5JFXA

Crystal structure of trka in complex with pf-06273340
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
277
Chain Sequence
MHHHHHHLVPRGSVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title The Discovery of a Potent, Selective, and Peripherally Restricted Pan-Trk Inhibitor (PF-06273340) for the Treatment of Pain.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 277
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jfxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jfxA01
3PPKA 3RZBA 1MP8A 5DGZA 4EWHA 2W1GA 2HY81 3ZRKA 5ETFA 3PJ8A 3GNIB 4FC0A 4Q5HA 3UPZA 2PVKA 1O6LA 2B9IA 3QUPA 2B4SB 4I1ZA 4RZVA 3V5QA 4EH2A 4YURA 2JEDA 4JBQA 4TWPA 3ROCA 2P55A 2C3IB 3I5NA 4QMMA 1KE7A 4O6EA 4TRLA 4FUXA 1APME 4NJ3A 4CZUA 2W1IA 4NCTA 3NCGA 1OPJA 5LVLA 5DVRA 5EM6A 3TWJA 3PXYA 5AP4A 4ZJVA 3UIUA 4FKRA 3QKLA 2R3LA 4TKSA 5DI1A 3CS9A 5HE1A 4P5ZA 2IZUA 5M55A 3UODA 1NVQA 3ZFMA 3DAJA 4WBBB 5J95A 3LCTA 3VF8A 1DAYA 3NW7A 4H3QA 2VTTA 2Y4IB 4GIIA 3HKOA 3QQFA 4ORKA 4AOJA 3KGAA 5E7RA 3A7GA 3A4OX 4N4SA 3TKIA 3CY3A 4CCBA 2BDFA 4QQ5A 4M66A 4APCA 4C8BA 2YM5A 5FDPA 5JK3A 3BLQA 4EONA 4BBFA 4GG7A 4A4XA 4CFNA 1IAJA 2W99B 4U41A 2O63A 1K3AA 5KUPA 3VHKA 3A61A 2X6DA 2OZOA 2R3NA 3D5XA 3JY0A 3KXMA 3L9LA 4MX9A 4NKSA 5CLPA 5A4EA 2UVXA 4EEVA 4DG2E 4QYEA 5KNJA 3BHUA 3AC3A 4TWOA 3ZEWA 1XH9A 2I6LA 4EI4A 5CEPA 4O0XA 2PMLX 4BGQA 1IASA 3FPQA 3FMLA 1YDRE 4NKAA 5CF5A 4GUEA 3BV2A 5IEYA 5M4FA 3DBFA 4FKUA 5LMAA 4FL1A 5A54A 3R9DA 5C8NA 4PF4A 2QOQA 4DTKA 1TQIA 3P79A 3FLQA 4NFMA 5H8GA 2B7AA 5AIKA 4L01A 4ZMFA 4GFMA 2KULA 3TCPA 4NYEA 2I7QA 3LFFA 1R39A 3HMIA 4EH4A 2R3MA 3UP2A 4RSSA 3Q2MA 3NMUF 1LP4A 3TNWA 5AM7A 4ANQA 4AW2A 1CDKA 3BLHA 4CMUA 3FMJA 1XR1A 3CE3A 3FQHA 3MB7A 5AAEA 4QYHA 3F2RA 2XIKA 4RWKA 5HE3A 1KSWA 3GCUA 4CSVA 5HU9A 2RSVA 3MTLA 4J8NA 3V04A 5KMJA 2J2IB 4BGHA 4FIIA 4QP4A 3SXFA 2QU5A 3KC3A 5A4CA 4C2VA 1KE8A 4EQCA 1CM8A 3EQPA 3MFTA 3MH1A 4BCOA 1E9HA 3FE3A 4XH6A 2J4ZA 4F63A 2IW6A 4X2GA 1OI9A 1XH6A 1KUTA 2V7AA 3BHVA 4XJ0A 3RPOA 1ZMUA 3VBWA 3QU0A 2XMYA 4TTHB 3NAYA 1J3HA 3N4UA 3RWPA 4IAAA 4LMUA 3KULB 1I44A 3GU5A 1Q5KA 1R78A 4GKIA 1WBTA 3KREA 4FG9A 3OXTA 3SRVA 4BI0A 3QZHA 2WMQA 3WARA 3I0OA 5DA3A 2IZTA 1GIIA 4GT4A 3B8RA 4FIHA 3EL8A 4FT7A 1CKPA 3MJ2A 4ASZA 5AAGA 3MDYA 3IDCA 3Q53A 4A9SA 3I60A 4LOOA 4O0YA 5HG5A 4XV1A 5CF8A 4FTUA 1NXKA 2OF4A 4G3DA 4BL1A 3PE1A 4ACMA 4G2FA 2AC3A 4IVAA 4RQVA 2R7IA 3QQJA 4P2KA 5FTQA 2QOLA 4FL3A 3KRWA 2H9VA 3TN8A 3UTOA 4AZSA 2VTIA 3GGFA 5IDNA 2EB2A 2BTSA 4ACCA 3MA6A 4OTDA 4YLJA 4UWBA 4FIJA 3ZFYA 4PV0A 3D5VA 3VBYA 3F82A 2XCKA 5L8JA 4IANA 5HLWA 3BPRA 4ACGA 3NSZA 4WT6A 1OL1A 4BDGA 4TW9A 1JKKA 3C9WA 3NUNA 5B0XA 4F09A 4IAZA 3DZQA 4CFVA 2ESMA 2HYYA 5HCXA 1H25A 1DI9A 4RQKA 3ZSIA 4Y72A 1BL6A 3TXOA 4E26A 4EZ5A 4LRJA 5A14A 3OFMA 2R4BA 3QUDA 3R1SA 4BZDA 1K2PA 3KRRA 1OKWA 3UC3A 3TJDA 5J7HA 4DCEA 3ZLXA 4MNEA 3D0EA 3Q2JA 5AFVA 1OUKA 1U5QA 3HP2A 5JRSA 4E4LA 5FM3A 1HOWA 2JLDA 1W7HA 4K18A 3V8TA 2DUVA 5DFPA 5HNIX 4N6ZA 4DINA 2WTJA 4NJDA 1GZOA 2X4ZA 3CQWA 1QPJA 3DT1A 4K8AA 4K0YA 4BICA 4GU9A 4DGNA 1BUHA 4BWXA 2XNNA 4FT3A 4YJUA 4JR7A 5AUYA 1F0QA 5B7VA 1A06A 4GW8A 3LJ0A 4RFMA 3O17A 4CT1A 2W1HA 5ETAA 4D58A 2GHGA 4QMNA 5HICA 3FHRA 4PUZA 1NVRA 2B9HA 3PA3A 4DEBA 2NRYA 3TDWA 2J0KA 4GRBA 4K11A 3U55A 2O5KA 2OICA 4XMOA 2ZB0A 1JKTA 3MW1A 3QZGA 5CZHA 5HD7A 5TR6A 5LVNA 3HX4A 5BVWA 3HMNA 3KCKA 2WELA 4KD1A 4M12A 2W17A 4RFYA 5IQGA 2P4IA 2V55A 3QZFA 2XNPA 3UO6A 4ALVA 3VS4A 3ERKA 3TV4A 5IQDA 5DEWA 1MQ4A 3NW5A 3FKOA 1W98A 4ASDA 3C13A 5IEXA 3NYVA 3IPHA 3QRTA 3MY1A 3P7BA 3OEFX 5IUGA 5EQYA 1Q3DA 4DLIA 5A6NA 1YWRA 4I23A 1VR2A 5G6VA 5HG7A 4PNKA 4FKSA 3RHXA 2W5AA 4WKQA 3EOCA 1KWPA 3BEAA 2BKKA 2GQRA 2XYNA 4H39A 2BILB 4KRCA 5M06A 3NIZA 4FF8A 3VUMA 1J7UA 3LQ5A 1VJYA 4ZY4A 1UU9A 4W4YA 4QPSA 1Y91A 4R3PA 1HCKA 3UZRA 5J7BA 4FT0A 1IG1A 3N9XA 4FYOA 3IGOA 3ZHPC 1J91A 3D83A 3RKBA 3COKA 4OGRA 2GTNA 2VTAA 3PSDA 3RNYA 4RVLA 2F4JA 3CQEA 5M56A 4JAJA 2V5QA 3D9VA 1Y6AA 4C4HA 3OT3A 3OHTA 5EYKA 4A9TA 5DRDA 2QG7A 4AGUA 4RWJA 4Z16A 4IM2A 2XIXA 4FV3A 4RWLA 4W9WA 3GENA 3VBXA 1M7QA 3BGPA 4QQCA 3BBTB 5D9HA 4ANMA 5GIOE 4U3ZA 4MF0A 4P7EA 3HGKA 2C4GA 2HY0A 2R3PA 4MD7E 4NT4A 3PYYA 5I9UA 2JAVA 1V0OA 4EK4A 4UMPA 5FXRA 4BDHA 2FVDA 3BGZA 4PMSA 3EIDA 1OB3A 1GJOA 4M0ZA 4OTWA 4ANSA 3UOKA 4D9TA 1YHWA 3QTUA 3R1NA 4YNEA 2P2IA 3E8EA 4LG4A 2W1DA 4FR4A 4FSMA 3O8PA 3CTQA 4QMWA 4RPVA 1OKYA 4XV9A 3Q5ZA 2HXQA 2XNOA 3QRIA 1RE8A 2VNWA 4HZRA 3RAHA 4CXAA 1HCLA 4L6QA 1ZYCA 4R8QA 2GTMA 4PY1A 3F5PA 3NLBA 4DEAA 4NL0A 2ITYA 3U51A 5AV2A 5CEKA 3Q6WA 1OBGA 4FTMA 2CMWA 1P2AA 3I6WA 2IVSA 5BVKA 3TUCA 4O7LA 2XS0A 4M84A 2NPQA 3O50A 4W4WA 4EHEA 5L6OA 3ODZX 4C58A 4FTNA 4I0SA 4CV9A 2R3HA 3MIYA 1URWA 1G5SA 2OI4X 2XCHA 3TTIA 4BRXA 5JFWA 4WUAA 4UV0A 4I21A 5DH3A 3NUXA 2C1AA 3D7TA 3M1SA 4X0MA 2ITUA 3VUIA 3WILA 3VN9A 2F49A 2JKKA 4HOKA 4E3CA 4J71A 5LWNA 2BAKA 3TT0A 2BZKB 1SNXA 4FKTA 3VS5A 3DTWA 3PIZA 4KIOA 5HVYA 3V8SA 4FKVA 1OMWA 4FV2A 4YJSA 5AV3A 2UZTA 1PKDA 4O6LA 4Y8DA 3DZOA 1WZYA 4FSYA 4I6QA 1OVEA 4AGWA 3SW7A 4C57A 4M3QA 2WQMA 3O71A 3NUSA 5EDRA 2GU8A 5TO8A 2CNQA 3C4ZA 4JQ7A 4R78A 4EOLA 2YDIA 3ENHA 3V5TA 2Y0AA 4L53A 5FM2A 3U4WA 2QO9A 4XP3A 3OEZA 3VJOA 3LXKA 3ZUUA 3T3UA 3W32A 3WZKA 2PVHA 3ORTA 4C35A 3QWJA 3F6XA 3LXLA 5FWKK 4XS2A 5KKRC 3UIMA 2FO0A 3MIAA 4X7QA 4QYFA 4ZTNA 4B8LA 3DA6A 1E1VA 1IEPA 3PY0A 4LQMA 5KO1A 5BUIA 2QR8A 5EK7A 3TUBA 2BCJA 4DFNA 3W2CA 4YZDA 3AD5A 4KS8A 3GI3A 2GNFA 2J9MA 4QD6A 3S00A 2B9FA 4DGMA 5BPYA 3BCEA 4F65A 1H28A 4HVIA 3C50A 3FLYA 1PY5A 1H8FA 3FLSA 4AZVA 2WU7A 4D2WA 4QMPA 3SXRA 2EB3A 4PDPA 4DFLA 2F7XE 4DYMA 2W7XA 2X9FA 1ZXEA 4BBEA 3FI2A 5M51A 3SGCA 4Z3VA 2QU6A 3R8MA 3EFKA 1H26A 3BHYA 2OKRA 2G2FA 2XH5A 3IKAA 3FLNC 3KF4A 4RIXA 2J7TA 3RM6A 3ULIA 4ZAUA 2O8YA 3R6XA 4CMOA 1GIHA 2JITA 4WNKA 1UVRA 2HCKA 5K3YA 5L2QA 4XG8A 2BIYA 2VTMA 3V3VA 3ZXTA 4YNOA 3QTRA 3WF7A 5LMBA 3PA5A 5I5ZA 4EWQA 4DH8A 3DDQA 4EC9A 4O7ZA 3OCGA 5EOBA 3HV7A 3Q9WA 4UY9A 4HPTE 1BMKA 3C7QA 3LKMA 2OBJA 4BR3A 3PUPA 3IS5A 5EDQA 3ORZA 2Q83A 1FVTA 2V0DA 2JBPA 4GT5A 2OO8X 3DQWA 3KFAA 1AQ1A 3M11A 3EQBA 4PPCA 3VBTA 1GNGA 4EOMA 1XH8A 1IR3A 4DA5A 3QAME 4MXCA 4AT4A 2B1PA 3TDVA 2ERKA 5AP3A 4FGRA 2BHHA 3I1AA 1FMOE 2CGVA 3SA0A 4OBOA 5EW9A 5LARA 4R77A 2IPXA 2Y4IC 4XP2A 4X3FA 1UKHA 3CKWA 5AUXA 3ZC6A 4J7BA 5J9LA 3JUHA 4Z9LA 5I9WA 3R2YA 4K6ZA 4MK0A 4TYHB 5HTCA 4FEXA 2BIKB 3G2FA 2QI8A 3TEIA 4FEQA 4DGGA 4AA4A 2GNGA 5GZ8A 5T6KA 3LMIA 5AAFA 2YLFA 3WBLA 2IZSA 3DJ6A 3BE2A 3PWDA 4C0TA 4FE2A 4FKIA 3TUDA 3U6JA 5E9EA 2NP8A 2OXXA 2BHEA 5FG8A 4F7LA 4XG2A 2PL0A 4U5JA 2V62A 2Y8OA 3FQEA 3KY2A 2W05A 4A4OA 4ERWA 2J0MB 4JL9A 4PTCA 4R7BA 4XBUA 5E8TA 3MPTA 3AG9A 3BYSA 3ORKA 2C6KA 1ZARA 4LMNA 4MBJA 3ZYAA 3DTCA 3LCDA 4Y73A 3GC8A 5CVGA 3TL8A 4B0GA 4ENXA 1XH4A 3LIJA 4IB0A 4EBWA 4ZZNA 2PUIA 4XCUA 2YIYA 4NEUA 4I3ZA 4U0IA 4OBQA 1FGIA 4JDKA 5TF9A 5JFVA 3QUEA 5FLFA 2OJJA 3HV5A 4IWPA 5E8XA 1KE6A 2I0YA 3QF9A 4FV9A 4I4FA 3NYXA 4BC6A 3IW8A 3AMYA 3C5UA 3PA4A 4JAIA 4KSQA 3UZTA 4D4YA 2X4FA 2PVNA 4FV4A 4APPA 3PP1A 2WMVA 5I9YA 5CSHA 4LL5A 1XHAA 5CF6A 2PVLA 2E9PA 2UZBA 2ERZE 3A4PA 5J1WA 3MH0A 4F70A 4QMTA 3V51A 3ZDUA 2PUPA 5DHJA 3QKMA 3D2KA 1O9UA 3ENMA 2UW3A 2BALA 3W2QA 1PXPA 4AE6A 4CQGA 3COIA 3D2IA 4NCTC 3TG1A 2C6TA 2GNLA 4MAOA 5E1SA 2E9UA 4DE4A 2CSNA 3R2BA 3Q4ZA 4FKJA 4MXZA 4DHFA 4Z55A 3LM5A 1YI3A 1FOTA 4ZY6A 5KMIA 4O82A 4PMTA 2UW5A 2ZM3A 2QOHA 4D1ZA 5EM5A 4GT3A 3TKUA 4H05A 1P4OA 5IA4A 1P4FA 3BHHA 5CZIA 1XQZA 4YPSA 3QCQA 5F9EA 3MFSA 5K5NA 4X3FB 3WIKA 3E87A 3NW6A 4LYNA 5I9ZA 5LXMA 1WVWA 1YW2A 3EWHA 1ERKA 3QGWA 3ZO1A 3FKLA 4UN0C 3KMMA 4WSQA 4QP3A 5C03A 5HIEA 3ORMA 4BY9E 4IAIA 3F3ZA 2CHLA 4OR5A 4FEWA 3UIBA 3MPAA 2X39A 2O2UA 4BZOA 1B39A 2FUMA 3G6HA 3BU5A 4YZMA 3OBGA 1OIYA 4FTIA 4F9BA 4LOQA 4BWKA 3R1YA 1R0PA 1VZOA 4IZ5A 5M09A 3IOKA 3U8WA 3MI9A 4X21A 4BDIA 2E9OA 5HCYA 3RPSA 2X7GA 4EQUA 2XIZA 3LXPA 5AP2A 3MVJA 4AQCA 4FZAB 5FGKA 5HX6A 4HVSA 4FNWA 3DAEA 3HP5A 3JYAA 3VF9A 2XF0A 5LVOA 4IM0A 4GJ2A 4CKIA 2VO6A 4JBPA 4E4MA 5CAOA 2JAMA 3R7YA 2YHVA 2XYUA 3PXRA 4JG8A 3OWKA 5HZNA 1T46A 4JS8A 3E3PA 3D5UA 4TNBA 3CPBA 4RJ4A 2WMSA 5EHYA 3FC2A 4RLLA 1PXJA 1FVRA 4EORA 2RIOA 4YSJA 4EKKA 1ZZ2A 3QD3A 1BI7A 3NCZA 5IMXA 5CAQA 3U4UA 2UW8A 2VRXA 3OC1A 3KKVA 1Z5MA 5HLPA 3QD2B 3R8PA 3W8QA 3P5KA 4HYSA 2WMTA 4I92A 4O1PA 3W2SA 4X2JA 1YVJA 2FGIA 4IAYA 4IDVA 5HNGA 4D28A 4OBPA 5E8YA 4BDBA 1BX6A 3E88A 4P4CA 3EKNA 3FXWA 4NWMA 2OFUA 3NNVA 4G31A 4RIOA 5EOLA 2O64A 4LUDA 1FBNA 4XG4A 3QQGA 2B55A 4NU1A 2YCQA 3GP0A 4CFWA 5KE0A 3K5UA 4BI1A 1YXVA 2OJIA 3HECA 5E8WA 4FVRA 3AQVA 5DLSA 4XG3A 4KA3A 5DWRA 3N4TA 1UA2A 5EQPA 4RLKA 2QKWB 4G9CA 3LPBA 3CTJA 2JBOA 2PWLA 3SOAA 4AT3A 4X6QC 4O7RA 5C8KA 2GMXA 4JX3A 2DS1A 3DBCA 4RVMA 3ORNA 1YOLA 3FMKA 5AR2A 2YAKA 1AD5A 4JVGA 3COHA 1JLUE 4O0VA 2Z7LA 4EHGA 5B2KA 1R1WA 4MNFA 4E5AX 4MTAA 2BVAA 2WTKB 1XWSA 2JDSA 3IQ7A 3QXOA 4PPBA 4Q9SA 5AWMA 3SXSA 3UQGA 3LFEA 2QO7A 4WRGA 4C3PA 4F7NA 3O8TA 3NNXA 1FGKA 4U42A 4AGDA 3QYWA 5D7VA 3D14A 4E7WA 4GIHA 3SD0A 2IN6A 3QL8A 2EXCX 3P4KA 5HBJA 5IEVA 2OWBA 2XIRA 2BR1A 4FUYA 5A4QA 2C69A 4II5A 4B9DA 3FV8A 3IGGA 3NNWA 3ROYA 4PMPA 5M4IA 4QTCA 1O6KA 4HGEA 4PMMA 3GCSA 1X8BA 3GXLA 3F7ZA 4CEGA 1PMNA 4YC3A 1FQ1B 3G9NA 3C51A 4G3CA 4XRJA 2R9SA 3FUPA 4FNYA 1SYKA 2A27A 1JWHA 2VTSA 5F20A 4XG6A 5AV0A 2ETKA 5GJGA 4HNIA 3OBJA 3TACA 3ZSHA 3K3JA 3LCSA 4FSUA 1M14A 3D94A 4G9RA 3RK5A 4QPAA 3G15A 1OL6A 2JC6A 4UYNA 5CI6A 4CG9A 2GNIA 4FV5A 2A1AB 2QQ7A 3PIYA 3ID6C 2X2LA 2XKFA 2J0JA 5CF4A 5DR2A 5AA8A 4J98A 3KVXA 2C1BA 4HYUA 2WIPA 2ZDUA 4NM7A 4TXCA 4DITA 3OG7A 2ONLA 4FTQA 5EHLA 5H9BA 3QA0A 5HVJA 3WF5A 4IWOA 2X7FA 1F3MC 2WEVA 2B0QA 2YCSA 5DT4A 5L6WL 2PVRA 3EN6A 5DG5A 5L2TA 3OOGA 3P23A 3LM0A 1YOJA 2QR7A 2F7EE 3IW5A 5CU6A 4FTAA 3V5WA 2AUHA 3HA8A 2JKOA 3KULA 4FZDB 2XKEA 3D7ZA 3GFWA 4QP7A 4FIGA 4V01A 3UZPA 2YIRA 2C0OA 3U54A 2RKUA 5HNBA 3BZ3A 5CSVA 2WTDA 3GCQA 4ENYA 3GU6A 2X9EA 3FBVA 4HPUE 3V5LA 4E6DA 3H0YA 4S33A 2CN8A 3OUNB 5AP1A 4QMUA 5K4JA 3OTVA 4PL4A 5AP5A 5TT7A 3PPJA 3C4CA 4P90A 3ZC5A 3CIKA 1YXSA 3CR0A 3RNIA 1JKSA 2XJ1A 2YFXA 3HDMA 4RX8A 1W0XC 4PP7A 4MVFA 2PZYA 4I22A 4O0WA 5HBEA 2UVZA 4ANLA 2ETRA 3DFCB 3FI3A 1FVVA 4YUQA 5FEEA 2YZLA 3TZ9A 1LEWA 2B52A 2C6IA 1M2PA 4AE9A 1ND4A 4WNOA 2OF2A 3BIZA 3VHEA 5D10A 2QHMA 4GU6A 5D41A 3DXPA 1MRVA 3C4FA 3U87A 2H96A 2OIBA 3PVGA 3WF6A 4ARKA 4PQNA 3GOKA 4EOOA 5JMSA 2IZRA 1UU8A 3HUCA 2C6EA 3LAUA 4FV7A 2GS2A 5KHXA 3TNQB 2HZ0A 3BV3A 2XNMA 1P14A 4AW5A 2I1MA 2JDTA 1YHSA 3E63A 2EU9A 4FOBA 5IKWA 2HIWA 2P3GX 3KMUA 2W4KA 3Q5IA 2PUNA 2Z7RA 2X6EA 1LUFA 3E3BX 3KRXA 4F9AA 3DQXA 4QMQA 4RA5A 4O22A 3FC1X 3H4JA 4YTFA 3BEGA 2Z7SA 2IJMA 3UNZA 4QP6A 1YI6A 4RIWB 4D0XA 4JBOA 4EOPA 3HUBA 3UIXA 4IACA 4BDKA 3F7WA 2UZDA 3P0MA 1UU7A 1ZYJA 3RWQA 3GQIA 3GB2A 3PE2A 3LLAA 4L68A 2W5HA 1KE9A 4DCAA 3BX5A 3PY1A 2QOCA 4RIYB 3SAYA 3FY2A 2PZ5A 4QRCA 5AMNA 3OWLA 4GG5A 3DU8A 1OL2A 3VS2A 5ANIA 1WBNA 2YZAA 5GNKA 2CDZA 5IA3A 3WIGA 2CCHA 3AXWA 3UDBA 1W84A 4BCPA 4AF3A 4C33A 4D5HA 2J50A 4GS6A 3ANQA 4IC8A 2XB7A 3HL7A 4FTRA 2YJSA 3KXXA 3PJ2A 3QKKA 3PIXA 4GV1A 3CLYA 3UVRA 1MQBA 4RJ5A 4U43A 4F64A 3WZUA 5HG9A 1OUYA 2JKQA 5E92A 5IUIA 3VW6A 5IQHA 3BYOA 1H4LA 2UZLA 1CTPE 3NS9A 4IC7A 5LMKC 4GYIA 4O2PA 5CYIA 3QTIA 1R3CA 3RK9A 3K5VA 2DWBA 4D0WA 3IO7A 2P33A 3PFQA 4BDDA 1OM1A 2XK3A 4DT8A 2OJGA 3UE4A 3IECA 1NY3A 3QTSA 3UVQA 4YHFA 1YXUA 1W82A 5IPJA 4JNWA 3UYTA 4YR8A 5ETIA 4R3CA 4XHKB 1GZ8A 2Q0BA 2VN9A 2YCFA 4OW8A 4E8AA 4F0IA 4D4VA 2YLEA 2ZV8A 3DS6A 2R3OA 3PSBA 3DB6A 4PTEA 3AT4A 4WRSA 4WOVA 5FEQA 5CENA 3BQCA 2XKDA 3OS3A 4RJ8A 3TIZA 1Q41A 1YQJA 4BB4A 4HNFA 4FODA 3OWJA 3ZBXA 4R5YA 4C7TA 3CXWA 2FA2A 3MY5A 3MV5A 2BZIB 3ORLA 4Z7GA 2XRUA 4KIPA 4CCUA 4AZWA 5FXQA 4O83A 2ZMDA 4GCJA 4IB5A 2BDWA 3S4QA 1I09A 5E91A 1JQHA 3FMHA 4IB1A 3MA3A 3NX8A 5ANDA 5EI2A 4AA5A 2WMXA 3R28A 5EM8A 3KXNA 4AN9A 2R5TA 1OL7A 2PVFA 2IVTA 1L3RE 2LGCA 3KXHA 4YZBA 3AT3A 2VTHA 3R71A 1UKIA 4M15A 3AD6A 1ZWSA 3VW8A 5A4LA 4E1ZA 2CGUA 4IVDA 4HGTA 4LM5A 4PP9A 5KZIA 3OWPA 2ITPA 3DKOA 3TIYA 3TTJA 4C4FA 3TV7A 3MBLA 2ZOQA 1Q4LA 4U45A 3PG3A 2WNTA 1Q8ZA 1WCCA 2OLCA 5CEQA 4FX3A 3RINA 1R0EA 4RG0A 3P1AA 1QMZA 2BKZA 2GPHA 3FMEA 1U46A 3PRFA 4EOKA 1VYWA 5EKOA 3PJ1A 1YI4A 4CQEA 1ZY5A 3BWFA 4BZNA 4LGDA 3I4BA 4A07A 4DEEA 5JSMA 1YOMA 1SNUA 3HA6A 4EBVA 3AMAA 3RJCA 3IDBA 4UZHA 4ALUA 2VUWA 4TYGA 3V6SA 4AGCA 4L67A 4OTPA 3U9CA 3UGCA 1Q8YA 3WE4A 3EYGA 4Y46A 3QRKA 4QMOA 2I0HA 4IQ6A 4LV5A 2VTQA 2WMBA 2WTCA 3ZZWA 3I0QA 2QHNA 3TZ7A 3QLGA 5EH0A 4GK2A 3H10A 1SM2A 2BRGA 3OP5A 3R8ZA 3W33A 5IA5A 1OZ1A 2OGVA 1VYZA 1PXNA 3HDNA 3FI8A 4CRLA 3NGAA 5CQWA 3RVGA 1ZAOA 4ITJA 4FNZA 4QTBA 2CNVA 3EZRA 4BI2A 3MS9A 4K2RA 3TV6A 1XH5A 5HEZA 5KMOA 2PVMA 3OVVA 3SX9A 1M2QA 5HIBA 5HORA 3A7HA 4DEDA 3EQHA 4ITIA 4MBLA 2HENA 2WEIA 4M67A 2C47A 3ETAA 4L52A 2QKRA 4RX9A 3G90X 5JQ8A 4BCKA 1PF8A 4IB3A 4RWIA 4ZSJA 4EZ3A 1JNKA 3DXQA 4X6RA 3CJFA 4J52A 3W16A 4RC2A 2F7ZE 5FP5A 3VUTA 3A8XA 3HNGA 1M17A 4ZOGA 5EI6A 3LE6A 2WTWA 3DKGA 3D5WA 3VS0A 3C0GA 4LI5A 3E5AA 2PU8A 1GZNA 3ORPA 3AMBA 3PRIA 3ZO2A 3EHAA 5HKMA 4FKGA 4M97A 3UOLA 3PXFA 2R3RA 4RVTA 4QOXA 3FWQA 4RX5A 5LCJA 4FG8A 3QD0A 4PTGA 3LCKA 4GVJA 3RHKA 2OU7A 3ZSGA 4E5WA 5IUHA 3RAKA 3F2NA 4H3BA 4IFGA 4LV8A 1JOWB 4XLIA 4AX8A 3NUAA 5KZ0A 2VWYA 3ELJA 3G9LX 1H01A 3QX4A 4UMTA 2ITTA 5ANJA 4IZAA 5EQEA 5FQDC 3BELA 2OIQA 3KEXA 3SOCA 4O7WA 4BDFA 4KUJA 5EW3A 5ANKA 2XNEA 3GC0A 4PPAA 5LCKA 3BGQA 5CX9A 4B8MA 3R9RA 3L1SA 5FP6A 5L8LA 2YDJA 3LQ3A 2R0IA 4YZ9A 4E20A 2GCDA 1PRYA 3E93A 4MKCA 4OAVB 2ITNA 4QYGA 2BRNA 2WTIA 4H3PA 4G3GA 1H27A 4I4EA 3K3IA 4AG8A 2XEZA 3GCVA 2OJ9A 2YABA 4NUSA 4RJ6A 4C4IA 2F2CB 2ZDTA 4HZSA 4QMXA 3CP9A 4U7ZA 1Q24A 4NW5A 2EVAA 2W0JA 2WHBA 5CI7A 1SVHA 2PY3A 1P5EA 4FSWA 1GAGA 3VQHA 3DK6A 2XM8A 3FMDA 3FZ1A 3LHJA 5JGDA 3OF0A 1OGUA 3H9RA 3F88A 4ZZOA 4XOZA 3VQUA 5M57A 4RC4A 4YZCA 5EYDA 1Y8GA 4C37A 2QURA 2PTKA 2PVYA 3LJ2A 2C5VA 3VC4A 3EN4A 2Y9QA 2QNJA 3U9NA 3VS1A 3O23A 5D7AA 2G01A 5AEPA 3UC4A 3ZUVA 4O7YA 3EYHA 3G51A 3C0IA 4DF3A 3GVUA 3VUHA 4FV0A 4KKHA 4BTMA 3ACKA 3GUBA 3I81A 4EH6A 3VO3A 2W1ZA 5BNJA 5GIPE 2XM9A 2C5NA 5DBXA 4YTCA 4V04A 4C34A 4TYHA 3GU8A 3Q96A 5KX8A 2Y6OA 5HU3A 3KQ7A 2F57A 3E64A 1NVSA 5JZNA 3KA0A 3NUUA 5ACBC 4F6WA 4G5PA 2GS7A 2JDRA 4ALWA 3CKXA 4E4NA 3BRBA 5CVFA 2PMIA 3WZDA 1A48A 5D12A 4XP0A 2ZV7A 1BL7A 2Q0NA 3CPCA 3CD8A 4G6LA 1PMEA 3EFLA 4O7VA 4CT2A 4C61A 3F9NA 3JY9A 1QCFA 4WD5A 3OUKA 4EK5A 4ZZMA 3HV6A 1F5QA 4FI1A 3RI1A 4O27B 3S1HA 3FZOA 3NVKI 3P7AA 4DTAA 4F1OA 5L2IA 4FSZA 1H1QA 5K0XA 3QFVA 2AC5A 5CS6A 5AR7A 1V0PA 2HAKA 4BDAA 5CASA 3E8DA 3FKNA 4FKPA 2VX0A 4BCJA 5CAPA 3FLZA 3R8VA 2J0LA 3REPA 4N57A 4F1TA 5CEIA 5EDPA 2QOIA 5C26A 4I5MA 2OFVA 2BAQA 3A2CA 4FSNA 3HV3A 3ZMMA 1CSNA 2BZHB 4IVCA 3AGLA 3CCNA 2XA4A 4FSRA 3DLZA 1BYGA 5EG3A 3CC6A 2C5YA 4GH2A 5BVNA 1H07A 2W06A 3TZMA 4ANBA 4CNHA 2UZVA 4K77A 4CLIA 4XEYA 5CWZA 5BVFA 3GQLA 4BTJA 2AYPA 3RGFA 1S9JA 4IWQA 2C68A 3R8LA 5DYJA 3VAPA 4AT5A 4AWIA 5D1JA 5BQ0A 5J5SA 4HGSA 1H1SA 4BIEA 4USEA 4R5SA 4M0YA 4PX6A 4IX3A 3EH9A 3EZVA 4EK6A 3GFEA 4D55A 3NPCA 3PLSA 3Q32A 3VJNA 5IH4A 3LZBA 3JXWA 4U6RA 2YM4A 4N70A 2P2HA 3SG8A 4JG7A 3OY1A 3Q9YA 4AZFA 5IH6A 2YISA 4CV8A 4EJNA 4F6UA 3QQUA 3HVCA 4X2NA 5AUWA 5EYMA 2RF9A 2OSCA 4H36A 2NRUA 5EKNA 4J8MA 4GKHA 3DNDA 2XUUA 4ZSEA 2R3JA 4BDJA 3LMHA 3F5GA 1PYXA 2UW0A 4AW1A 2E9NA 2C6DA 4YC6A 3ATTA 4BYJA 2CPKE 2X1NA 3IOPA 4J1RA 3HMPA 1B38A 4FT5A 3UYSA 3RPYA 2WU6A 3OOMA 4ASEA 2VZ6A 4YJTA 1TQPA 4QMSA 4WNMA 4ZS4A 4AOTA 3PVWA 1OIRA 1WBPA 1URCA 3DBQA 5DR6A 4BFMA 3ZLSA 2ZYBA 4U3YA 3SHEA 2YIXA 4CFXA 4F7JA 3FZTA 4AN2A 4F99A 5HI2A 3H30A 5T68A 1XBBA 4WBOA 5FBOA 2BZJA 1OKVA 4Y95A 3F5UA 2PHKA 5BMMA 2XK8A 5TOZA 3CY2A 4PNIA 2W9ZB 5K5XA 5C01A 1IRKA 3ACJA 2QODA 4UEUA 5ANGA 1PMUA 4I0TA 4HVGA 4FT9A 4MCVA 4OTQA 3ZDIA 1KOAA 5I4NA 4DGLC 5KBRA 4C62A 4DEGA 3Q4UA 3EN9A 3O8UA 3SQQA 2ITXA 4GSBA 4CYIA 3DJ7A 4DFYA 2ZV2A 1OIUA 2G2IA 3T9IA 3MH3A 1A9UA 5CSXA 2BRHA 3DK7A 3NR9A 3BBWA 2WFYA 4RC3A 4FTKA 4R1VA 3ZS5A 4M7IA 4FVPA 5AX3A 5C9CA 4D2PA 5JFXA 2ACXA 3RPVA 3QHRA 3SG9A 3FYJX 4I94A 3NEWA 5BYZA 2PZPA 3NIEA 1PXIA 2JDVA 1WFCA 3K2LA 3MH2A 4PWNA 4QMZA 1ZLTA 4KINA 2PVJA 3ZUTA 2X8IA 3WOWA 2BAJA 3HAVA 2WD1A 2RL5A 3R7IA 2RG5A 3EKKA 4YC8A 2WAJA 3O2MA 3P7CA 5CANA 2ONLC 3NDMA 3B2TA 4CMTA 3CGOA 3CTHA 2IWIA 2YIQA 4UWCA 1EH4A 4W4XA 3KRLA 4G6NA 3RALA 3BKBA 3E7VA 4KNBA 5ANOA 1UNHA 2UW9A 3FSFA 2W1FA 1CKIA 2UW6A 4CVAA 4BCFA 1OKZA 3LFCA 1STCE 4BKZA 4M8TA 4YP8A 3VS7A 3AC2A 4C38A 4YHTA 4ZLZA 3R8UA 4OTFA 1Y8YA 3DAKA 3QC9A 3RZFA 3PY3A 5LVMA 2PZRA 1J7LA 3G33A 3PZEA 4FV6A 4RJ7A 3TNIA 5IA0A 4CTCA 5AUZA 5BYYA 4UBAA 3P78A 1WBOA 5GZAA 4D2VA 2IO6A 3HZTA 3MSSA 2R0UA 5DT3A 3RAWA 3SDJA 3ZH8A 4YZNA 5A46A 1GIJA 1Q61A 3A7IA 3DV3A 3KMWA 4EYJA 4EK3A 3BLRA 2C3JA 3LVPA 4BKYA 2WXVA 4OTIA 2OZAB 1JSVA 3R0TA 5IG1A 3ZLWA 4FYNA 4EOIA 1J1BA 3O0GA 4FZFB 1BLXA 4GFOA 4EOQA 4PL3A 2R3FA 3WYYA 4OTRA 2G1TA 5F95A 3C4XA 1UNGA 3ZOSA 3R30A 3DGKA 3KXGA 3ZONA 4A7CA 4QNYA 1H24A 5AR4A 2GFSA 3DKFA 5J5TA 2G15A 2YM7A 4DFZE 3BYUA 5HTBA 2ITWA 4ZEGA 2JIIA 1FPUA 3GOPA 2UZOA 3HEGA 4CTBA 2YN8A 1ATPE 5IQAA 3V5JA 1H0WA 5DNRA 2VX1A 5M4UA 3W2OA 3H9OA 3UMWA 4TY1A 4TNDA 3W55A 4ZSAA 4CGAA 3MPMA 4MBIA 3FHIA 4QP9A 5L6PA 2VO7A 3Q60A 4A06A 1OIQA 3I7BA 3LFAA 4OTHA 1PMVA 2QVSE 4IIRA 2HELA 5IH5A 2OXYA 3MFUA 3R7VA 4J97A 4F1MA 5GINE 4IDTA 3BWJA 4FSQA 2PMNX 5HG8A 3PZHA 2CGWA 5M53A 4I24A 5JKGA 1DAWA 2X81A 4E5BA 4H1JA 4NH1A 2VTPA 1PW2A 5CT0A 4ANOA 4QT1A 4JR3A 2V7OA 1ZRZA 5CSPA 2HOGA 4K33A 2B54A 1OITA 1G8AA 4AS0A 4E73A 3QZIA 2ZB1A 4RZWA 5J9YA 4O84A 3FY0A 3R63A 4GK3A 2XVDA 3LW0A 5H3QA 2RGPA 4BHZA 4O86A 2H8HA 2C6MA 1UV5A 3DBDA 3ZO4A 3AT2A 3F3WA 2GS6A 2JIVA 4YPDA 5HE0A 4LRKA 4I5CA 4KRDA 4IZ7A 3IK3A 5B2LA 4GJ3A 1J1CA 1WVYA 3LJ1A 3MGYA 4DBNA 5JGBA 3VUKA 4EUUA 3VWAA 3UNKA 5J8IA 5CU4A 4JBVA 5IU2A 1XKKA 4XRLA 4FV1A 4R6VA 3JPVA 4X2KA 3E8NA 3LFNA 2C3LA 5KKRB 2VWBA 2NNWB 1YWVA 4AFJA 5M07A 4MH7A 5ACKA 2OK1A 4ZP5A 3OY3A 1UU3A 2O65A 3Q4CA 1QL6A 3R00A 2X7OA 4YJOA 4HCUA 5AP6A 5EFQA 1KV1A 4R1YA 4EYMA 2CKEA 1PXLA 4HCTA 5LWMA 4U79A 4N6YA 2BTRA 5HGIA 4XBRA 5I3OA 3RCDA 3EQFA 4GYGA 2JDOA 4KAOA 3PJ3A 3ZEPA 1M2RA 4O81A 2JFMA 4AUAA 5GHVA 5M08A 1TQMA 2ZVAA 4IADA 5AV4A 3PLAE 2XJ0A 3LQ8A 3Q04A 4GVAA 5JFSA 1IAHA 2ZM1A 4DFXE 4BYIA 3EQRA 4JDHA 3DXNA 5AR8A 2Z8CA 1Q8UA 3R02A 3E92A 3FQSA 3IW7A 2WQOA 3ORIA 3E8CA 5HE2A 3BQRA 2XIYA 5CEMA 3NAXA 1PXKA 2QOKA 4IMYA 4RRVA 3QTWA 3R1QA 2UV2A 4NZWB 4RIWA 4LUEA 4S30A 1REKA 4L00A 4DLJA 3F3TA 3HYHA 3A7JA 3MTFA 3ZRLA 2H34A 2HZNA 3G0EA 4IVBA 2ITVA 4UZDA 5CSWA 4EKLA 1H1RA 3UMXA 4HVDA 4L43A 4XV3A 4I6BA 5FRIA 5AR3A 4V0GA 2XZSA 2GFCA 2F9GA 2I0EA 3OCSA 4FZ6A 4WG5A 5F4NA 4RIYA 1ZMWA 4JIAA 5L8KA 4G17A 3G0FA 2FSMX 2CJMA 4B7TA 3CSVA 3FL5A 4DN5A 2VAGA 2XK6A 3KU2A 4WO5A 4YLLA 3TI1A 2QLQA 2XK9A 4IW0A 4O2ZA 4ZTSA 4U40A 5BUEA 2CGXA 5J87A 3EFJA 2CKQA 2PE0A 4AFEA 4E6QA 4WG4A 5HTIA 3RCJA 5KHWA 3GC7A 2BRBA 4BGGA 4DTBA 3TNPC 5M44A 1GY3A 4I0RA 4KKGA 5FTOA 3R01A 2RFEA 4F6SA 4C59A 3HV4A 3I6UA 4M68A 3FYKX 3MVLA 5BVOA 1YDTE 5KBQA 5KCVA 4RVKA 2OH4A 3E62A 4ASXA 4G34A 5D11A 4JXFA 1ZYSA 2BFXA 4WA9A 5AUUA 4IWDA 1KOBA 5KMKA 1G8SA 4MD8E 1LPUA 5FTGA 3R7UA 4RX7A 4IH8A 4B99A 4QNAA 5E8VA 2VNYA 5C1QB 4USFA 5KMMA 4I5HA 1DS5A 4ZTLA 4XG7A 3F2AA 4AXAA 5B2MA 5G1XA 2P0CA 4D4SA 4YMJA 3PWYA 4FTTA 4A4LA 4ACDA 5HO8A 4OLIA 2G2HA 2EUFB 1RW8A 3NVMB 4RT7A 4E4XA 2VTLA 4YBJA 2YWVA 4QP8A 4WHZA 4F9WA 2Y6MA 3MN3A 4C4EA 5LQFA 1G3NA 2PE2A 4L3LA 3KVWA 4YHJA 4HGLA 2QOFA 2XKCA 4CFUA 4DH5A 5HLNA 5HX8A 3OTUA 3PDTA 5AJQA 3VUDA 3EJ1A 4OTGA 1XH7A 4AZTA 2VX3A 2WB8A 2WMRA 3VBQA 4HYIA 4JRVA 4F9CA 3QRJA 4L42A 4M14A 3GBZA 5CU3A 4ZIMA 4C2WA 3CGFA 2R3IA 4QP2A 3QCYA 4KBKA 3SLSA 4CRSA 4V0GB 4Y5QA 4R3RA 4N0SA 4AZEA 2HK5A 4OT5A 4YJQA 4Z7HA 3P86A 2A19B 5L2WA 3VRZA 5CAUA 3VUGA 4C4GA 4O0RA 3NNUA 4FVQA 4KBAA 1V1KA 2WTVA 1K9AA 3I5ZA 2PPQA 2R7BA 3OCBA 3UG2A 3QRUA 2UZUE 3HRFA 3THBA 4O7SA 3COMA 3MWUA 4QPMA 4WSYA 3A60A 4FTCA 2VGOA 2R3QA 4GFGA 4JRNA 3A7FA 4FG7A 4FV8A 4IFCA 5AA9A 3CJGA 4JI9A 3JVSA 3W18A 4BWPA 4DG3E 1M52A 2XK7A 4EJ7A 3FZPA 3UQFA 4V05A 3Q4TA 3ZTXA 3WZEA 1RJBA 4W9XA 2PUUA 3SC1A 4EHVA 3BYVA 2IVUA 2B9JA 3SW4A 3QCSA 2C6LA 2A2AA 5HHWA 4DBXA 1YXXA 1NA7A 3ZRMA 4EOSA 2XP2A 1ZMVA 2BMCA 4G6OA 5DIAA 3EN7A 3D4QA 4ZXTA 3R9NA 3WE8A 5K9IA 5FUTA 1H1PA 4UXQA 3VNTA 3ZXZA 4CLJA 4J53A 4TZRA 2PZIA 3F66A 5CXHA 3ZU7A 1QPEA 5I9VA 1GZKA 4GL9A 4KSPA 3FSKA 1ZOGA 2OJFE 5AUVA 3DCVA 5IZFA 2UVYA 3OMVA 4Y83A 4NW6A 5FXSA 3BI6A 2X2KA 5LVPA 1CMKE 2OH0E 5T3QA 5AR5A 4D5KA 2VTJA 3DPKA 4IAKA 4O96A 2R3GA 2C5XA 4ACHA 3PXKA 2GHMA 5DEYA 4XOYA 5H2UA 2CCIA 3SKCA 3VS6A 3HAMA 3PXZA 1OBDA 3T8OA 3RTPA 3S3IA 2WMWA 4NM0A 3D15A 4XUFA 3DKCA 2YDKA 3LFSA 4IX5A 4ZK5A 5JQ5A 5KMLA 4BHNA 5DPVA 5DRBA 3A99A 4U80A 4UYAA 4E93A 4ZTMA 3R73A 3Q9XA 2IW9A 2JD5A 3EQCA 3MYGA 2VWIA 4FOCA 4ZSGA 3OW3A 4ZS0A 4RMZA 2O0UA 2VWVA 2YEXA 2Z2WA 3EN5A 4QMLA 5TE0A 3RAIA 4F4PA 4KWPA 1WBSA 4D2RA 4EH3A 3IONA 4DFUA 5JEBA 3F3VA 2IVVA 5CTPA 4XNEA 4S31A 2VWWA 1V0BA 2QG5A 2VU3A 3W2PA 5HOAA 2WO6A 3ODYX 3DB8A 3AC1A 3BU6A 3QTXA 3GEQA 3HLLA 3LMGA 3UPXA 2H6DA 3DFAA 5BVEA 3RK7A 3VVHA 4BCMA 2QC6A 2VTNA 3L9NA 3FLWA 4FGBA 4X3JA 3UO5A 2Z60A 5L4QA 5E90A 2J0IA 2YERA 2PMOX 3FZSA 3HMMA 4YO6A 1JAMA 4HW7A 4I20A 2WOTA 1DI8A 4CD0A 1UWHA 2W1CA 4ZSLA 3ZM9A 3QGYA 1QPCA 1BI8A 2BROA 3FI4A 3SRVB 2RFDA 4AOIA 2VTRA 2CKPA 5HO6A 3R83A 1JPAA 3RP9A 2C0TA 3PVBA 5CEOA 4CFMA 5IQIA 1PKGA 3KF7A 3L8PA 4ZTHA 3ZO3A 1U54A 4KKEA 4FKOA 4XV2A 5BVDA 4KABA 4JX7A 4MHAA 2OG8A 3QC4A 2ZMCA 1ZY4A 4IHPA 4BIDA 4U8ZA 4L9IA 4ITHA 5E8ZA 4OT6A 5GJDA 4O1OA 1U4DA 4K9YA 5ETCA 3DOGA 1W8CA 2YM3A 5CU0A 3K54A 2BUJA 3VS3A 5BMSA 2JKMA 3F5XA 3L9PA 3QBNA 4YJNA 2UUEA 3ORXA 3ALNA 2RFSA 3R9OA 3L8XA 3FXXA 4X2FA 4BKJA 4F0GA 2YAAA 2SRCA 4ZJIA 2Z7QA 3ALOA 2YCRA 3C0HA 3T9TA 4DC2A 4O0SA 5ICPA 5BYLA 2VWXA 4D4RA 5JGAA 4S34A 4L3PA 3V8WA 3Q3BA 3GCPA 2CLQA 4U97A 2EXMA 4X3FC 2XBJA 4EH5A 3JS2A 3PP0A 2W5BA 4I41A 2ZM4A 1OL5A 4JDIA 4AACA 3NZ0A 4DG0E 4GK4A 2QLUA 4Y5HA 4EH9A 4TT7A 5DN3A 3DY7A 4CKRA 1UNLA 3LFQA 4J95A 5FEDA 5AADA 2X2MA 3PVUA 4PL5A 3T3VA 3O7LD 4E6AA 4MXOA 3A8WA 2FSOX 1BKXA 2R2PA 4YO4A 2XJ2A 4MNEB 1J7IA 4KS7A 4W8EA 4W4VA 2E2BA 2UZEA 2ZAZA 5C8MA 2PULA 4FKQA 4G3FA 5CU2A 3MESA 4XYFA 5DT0A 2J51A 1ZOEA 2OW3A 3IW4A 4MQ2A 3WF8A 3IDPA 5IQEA 2VWZA 3WYXA 5EHOA 1SVEA 3N51A 3ZM4A 3I7CA 1PYEA 2GQGA 4LL0A 1JKLA 2BFYA 5AIRA 3MB6A 2JFLA 4BDCA 2W96B 1WAKA 2XBAA 1RQQA 3C4EA 3OXIA 2B53A 1OPLA 1U54B 1Q62A 3OCTA 5E8UA 4EUTA 3TM0A 3QX2A 1PXMA 3DBEA 2UW4A 3R7GA 4D9UA 2ETMA 4AN3A 5HBHA 4I6FA 5L3AA 1NT2A 4C4JA 1ZYLA 4MWHA 4YU2A 3TKHA 4NM3A 4OAUC 2W4JA 4U44A 3KK8A 1LEZA 3BU3A 3S2PA 2PE1A 5EYCA 1IA9A 3ATSA 5LMKA 4IXPA 3PJCA 4TWNA 4YJRA 4FICA 1LR4A 4G3EA 4DFBA 4FEVA 3NRMA 4U9AA 4AP7A 1ZZLA 4DT9A 4LRMA 4YJPA 4EH7A 4J99A 5TKDA 3W2RA 3AC5A 4AW0A 2W9FB 5CVHA 2OXDA 2XNBA 4ONAA 5E1EA 1Y57A 5CQUA 3LFDA 3R21A 4FA2A 4HVHA 3IW6A 3OW4A 5C4KA 4MWIA 4A9YA 4D2SA 4ERKA 5KMNA 4A9RA 4FEUA 3LFBA 2HW6A 4HCVA 2Y4PA 2WPAA 3QQLA 2RFNA 4QP1A 4FTJA 4DAWA 4PDYA 2QO2A 4DEIA 5H8BA 4O91A 5C27A 2Y7JA 3CBLA 4UMQA 2YITA 5IMEA 2RG6A 3F3UA 1FINA 3FMNA 4MD9E 2A4LA 4PDOA 5J79A 4FL2A 4K1BA 2E9VA 3KCFA 3S0OA 4CG8A 2HZ4A 4D1XA 3VIDA 1WMKA 4EL9A 4QTDA 2W4OA 4TN6A 5K4IA 3I79A 3DDPA 4EHZA 2WTKC 3EMGA 1UWJA 3QD4A 4M69A 4G16A 3KXZA 3TJCA 4FIEA 4BCGA 4UMRA 3WI6A 4WG3A 3H9FA 5CT7A 4JDJA 4QTAA 5AP0A 3V01A 3KRJA 4MXXA 5HESA 4KIQA 2OIDA 4U81A 3B2WA 3FJQE 3RMFA 3ZZEA 1Q8TA 4B4LA 4PDSA 3O7LB 3P08A 3OZ6A 3QA8A 4AU8A 2WMAA 4D2TA 5M4CA 2IG7A 4L46A 1TKIA 4ZLYA 4H58A 3UNJA 3UO4A 5JH6A 1O6YA 4FMQA 4L44A 1YXTA 1AGWA 2YM8A 4Y85A 5HQ0A 2QONA 4IEBA 3QQKA 4L45A 4OUCA 2YM6A 5AX9A 3OROA 5LOHA 4QMYA 4TYIA 4D1SA 3L8VA 3OT8A 2ZJWA 4NK9A 3KN6A 1JBPE 5IISA 4YLKA 5ANEA 1KV2A 5AM6A 4RGJA 2ITQA 4YTHA 3QWKA 1MRUA 3WF9A 3UOHA 4GEOA 4MYGA 4ZTQA 1M7NA 5HO7A 4F7SA 5A4TA 3FDNA 1OPKA 1PHKA 4BBMA 3KL8A 4YTIA 3OD6X 5L2SA 3R04A 2GDOA 3Q6UA 4Q9ZA 1YWNA 3QCXA 4EH8A 4RJ3A 5A3XA 1JVPP 2CN5A 3P9JA 3R9HA 2HZIA 1DM2A 3B8QA 4JT3A 5LJJA 4FTLA 5JRQA 3JVRA 2KTYA 2QOOA 3AD4A 3Q52A 4HYHA 4NM5A 4TWCA 2IW8A 1WBVA 4WNPA 5AP7A 3TZ8A 2EXEA 1Y6BA 2W1EA 3D7TB 3KK9A 2GQSA 2R3KA 3FMMA 4RA4A 4TYJA 1JSUA 5CALA 1CKJA 4BCHA 5JN2A 4L3JA 2WQBA 4HJOA 3GC9A 1XJDA 2FYSA 1Z57A 4EK8A 4LGGA 3ZCLA 2GNJA 2F2UA 2PYWA 2A0CX 2X8EA 4FNXA 4UWYA 2VV9A 4XLVA 1H08A 4TPTA 4Q2AA 3M2WA 4NFNA 1NW1A 4FTOA 3PPZA 3U6HA 1U5RA 4M69B 3LLTA 4UXLA 4YBKA 1H00A 2JGZA 3HMOA 4BIBA 3V5PA 5C4LA 1MRYA 3RM7A 5K0KA 3SV0A 4QYYA 2C30A 3QHWA 2PSQA 4FKWA 5EM7A 2LAVA 4EOJA 2EWAA 2J90A 4NIFA 2HWPA 1XBAA 3S95A 4C3RA 5EI8A 2WZJA 1GOLA 2OZAA 4QTEA 3CEKA 4CFFA 4IAFA 2HXLA 1MUOA 2WIHA 3ULZA 4F9YA 1Q8WA 3C4WA 4WIHA 3TNHA 1YHVA 3U6IA 4AAAA 3NUYA 4JJRA 3JR1A 3BYMA 3R7EA 3RPRA 3KB7A 4MEDA 4BCIA 2O3PA 4O38A 4IBMA 4G5JA 2UZNA 3UG1A 4IX4A 5IQCA 1SMHA 4IM3A 4BCQA 3C5IA 5EW8A 4G1WA 4LOPA 4QO9A 5JZJA 3FEGA 3MFRA 4P5QA 4CZYB 4L7SA 3POZA 4R7HA 5IQFA 5CNOA 2VTOA 3ZLYA 5IQBA 1FMKA 3QTQA 4ZMEA 2XNGA 5JT2A 1PJKA 5I0BA 4RIXB 2GHLA 4RFZA 3FXZA 1RDQE 4UALA 1Q3WA 4IZYA 4UMUA 1Q99A 4H1MA 3R7OA 5CXZA 3F61A 3L9MA 3DK3A 3UQCA 1JSTA 3N4VA 4B6LA 3EL7A 3PTGA 4L7FA 3SVVA 3ANRA 1YKRA 4KB8A 4BCNA 3C1XA 4UB7A 5A9UA 3DLSA 5E8SA 4QQTA 5BUJA 1XO2B 3HRBA 4BVUA 3QLFA 2J5FA 4KBCA 4C3FA 4ZY5A 3H3CA 1VEBA 3NYOA 3II5A 3DNEA 3QXPA 3FPMA 4CKJA 3LOKA 5HCZA 2VGPA 2C5OA 2NO3A 1H0VA 4MXAA 4GUBA 3DJ5A 3QYZA 4AA0A 3VULA 2FB8A 5FDXA 2X0GA 3EFWA 3AGMA 3O96A 3OXZA 3CQUA 5DE2A 5CY3A 3FL4A 5FD2A 1T45A 4MQ1A 3V6RA 4QMVA 5AUTA 2FSLX 1IA8A 2J6MA 3QQHA 4E6CA 2VO3A 2GSFA 5F1ZA 3G5DA 4YJVA 4TL0A 4FZ7A 2BRMA 4UX9A 2YACA 3GT8A 3AC8A 1ZOHA 4J96A 4NIFB 5HVKA 4FSTA 3UP7A 1Q97A 4F08A 4NTSA 4PRJA 3FZRA 4DH7A 3NUPA 2YIWA 3H0ZA 3M42A 4BN1A 3EQIA 4YSMA 2XEYA 2QD9A 3PG1A 1WBWA 4ID7A 4I5PA 5FBNC 2GNHA 5GZ9A 5DR9A 2UZWE 5DOSA 4WUNA 2BPMA 3IG7A 3RBWA 1L8TA 3MVMA 4KIKA 1SZMA 4GMYA 4MF1A 3WZJA 3NYNA 3GU4A 4IX6A 1S9IA 2VO0A 4DH1A 3O51A 3UOJA 2R64A 2UW7A 1WVXA 1KE5A 1QPDA 3BHTA 3MJ1A 2XRWA 4NTTA 5CNNA 4FK3A 3LXNA 4IJPA 5E4HA 4JIKA 4YGAA 2QCSA 4FBXA 4S32A 5F94A 1YDSE 2QOBA 4EC8A 2CLXA 3GU7A 2C6OA 2YJRA 1E1XA 5BX0A 3BE9A 4IE9A 5HD4A 1TVOA 3EQGA 4BDEA 4ZLOA 2WOUA 4M13A 4DH3A 3EQDA 3EB0A 4JLCA 2G9XA 4TYEA 5IDPA 2ITZA 3AOXA 3W10A 2FH9A 5ITAA 1H1WA 3VRYA 3A62A 5IA1A 2HW7A 4C02A 3ZFXA 4QQJA 2ITOA 3CD3A 4MXYA 5AV1A 2I40A 4JG6A 1YRPA 4BTKA 3UBDA 4USDA 3UVPA 4A9UA 1W83A 4I6HA 2REIA 5A6OA 3KN5A 4DGOA 3NWWA 4Q5EA 3W8LA 4JOAA 4S2ZA 4EQMA 1Z9XA 2J5EA 2BDJA 4ZTRA 1XBCA 3F69A 4I93A 4BTFA 2V22A 2CNUA 4XG9A 1ZYDA 5I9XA 4W8DA 3R22A 3QALE 2C0IA 5GJFA 3ET7A 2Z02A 1B6CB 4O0UA 3POOA 5HIDA 5J9ZA 5H8EA 4IJ9A 4DEHA 2VD5A 2C3KA 4ZJJA 4FK6A 4ANNA 2ZV9A 2XK4A 2WQNA 3FAAA 3VBVA 3LCOA 1PXOA 4O7NA 3L8SA 1OECA 5I3RA 3G6GA 1REJA 2WQEA 3E7OA 4CZTA 2FSTX 2YWPA 4KIKB 1SVGA 4LFIA 2CKOA 4FIFA 3AC4A 5CAVA 4O21A 2HWOA 4O7TA 3HRCA 5J1VA 2PK9A 3Q9ZA 5DMZA 2WKMA 2JIUA 4NSTA 2WGJA 2YA9A 4JQEA 3PXQA 4FKLA 4O0TA 4F0FA 4LGHA 2X8DA 4L8MA 3UJGA 3ZBFA 3MVHA 4JQ8A 3ITZA 4BF2A 2DQ7X 1U59A 2I0VA 4EZ7A 3MY0A 2VWUA 5IA2A 4XX9A 4R7IA 3PSCA 3QTZA 4RBLA 2DYLA 4CYJA 5IF1A 4C36A 3W1FA 2WMUA
chains in the Genus database with same CATH superfamily
3PPKA 3RZBA 1MP8A 5DGZA 4EWHA 2W1GA 2IF8A 2HY81 3ZRKA 5ETFA 3PJ8A 3GNIB 4FC0A 4Q5HA 3UPZA 2PVKA 1O6LA 2B9IA 3QUPA 2B4SB 4I1ZA 4RZVA 3V5QA 4EH2A 4YURA 2JEDA 4JBQA 4TWPA 3ROCA 2P55A 2C3IB 3I5NA 4QMMA 1KE7A 4O6EA 4TRLA 4FUXA 1APME 4NJ3A 4CZUA 2W1IA 4NCTA 3NCGA 1OPJA 5LVLA 5DVRA 5EM6A 3TWJA 3PXYA 5AP4A 4ZJVA 3UIUA 4FKRA 3QKLA 2R3LA 4TKSA 5DI1A 3CS9A 5HE1A 4P5ZA 2IZUA 5M55A 3UODA 1NVQA 3ZFMA 3DAJA 4WBBB 5J95A 3LCTA 3VF8A 1DAYA 3NW7A 4H3QA 2VTTA 2Y4IB 4GIIA 3HKOA 3QQFA 4ORKA 4AOJA 3KGAA 5E7RA 3A7GA 3A4OX 4N4SA 3TKIA 3CY3A 4CCBA 2BDFA 4QQ5A 4M66A 4APCA 4C8BA 2YM5A 5FDPA 5JK3A 3BLQA 4EONA 4BBFA 4GG7A 4A4XA 4CFNA 1IAJA 2W99B 4U41A 2O63A 1K3AA 5KUPA 3VHKA 3A61A 2X6DA 2OZOA 2R3NA 3D5XA 3JY0A 3KXMA 3L9LA 4MX9A 4NKSA 5CLPA 5A4EA 2UVXA 4EEVA 4DG2E 4QYEA 5KNJA 3BHUA 3AC3A 4TWOA 3ZEWA 1XH9A 2I6LA 4EI4A 5CEPA 4O0XA 2PMLX 4BGQA 1IASA 3FPQA 3FMLA 1YDRE 4NKAA 5CF5A 4GUEA 3BV2A 5IEYA 5M4FA 3DBFA 4FKUA 5LMAA 4FL1A 5A54A 3R9DA 5C8NA 4PF4A 2QOQA 4DTKA 1TQIA 3P79A 3FLQA 4NFMA 5H8GA 2B7AA 5AIKA 4L01A 4ZMFA 4GFMA 2KULA 3TCPA 4NYEA 2I7QA 3LFFA 1R39A 3HMIA 4EH4A 2R3MA 3UP2A 4RSSA 3Q2MA 3NMUF 1LP4A 3TNWA 5AM7A 4ANQA 4AW2A 1CDKA 3BLHA 4CMUA 3FMJA 1XR1A 3CE3A 3FQHA 3MB7A 5AAEA 4QYHA 3F2RA 2XIKA 4RWKA 5HE3A 1KSWA 3GCUA 4CSVA 2X0QA 5HU9A 2RSVA 3MTLA 4J8NA 3V04A 5KMJA 2J2IB 4BGHA 4FIIA 4QP4A 3SXFA 2QU5A 3KC3A 5A4CA 4C2VA 1KE8A 4EQCA 2IEWA 1CM8A 3EQPA 3MFTA 3MH1A 4BCOA 1E9HA 3FE3A 4XH6A 2J4ZA 4F63A 2IW6A 4X2GA 1OI9A 1XH6A 1KUTA 2V7AA 3BHVA 4XJ0A 3RPOA 1ZMUA 3VBWA 3QU0A 2XMYA 4TTHB 3NAYA 1J3HA 3N4UA 3RWPA 4IAAA 4LMUA 3KULB 1I44A 3GU5A 1Q5KA 1R78A 4GKIA 1WBTA 3KREA 4FG9A 3OXTA 3SRVA 4BI0A 3QZHA 2WMQA 3WARA 3I0OA 5DA3A 1W2DA 2IZTA 1GIIA 4GT4A 3B8RA 4FIHA 3EL8A 4FT7A 1CKPA 3MJ2A 4ASZA 5AAGA 3MDYA 3IDCA 3Q53A 4A9SA 3I60A 4LOOA 4O0YA 5HG5A 4XV1A 5CF8A 4FTUA 1NXKA 2OF4A 4G3DA 4BL1A 3W0MA 3PE1A 4ACMA 4G2FA 2AC3A 4IVAA 4RQVA 2R7IA 3QQJA 4P2KA 5FTQA 2QOLA 4FL3A 3KRWA 2H9VA 3TN8A 3UTOA 4AZSA 2VTIA 3GGFA 5IDNA 2EB2A 2BTSA 4ACCA 3MA6A 4OTDA 4YLJA 4UWBA 4FIJA 3ZFYA 4PV0A 3D5VA 3VBYA 3F82A 2XCKA 5L8JA 4IANA 5HLWA 3BPRA 4ACGA 3NSZA 4WT6A 1OL1A 4BDGA 4TW9A 1JKKA 3C9WA 3NUNA 5B0XA 4F09A 4IAZA 3DZQA 4CFVA 2ESMA 2HYYA 5HCXA 1H25A 1DI9A 4RQKA 3ZSIA 4Y72A 1BL6A 3TXOA 4E26A 4EZ5A 4LRJA 5A14A 3OFMA 2R4BA 3QUDA 3R1SA 4BZDA 1K2PA 3KRRA 1OKWA 3UC3A 3TJDA 5J7HA 4DCEA 3ZLXA 4MNEA 3D0EA 3Q2JA 5AFVA 1OUKA 1U5QA 3HP2A 5JRSA 4E4LA 5FM3A 1HOWA 2JLDA 1W7HA 4K18A 3V8TA 2DUVA 5DFPA 5HNIX 4N6ZA 4DINA 2WTJA 4NJDA 1GZOA 2X4ZA 3CQWA 1QPJA 3DT1A 4K8AA 4K0YA 4BICA 4GU9A 4DGNA 1BUHA 4BWXA 3AKKA 2XNNA 4FT3A 4YJUA 4JR7A 5AUYA 1F0QA 5B7VA 1A06A 4GW8A 3LJ0A 4RFMA 3O17A 4CT1A 2W1HA 5ETAA 4D58A 2GHGA 4QMNA 5HICA 3FHRA 4PUZA 1NVRA 2B9HA 3PA3A 4DEBA 2NRYA 3TDWA 2J0KA 4GRBA 4K11A 3U55A 2O5KA 2OICA 4XMOA 2ZB0A 1JKTA 3MW1A 3QZGA 5CZHA 5HD7A 5TR6A 5LVNA 3HX4A 5BVWA 3HMNA 3KCKA 2WELA 4KD1A 4M12A 2W17A 4RFYA 5IQGA 2P4IA 2V55A 3QZFA 2XNPA 3UO6A 4ALVA 3VS4A 3ERKA 3TV4A 5IQDA 5DEWA 1MQ4A 3NW5A 3FKOA 1W98A 4ASDA 3C13A 5IEXA 3NYVA 3IPHA 3QRTA 3MY1A 3P7BA 3OEFX 5IUGA 5EQYA 1Q3DA 4DLIA 5A6NA 1YWRA 4I23A 1VR2A 5G6VA 5HG7A 4PNKA 4FKSA 3RHXA 2W5AA 4WKQA 3EOCA 1KWPA 3BEAA 2BKKA 2GQRA 2XYNA 4H39A 2BILB 4KRCA 5M06A 3NIZA 4FF8A 3VUMA 1J7UA 3LQ5A 1VJYA 1XMLA 4ZY4A 1UU9A 4W4YA 2XALA 4QPSA 1Y91A 4R3PA 1HCKA 3UZRA 5J7BA 4FT0A 1IG1A 3N9XA 4FYOA 3IGOA 3ZHPC 1J91A 3D83A 3RKBA 3COKA 4OGRA 2GTNA 2VTAA 3PSDA 3RNYA 4RVLA 2F4JA 3CQEA 5M56A 4JAJA 2V5QA 3D9VA 1Y6AA 1XMMA 4C4HA 3OT3A 3OHTA 5EYKA 4A9TA 5DRDA 2QG7A 4AGUA 4RWJA 4Z16A 4IM2A 2XIXA 4FV3A 4RWLA 4W9WA 3GENA 3VBXA 1M7QA 2XAMA 3BGPA 4QQCA 3BBTB 5D9HA 4ANMA 5GIOE 4U3ZA 4MF0A 4P7EA 3HGKA 2C4GA 2HY0A 2R3PA 4MD7E 4NT4A 3PYYA 5I9UA 2JAVA 1V0OA 4EK4A 4UMPA 5FXRA 4BDHA 2FVDA 3BGZA 4PMSA 3EIDA 1OB3A 1GJOA 4M0ZA 4OTWA 4ANSA 3UOKA 4D9TA 1YHWA 3QTUA 3R1NA 4YNEA 2P2IA 3E8EA 4LG4A 2W1DA 4FR4A 4FSMA 3O8PA 3CTQA 4QMWA 4RPVA 4AAYA 1OKYA 4XV9A 3Q5ZA 2HXQA 2XNOA 3QRIA 1RE8A 2VNWA 4HZRA 3RAHA 4CXAA 1HCLA 4L6QA 1ZYCA 4R8QA 2GTMA 4PY1A 3F5PA 3NLBA 4DEAA 4NL0A 2ITYA 3U51A 5AV2A 5CEKA 3Q6WA 1OBGA 4FTMA 2CMWA 1P2AA 3I6WA 2IVSA 5BVKA 3TUCA 4O7LA 2XS0A 4M84A 2NPQA 3O50A 4W4WA 4EHEA 5L6OA 3ODZX 4C58A 4FTNA 4I0SA 4CV9A 2R3HA 3MIYA 1URWA 1G5SA 2OI4X 2XCHA 3TTIA 4BRXA 5JFWA 4WUAA 4UV0A 4I21A 4DHIB 5DH3A 3NUXA 2C1AA 3D7TA 3M1SA 4X0MA 2ITUA 3VUIA 3WILA 3VN9A 2F49A 2JKKA 4HOKA 4E3CA 4J71A 4MUQA 3NFGB 5LWNA 2BAKA 3TT0A 2BZKB 1SNXA 4FKTA 3VS5A 3DTWA 3PIZA 4KIOA 5HVYA 3V8SA 4FKVA 1OMWA 4FV2A 4YJSA 5AV3A 2UZTA 1PKDA 4O6LA 4Y8DA 3DZOA 1WZYA 4FSYA 4I6QA 1OVEA 4AGWA 3SW7A 4C57A 4M3QA 2WQMA 3O71A 3NUSA 5EDRA 2GU8A 5TO8A 2CNQA 3C4ZA 4JQ7A 4R78A 4EOLA 2YDIA 3ENHA 3V5TA 1W2CA 2Y0AA 4L53A 5FM2A 3U4WA 2QO9A 4XP3A 3OEZA 3VJOA 3LXKA 3ZUUA 3T3UA 3W32A 3WZKA 2PVHA 3ORTA 4C35A 3QWJA 3F6XA 3LXLA 5FWKK 4XS2A 5KKRC 3TYKA 3UIMA 2FO0A 3MIAA 4X7QA 4QYFA 4ZTNA 4B8LA 3DA6A 1E1VA 1IEPA 3PY0A 4LQMA 5KO1A 5BUIA 2QR8A 5EK7A 3TUBA 2BCJA 4DFNA 3W2CA 4YZDA 3AD5A 4KS8A 3GI3A 2GNFA 2J9MA 4QD6A 3S00A 5BV3A 2B9FA 4DGMA 5BPYA 3BCEA 4F65A 1H28A 4HVIA 3C50A 3FLYA 1PY5A 1H8FA 3FLSA 4AZVA 2WU7A 4D2WA 4QMPA 3SXRA 2EB3A 4PDPA 4DFLA 2F7XE 4DYMA 2W7XA 2X9FA 1ZXEA 4BBEA 3FI2A 5M51A 3SGCA 4Z3VA 2QU6A 3R8MA 3EFKA 1H26A 3BHYA 2OKRA 2G2FA 2XH5A 3IKAA 3FLNC 3KF4A 4RIXA 2J7TA 4AXFA 3RM6A 3ULIA 4ZAUA 2O8YA 3R6XA 4F78A 4CMOA 1GIHA 2JITA 4WNKA 1UVRA 2HCKA 5K3YA 5L2QA 4XG8A 2BIYA 2VTMA 3V3VA 3ZXTA 4YNOA 3QTRA 3WF7A 5LMBA 3AKJA 3PA5A 5I5ZA 4EWQA 4DH8A 3DDQA 4EC9A 4O7ZA 3OCGA 5EOBA 3HV7A 3Q9WA 4UY9A 4HPTE 1BMKA 3C7QA 3LKMA 2OBJA 4BR3A 3PUPA 3IS5A 5EDQA 3ORZA 2Q83A 1FVTA 2V0DA 2JBPA 4GT5A 2OO8X 3DQWA 3KFAA 1AQ1A 3M11A 3EQBA 4PPCA 3VBTA 1GNGA 4EOMA 1XH8A 1IR3A 4DA5A 3QAME 4MXCA 4AT4A 2B1PA 3TDVA 2ERKA 5AP3A 4FGRA 2BHHA 3I1AA 1FMOE 2CGVA 3SA0A 4OBOA 5EW9A 5LARA 4R77A 2IPXA 2Y4IC 4XP2A 4X3FA 1UKHA 3CKWA 5AUXA 3ZC6A 4J7BA 5J9LA 3JUHA 4Z9LA 5I9WA 3R2YA 4K6ZA 4MK0A 4TYHB 5HTCA 4FEXA 2BIKB 3G2FA 2QI8A 3TEIA 4FEQA 4DGGA 4AA4A 2GNGA 5GZ8A 5T6KA 3LMIA 5AAFA 2YLFA 3WBLA 2IZSA 3DJ6A 3BE2A 3PWDA 4C0TA 4FE2A 4FKIA 3TUDA 3U6JA 5E9EA 2NP8A 2OXXA 2BHEA 5FG8A 4F7LA 4XG2A 2PL0A 4U5JA 2V62A 2Y8OA 3FQEA 3KY2A 2W05A 4A4OA 4ERWA 2J0MB 4JL9A 4PTCA 4R7BA 4XBUA 5E8TA 3MPTA 3AG9A 3BYSA 3ORKA 2C6KA 1ZARA 4LMNA 4MBJA 3ZYAA 3DTCA 3LCDA 4Y73A 3GC8A 5CVGA 3TL8A 4B0GA 4ENXA 1XH4A 3LIJA 4IB0A 4EBWA 4ZZNA 2PUIA 4XCUA 2YIYA 4NEUA 4I3ZA 4U0IA 4OBQA 1FGIA 4JDKA 5TF9A 5JFVA 3QUEA 5FLFA 2OJJA 3HV5A 4IWPA 5E8XA 1KE6A 2I0YA 2X0PA 3QF9A 4FV9A 4I4FA 3NYXA 4BC6A 3IW8A 3AMYA 3C5UA 3PA4A 4JAIA 4KSQA 3UZTA 4D4YA 2X4FA 2PVNA 4FV4A 4APPA 3PP1A 2WMVA 5I9YA 5CSHA 4LL5A 1XHAA 5CF6A 2PVLA 2E9PA 2UZBA 2ERZE 3A4PA 5J1WA 3MH0A 4F70A 4QMTA 3V51A 3ZDUA 2PUPA 5DHJA 3QKMA 3D2KA 1O9UA 3ENMA 2UW3A 2BALA 3W2QA 1PXPA 4AE6A 4CQGA 3COIA 3D2IA 4NCTC 3TG1A 2C6TA 2GNLA 4MAOA 5E1SA 2E9UA 4AQKA 2CSNA 4DE4A 3R2BA 3Q4ZA 4FKJA 4MXZA 4DHFA 4Z55A 3LM5A 1YI3A 1FOTA 4ZY6A 5KMIA 4O82A 4PMTA 2UW5A 2ZM3A 2QOHA 4D1ZA 5EM5A 4GT3A 3TKUA 4H05A 1P4OA 5IA4A 1P4FA 3BHHA 5CZIA 1XQZA 4YPSA 3QCQA 5F9EA 3MFSA 5K5NA 4X3FB 3WIKA 3E87A 3NW6A 4LYNA 5I9ZA 5LXMA 1WVWA 1YW2A 3EWHA 1ERKA 3QGWA 3ZO1A 3FKLA 4UN0C 3KMMA 4WSQA 4QEBA 4QP3A 5C03A 5HIEA 3ORMA 4BY9E 4IAIA 3F3ZA 2CHLA 4OR5A 4FEWA 3UIBA 3ML1A 4DHZA 3MPAA 2X39A 2O2UA 4BZOA 1B39A 2FUMA 3G6HA 3BU5A 4YZMA 3OBGA 1OIYA 4FTIA 4F9BA 4LOQA 4BWKA 3R1YA 1R0PA 1VZOA 4IZ5A 5M09A 3IOKA 3U8WA 3MI9A 4X21A 4BDIA 2E9OA 5HCYA 3RPSA 2X7GA 4EQUA 2XIZA 3LXPA 5AP2A 3MVJA 4AQCA 4FZAB 5FGKA 5HX6A 4HVSA 4FNWA 3DAEA 3HP5A 3JYAA 3VF9A 2XF0A 5LVOA 4IM0A 4GJ2A 4CKIA 2VO6A 4JBPA 4E4MA 5CAOA 2JAMA 3R7YA 2YHVA 2XYUA 3PXRA 4JG8A 3OWKA 5HZNA 1T46A 4JS8A 3E3PA 3D5UA 4TNBA 3CPBA 4RJ4A 2WMSA 5EHYA 3FC2A 4RLLA 1PXJA 1FVRA 4EORA 2RIOA 4YSJA 4EKKA 1ZZ2A 3QD3A 1BI7A 3NCZA 5IMXA 5CAQA 3U4UA 2UW8A 2VRXA 3OC1A 3KKVA 1Z5MA 5HLPA 3QD2B 3R8PA 3W8QA 3P5KA 4HYSA 2WMTA 4I92A 4O1PA 3W2SA 4X2JA 1YVJA 2FGIA 4IAYA 4IDVA 5HNGA 4D28A 4OBPA 5E8YA 4BDBA 1BX6A 3E88A 4P4CA 3EKNA 3FXWA 4NWMA 2OFUA 3NNVA 4G31A 4RIOA 5EOLA 2O64A 2A98A 4LUDA 1FBNA 4XG4A 3QQGA 2B55A 4NU1A 2YCQA 3GP0A 4CFWA 5KE0A 3K5UA 4BI1A 1YXVA 2OJIA 3HECA 5E8WA 4FVRA 3AQVA 5DLSA 4XG3A 4KA3A 5DWRA 3N4TA 1UA2A 5EQPA 4RLKA 2QKWB 4G9CA 3LPBA 3CTJA 2JBOA 2PWLA 3SOAA 4AT3A 4X6QC 4O7RA 5C8KA 2GMXA 4JX3A 2DS1A 3DBCA 4RVMA 3ORNA 1YOLA 3FMKA 5AR2A 2YAKA 1AD5A 4JVGA 3COHA 1JLUE 4O0VA 2Z7LA 4EHGA 5B2KA 1R1WA 4MNFA 4E5AX 4MTAA 2BVAA 2WTKB 1XWSA 2JDSA 3IQ7A 3QXOA 4PPBA 4Q9SA 5AWMA 3SXSA 3UQGA 3LFEA 2QO7A 4WRGA 4C3PA 4F7NA 3O8TA 3NNXA 1FGKA 4U42A 4AGDA 3QYWA 5D7VA 3D14A 4E7WA 4GIHA 3SD0A 2IN6A 3QL8A 2EXCX 3P4KA 5HBJA 5IEVA 2OWBA 2XIRA 2BR1A 4FUYA 5A4QA 2C69A 4II5A 4B9DA 3FV8A 3IGGA 3NNWA 3ROYA 4PMPA 5M4IA 4QTCA 1O6KA 4HGEA 4PMMA 3GCSA 1X8BA 3GXLA 3F7ZA 4CEGA 1PMNA 4YC3A 1FQ1B 3G9NA 3C51A 4G3CA 4XRJA 2R9SA 3FUPA 4FNYA 1SYKA 2A27A 1JWHA 2VTSA 5F20A 4XG6A 5AV0A 2ETKA 5GJGA 4HNIA 3OBJA 3TACA 3ZSHA 3K3JA 3LCSA 4FSUA 1M14A 3D94A 4G9RA 3RK5A 4QPAA 3G15A 1OL6A 2JC6A 4UYNA 5CI6A 4CG9A 2GNIA 4FV5A 2A1AB 2QQ7A 3PIYA 3ID6C 2X2LA 2XKFA 2J0JA 5CF4A 5DR2A 5AA8A 4J98A 3KVXA 2C1BA 1G8KA 4HYUA 2WIPA 2ZDUA 4NM7A 4TXCA 4DITA 3OG7A 2ONLA 4FTQA 5EHLA 5H9BA 3QA0A 5HVJA 3WF5A 2AEGA 4IWOA 2X7FA 1F3MC 2WEVA 2B0QA 2YCSA 5DT4A 5L6WL 2PVRA 3EN6A 2ZFYA 5DG5A 5L2TA 3OOGA 3P23A 3LM0A 1YOJA 2QR7A 2F7EE 3IW5A 5CU6A 4FTAA 3V5WA 2AUHA 3HA8A 2JKOA 3KULA 4FZDB 2XKEA 3D7ZA 3GFWA 4QP7A 4FIGA 4V01A 3UZPA 2YIRA 2C0OA 3U54A 2RKUA 5HNBA 3BZ3A 5CSVA 2WTDA 3GCQA 4ENYA 3GU6A 2X9EA 3FBVA 4HPUE 3V5LA 4E6DA 3H0YA 4S33A 2CN8A 3OUNB 5AP1A 4QMUA 5K4JA 3OTVA 4PL4A 5AP5A 5TT7A 3PPJA 3C4CA 4P90A 3ZC5A 4LV7A 3CIKA 1YXSA 3CR0A 3RNIA 1JKSA 2XJ1A 2YFXA 3HDMA 4RX8A 1W0XC 4PP7A 4MVFA 2PZYA 4I22A 4O0WA 5HBEA 2UVZA 4ANLA 2ETRA 3DFCB 3FI3A 1FVVA 4YUQA 5FEEA 2YZLA 3TZ9A 1LEWA 2B52A 2C6IA 1M2PA 4AE9A 1ND4A 4WNOA 2OF2A 3BIZA 3VHEA 5D10A 2QHMA 4GU6A 5D41A 3DXPA 1MRVA 3C4FA 3U87A 2H96A 2OIBA 3PVGA 3WF6A 4ARKA 4PQNA 3GOKA 4EOOA 5JMSA 2IZRA 1UU8A 3HUCA 2C6EA 3LAUA 4FV7A 2GS2A 5KHXA 3TNQB 2HZ0A 3BV3A 2XNMA 1P14A 4AW5A 2I1MA 2X0OA 2JDTA 1YHSA 3E63A 2EU9A 4FOBA 5IKWA 2HIWA 2P3GX 3KMUA 2W4KA 3Q5IA 2PUNA 2Z7RA 2X6EA 1LUFA 3E3BX 3KRXA 4F9AA 3DQXA 4QMQA 4RA5A 4O22A 3FC1X 3H4JA 4YTFA 3BEGA 2Z7SA 2IJMA 4FRFA 3UNZA 4QP6A 1YI6A 4RIWB 4D0XA 4JBOA 4EOPA 3HUBA 3UIXA 4IACA 4BDKA 3F7WA 2UZDA 3P0MA 1UU7A 1ZYJA 3RWQA 3GQIA 3GB2A 3PE2A 3LLAA 4L68A 2W5HA 1KE9A 4DCAA 3BX5A 3PY1A 2QOCA 4RIYB 1TFFA 3SAYA 3FY2A 2PZ5A 4QRCA 5AMNA 3OWLA 4GG5A 3DU8A 1OL2A 3VS2A 5ANIA 1WBNA 2YZAA 5GNKA 2CDZA 5IA3A 3WIGA 2CCHA 3AXWA 3UDBA 1W84A 4BCPA 4AF3A 4C33A 4D5HA 2J50A 4GS6A 3ANQA 4IC8A 2XB7A 3HL7A 4FTRA 2YJSA 3KXXA 3PJ2A 3QKKA 3PIXA 4GV1A 3CLYA 3UVRA 1MQBA 4RJ5A 4U43A 4F64A 3WZUA 5HG9A 1OUYA 2JKQA 5E92A 5IUIA 3VW6A 5IQHA 3BYOA 1H4LA 2UZLA 1CTPE 3NS9A 4IC7A 5LMKC 4GYIA 4O2PA 5CYIA 3QTIA 1R3CA 3RK9A 3K5VA 2DWBA 4D0WA 3IO7A 2P33A 3PFQA 4BDDA 1OM1A 2XK3A 4DT8A 2OJGA 3UE4A 3IECA 1NY3A 3QTSA 3UVQA 4YHFA 1YXUA 1W82A 5IPJA 4JNWA 3UYTA 4YR8A 5ETIA 4R3CA 4XHKB 1GZ8A 2Q0BA 2VN9A 2YCFA 4OW8A 4E8AA 4F0IA 4D4VA 2YLEA 2ZV8A 3DS6A 2R3OA 3PSBA 3DB6A 4PTEA 3AT4A 4WRSA 4WOVA 5FEQA 5CENA 3BQCA 2XKDA 3OS3A 4RJ8A 3TIZA 1Q41A 1YQJA 4BB4A 4HNFA 4FODA 3OWJA 3ZBXA 4R5YA 4C7TA 3CXWA 2FA2A 3MY5A 3MV5A 2BZIB 3ORLA 4Z7GA 2XRUA 4KIPA 4CCUA 4AZWA 5FXQA 4O83A 2ZMDA 4GCJA 4IB5A 2BDWA 3S4QA 1I09A 5E91A 3KIOC 1JQHA 3FMHA 4IB1A 3MA3A 3NX8A 5ANDA 5EI2A 4AA5A 2WMXA 3R28A 5EM8A 3KXNA 4AN9A 2R5TA 1OL7A 2PVFA 2IVTA 1L3RE 2LGCA 3KXHA 4YZBA 3AT3A 2VTHA 3R71A 1UKIA 4M15A 3AD6A 1ZWSA 3VW8A 5A4LA 4E1ZA 2CGUA 4IVDA 4HGTA 4LM5A 4PP9A 5KZIA 3OWPA 2ITPA 3DKOA 3TIYA 3TTJA 4C4FA 3TV7A 3MBLA 2ZOQA 1Q4LA 4U45A 3PG3A 2WNTA 1Q8ZA 1WCCA 2OLCA 5CEQA 4FX3A 3RINA 1R0EA 4RG0A 3P1AA 1QMZA 2BKZA 2GPHA 3FMEA 1U46A 3PRFA 4EOKA 1VYWA 5EKOA 3PJ1A 1YI4A 4CQEA 1ZY5A 3BWFA 4BZNA 4LGDA 3I4BA 4A07A 4DEEA 5JSMA 1YOMA 1SNUA 3HA6A 4EBVA 3AMAA 3RJCA 3IDBA 4UZHA 4ALUA 2VUWA 4TYGA 3V6SA 4AGCA 4L67A 4OTPA 3U9CA 3UGCA 1Q8YA 3WE4A 3EYGA 4Y46A 3QRKA 4QMOA 2I0HA 4IQ6A 4LV5A 2VTQA 2WMBA 2WTCA 3ZZWA 3I0QA 2QHNA 3TZ7A 3QLGA 5EH0A 4GK2A 3H10A 1SM2A 2BRGA 3OP5A 3R8ZA 3W33A 5IA5A 1OZ1A 2OGVA 1VYZA 1PXNA 3HDNA 3FI8A 4CRLA 3NGAA 5CQWA 3RVGA 1ZAOA 4ITJA 4FNZA 4QTBA 2CNVA 3EZRA 4BI2A 3MS9A 4K2RA 3TV6A 1XH5A 5HEZA 5KMOA 2PVMA 3OVVA 3SX9A 1M2QA 5HIBA 5HORA 3A7HA 4DEDA 3EQHA 4ITIA 4MBLA 2HENA 2WEIA 4M67A 2C47A 3ETAA 4L52A 2QKRA 4RX9A 3G90X 5JQ8A 4BCKA 1PF8A 4IB3A 4RWIA 4ZSJA 4EZ3A 1JNKA 3DXQA 4X6RA 3CJFA 4J52A 3W16A 4RC2A 2F7ZE 5FP5A 3VUTA 3A8XA 3HNGA 1M17A 4ZOGA 5EI6A 3LE6A 2WTWA 3DKGA 3D5WA 3VS0A 3C0GA 4LI5A 3E5AA 2PU8A 1GZNA 3ORPA 3AMBA 3PRIA 3ZO2A 3EHAA 5HKMA 4FKGA 4M97A 3UOLA 3PXFA 2R3RA 4RVTA 4QOXA 3FWQA 4RX5A 4O4CA 4FG8A 3QD0A 4PTGA 3LCKA 4GVJA 5LCJA 4JMQA 3RHKA 2OU7A 3ZSGA 4E5WA 5IUHA 3RAKA 3F2NA 4H3BA 4IFGA 4LV8A 1JOWB 4XLIA 4AX8A 3NUAA 5KZ0A 2VWYA 3ELJA 3G9LX 1H01A 3QX4A 4UMTA 2ITTA 5ANJA 4IZAA 5EQEA 5FQDC 3BELA 2OIQA 3KEXA 3SOCA 4O7WA 4BDFA 4KUJA 5EW3A 5ANKA 2XNEA 3GC0A 4PPAA 5LCKA 3BGQA 5CX9A 4B8MA 3R9RA 3L1SA 5FP6A 5L8LA 2YDJA 3LQ3A 2R0IA 1G8JA 4YZ9A 4E20A 2GCDA 1PRYA 3E93A 4MKCA 4OAVB 2ITNA 4QYGA 2BRNA 2WTIA 4H3PA 4G3GA 1H27A 4I4EA 3K3IA 4AG8A 2XEZA 3GCVA 2OJ9A 2YABA 4NUSA 4RJ6A 4C4IA 4AXEA 2F2CB 2ZDTA 4HZSA 3PFYA 4QMXA 3CP9A 4U7ZA 1Q24A 4NW5A 2EVAA 2W0JA 2WHBA 5CI7A 1SVHA 2PY3A 1P5EA 4FSWA 1GAGA 3VQHA 3DK6A 2XM8A 3FMDA 3FZ1A 3LHJA 5JGDA 3OF0A 1OGUA 3H9RA 3F88A 4ZZOA 4XOZA 3VQUA 5M57A 4RC4A 4YZCA 5EYDA 1Y8GA 4C37A 2QURA 2PTKA 2PVYA 3LJ2A 2C5VA 3VC4A 3EN4A 2Y9QA 2QNJA 3U9NA 3VS1A 3O23A 5D7AA 2G01A 5AEPA 3UC4A 3ZUVA 4O7YA 3EYHA 3G51A 3C0IA 4DF3A 3GVUA 3VUHA 4FV0A 4KKHA 4BTMA 3ACKA 3GUBA 3I81A 4EH6A 3VO3A 2W1ZA 5BNJA 5GIPE 2XM9A 2C5NA 5DBXA 4YTCA 4V04A 4C34A 4AXDA 4TYHA 3GU8A 3Q96A 5KX8A