1ZYCA 3S3IA 4DT9A 3R28A 3TV6A 4CNHA 5B0XA 4NZWB 4FSYA 2HY0A 1JSTA 2HZIA 4FSUA 4PL4A 4XV3A 4KRDA 5I4NA 4R8QA 4PWNA 5IQDA 5B2KA 4U5JA 2OJIA 5FP5A 3C4ZA 3MVHA 5AA8A 5HTIA 5D10A 1TFFA 3I7BA 2G2FA 4DITA 4B8LA 3LCOA 4RRVA 1APME 3Q52A 2JIUA 5CVHA 3RK5A 3SV0A 4ACDA 2ETMA 4YJRA 2PPQA 2E9PA 3CXWA 4F78A 4D55A 4ASXA 3FEGA 3AGMA 1ZY4A 5E8ZA 4OT5A 2OU7A 3V5LA 2I40A 1OL6A 2VTNA 4NCTC 3QAME 2XK8A 2BMCA 2XF0A 3ENHA 5HE3A 3LZBA 2HZNA 5CLPA 3P7BA 4J8MA 2OF4A 4BKYA 4EZ3A 5FLFA 2UW0A 4IWOA 4DDGA 2I7QA 1T45A 2C30A 3FY2A 3O7LB 2OK1A 4IVAA 3OTVA 3HV4A 2AQXA 2H9VA 3TL8A 4QP2A 1OKZA 3RHKA 5LVLA 4AW1A 3K5UA 4R77A 2GTNA 4DEGA 4NIFA 4NIFB 2ESMA 2XJ1A 4WKQA 1FVRA 3BBWA 3RBWA 4IADA 1YOJA 5GZAA 1BX6A 5HTBA 2WTWA 3ORTA 4EH7A 5BUJA 4YZBA 1WFCA 4V0GB 2OJJA 4QTDA 2IW8A 4F0GA 3SC1A 3AG9A 5LMBA 5CSVA 3BHTA 3QWKA 5L2WA 5DGZA 2EXCX 2OJ9A 4BGHA 3BL7A 3MVLA 1U5QA 3KK9A 4S31A 4DH5A 4BC6A 4EWHA 3OXTA 2VWZA 1GIHA 3LFNA 4DBXA 2PZYA 5AM6A 3QTRA 4WSYA 4IC7A 5I3RA 4J99A 3ORIA 4FYOA 3EN7A 4EJ7A 2JDTA 4OAVB 3UMWA 1P2AA 2HK5A 2YITA 5EM8A 3RJCA 2PVYA 5J5SA 4MXYA 4FIHA 4AWIA 5BMMA 5HZNA 3RNIA 3SRVA 2UZUE 2WEVA 3LFBA 1Y8YA 2FSTX 4XOZA 4YO6A 5CEQA 4EL9A 4I21A 4DFUA 2OI4X 4D2SA 4HW7A 4I0SA 5A54A 4JRNA 5HO7A 4IZYA 3ATSA 3A7HA 3R1SA 3W2CA 4C61A 1VZOA 1ZAOA 3DBCA 2QU5A 3GEQA 5DNRA 3A8WA 3ULIA 2VX3A 3KCFA 5TOZA 1CKPA 4X3FA 4CLIA 2F9GA 4X2NA 4ZXTA 2BIYA 3QD3A 3LFFA 3MYGA 4I23A 2WMRA 5JGAA 3VQUA 2R4BA 3UVRA 3AMAA 4IM2A 1UU3A 2OICA 2R3FA 3NGAA 3SXRA 1SNXA 3E87A 5CAOA 3AKKA 3M2WA 3TZMA 4KKGA 4NT4A 3QXPA 5B2MA 3A7JA 5KX8A 1OGUA 4XP0A 2JFMA 1H28A 3I6WA 5HG9A 5HOAA 3HV7A 3FLZA 5C1QB 4AA5A 2OWBA 3KXXA 3UMXA 3GU7A 2C5YA 2NPQA 3FLWA 3QX4A 4IJ9A 2PVNA 2V55A 4KA3A 4EHEA 2DWBA 4B0GA 2VO3A 3NUAA 3TYKA 4EOKA 4Z55A 1H1WA 2X0QA 4AS0A 4YLJA 2ZFYA 3BV3A 3I60A 2ZM4A 3QALE 3R63A 5E8SA 3ZLYA 4DLIA 3C0HA 2VD5A 5HVJA 5CF5A 2W1EA 3OBJA 2WMXA 4ORKA 4E5WA 1ZY5A 3MFSA 3UPXA 2Z7LA 5L4QA 2BHEA 3SAYA 5HLPA 3FXZA 3CE3A 5HD4A 1G8KA 1CTPE 3A4OX 4QP8A 4XV9A 2VWWA 3Q2MA 4UYNA 2X9FA 3PJ8A 3RWQA 3TMOA 2V7OA 3NLBA 3FMNA 4O96A 5CEPA 4P7EA 4CZUA 4MXXA 5ANDA 2OF2A 1SNUA 4EUUA 4HVDA 2XH5A 2C6EA 2VTQA 3KN6A 4FG8A 4AX8A 5EQEA 4MD7E 2B53A 3HA8A 2PUPA 2ITOA 2XNPA 2FSMX 3QZIA 3SLSA 3SXFA 3AC2A 4EK3A 4FGRA 3LHJA 2JAVA 3NZ0A 2P2IA 4E3CA 3NW5A 4RIXB 4BDDA 3HRCA 4I24A 1H1RA 2SRCA 3PZHA 2XK3A 4UMTA 4YTCA 2PE2A 2GHGA 4U97A 3VUKA 5IH5A 4TYGA 3EQIA 2UZLA 2XZSA 3GP0A 3OROA 5AP2A 2IWIA 2PZPA 1RQQA 2VTSA 3F6XA 3BHHA 1FBNA 4GVAA 1GNGA 2PTKA 3KMUA 4O7ZA 3U4UA 3NDMA 2CN8A 3LCTA 3LFQA 1UWHA 4FMQA 2GHMA 2XYNA 2YM4A 4L43A 4UMUA 3ZFXA 4Z16A 3F2RA 3KF7A 5CAVA 5IEYA 3HMPA 4FTKA 4OT6A 3CD3A 2RG6A 1MRYA 4GIIA 4MEDA 1YW2A 3SW4A 2C6DA 4W4XA 3SX9A 2QHNA 3K3JA 3R1YA 3ZH8A 3C13A 4FKSA 4F08A 3C50A 4FEVA 1CSNA 1KE6A 4RC4A 3AD6A 3FMLA 3FXXA 3NUPA 2WTKB 2WMUA 2J4ZA 4EOSA 1XH5A 4QYGA 4KIQA 5AUTA 4IDVA 4GS6A 4MD8E 2VTRA 3NNWA 4IE9A 3ZHPC 3KK8A 2Z7QA 4QMSA 3QTQA 4X2GA 2WD1A 2XEYA 4I5MA 2BZHB 1O6KA 4ENYA 2X39A 5FM3A 3R30A 4P2KA 2IVUA 5HG8A 3HV3A 4DHIB 2G01A 4PDOA 4LRJA 4BI2A 4BTMA 4Q2AA 1RE8A 2XNNA 5BUEA 5FXSA 2YM6A 1TQPA 2VWVA 1DI9A 4TWCA 1G5SA 3F69A 4W8EA 1GZOA 2NRUA 4CKIA 3L8SA 2YACA 4JX3A 3R01A 2GHLA 3N4UA 3D9VA 4PP9A 5IUGA 2J0LA 4RJ4A 4AE9A 3G15A 4U0IA 3ZS5A 5C4LA 4BGQA 4IAYA 4JDHA 3T3VA 5K0XA 2XIRA 2R3LA 5CANA 1PYXA 2ZMDA 3MA3A 2FA2A 4RGJA 3MTLA 3RKBA 3MIAA 2GDOA 2EVAA 1VLRA 2GQGA 3CR0A 3O96A 5HVYA 4KBAA 5GZ9A 5C8MA 2F2CB 1M7NA 3KKVA 3QGYA 3HRBA 2UZOA 2B7AA 3QTIA 3ZONA 5L8JA 1Q24A 4HNFA 5CT0A 1KV1A 3HYHA 3PRIA 5I3OA 5AA9A 2B9HA 3CQWA 4X21A 4DEIA 2XIYA 1AQ1A 4FL2A 1VYZA 4L53A 4AUAA 4ZTHA 1KUTA 2X7GA 3PLSA 4L8MA 3AMYA 3VUGA 3KXNA 3GU5A 4X6QC 4JQEA 2GMXA 1ZMVA 4EZ7A 5AP6A 3U9CA 3W0SA 4FSRA 3KGAA 3RK7A 3GCUA 4A9UA 4FV5A 3A7IA 5KCVA 3QQGA 3BCEA 1G8AA 4RC2A 2BDJA 4D2RA 3U6IA 5M44A 3ZZEA 3A61A 3LQ8A 2YABA 3VBWA 3QKLA 2CCIA 3O50A 4S2ZA 3NAXA 3NUSA 4ZTQA 1NVQA 1OBGA 5EYKA 1GIJA 4F7SA 1FMKA 4M97A 5H9BA 2J51A 1W83A 4FTOA 3OMVA 4I6BA 3QQFA 4WG3A 4O86A 2GPHA 3PY3A 4XYFA 2XM9A 4BIDA 5I9ZA 5AAEA 1CDKA 2DUVA 3VAPA 4ACHA 4MUQA 1GZ8A 1E1XA 4FKTA 4DDIA 3FL4A 4O83A 3DKCA 4W9WA 5AP5A 2QURA 3FKOA 3MV5A 4BTKA 4FSTA 3LXNA 4RVKA 3V8TA 3UZTA 2XB7A 1OPJA 4BF2A 3WF6A 2UZEA 3OXZA 4QQ5A 3BRBA 4C33A 4DG2E 4FSQA 4CRSA 4FK3A 2XK6A 4BYJA 5DHJA 3LXPA 3Q2JA 3IO7A 2PZIA 4BHNA 5M4IA 3ANQA 4KIKB 3TNPC 3WF5A 3R0TA 1OL7A 3GU6A 2ONLA 4EZ5A 5F9EA 4APCA 4E6QA 4M68A 4BDCA 4IVDA 4I92A 3VW6A 4ZS4A 5DYJA 1PHKA 1LEWA 4RVMA 1MQBA 2Y7JA 3L9MA 1U46A 5CTPA 1W0XC 4G34A 3ID6C 4YC3A 3R83A 3B2TA 3NVKI 1F3MC 2X6EA 2X81A 3E8CA 3U6JA 3GU8A 4FKUA 4XG4A 3R8VA 4HOKA 4C4JA 1RDQE 1XBCA 4K1BA 5JK3A 5DR2A 4QMQA 3CTQA 2ITZA 2X7FA 4O0YA 3NNUA 3V51A 3EWHA 4DGNA 2Y0AA 4PMMA 3UO4A 4I6LA 4KS8A 4YO4A 3ROCA 4XG2A 5TF9A 2FSOX 4LUDA 4O0WA 4U40A 4XBRA 3DXPA 5KHWA 3NNVA 1OBDA 3QQKA 4MXOA 5A46A 3CEKA 4D2PA 5IA0A 4TY1A 3DPKA 1XH7A 3PVBA 4AN3A 3SVVA 4MXAA 4RWLA 3FE3A 2X1NA 3GCSA 5E8UA 1PXJA 2X8IA 3R8LA 3VS7A 4E93A 3ZUUA 1WBNA 1Q61A 4S30A 1GZNA 5ACBC 4FX3A 5HE0A 1PRYA 3PJCA 5CEIA 3OC1A 1JPAA 3WILA 4E6CA 5FXQA 5FTGA 3BGZA 4FIJA 2EUFB 2VGOA 2IN6A 3W10A 2LGCA 2ZM1A 4HGEA 4GG7A 2IPXA 4J7BA 3SKCA 2RKUA 3GFWA 3IONA 4I4FA 4QMTA 4F6SA 3DXNA 2P3GX 1VEBA 4N6ZA 5J95A 3NFFB 1YXSA 3EYGA 2PVLA 3OWLA 5KMKA 2F49A 5EYMA 2WMWA 5KKRC 3C1XA 3RALA 3ZSHA 4ZY4A 2ITYA 3D4QA 4EH6A 5AUUA 2UW9A 4ENXA 1ZYSA 3COMA 5IEXA 3FKNA 3LMGA 5AP0A 5F1ZA 5L6WL 3JVRA 3FZTA 3R7EA 5DIAA 4C2WA 4G3DA 4J95A 3F66A 4O0RA 5IDPA 3IG7A 1M52A 2WMAA 3AD4A 5DH3A 3HMIA 3H9FA 3Q9WA 1PMEA 4HPTE 3ZM9A 3PJ1A 4RIYB 4C59A 5EM6A 4XG6A 3PPZA 4QYFA 4FK6A 4FOBA 4IZ5A 4OTHA 3THBA 2YM3A 2C6IA 5FBOA 4PQNA 3MTFA 3RPVA 3DBEA 3OP5A 2B9JA 4QMPA 4IM3A 4GUEA 3PWDA 3TG1A 2IO6A 3R2YA 3F2NA 2O65A 2ZVAA 5GHVA 3QYWA 3FZOA 5AX3A 3FZRA 3QCXA 5JZJA 3AC4A 3OY1A 5LWNA 5DOSA 3Q3BA 5L8KA 4HCTA 2A0CX 2C1AA 4LV8A 4AACA 4UZDA 5DT0A 4NFMA 3DBFA 3UIBA 5DMZA 4M67A 1BLXA 4CYIA 2O3PA 1Z57A 4QTAA 5J79A 2Z02A 4AZSA 2ERKA 2B55A 3ENMA 3TKUA 3EMGA 4C34A 2C3IB 3D5VA 3KA0A 4NJ3A 4Y8DA 4E6DA 4I94A 4USDA 1WBWA 5E8WA 3UGCA 4IACA 4IX5A 5AR7A 5JRSA 2P55A 5BVFA 4FTQA 1YHSA 2F7XE 2E9UA 4L7SA 4JBQA 3ZXZA 1Q41A 4C4GA 4DYMA 3DTWA 3DNDA 4EONA 1I44A 4RPVA 5CQWA 4DFZE 2YHVA 3QA0A 4G5PA 4NCTA 5CXHA 2W5BA 3ALNA 3QQUA 4F4PA 4TNBA 2H34A 4D4SA 1VR2A 3ITZA 2WTDA 2ZV2A 3V8SA 5ICPA 3HNGA 4UMPA 3UDBA 4HVGA 2BIKB 1B38A 5M4CA 3V5QA 1DI8A 4O6LA 4ZSEA 4BI1A 3G2FA 5KMJA 2RFNA 2XK4A 4R3CA 4Y73A 3AC3A 2VTAA 2FYSA 3OT8A 4ZTLA 2BRNA 5J7HA 4LRMA 3F82A 3FPQA 3ZO4A 3GXLA 4AW2A 3I6UA 4XX9A 2FVDA 4D1SA 4L68A 2JKKA 5FBNC 1ZMWA 1U54B 3ATTA 1XBBA 2XANA 5A9UA 4TWOA 2HXQA 4LL0A 4GT5A 4FIIA 4QMVA 5M57A 2PULA 3QC4A 4YJUA 1LR4A 3UC3A 2UUEA 2CKEA 3U9NA 4CFFA 5LJJA 4D5KA 4BCOA 3ORZA 3OTUA 4IWDA 1ZZ2A 4DG3E 2O8YA 3GQLA 3ACJA 2F7ZE 4CSVA 4AAYA 4FV1A 2QVSE 2JLDA 3AC5A 4G16A 1YVJA 4G6LA 2DYLA 2YAAA 3KRLA 4IAAA 1T46A 4AGDA 3R00A 5EM5A 2O2UA 4EH5A 2HOGA 4U7ZA 2IZRA 1CKJA 2R3JA 2WIPA 4EORA 1YHWA 4CEGA 1S9IA 4JRVA 5J87A 1OUKA 2J0JA 4CTBA 4AQKA 4FEQA 3NS9A 2GFCA 2CGVA 4AOJA 5AV2A 4CCBA 1MRVA 1H26A 4OTPA 4YZMA 3TDWA 3E8DA 4BCKA 1UU8A 3TNIA 5HX6A 3LMHA 4CD0A 5ANJA 2HENA 2WTVA 3D83A 4ARKA 2WMVA 3UOKA 3P0MA 4ZZNA 4BVUA 3G9NA 5H2UA 2JDRA 2WTIA 4ZTNA 3OCGA 3IW5A 5BVDA 2UW8A 4YJTA 3AC1A 3EKNA 3V5PA 3IOPA 2J5FA 1REJA 4FIEA 2UZBA 3VBQA 4RG0A 1Q97A 5IH4A 4XCUA 4BZOA 4WNMA 3OWJA 4M66A 3OCTA 4EOQA 4NTTA 3E88A 4IX4A 2W96B 4YHFA 4QMOA 1PY5A 4AZTA 3BELA 3EQFA 3QU0A 3COIA 4ACGA 3RPYA 3ZO3A 3PYYA 5K9IA 4B99A 3UQGA 1CMKE 3LOKA 4M69A 5I0BA 5AADA 3Q96A 3LVPA 4UX9A 4NL0A 1DM2A 3UDTA 3Q9XA 4WRGA 1W82A 2CN5A 2YEXA 3UNZA 5DR6A 4ANOA 1YRPA 4O22A 2CGUA 2PMIA 3G0EA 4RBLA 2EXEA 3WYYA 2I0EA 4JXFA 5M08A 4WBBB 2REIA 3QHWA 3I5ZA 1IAJA 4QMNA 4NSTA 3E7OA 4FTIA 4KKHA 1AGWA 3A2CA 4OBQA 4R7HA 4FTCA 4BCIA 4FKGA 4GK2A 3EL8A 5EYCA 1R39A 4RFYA 1OVEA 1SVHA 1FQ1B 3O0GA 3QCQA 3A62A 2R3HA 4BBEA 4YUQA 4AT3A 4O7VA 3F2AA 3BQRA 4FV7A 4YBKA 5DT3A 2C0TA 5HHWA 3T8OA 3VW8A 3U51A 3MB6A 1PXNA 3JYAA 5M53A 2YFXA 1JKKA 2UVZA 4KIOA 3VS3A 4U79A 3U4WA 4DN5A 2PUIA 1P14A 1FVTA 3MH0A 3LE6A 3T3UA 3MVJA 1YHVA 4MQ1A 4W9XA 3MGYA 4G9RA 2BRGA 4UMQA 5ANGA 4AF3A 5BVOA 2BAJA 3FI8A 5IPJA 4I1ZA 5CAUA 5EI2A 4HYUA 3UBDA 5CAQA 3TUCA 3G33A 3RTPA 3ZBXA 5C26A 5CNNA 4G6NA 3PUFC 1KE8A 4AXEA 3GQIA 2C68A 2B1PA 4KBKA 4WD5A 5DR9A 4X2KA 3WZEA 2QC6A 2W7XA 5AIKA 4ERKA 1IAHA 2HIWA 2A1AB 2PL0A 3OWKA 5GNKA 1GOLA 5IA1A 3PUPA 3REPA 4PDPA 3TKHA 2J2IB 4O0UA 2QHMA 4JQ8A 3MIYA 5LVNA 3MI9A 3F7WA 1X8BA 2VTMA 3PIZA 3QC9A 5D7VA 2XKCA 3U55A 3D94A 2ITWA 2R3IA 4RQVA 4HGSA 5A3XA 2OBJA 4WUAA 2IF8A 4E4MA 3O71A 4BDAA 4BN1A 5I9YA 2YCQA 5EKNA 4YZDA 5TKDA 4BIEA 3TM0A 1I09A 4ALWA 4FICA 4DCAA 3BLAA 1KE9A 5DE2A 3BLQA 3F61A 4IAKA 4I0TA 4OTGA 3TV4A 1IA8A 1WCCA 3R7YA 1V0OA 2B54A 4FZFB 4OAUC 3MJ1A 3TEIA 3DJ7A 1BL6A 2CPKE 2WKMA 3DU8A 3MH2A 4G17A 4E4LA 4FV2A 5TE0A 3OG7A 1OKVA 5CSWA 5L6PA 2H6DA 2YDJA 1LEZA 4WOVA 2R64A 4A06A 2VTPA 1Q8YA 4YJOA 1YWRA 4WO5A 4EOMA 3VIDA 1H24A 4L00A 3QLFA 3V8WA 3ACKA 3QQJA 4QYYA 1M7QA 1PMNA 3CY3A 1XR1A 2XVDA 1URWA 2F4JA 4PPCA 5JFSA 4Z3VA 1JKSA 4FKQA 3HUBA 3R8ZA 1NA7A 4QTBA 1JBPE 4PL3A 2J6MA 4GK3A 2OSCA 2PMLX 3CD8A 3KC3A 4UWYA 4A4LA 4C4EA 3W0PA 3W0NA 3S4QA 4OTQA 2O63A 2BRHA 2VNWA 3R8MA 3DKGA 4YBJA 4FSWA 1ZRZA 5LMKC 3MB7A 4DCEA 2XAOA 2C0OA 4AZFA 5CSHA 2BKKA 5K4JA 3IDPA 4FG7A 4D2TA 3P7CA 4FIGA 4H58A 2WU7A 3K54A 2P4IA 4EWQA 3CQUA 1OUYA 3VUHA 4BKZA 2R3MA 3U87A 3MSSA 3D5WA 1XMMA 2J7TA 2Z2WA 4M14A 4YSMA 2P33A 4HVHA 3KXZA 5IEVA 4Q9ZA 1HCLA 4FKLA 2GTMA 1OKWA 2W9ZB 3NAYA 4JIKA 3C0IA 3LXKA 4Y95A 2G1TA 3V5WA 4IZAA 4BWPA 2ACXA 3Q9ZA 3HAMA 4HGTA 1MP8A 3FY0A 3S00A 2UW7A 4JAJA 4CTCA 5B7VA 4BY9E 4JVGA 5DG5A 4H3QA 2Y6MA 3F3WA 1KE7A 4DH7A 3OEZA 1UNGA 4ANNA 3NCZA 1W84A 4IB1A 5M4FA 3TNQB 3V01A 3SRVB 5HICA 4GEOA 3WIGA 3O17A 2QONA 4RIWA 3UZPA 4FT3A 3LAUA 3F5XA 4IAIA 1TKIA 2BCJA 4U3ZA 4XV1A 3E8EA 4ZIMA 5HE1A 5IISA 4ZS0A 4PTCA 2UZWE 4BDKA 3C51A 4D58A 2W0JA 4O2PA 4AW5A 3QBNA 4C8BA 3FPMA 3D7TA 4DFXE 3RINA 2EB3A 1UNHA 2GSFA 4K9YA 4FKRA 5IQFA 3D2IA 1B39A 3CSVA 4WNPA 4FNYA 3FI4A 4X3FB 2NNWB 4L52A 4C4HA 3IECA 3PPJA 2C3LA 2VTIA 2ZAZA 4W4YA 5KBQA 2ZV9A 3F9NA 4IWPA 4M13A 3C4WA 4MNEA 5AUXA 3ZC6A 3P5JC 4YR8A 2ZOQA 5AP7A 5AEPA 3QF9A 5CF8A 5E8YA 4O4FA 1BI7A 2XEZA 4IANA 3FZSA 1J3HA 5DEYA 5CENA 2E9NA 2QD9A 2XYUA 2BUJA 2JDVA 3FWQA 4PPAA 3L8PA 3EOCA 5FD2A 4AZVA 1H1QA 4PY1A 3PXRA 4DGOA 5C8NA 4M0ZA 3L9PA 3QZHA 5CVGA 3PXKA 3KF4A 3NMUF 4ITJA 4CV8A 1QL6A 2YIRA 2BVAA 4USFA 2Y4IC 4CZYB 1LPUA 5FDPA 2PMOX 4O4DA 4K0YA 4GL9A 4WNOA 1YQJA 3L1SA 5TO8A 5A4EA 5BVWA 3P86A 5HE2A 4I6QA 5KZIA 4KSPA 4APPA 1WVWA 4D0WA 5I9UA 4FKPA 5C8KA 2I6LA 3NYNA 4BTFA 3O7LD 4DEBA 3M11A 1ZMUA 4RLLA 3I4BA 2JDOA 2A27A 1H0WA 3VS6A 3KRXA 4L01A 3WBLA 2ERZE 3QD2B 4AT5A 2OJGA 3KEXA 3PXYA 5E8VA 3UOJA 5F20A 1IASA 5AUZA 4C62A 4O7NA 3NYXA 4O38A 5CYIA 3VJNA 4EK4A 3BL9A 4OTRA 1LUFA 4NYEA 2CGWA 2W1HA 3UTOA 3DAKA 4WBOA 4N70A 3TZ7A 2UZNA 4FI1A 4YJSA 2VTHA 3AKJA 3ODYX 1H4LA 4NM3A 4XG7A 5HLWA 2A2AA 2IJMA 3EFWA 3ERKA 1S9JA 4DINA 5KHXA 4KWPA 4AN9A 4G5JA 4IZ7A 4LRKA 1PMUA 4UV0A 2YAKA 5A4TA 1URCA 4XV2A 3V3VA 2BZJA 4TKSA 4BCGA 2BTRA 1BUHA 2W9FB 2XRWA 4TWPA 2C0IA 5EHLA 4ZSLA 4EH3A 5M07A 3E92A 1R78A 4RX7A 4Z7GA 2VTLA 3E3PA 3QRTA 5GJDA 1IA9A 1P4FA 3OF0A 3VJOA 4FEUA 4A4OA 2OZAA 2OZAB 3NUXA 2IVVA 4M0YA 5FEQA 1IRKA 4I5PA 4ZY5A 2PE0A 3HVCA 4C3FA 1GIIA 2JBOA 5ETAA 1UKHA 4F1TA 3R2BA 3WOWA 2ITNA 2YCSA 3WI6A 2XBJA 4TYEA 4UYAA 3D15A 5LVOA 3CGFA 1U4DA 3BPRA 5BVNA 4YZ9A 4L3LA 3QRUA 1SVEA 4XP3A 4FTLA 5F94A 4R7IA 1YXTA 2IVTA 4AW0A 4FVPA 5E91A 4LGDA 2IEWA 1GJOA 3FBVA 3TCPA 2HYYA 4DHZA 4D9UA 3G0FA 5CU2A 1TZDA 3Q5ZA 5BVEA 3CPBA 3V04A 5LOHA 3AOXA 3JXWA 4HZSA 5KMIA 2XK7A 1KE5A 3KB7A 1ZOGA 2WO6A 3FL5A 5HVKA 4G3FA 4L3PA 4QMYA 4WHZA 4MTAA 3H4JA 3ULZA 4FT5A 1UKIA 1NW1A 4GK4A 4N57A 2VGPA 3AT2A 2GU8A 4FV0A 4ZJJA 3N51A 5ACKA 4KAOA 1JLUE 4FJVA 5HX8A 4XLIA 1BYGA 4P5QA 5BV3A 3IGGA 3PXZA 5BVKA 2CSNA 3E62A 3D5XA 5EKOA 3ORXA 3DKFA 3PIYA 3PSCA 5KMMA 5JSMA 4HGLA 5FDXA 5IQGA 1PMVA 2HW7A 5HCYA 5JZNA 3PP0A 5J8IA 4ANMA 5ANOA 2CDZA 2JD5A 3EFJA 2KTYA 3EJ1A 4O82A 2RL5A 1IEPA 3E5AA 3VBXA 3WF9A 3QRIA 5D9HA 4D4VA 2A98A 4A07A 3TJCA 4U3YA 4AFEA 2QOFA 4RA5A 4QP9A 2G15A 2W1DA 3Q4CA 2VWBA 3K3IA 1GZKA 2VO6A 5IQHA 3RMFA 1XHAA 4FZ6A 4BZDA 1A9UA 4MF0A 1H00A 3FLNC 4S33A 4E20A 2F7EE 4XUFA 3ML1A 4BR3A 4DTAA 1WBTA 4IH8A 1E9HA 4DH8A 2NP8A 2QOIA 3B2WA 5CAPA 5D12A 4JQ7A 4EHZA 4F9YA 2Q83A 3PA3A 3KN5A 3VC4A 3F5GA 4KABA 5EG3A 3V5JA 3GCVA 3V5TA 5A4CA 4J97A 4WT6A 3S0OA 3K5VA 1XH9A 1KWPA 4QMMA 5AUWA 5E92A 4EK8A 2UV2A 1M17A 1PKGA 4JDIA 3WE8A 1Q4LA 3GU4A 4J71A 1Q62A 3W18A 2X0OA 2B4SB 4D0XA 4HVSA 2ITTA 3OD6X 3R6XA 3VN9A 4WRSA 2NRYA 3A8XA 3ORKA 5L3AA 3O51A 2VZ6A 4KKEA 3VULA 4EKLA 5I5ZA 3WZKA 4GCJA 2CCHA 3ZEWA 2QNJA 3H0ZA 2UW4A 4L6QA 4HCVA 1M2PA 3FI2A 4OTFA 4TN6A 5EHYA 4DEEA 4F1MA 4BCMA 3FC2A 5IA3A 3QKMA 2CLXA 3G9LX 3RAWA 4E8AA 4QTEA 4M3QA 5F4NA 4BWXA 3GC7A 4QDEA 3UOHA 3R7GA 1Z5MA 3RVGA 1CM8A 1NY3A 1YI4A 4Z9LA 4E6AA 4ID7A 5EYDA 5D1JA 3CBLA 3JPVA 4JI9A 2WOTA 3I5NA 3JR1A 3MFRA 4KUJA 1ATPE 3FZ1A