2KULA

Solution structure of human vaccinia related kinase 1(vrk1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
360
structure length
360
Chain Sequence
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase VRK1
publication title Solution structure of human vaccinia related kinase 1(VRK1)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 360
sequence length 360
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2kulA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2kulA01
3CCNA 4WO5A 3FPQA 5JH6A 2VWIA 3RZFA 4XS2A 3SDJA 5HO7A 2YIWA 4CQEA 4J8MA 5HIDA 3MBLA 4EK4A 1Y6AA 2RSVA 4J98A 1U46A 4NTSA 2YAAA 2YM5A 3NUYA 3ORIA 3QX4A 2QVSE 3AC5A 4I6QA 4BBEA 2YCFA 2ZM4A 4BVUA 3ACKA 1UWHA 4QMWA 3HV6A 2BTRA 4NW5A 3ZLSA 2J6MA 4FL3A 3FKNA 4E20A 5L2WA 1M2PA 4AE6A 3ORNA 4Y83A 4CKJA 2CPKE 5H8EA 1J7UA 5M44A 2WTJA 1GAGA 4NFNA 4BCOA 2UZTA 5LARA 4CT2A 3POOA 3H9RA 4FNZA 3F2AA 3MVLA 4GFGA 4JBPA 4JDHA 3PXQA 2CKQA 4YZBA 4Q9ZA 1S9IA 2WU6A 3SKCA 3OXIA 4QTCA 1WBOA 5L2TA 2OWBA 3IDPA 3LFSA 5AUZA 4O6EA 3VW8A 3QQFA 4C59A 4F70A 2R64A 2X2KA 2A1AB 4RRVA 3LMIA 3TKHA 5JQ8A 4CMOA 3FJQE 3PXKA 4PDYA 2O2UA 5M57A 3DXPA 3ULZA 4BGGA 5E8SA 3VBQA 4BICA 4IAKA 3TUCA 5CZIA 2O63A 2H8HA 4CTBA 1UU8A 3QTUA 4BBMA 4ERWA 5HVJA 2YCRA 2C5OA 4MXOA 3K2LA 4AT4A 4PTCA 4O2PA 2GQGA 5LVMA 1J7LA 4YHTA 5EHLA 4C37A 3E8DA 4IW0A 4EQCA 4CZYB 3CQUA 3D2IA 3L8VA 3QALE 3R0TA 3A8XA 4XOZA 4D4VA 3S95A 3IGGA 3TUBA 5CENA 4UX9A 4K9YA 4LM5A 2EUFB 1KE8A 4U8ZA 2XK9A 3KC3A 4I20A 4U41A 1FBNA 3TZ7A 3JPVA 3R7EA 4Z7HA 4CRSA 1FVRA 3KRLA 2RFSA 2QLUA 4GV1A 4OBOA 5FQDC 4LG4A 4APCA 1WBSA 2B9JA 2YM6A 1FPUA 2XMYA 4KUJA 3PJ8A 3UE4A 2JIIA 3BYOA 2BRHA 5BVOA 3GU8A 4RGJA 4CXAA 5HVKA 4M68A 1JKKA 5K5NA 3SXRA 3ZLWA 4EJ7A 3COHA 1KSWA 4M13A 3D7TA 4XOYA 4WA9A 4ITHA 4QYGA 5DPVA 5JRQA 2DUVA 2J7TA 1YWVA 2F2CB 3MPTA 4K2RA 1SMHA 2BPMA 3HA6A 4LRKA 3FYJX 5C26A 3ZTXA 3C13A 4L00A 2V5QA 4WSQA 1GIIA 3TV4A 1OECA 4HVIA 5EQYA 3IK3A 3ERKA 3BBTB 3FQEA 4JX7A 4LI5A 3OW3A 1PJKA 4UV0A 1AD5A 4WRGA 2IZRA 5C01A 4C61A 5I9VA 2I7QA 3QTQA 4I5MA 4MNFA 2Q83A 5CZHA 3SW4A 3RMFA 4D2WA 5BVFA 2VNYA 2HY81 5D7VA 3FZTA 3R1SA 1OL5A 3SQQA 3DBFA 2IW6A 3EN4A 3NGAA 4CMTA 4EYJA 4QD6A 2F9GA 4TKSA 4U3YA 4TWCA 1KUTA 3OC1A 4W9WA 3CS9A 4LGDA 5B2LA 2WMBA 4H58A 1UKHA 4IB1A 4D1ZA 4GIIA 2WTIA 3D5XA 4KNBA 3VQHA 3KMMA 3F3WA 1OB3A 3HV4A 4WD5A 5EYMA 2X4ZA 3KVXA 1KWPA 3OUNB 3H30A 3F2RA 4BDAA 4W4YA 5DT4A 5BYLA 1VR2A 3R1NA 3D4QA 2NRYA 2WGJA 3RHXA 1WZYA 1H1QA 3EQRA 4FYNA 4RQVA 4QYFA 2J90A 5KE0A 5EG3A 3FDNA 3JYAA 5AR3A 1W98A 4F65A 3V5TA 5L6WL 4BR3A 1NVRA 2C69A 2ZJWA 3G9NA 3LFBA 3LQ5A 3ZHPC 4PMSA 4EC9A 3KMWA 3POZA 4FEXA 2ITZA 2BRBA 2DYLA 4OBQA 5EH0A 4IX4A 2ITPA 3LFFA 5E8YA 5ETFA 3JVSA 3KRRA 1H1WA 2J4ZA 3RGFA 3T8OA 4RVKA 3PG3A 4EZ5A 5KMOA 3FWQA 2JLDA 4I4EA 3QCXA 3CJFA 3PY0A 4D5KA 4DBNA 4GUBA 4QP4A 2WQBA 1YOJA 5L3AA 5CY3A 2QU6A 3DFAA 3BE2A 4G34A 2XA4A 4IAFA 1WBVA 5AMNA 4AZTA 5K9IA 2DS1A 4QMSA 4D1SA 4IDTA 4FTUA 4BFMA 4XBUA 4CMUA 4O7RA 4EH8A 4B9DA 3IS5A 2WTKC 3E8CA 4JDJA 5DWRA 2WTVA 3S3IA 1TVOA 2I0VA 3LFAA 3QGYA 5T6KA 4DC2A 3FAAA 4JRNA 2QC6A 4M66A 4BCPA 4BDIA 3NYVA 3DK7A 2PMOX 5J1WA 2NNWB 4FV3A 4AW5A 1H01A 3QD4A 3EH9A 3C0HA 2R3KA 4I24A 3O0GA 3EWHA 4G6LA 2GSFA 4I5CA 4YJRA 2VTHA 3DJ7A 4MXYA 4IFCA 5HD7A 4ALUA 1YOLA 3EQCA 4KA3A 3QD2B 4FVPA 1DAYA 3BWJA 4FIJA 4GKIA 4P4CA 3SD0A 5EW9A 3KN5A 2XRUA 4N6ZA 4QP7A 2CSNA 3BLRA 2C30A 2WHBA 3FUPA 3OOMA 2VTJA 4FT5A 1OMWA 3U9CA 2UZVA 3EKNA 3P08A 3F3UA 3KL8A 4IB5A 4RIOA 4YGAA 3FSFA 4Z7GA 4AACA 3A8WA 3VBYA 4U43A 5FD2A 3AOXA 2EXEA 5BUIA 5JK3A 3TDVA 3FY2A 3F9NA 2XNPA 4IAAA 5AUVA 4FZAB 3GCSA 3A7FA 1AGWA 4AT5A 3GU7A 1U5RA 3BYUA 2O64A 1FVVA 4JBVA 1OIRA 3PSBA 2PE0A 3NNUA 3VS0A 3W32A 1BL7A 4AF3A 5KCVA 5LVNA 4HNIA 4XX9A 1ZRZA 4HYHA 4J95A 5IQAA 4ERKA 5HG5A 2F49A 4JS8A 2QOHA 5LCJA 2BIYA 2YAKA 3DQWA 4FI1A 5HNBA 2XIYA 3ORZA 4FVRA 4PNIA 4WG4A 3BLQA 4NCTA 5CVGA 3W33A 3WBLA 2XKEA 4I3ZA 5JZNA 3HUCA 4QMUA 4X6RA 3UGCA 4WG5A 3FLWA 3W16A 2UW0A 4BKZA 3TZMA 5AR8A 3ZU7A 3AQVA 4EK6A 4EI4A 5CLPA 3KULB 2G2FA 2YLFA 4PDPA 2HYYA 5G6VA 1GIHA 2YM4A 4ZZMA 4W4WA 3R9DA 5CSPA 2OIQA 5JFSA 2RKUA 3FMLA 3WF9A 4DT8A 3U9NA 3WE4A 2GQRA 3TJDA 4X3FB 1HCLA 3D5UA 5HBJA 1Y6BA 2B53A 3E93A 5AP7A 5J8IA 4DFZE 4NM5A 2BRMA 3KF7A 1WVWA 3HX4A 4DG3E 4DG2E 1OIYA 1TQMA 4OTQA 4J1RA 4O21A 1FOTA 4UMQA 4I22A 3IONA 4RWLA 2GU8A 2R2PA 3A7IA 1KOBA 5DLSA 3VWAA 4RVTA 4R78A 3FQHA 3BWFA 4CQGA 5B7VA 3MH2A 5FTGA 3D7ZA 2E9OA 4UB7A 2RFDA 5CASA 4E4XA 4UYAA 2Y6MA 1YQJA 1JLUE 2ZM1A 5LJJA 4LFIA 4F7SA 4CSVA 4ENYA 4FZ6A 1J1CA 4USFA 4A9RA 3RVGA 4KIQA 3L8SA 4PL4A 4ZTLA 4AFJA 4ZLZA 5J7BA 4J53A 1VYZA 1P4OA 4ZAUA 4LOOA 4C02A 1BYGA 5E8XA 2BRGA 3RCJA 3ZLXA 4EQUA 2RIOA 5H2UA 4A06A 4B99A 3HEGA 2R3NA 3QGWA 2QO9A 4BCFA 2REIA 3KN6A 4UYNA 4EZ3A 4DE4A 4X2FA 2PZRA 3ZC5A 1ND4A 4HNFA 1M52A 4Q2AA 4E8AA 3LMHA 1M2RA 5EW8A 5EI2A 1YKRA 4BIEA 4O1OA 1Q8UA 3ANRA 3FI4A 4JG8A 4QO9A 5H3QA 1PXJA 2UW5A 2BCJA 4NK9A 4Y46A 5M4FA 2HW6A 4FODA 3ZOSA 4JG6A 4YLKA 1PHKA 3DB6A 4TT7A 2O3PA 1M17A 3ENMA 1BI8A 3KU2A 3KXNA 3VUHA 3FL4A 5FRIA 4RJ5A 2XKDA 2X2MA 1GZ8A 2EB3A 3F66A 3HECA 4EONA 1WVXA 2R3IA 4L3LA 3R71A 4QPMA 4A9TA 1H8FA 3FHIA 4QMTA 1OL2A 5E8UA 5FTOA 4AGUA 1DI9A 4J7BA 4D4RA 5L6OA 4I5PA 3VC4A 5AIKA 4I41A 1CDKA 1SVGA 3NW7A 5CQWA 3V5QA 2QOFA 2ZMDA 4RZWA 2OIBA 4BCJA 4U44A 3EFWA 5FEDA 2X81A 4DA5A 4USDA 5AR4A 1KOAA 1DAWA 3F5XA 4U9AA 2I0YA 3KCKA 5H8GA 3KB7A 3SVVA 4OTHA 1XO2B 3QQHA 4FL2A 5BX0A 4UALA 2BTSA 3FMJA 4DEHA 4E6AA 4YO4A 2UZLA 3BI6A 3M42A 5EI8A 5GJDA 4BZDA 3R7YA 5IQCA 2QOLA 3KK9A 3CGOA 3V3VA 2CLQA 5JGDA 3QHRA 3AT3A 5L8KA 3COMA 4L52A 2F2UA 5L8LA 4PQNA 3VBXA 4IVCA 3EYHA 1YHSA 1V0OA 2HCKA 4YJTA 3ZZWA 4FTKA 3FLYA 3Q32A 3F5PA 3QTWA 4DGLC 4BTJA 4G5JA 4DBXA 5EM5A 5AA9A 3TDWA 5I4NA 4BYIA 4MWHA 3G6HA 4YC6A 4Y5QA 4BIDA 5M4CA 3VRZA 3W2QA 2WKMA 4O7WA 4Z55A 3BLHA 4O7LA 1F0QA 3PRFA 2NP8A 4PPCA 5FEQA 3KRWA 5HE3A 3WARA 4PNKA 3E8NA 3WF7A 3PJ3A 4X6QC 4EOMA 4ZJIA 4GFMA 4XV3A 4MEDA 2WU7A 4EKLA 5IDPA 1WBNA 3GFEA 4WIHA 1G5SA 5HO6A 3VULA 3LLAA 5HLPA 5B0XA 3DAJA 1RW8A 5E1EA 1YRPA 2WPAA 2PHKA 5CU6A 3REPA 2GTMA 4QQTA 3PA5A 3FI2A 4RIXB 2QG7A 3GC8A 3OCSA 2PMLX 2YDJA 3Q4ZA 4FKUA 4P7EA 5BYYA 3U6IA 2X9FA 4J99A 4QMPA 4DH1A 3E5AA 4B8LA 4GCJA 3FYKX 2GFCA 1KE6A 3FXZA 2UW9A 2VU3A 3NIEA 4RVLA 4EWHA 1XBBA 1O6KA 4JXFA 1FQ1B 3BYMA 2IVUA 3K5VA 3NUXA 4E5AX 3FBVA 1NT2A 5E90A 3EFJA 3QLGA 4ZTSA 2ITOA 3ORPA 4PX6A 4C4GA 5AJQA 5TF9A 3HMOA 4QP2A 4UZHA 5CEIA 5A4QA 3CSVA 2H9VA 4L01A 3L9LA 3CY3A 2J51A 3ODYX 2OICA 4GEOA 5CEMA 4F0FA 2B0QA 1QCFA 3AG9A 3TT0A 5B2MA 4CZTA 2WXVA 4FTIA 4FIEA 5CT0A 2WAJA 4GVAA 4YNEA 4NM7A 1Q97A 2R9SA 3EQBA 4EZ7A 4OTFA 4YZMA 5A9UA 3RAHA 1PKGA 4F6UA 5ETCA 2V7AA 2OJIA 5HU9A 3ZONA 1NA7A 4GK2A 3RCDA 3VUGA 3MV5A 4AT3A 2O65A 3SGCA 2PPQA 3TM0A 4JR7A 3QD0A 4G5PA 1PKDA 4O38A 1OUYA 3AT4A 3PPKA 3C51A 3OG7A 1Q62A 5D9HA 3CQWA 2W4KA 3LFNA 3CTQA 1TQPA 2RFEA 1BUHA 1YI3A 1HCKA 4EH7A 3CLYA 2C6LA 2P33A 4IH8A 1CMKE 2GNIA 4UMUA 2C5XA 2PVYA 2BHHA 4D0XA 1B6CB 5LMAA 4MD9E 4TWOA 5CXHA 5ITAA 4XYFA 5AP2A 4U5JA 1OKWA 2BZKB 4RIWA 4FR4A 4I94A 3C4EA 4YZCA 2J0MB 3W8LA 4AGCA 5BNJA 3PWYA 3JXWA 3UVRA 3HP2A 3BKBA 4FKQA 3VBTA 4ID7A 4JQ8A 5J87A 2BHEA 1OL6A 2CCIA 4FSZA 5F1ZA 1OIQA 1YXXA 4IWOA 3AXWA 5HCYA 1E9HA 1YI6A 1JNKA 4TNDA 3C7QA 3S2PA 2VX1A 5IH5A 3KA0A 5FXRA 5BVNA 4E3CA 4G2FA 2CMWA 5LVLA 4R5YA 4YO6A 1KE7A 2B4SB 4JNWA 4L46A 5BPYA 2ZV9A 5JSMA 3AC8A 3Q60A 4H1MA 3VUDA 3HDNA 4QMNA 1ATPE 4FKIA 5FP5A 2PUNA 3QLFA 3MFRA 5LMBA 5GZ9A 5EHYA 3R8VA 4BWXA 4CKIA 3DNDA 3RM7A 1Q99A 4BI0A 4L9IA 4PY1A 4OAUC 3LCTA 1LEZA 3BHYA 4QYHA 3R9HA 3NUAA 3A99A 3ET7A 3HMNA 3P9JA 4YJOA 3IG7A 5IEVA 1TQIA 3LIJA 4LOQA 5HTIA 2PK9A 3OXTA 4JX3A 3ZCLA 5J7HA 4E26A 4FKWA 3MS9A 2BAJA 3RJCA 3EYGA 2YZLA 1WFCA 4TWNA 5DEYA 4HGSA 3FC2A 4PPBA 5HX8A 3BIZA 1JSUA 4V0GB 5FM3A 3VHKA 5BVDA 4IWPA 3WOWA 5J79A 3AC2A 3NNXA 4OW8A 5AUYA 4OT6A 3RBWA 3K3JA 4R8QA 4ZY5A 2WD1A 2QD9A 1XH8A 3RPRA 2Y4IC 1R39A 3I6UA 2Q0NA 3CD8A 5CU3A 3G0FA 4M0YA 2GMXA 1A48A 3A7HA 1PXOA 3ORXA 4FMQA 4YJVA 2VN9A 2Y8OA 1GIJA 2EXMA 4X7QA 2WNTA 3EL8A 4RFZA 5AP5A 3FLZA 4XG8A 2PVRA 1CM8A 3ORMA 2ZV7A 2ZDUA 5FGKA 5GJFA 4L43A 3OT8A 3ZRMA 2WEVA 4FUYA 3CGFA 3O8PA 2VWXA 3K5UA 4R7HA 4CCUA 4FIFA 5CVHA 4TYHA 2GCDA 4MYGA 3O23A 2W9FB 4IVBA 4K0YA 2XVDA 3AC3A 4ZTNA 5J5SA 4FV6A 2ONLA 3PG1A 3SV0A 3A61A 3VBWA 2V0DA 2CKPA 2XRWA 1ZAOA 3F5UA 2YLEA 2BROA 2CN8A 4CTCA 1YDTE 2C6MA 2B52A 2GS6A 3JY0A 1MRVA 3BELA 3GU4A 4R3RA 4CGAA 2GHGA 4KB8A 4HYSA 3RK7A 4C4EA 4FTRA 2IG7A 5FDPA 5J9LA 4AOJA 4W8EA 4F9YA 3PZEA 4L42A 4DYMA 1H4LA 4CNHA 1XHAA 2PVHA 3MPMA 4APPA 2VWZA 4EOOA 4GH2A 3UP2A 4FZDB 3R63A 4ZEGA 2CHLA 2X8DA 5FP6A 3FEGA 2CJMA 4NIFB 3MY1A 5D12A 4YU2A 3OW4A 4MBJA 5GNKA 1ZOGA 4ACDA 2GNLA 2W1IA 3OCTA 4GVJA 5LWMA 3EFLA 1IASA 1YOMA 2WEIA 4RA5A 4TYEA 5EI6A 2W5HA 4Y72A 3H0YA 3E8EA 5HO8A 2XK8A 3LFCA 4JG7A 2RG6A 4GJ2A 4IB0A 1GY3A 2UW8A 5KBQA 5KKRC 3QA8A 3DU8A 2F7ZE 2OJFE 4HYUA 1ZY4A 5AR5A 4J8NA 4BCIA 5EYCA 3BHHA 3FZOA 4QP6A 4JJRA 4B8MA 1SVEA 2Y9QA 4M97A 4XBRA 4ZY6A 4AA0A 3LFQA 4G9CA 4BCGA 4BCQA 4IX5A 4DGOA 5DRBA 4RWKA 2YA9A 4DFLA 4O0SA 4DEIA 3VS5A 3ZUUA 4F7LA 3NUUA 4RJ6A 2C1BA 3MN3A 2XZSA 4YJPA 5C9CA 2OFVA 3RPVA 1YXTA 3UTOA 4C4HA 5EQPA 2QOQA 3MTFA 3EQIA 2XK7A 1M2QA 2WQEA 4WUNA 1IR3A 2HK5A 3OEFX 1UU7A 1PRYA 3TNWA 2WTKB 3A7JA 3SOAA 1OUKA 4G3CA 2GQSA 4PTEA 3PVWA 4JLCA 3BHUA 4YTHA 1U54B 2XJ1A 3FMKA 4X0MA 2XP2A 2BDFA 4EH3A 3U54A 5E8ZA 4GIHA 4H3PA 4F9WA 3MTLA 4PPAA 1LUFA 3UG1A 2OK1A 4AN3A 2C6DA 2VO0A 4RC2A 2FH9A 4ANBA 3B8QA 5GZAA 5KMNA 3OP5A 1Q8TA 5L2QA 2HZNA 3NNWA 4JDIA 4LRMA 5J1VA 5EDPA 3ZFXA 4ZMFA 4A9YA 3DK3A 4AZVA 5M08A 1XH9A 2H96A 3R7VA 3KRXA 2QOIA 3O8UA 3PRIA 2XS0A 3WIGA 3W55A 1PW2A 5FWKK 5J95A 5LVPA 3BE9A 2VTOA 2XCKA 5E4HA 3LFEA 3R9OA 3EN9A 4IANA 3GT8A 3OD6X 3Q5ZA 3QZFA 4DEBA 5DGZA 2JBOA 4QTBA 4WBBB 3SAYA 2XKFA 2X0GA 4K8AA 1B38A 3B8RA 3DXNA 3DAEA 1GOLA 2W96B 2KULA 2X8EA 1IAHA 4FSTA 1R3CA 2C5VA 4JI9A 3NVMB 3ZSHA 1JPAA 4FKTA 3DA6A 1OKYA 2IVSA 1NW1A 1SNUA 2BFXA 2J0JA 3BEGA 4FKOA 5IQIA 2QOOA 5ETIA 3P78A 2G2IA 5BYZA 3MSSA 3O8TA 4ANLA 5AP4A 3NAYA 3ROCA 4ZSEA 2QNJA 2JFLA 4R3PA 4C2VA 2YEXA 3QWJA 4EH9A 3UO4A 4FSYA 4MNEB 5ANOA 1J7IA 4U97A 4GS6A 4TL0A 3DQXA 3WYXA 3MVHA 3UC3A 2WZJA 4HVGA 3Q9WA 1MUOA 3A2CA 5E7RA 1JKSA 1FMKA 1WCCA 1ZXEA 4HCTA 5AUUA 1OKZA 3QD3A 3U55A 3DGKA 4LUDA 2XM8A 3B2WA 2HZ0A 5LVOA 3TUDA 1SYKA 2E2BA 3SHEA 4HCVA 5GJGA 4Z16A 2JKOA 2IPXA 5DIAA 3RPYA 3OVVA 1H08A 3VHEA 5DRDA 2H34A 3CJGA 4ZTQA 4MXAA 4EH6A 3S1HA 4EHVA 2VTLA 4IWDA 2BFYA 4R77A 3Q9YA 3CEKA 4FTLA 2I6LA 3R8ZA 3RAWA 3UYTA 3OCBA 2HWPA 2X39A 2W4OA 4Y85A 5G1XA 4WSYA 1XH7A 3QYZA 4I92A 2XYUA 2VX3A 2VD5A 4LL5A 2DQ7X 3TEIA 4FNYA 4F09A 5HBHA 4H05A 4EUUA 4YSMA 3ZXTA 5CS6A 4IAZA 4PP9A 3NMUF 1XH4A 3RALA 4C0TA 3QTRA 2R5TA 4I21A 4O7NA 3CR0A 4BZOA 2ZB1A 3F3VA 2HAKA 3A60A 3SRVA 3UNZA 2ONLC 3ZEPA 2PUIA 2WO6A 2E9VA 1H1PA 3E62A 3HA8A 3L1SA 3DKOA 4ASEA 4OTGA 3LM0A 5M4IA 3FHRA 5IA1A 1AQ1A 3TI1A 2BDWA 2QO2A 2RL5A 5LCKA 3ALOA 3V51A 2AC3A 2XNNA 3CC6A 4IADA 3ULIA 4RLKA 3QUPA 2YWVA 2CCHA 4LGHA 3VO3A 4BCHA 3C0IA 4EBVA 3H9FA 5D11A 2I1MA 1QL6A 1QPJA 2YERA 3KK8A 5HG8A 3VS6A 4BDJA 2Z7QA 1URCA 3QYWA 4R3CA 3HRFA 4AG8A 4AOTA 4YJUA 4U0IA 4DFYA 4RIYB 4X2KA 3UYSA 4X2GA 3UODA 3EMGA 5I9UA 4XEYA 5HQ0A 4UY9A 4L7SA 5CQUA 4OUCA 2JDVA 4G17A 3CPBA 3LE6A 5HVYA 3TTJA 3UQGA 4C58A 5CEKA 2ITQA 4XUFA 5HNIX 4XG6A 2W0JA 2IVTA 3NPCA 4RG0A 4PL5A 3FI8A 5HE2A 2P4IA 4FG7A 1S9JA 3WZJA 3K54A 4RC4A 2I0HA 3PXZA 4QOXA 4OTPA 2RGPA 3IOPA 5D41A 1H1RA 4RT7A 3MA6A 4IHPA 5CAOA 2VTTA 1MQ4A 3KXXA 4FV0A 4W4VA 4AN2A 3I0QA 3F7WA 3PY1A 4F63A 3EQGA 4F7JA 4IM2A 4F1MA 4MVFA 2QQ7A 3LKMA 1ZYLA 3OCGA 3HV3A 3QZGA 4ASXA 4ALVA 4GYGA 3KKVA 3QQJA 4XG9A 4DF3A 3UIUA 3HL7A 4QYYA 3V5LA 4Q9SA 2IW8A 5L6PA 3JUHA 3O17A 4F64A 3SXSA 2C5NA 4TY1A 1CSNA 4M8TA 5CVFA 4FX3A 4YR8A 3I7CA 5IA0A 4IXPA 5HKMA 3ZRLA 3QCYA 4CFMA 5DNRA 4E4MA 2W06A 5JFVA 2R7IA 3BBWA 5HEZA 3TL8A 5J9YA 2Z7RA 3WZUA 3ZDIA 5FUTA 3GCQA 3BEAA 3TCPA 4IZ7A 4O22A 3MH3A 3VF8A 3R8LA 2WELA 4KWPA 3HMMA 5JRSA 2C0OA 3GCUA 1IRKA 2P2IA 4NSTA 5CYIA 5ANKA 5EYKA 3DKFA 3GCVA 2YM8A 3P7AA 3QKLA 4ACGA 4E5BA 4NWMA 4IFGA 4EOPA 4O1PA 3UPZA 3QRTA 1ZMUA 3OFMA 2W1EA 3UMXA 4QPAA 4RWIA 3G90X 4ANOA 2F4JA 3CTHA 3FKOA 3DZOA 4BGHA 4CFNA 1LR4A 2C68A 4JT3A 4PUZA 5HG7A 2XNGA 2C0IA 3D5WA 3IW5A 3OF0A 3TNQB 1A9UA 4DLJA 3ID6C 4CG9A 2GFSA 2X9EA 3ATTA 1W8CA 2UVZA 5K0XA 2J2IB 4OTRA 3ORKA 4EHGA 4AN9A 1JSVA 2XIZA 4O7TA 4ACHA 4YSJA 2ESMA 4GMYA 4AQCA 4PL3A 2VX0A 3BGQA 4JQ7A 1VEBA 2R3JA 3EKKA 4ONAA 3WILA 3PA3A 1OL7A 2UW3A 3P7BA 1BI7A 3QQKA 4UBAA 4O0YA 2C6IA 4AA4A 4BHNA 3ACJA 3QCQA 4OT5A 3VUKA 3HAMA 3JS2A 2QR7A 2FSMX 3A4PA 1U4DA 4NH1A 2BIKB 1PYEA 4BDEA 5CXZA 5HCZA 4BTMA 4DFXE 2W1FA 4D55A 3A4OX 4UWYA 1Q4LA 1Q5KA 1Q61A 2QO7A 4QTDA 4R6VA 4LMNA 4C4FA 4FZ7A 4D4YA 4CT1A 5EHOA 1RE8A 5CWZA 3UG2A 4C4IA 3C5UA 3VAPA 3ZSGA 4W9XA 2OJ9A 4UWCA 4O7ZA 3DXQA 4WNOA 5M4UA 2QURA 4C3PA 5DI1A 4JAJA 4OTWA 5T3QA 4BI1A 3PVGA 4EOJA 2Y4PA 3PZHA 5BMMA 1V1KA 4O0RA 5BVWA 4IQ6A 4QPSA 3TWJA 4ZSJA 3II5A 5FG8A 3ZRKA 4XG3A 4KKHA 3R7UA 3VW6A 2PUUA 3D9VA 4TXCA 5IQHA 3BHTA 3WYYA 4W4XA 3OROA 1SZMA 3OOGA 3QUDA 2BUJA 3LW0A 3CIKA 4WUAA 4YJSA 4LYNA 4TYJA 3UNJA 1OKVA 4FV8A 5LXMA 4JR3A 2BKKA 4D4SA 3R7GA 4Y8DA 1R0PA 4FK3A 5C27A 4AS0A 4BZNA 2P2HA 2CNQA 2OJJA 4GJ3A 4NU1A 3GENA 4DEDA 1XH5A 2Z02A 5EKNA 5C1QB 1IEPA 4L3JA 4MBLA 5ANJA 4QMXA 5EKOA 1Z57A 2R7BA 2W9ZB 4NZWB 2OO8X 3KULA 3PJ1A 4JBQA 3GC7A 4AA5A 3CPCA 3QA0A 1UA2A 2R3MA 3EJ1A 4U42A 1PMEA 2BRNA 3R1YA 2IZTA 4G3FA 1OITA 4X3FA 3ZUTA 2EVAA 3PLSA 1GNGA 3PWDA 3QHWA 4P2KA 3UOLA 4ANNA 4FA2A 3EZVA 3T3UA 2XB7A 3O51A 4JRVA 5KZIA 1W84A 2Z60A 4E6CA 5A6OA 4O82A 2E9NA 2W99B 2AUHA 3C4ZA 4ZXTA 3NW6A 4GG5A 3HP5A 1Y8GA 5CF4A 3TTIA 3K3IA 1IA9A 1STCE 4C57A 2X1NA 2BAKA 3MVMA 3PIYA 3KVWA 3W2CA 2HWOA 2QODA 1SVHA 4Q5EA 2XYNA 4O0VA 5IUIA 2C3LA 3D15A 4D9TA 3QFVA 2ITVA 3PP0A 4FIIA 5KHXA 2B9FA 4CFUA 2P0CA 3ZZEA 4CFWA 3P79A 4O81A 1W0XC 3R7IA 1VZOA 4X2NA 4QP9A 1T46A 3L9NA 1WVYA 4YPSA 5CEPA 2UVXA 3QRIA 4K77A 4I0SA 4WHZA 2UV2A 3LCOA 2HZ4A 4AZWA 1PY5A 3TIYA 3MDYA 4KD1A 1J1BA 4FKVA 5AADA 2X6DA 2XUUA 2WTWA 3OTVA 4BN1A 4LL0A 4XLVA 4D2VA 5AR2A 4EOLA 4AWIA 2XNEA 4L8MA 3NEWA 1R78A 2FB8A 2Y4IB 4FKLA 4QP1A 4D1XA 5I5ZA 4FT3A 4D58A 4IE9A 5A4TA 4LV5A 3TXOA 4XRLA 1REJA 3TV7A 5A4CA 5ACBC 4R1VA 5DR2A 4F4PA 1OPKA 4M69B 1KE9A 3UVQA 4CYIA 4EH4A 3OMVA 2PZYA 2BZHB 3EZRA 3GVUA 3KY2A 2VTIA 4WBOA 2QHNA 4YURA 1JQHA 3NIZA 2W1GA 4DT9A 1M7NA 2XIXA 3OBGA 4G9RA 5IG1A 5AP0A 1ZMWA 4XHKB 1Z9XA 4ASZA 3DLSA 3RNIA 2WMSA 3QC4A 3FZRA 5IQGA 4NM3A 1ZZLA 3UBDA 2EXCX 4IZ5A 4O0TA 3E3PA 2WFYA 4XP2A 4EORA 4TYGA 4AOIA 2AC5A 2VO3A 3M2WA 4I5HA 4XP0A 3D0EA 3TKUA 3NYXA 3AC1A 3IPHA 4CV9A 1ZARA 3I1AA 1Y91A 4EOKA 4MAOA 2WQOA 3LQ8A 4MQ2A 5AIRA 5DR6A 3TZ9A 5A14A 5AX3A 3IO7A 4FG8A 2VWUA 4BCMA 3DAKA 4DEEA 1ERKA 2W5BA 1OM1A 2O0UA 3M1SA 1P14A 4G3EA 4YZNA 2VO6A 5AM6A 1PYXA 1CKPA 2W1ZA 5F95A 5HORA 1UWJA 4MTAA 2R3RA 5IA3A 3OY3A 3SXFA 4MD7E 4ZTMA 4YHJA 2ETRA 3AC4A 4QTAA 3G2FA 5FXSA 2W05A 1Q8ZA 4U6RA 3E7VA 3LM5A 3WF5A 2WIPA 3COIA 4H3QA 2F7XE 4RA4A 4BTKA 5KKRB 2WQMA 3KXGA 2HY0A 3R9RA 4N57A 5F4NA 4DEAA 4BDDA 4N0SA 1B39A 1ZOHA 2R0IA 3CKWA 4DGMA 3ZS5A 4QT1A 3ZYAA 4R1YA 4NCTC 3EB0A 4DAWA 3P1AA 3PJCA 5AV1A 3TV6A 3QAME 2VTNA 3VN9A 3C0GA 4ZMEA 1YHWA 3DT1A 3T3VA 1Q8WA 3GCPA 5AP6A 4ZS4A 3RP9A 4AW2A 3VS4A 2W1HA 4FTQA 2VNWA 4RIXA 3FLQA 2HXLA 4TRLA 4O84A 3PLAE 5KZ0A 2PULA 3SG9A 5D10A 4A07A 3CKXA 2UZDA 1YW2A 2YJRA 3SX9A 3V6RA 2IZSA 4LRJA 4IJPA 3OWPA 5IF1A 3PSDA 5E8TA 5EFQA 5IU2A 2OSCA 3GBZA 4GK4A 1X8BA 2B9HA 3E63A 4GRBA 5KNJA 4C38A 4U80A 3RWQA 2OIDA 2WMUA 3QKKA 3GQLA 4EK8A 4F7NA 5K5XA 1E1XA 4FL1A 4ANQA 1OPJA 4TPTA 5H8BA 4C34A 4RSSA 2BZJA 1PMVA 5JEBA 1W83A 4WG3A 2CGWA 2XF0A 4P5QA 3OWJA 4U45A 5DYJA 4JL9A 1UV5A 2OJGA 1BKXA 3EHAA 3G9LX 4IAIA 4U79A 3V01A 3FC1X 2Q0BA 2XBAA 4ARKA 1G8SA 4AP7A 4X3FC 3N4UA 5DVRA 2PSQA 4O91A 5IKWA 4EL9A 3LQ3A 5I9ZA 2VWWA 2KTYA 4FEVA 4J71A 1JKLA 2JD5A 2CKEA 3M11A 4E6DA 1DS5A 4S31A 3UIXA 3S0OA 5GHVA 2OGVA 4FZFB 4OTIA 4QMZA 4YTIA 5LQFA 3NSZA 3PDTA 4G1WA 2F7EE 5AUTA 2WMAA 4RVMA 4MCVA 4HVHA 4AUAA 3QF9A 4DTAA 5DBXA 5ANIA 3C9WA 2VGOA 3E64A 2FUMA 5CU4A 5JMSA 3VUTA 1YHVA 4QRCA 1YWRA 2CNVA 3H4JA 4BIBA 4HVSA 3ZM9A 1G8AA 5EOLA 5FTQA 5I9XA 1H25A 3QZIA 2QOBA 3ROYA 4J97A 3JR1A 3QX2A 4BI2A 2Y0AA 3R2YA 4DFUA 4IX6A 4JOAA 3EQDA 4OLIA 1J3HA 2GHLA 3LCKA 3NUPA 2UW7A 4II5A 4MBIA 5CX9A 2VRXA 3F2NA 3I5NA 1I44A 3MFTA 4G3DA 4K6ZA 4C8BA 3CQEA 5CAUA 5GZ8A 3P5KA 5JGBA 5HOAA 3Q2JA 3FMHA 4FKJA 4I6FA 4FEUA 5C4LA 4FKSA 5T68A 5CF8A 1G3NA 5J5TA 4EC8A 3OEZA 4FEWA 2G2HA 2GTNA 5HNGA 4DFBA 3QTZA 2P55A 1ZLTA 4FOBA 4S2ZA 1QMZA 1UU3A 5HE0A 3ZBFA 4L45A 4BKYA 5JFXA 3KREA 4KINA 3GNIB 4CD0A 5DOSA 3UQFA 3QTIA 2WMWA 3E7OA 4DHFA 3U6JA 5CEQA 2GS7A 5E8WA 5K4IA 3LXNA 3ENHA 3NVKI 1WAKA 4NFMA 3HAVA 3W1FA 2A27A 4L44A 3EIDA 4N6YA 5CNNA 3LCSA 4ZLOA 3O50A 4KABA 2ETMA 5EK7A 3FV8A 4V0GA 2ITXA 4ALWA 1DM2A 4FV1A 3ZM4A 3R30A 5HU3A 3DCVA 4EK3A 4BDHA 1GJOA 4ZK5A 4IDVA 4R7IA 4BY9E 4Z9LA 4B4LA 4NJDA 3SA0A 5HICA 3DTCA 3ZEWA 4HYIA 4AZEA 4J52A 2VTSA 2X7GA 5DR9A 3KXMA 2HXQA 4MD8E 4O7SA 4HCUA 2WIHA 5IDNA 4BDCA 4QMVA 4F6SA 5KMJA 2ZB0A 1SNXA 5BVKA 2OZAB 4C7TA 1A06A 1MQBA 4FKPA 2Y6OA 1F3MC 4QMMA 5JFWA 4DEGA 3R04A 3VS7A 2AYPA 3MA3A 5E1SA 1PXKA 4L53A 3EL7A 4L6QA 4QQCA 3UJGA 4KIKB 4IIRA 1U59A 3QXPA 2A2AA 2UW6A 3R1QA 4DCEA 4KSQA 4XJ0A 4CFFA 1H0WA 2I40A 3FMNA 5ANEA 4YZ9A 2C6KA 5HLNA 4FK6A 1XKKA 3R22A 2HW7A 5CSXA 5AV4A 2NPQA 2RFNA 5IH6A 3LCDA 4FEQA 4FNWA 3KF4A 3F5GA 3I79A 4IZAA 3H3CA 2C47A 3DPKA 4ZTHA 2A0CX 5I0BA 2X2LA 5EM6A 1L3RE 2V62A 5KMMA 5HE1A 2XK4A 3C4XA 2JKKA 1RDQE 3UOHA 4RFMA 3OHTA 3MPAA 5DG5A 1M14A 2F57A 1BX6A 2X7FA 1H26A 4NIFA 2QCSA 2PUPA 4DH5A 4QYEA 4E73A 4RWJA 2V7OA 3QBNA 3RK9A 5KUPA 2ITTA 3OWLA 2VV9A 4FTMA 3AT2A 4HZSA 4NM0A 2UZBA 3W2RA 4C3FA 5IMXA 3QQLA 3PXFA 3PXRA 4FV9A 3TJCA 3UC4A 4C62A 3PJ2A 3R01A 5CAPA 3IDBA 3SLSA 4A9UA 3F7ZA 4D28A 1GZKA 3NDMA 1JKTA 2OBJA 2PL0A 4FIGA 4JDKA 5CNOA 4RX5A 4M84A 4NUSA 4RJ7A 5K0KA 4O7VA 2B54A 4Y95A 4AAAA 2CLXA 3ZO3A 2VWBA 4PRJA 4B0GA 4KS7A 2QONA 3FZ1A 5CSWA 3PYYA 3UP7A 4NTTA 3IW7A 3GU6A 3C4WA 5E91A 2R3FA 5CANA 3MIAA 4FKGA 4QNYA 5ACKA 3MESA 3I5ZA 4I1ZA 4FV2A 4GU9A 2WMTA 2JIVA 3FMDA 3OBJA 2ZAZA 4EYMA 3OT3A 2JIUA 3GGFA 5I9YA 4BDGA 1PF8A 4TYIA 5JKGA 2OH0E 3DLZA 2IVVA 5HTBA 4XV1A 3Q9XA 3DOGA 4DFNA 4YTCA 4ZY4A 3NWWA 2ZDTA 1U54A 5TO8A 5JN2A 4FT7A 3DFCB 3NCZA 4AZFA 3O71A 5CTPA 4BRXA 3NCGA 3R7OA 3FE3A 2RG5A 4E1ZA 1IA8A 3MY0A 3MVJA 2VTAA 3PA4A 4RX7A 5TR6A 4S32A 3WIKA 4BL1A 4YP8A 4E93A 4O7YA 2NRUA 1Q24A 3N4TA 3V5WA 3TNHA 5AR7A 4USEA 1PMNA 4UMRA 2C3KA 4RJ3A 3BX5A 4FC0A 4IVDA 3PUPA 3IW6A 5HBEA 4D9UA 3LMGA 4FV7A 3Q96A 3F82A 4XP3A 5L8JA 3DBEA 1WBPA 4YBJA 3E87A 5HG9A 4F08A 5GIOE 2PVKA 2FA2A 3VF9A 2IN6A 3MYGA 5CI7A 5AUXA 5KX8A 5LWNA 2QKWB 5JT2A 3ZO1A 4ZZOA 2QHMA 4H1JA 1OBDA 2VWVA 5LOHA 4M14A 1JAMA 2YIRA 2BVAA 2QU5A 3FL5A 4M7IA 3LXKA 4ZTRA 4A7CA 3ODZX 3ZMMA 4PP7A 4O83A 2JDTA 3QKMA 2ITWA 2ITUA 4QMLA 4A9SA 2PU8A 2BILB 3HYHA 4ZSAA 3Q4CA 3C5IA 3MB6A 4O0XA 5IH4A 2R3PA 4DGNA 4XG7A 2BZIB 3ANQA 3EOCA 3UMWA 3ZUVA 3D7TB 3W10A 2QG5A 4AW0A 4L68A 4QNAA 3VUMA 3P7CA 4QP3A 2YHVA 5LMKA 3W2SA 5DA3A 5CALA 2FYSA 1WBWA 3O2MA 4MNEA 4AW1A 2R4BA 2WMVA 4ZIMA 5FM2A 3SRVB 3FI3A 4X3JA 4DH3A 5IISA 2YACA 2C0TA 4S33A 2WQNA 2Z8CA 3C4CA 1K3AA 3CD3A 3Q04A 4IZYA 4C35A 4G16A 2R3HA 3I60A 2OKRA 3BGPA 4G3GA 2E9PA 2WTDA 2B55A 1WMKA 3R28A 3KCFA 4F99A 4OR5A 5EDQA 4WNPA 4BB4A 2CDZA 3V5PA 3AGMA 4GL9A 4I0RA 2LGCA 5TT7A 4ACCA 4UZDA 4EHEA 2ERZE 4EEVA 4AZSA 4XNEA 1KV1A 3WF6A 2OI4X 2XM9A 1FGIA 3RTPA 2PVMA 3FMEA 4KS8A 5AP1A 3ZFYA 5CAVA 1Z5MA 4PTGA 5D1JA 4UWBA 3E88A 4FYOA 2YITA 3UIBA 4FT0A 4TZRA 3GB2A 5M51A 4M15A 4OBPA 4YLLA 4HOKA 4FT9A 3QXOA 3ZO2A 3GP0A 4QMYA 1YXUA 1ZY5A 2PTKA 3HVCA 3R8UA 4KKGA 4HGTA 1GZOA 3NRMA 3N9XA 2FGIA 3BYSA 4ANSA 3R00A 4XV9A 5TE0A 3Q4UA 3JVRA 5CSHA 1BLXA 3TIZA 1EH4A 2CGUA 3DJ5A 3HGKA 4ZZNA 1ZYCA 2Z2WA 3L8XA 4O0UA 5CSVA 2JAVA 3Q6UA 5IZFA 2GNJA 5CU2A 3G33A 3VIDA 2FO0A 5DFPA 3LAUA 4MF0A 2FSOX 2R3OA 5M06A 3QTSA 3PSCA 5DT3A 2JDRA 2YN8A 4X2JA 1JOWB 4RIYA 1Q3DA 3GC9A 3P4KA 5EOBA 5M55A 3QZHA 3CE3A 1BMKA 3UPXA 4AE9A 4NT4A 3R21A 2WMXA 3FZSA 4TN6A 3FZPA 4FSQA 1ZYJA 4N70A 3BU3A 4GFOA 4R5SA 4YLJA 5FEEA 5JZJA 4NW6A 2Z7LA 3NAXA 5HIBA 4FE2A 5DE2A 2W7XA 4L7FA 4CCBA 4AU8A 2OG8A 2BMCA 3GXLA 4PF4A 5CT7A 4DITA 4FICA 4CFVA 3PVBA 5BVEA 2XIKA 3HRCA 4RBLA 5AV0A 4ZJJA 3KEXA 2JFMA 2R3GA 5IUGA 4GUEA 4UN0C 1R0EA 3HNGA 4O96A 5M53A 1ZYDA 2XIRA 4PMPA 4ANMA 2C5YA 2XNMA 1UNGA 1H0VA 1V0BA 2UW4A 4RJ4A 4LMUA 4WRSA 3N4VA 3R73A 4ZLYA 5F94A 2HENA 1P2AA 3F61A 5EYDA 3V8SA 4KKEA 3NLBA 3H10A 4JAIA 3V6SA 3U51A 4AXAA 3O7LB 5CF5A 4NKSA 3D2KA 1RJBA 4XG4A 4UMTA 4IC8A 3G15A 3ZBXA 4M3QA 5AV2A 2PY3A 3BYVA 3VBVA 1P4FA 1JVPP 3Q52A 3QTXA 4U40A 4Y73A 2XJ0A 1UU9A 5L2IA 3KMUA 2VUWA 4OTDA 4DN5A 1OZ1A 2OXDA 3OWKA 3RZBA 3U4UA 4O2ZA 3LJ1A 1PXNA 1ZZ2A 3HV5A 3PP1A 3ZDUA 4WT6A 4AX8A 5A6NA 4UEUA 4FV5A 2R0UA 4K11A 4LGGA 4QQJA 5TKDA 3U4WA 2YIYA 2VGPA 3MFUA 2BDJA 3F6XA 5I3RA 2UZUE 3NUSA 4BHZA 3I81A 4F1TA 2PZIA 2LAVA 1K9AA 4YMJA 5DHJA 3BRBA 3E92A 3R8MA 5A46A 5BUJA 3RPSA 4BYJA 4OAVB 5HCXA 4DG0E 5JGAA 4QP8A 3H9OA 1PMUA 4WNMA 5GIPE 4K18A 3DBCA 4P5ZA 3COKA 1H1SA 4S34A 4I0TA 4FTCA 4IJ9A 3MI9A 5HHWA 3KQ7A 5IQFA 4J96A 3D5VA 2C3IB 3C1XA 3QUEA 2GNFA 4K1BA 5DN3A 3ZLYA 4ENXA 4GKHA 5C4KA 4HJOA 4FTAA 2C3JA 5AA8A 4WNKA 4I6BA 4RC3A 5HTCA 3GI3A 4FNXA 4E4LA 4ITIA 2JBPA 5FBOA 4CVAA 3ALNA 2XK3A 5A3XA 5HX6A 2WOTA 4M0ZA 4EOQA 1LP4A 1NVQA 3PFQA 1FINA 3PTGA 5K3YA 5LMKC 5GINE 4H3BA 4C2WA 3OY1A 1UNLA 3IW8A 1IAJA 4IWQA 5IQDA 4C36A 4D2TA 2OXYA 4IC7A 5FDXA 3NUNA 4EOSA 4U7ZA 1OPLA 4EUTA 5E92A 5CF6A 3HKOA 5DH3A 2JDOA 3V04A 3NW5A 2JKQA 3AMAA 4ZS0A 2PZ5A 2JITA 4E5WA 1L8TA 4MK0A 1YXVA 5C03A 3E3BX 3MH1A 1OIUA 4G6NA 1NXKA 2G15A 3TZ8A 3EQPA 3EN7A 1OVEA 3Q4TA 4ZSLA 4BGQA 4K33A 3VVHA 2C4GA 4UXLA 3HRBA 4UXQA 3SG8A 4EHZA 4RMZA 3LFDA 2EB2A 3QRJA 1YDRE 3OZ6A 3EQHA 4O0WA 3QQGA 2G1TA 3MGYA 4IEBA 2PVNA 1PXIA 5K4JA 3BZ3A 3LPBA 2XEYA 3A62A 4FG9A 2RF9A 4CKRA 4F0GA 4GSBA 5AFVA 2XJ2A 3THBA 2WOUA 4HPTE 3RPOA 4PMTA 2WMRA 5AM7A 2XNOA 3CY2A 3MFSA 3P0MA 4RX9A 1RQQA 1YI4A 1VJYA 3I6WA 2OLCA 4FTJA 3UQCA 2W17A 2XH5A 4G31A 4B7TA 2PVJA 4GU6A 2W5AA 4FSMA 4GT4A 4IAYA 4YC8A 4ZJVA 3DB8A 3WZDA 4MF1A 2J0KA 3SW7A 2HIWA 4FSWA 3DJ6A 4DLIA 3Q3BA 4DH8A 3HMPA 2CGXA 3FKLA 3QRKA 1QPCA 4YHFA 4B6LA 2JAMA 4NL0A 1BL6A 3IGOA 3TG1A 4LUEA 5BUEA 3N51A 2X6EA 4NJ3A 3KXHA 1ZOEA 1UKIA 3OUKA 1ZYSA 2G01A 2BALA 3AD4A 3S4QA 5ANGA 4FTNA 3BQCA 4JQEA 2WB8A 2X7OA 4EKKA 2PE2A 3AD6A 2XNBA 3LZBA 5CI6A 5HZNA 3UZRA 4KBCA 5C8MA 5CU0A 2PMIA 1MRYA 4D2SA 3GOPA 4EK5A 1O9UA 2YM3A 3EQFA 2YM7A 4FSRA 1XWSA 4FVQA 2H6DA 2VO7A 1F5QA 2OFUA 3NX8A 4YJQA 1FGKA 1UNHA 3FQSA 4U81A 4MH7A 2OF4A 2GS2A 4KSPA 4MQ1A 3UO6A 1PXPA 2OW3A 3T9TA 3VRYA 4YBKA 5FBNC 4HGEA 2J0LA 4BWKA 3W18A 1H00A 5B2KA 4U3ZA 3RNYA 2ZOQA 3QL8A 4MX9A 3D94A 2E9UA 5HESA 5A54A 5E8VA 5KHWA 2V22A 4R7BA 5ANDA 4RPVA 3VS3A 3LJ0A 2VAGA 3DBDA 3WI6A 3AGLA 4I23A 3FLSA 3L9MA 2OU7A 2YISA 4F9BA 5IA5A 1K2PA 3HUBA 2VTRA 2GNGA 3PPZA 2CN5A 2YABA 5EM7A 5DEWA 3GEQA 3RAIA 4FF8A 4XLIA 2IZUA 3QU0A 3OS3A 4DH7A 1APME 3IOKA 4FIHA 4MWIA 3R9NA 4M69A 3Q5IA 5IEXA 4F9CA 3NZ0A 4O27B 1H28A 4ZP5A 1OI9A 1P5EA 2B7AA 2HELA 2J9MA 3MJ2A 3LHJA 1XR1A 5AAEA 4MXZA 1XJDA 3RKBA 1Q41A 3Q2MA 4LV8A 2IW9A 4V01A 4ACMA 4XH6A 3EN6A 4HW7A 5HGIA 5IQEA 1OGUA 1SM2A 1V0PA 3ORLA 1MP8A 2PZPA 4CV8A 3IDCA 3IQ7A 3B2TA 4BWPA 3BU6A 3T9IA 2VZ6A 2HZIA 3NNVA 4ZSGA 2NO3A 2UZNA 3AMYA 1H27A 1H24A 1XBAA 3H0ZA 3ELJA 5AV3A 3FSKA 3WZKA 1UVRA 4LOPA 3PIXA 3HMIA 4KRCA 4NEUA 1YDSE 4P90A 3VUIA 5CAQA 3BPRA 4XMOA 1ZWSA 2QKRA 3BCEA 1Y57A 2X8IA 5KBRA 2G9XA 3R02A 4BF2A 3HDMA 1JWHA 5BQ0A 3KXZA 2GDOA 2UZEA 2FSLX 3RHKA 3I7BA 4KIOA 2SRCA 3C50A 3TACA 3VJNA 3UZTA 2YDIA 2C6OA 1GZNA 5BMSA 3TN8A 4BKJA 4IM3A 4KBAA 1REKA 4ZOGA 4FKRA 5IA2A 4F9AA 3GFWA 2CGVA 3V5JA 5DMZA 5D7AA 4BCNA 4EJNA 4O86A 4C33A 2YDKA 1WBTA 4QQ5A 2ACXA 3VJOA 5EDRA 2OXXA 2JEDA 3NR9A 4D2RA 3PE1A 4FOCA 2B9IA 4PDSA 3RAKA 4A4XA 3UVPA 3LJ2A 4YNOA 4XCUA 2BKZA 1DI8A 3QWKA 3WF8A 4FUXA 4QTEA 5C8KA 3DTWA 4V04A 4IMYA 1IG1A 1M7QA 1Q3WA 1T45A 2VWYA 1I09A 4A4OA 3Q53A 4F1OA 1URWA 3R2BA 1PXLA 4AFEA 5IMEA 1QPDA 4FV4A 2XK6A 4KRDA 4KAOA 4RIWB 3KFAA 5EW3A 4A4LA 4CFXA 4HGLA 1Q8YA 2CKOA 2BR1A 1R1WA 1CTPE 4EH2A 3W8QA 3PXYA 4TNBA 3FMMA 3GQIA 2JKMA 3HLLA 4DCAA 3RM6A 1XQZA 5EM8A 3EFKA 1VYWA 4L67A 4FSNA 5L2SA 2EWAA 3QC9A 4Y5HA 3F3TA 2BAQA 4IACA 3TKIA 3ZO4A 3CXWA 3ETAA 4BDBA 2I0EA 3DKGA 4YTFA 4BBFA 3OXZA 4XV2A 2OZOA 4BTFA 2J5EA 2QR8A 3D14A 4HVDA 5TOZA 2X4FA 3Q6WA 4Q5HA 2XCHA 3DV3A 4JIKA 4H36A 3GC0A 5A4LA 3R83A 5FXQA 3LLTA 4ITJA 4JBOA 1KE5A 1YVJA 3ITZA 2C1AA 3ZXZA 5L4QA 2A4LA 2R3LA 4GT5A 3UZPA 4M12A 5AAFA 5JQ5A 3BGZA 1U5QA 1ZMVA 3HZTA 1CKJA 3WE8A 4FGRA 4CEGA 4PV0A 3EN5A 2GHMA 1OL1A 2R3QA 3W2OA 3LXPA 3VS2A 1J91A 1Y8YA 3MY5A 3IKAA 4D2PA 1O6LA 4EBWA 3NS9A 4OGRA 4FTOA 4EQMA 4DTBA 3PY3A 4C3RA 1JSTA 2HOGA 3FLNC 3I0OA 5EQEA 3DS6A 1YXSA 3L8PA 4GG7A 3UO5A 3PPJA 4RQKA 4EH5A 4JIAA 3ZH8A 4CYJA 5IEYA 5KMIA 2WTCA 4H39A 4IM0A 1FVTA 1XH6A 2XEZA 3BQRA 2YZAA 3FXXA 3W2PA 1LEWA 3BU5A 4RJ8A 1O6YA 3MH0A 3QRUA 3UIMA 5KO1A 4IVAA 3O96A 3RI1A 1FMOE 4MKCA 2PVLA 4XRJA 5CEOA 2UVYA 4I4FA 1KV2A 5IQBA 3LVPA 2ZYBA 3IECA 5F20A 4D5HA 2QLQA 5AAGA 4YJNA 4GYIA 4MXXA 4RFYA 1PXMA 4HZRA 3NYNA 3UNKA 2J5FA 3G0EA 3IW4A 4MXCA 5M56A 4MHAA 4NYEA 2JGZA 2UZWE 3CBLA 2XBJA 2XKCA 3BV3A 2OF2A 2QOCA 2ETKA 2YCQA 4YZDA 3DNEA 2WMQA 5AWMA 4NKAA 1XBCA 2A19B 4TYHB 4BDFA 2W4JA 4CLJA 3FXWA 1OBGA 4ASDA 3U87A 3SC1A 2C6EA 3R8PA 4S30A 2EU9A 3P23A 3R6XA 1MRUA 2YCSA 3AMBA 5M09A 3FY0A 1NVSA 3DKCA 4YPDA 3V8WA 2QOKA 3RK5A 4KIPA 5H9BA 5M07A 4BCKA 3TNIA 4GW8A 3GOKA 4RX8A 3CTJA 2P3GX 4EOIA 4CLIA 4XG2A 5AEPA 2QI8A 2IWIA 4C4JA 2J50A 3RINA 1LPUA 2YFXA 5AX9A 1NY3A 4FGBA 3SOCA 3VNTA 2ITYA 3O7LD 5C8NA 2GNHA 2J0IA 2PYWA 3ORTA 3PE2A 4RLLA 4BC6A 5IPJA 4QMOA 4CRLA 4GT3A 3MW1A 5HI2A 5J9ZA 1YWNA 5E9EA 1CKIA 5AUWA 4YUQA 4YC3A 1JBPE 3HV7A 1QPEA 2UZOA 3G6GA 4IX3A 5ICPA 5FLFA 3KGAA 1E1VA 4F0IA 4UMPA 4GK3A 2Z7SA 2ZV8A 4Z3VA 2C6TA 3A7GA 2ZMCA 3ATSA 3C4FA 2VTMA 3PVUA 2UUEA 5AP3A 2IJMA 4TW9A 5ETAA 4TWPA 2VTPA 4L3PA 2ITNA 3DK6A 4G6OA 4CZUA 3JY9A 3PIZA 3AD5A 2PMNX 3Q9ZA 5KMKA 5F9EA 2B1PA 3GUBA 1TKIA 5DT0A 2OZAA 2Y7JA 4I93A 3RWPA 3CP9A 3WZEA 4F6WA 1W7HA 3BV2A 2IO6A 2V55A 3VQUA 5I3OA 2JDSA 2O8YA 3DDQA 4EWQA 3GU5A 2VTQA 4KIKA 4O6LA 3KRJA 2GPHA 3DZQA 4E6QA 3ZC6A 3UOJA 4E7WA 3U8WA 3I4BA 2W1CA 3F3ZA 3OTUA 5A4EA 4IBMA 3DBQA 5I9WA 3VS1A 3TNPC 4FSUA 4KBKA 4AGDA 2ZV2A 3UDBA 4ORKA 3ZFMA 4PWNA 2PVFA 2YIQA 1H07A 3D83A 2ERKA 2ZVAA 4I6HA 4PDOA 3QQUA 5HLWA 3BHVA 4TTHB 4RZVA 2O5KA 4FBXA 2W1DA 4W8DA 3ZSIA 4BDKA 4DTKA 5IA4A 3MWUA 3NYOA 2FVDA 4DINA 3S00A 4E4NA 4WKQA 3QCSA 4QMQA 5KMLA 4IB3A 2ZM3A 3F88A 4X21A 5IUHA 3G5DA 3MJ1A 2OH4A 3F69A 2YWPA 2DWBA 3P86A 3UOKA 2JC6A 4DGGA 5HIEA 4M67A 2FSTX 4FTTA 1HOWA 2PE1A 3LOKA 4JVGA 2PWLA 4WOVA 3V8TA 3L9PA 3MB7A 4HPUE 3U6HA 4PMMA 3DDPA 3MIYA 3G51A 2YIXA 3DY7A 3FPMA 2CNUA 5HD4A 4LQMA 4CG8A 4V05A 3LXLA 4N4SA 4AGWA 2YJSA 4D0WA 1W82A
chains in the Genus database with same CATH superfamily
3CCNA 4WO5A 3FPQA 5JH6A 1ST0A 2VWIA 3RZFA 4XS2A 3SDJA 5HO7A 2YIWA 4CQEA 4J8MA 5HIDA 3MBLA 4EK4A 1Y6AA 2RSVA 4J98A 1U46A 4NTSA 2YAAA 2YM5A 3NUYA 3ORIA 3QX4A 2QVSE 3AC5A 4I6QA 4BBEA 2YCFA 2ZM4A 4BVUA 3ACKA 1UWHA 4QMWA 3HV6A 2BTRA 4NW5A 3ZLSA 2J6MA 4FL3A 3FKNA 4E20A 5L2WA 1M2PA 4AE6A 3ORNA 4Y83A 4CKJA 2CPKE 5H8EA 2XALA 1J7UA 1OGYA 5M44A 2WTJA 1GAGA 4NFNA 4BCOA 2UZTA 5LARA 4CT2A 3POOA 3H9RA 4FNZA 3F2AA 3MVLA 4GFGA 4JBPA 4JDHA 3PXQA 2CKQA 4YZBA 4Q9ZA 1S9IA 2WU6A 3SKCA 3OXIA 4QTCA 1WBOA 5L2TA 2OWBA 3IDPA 3LFSA 5AUZA 4O6EA 3VW8A 3QQFA 4C59A 4F70A 2R64A 2X2KA 3UDSA 2A1AB 4RRVA 3LMIA 3TKHA 5JQ8A 4CMOA 3FJQE 3PXKA 4PDYA 2O2UA 5M57A 3DXPA 3ULZA 4BGGA 5E8SA 3VBQA 4BICA 4IAKA 3TUCA 5CZIA 2O63A 2H8HA 4CTBA 1UU8A 3QTUA 4BBMA 4ERWA 5HVJA 2YCRA 2C5OA 4MXOA 3K2LA 4AT4A 4PTCA 4O2PA 2GQGA 5LVMA 1J7LA 4YHTA 5EHLA 4C37A 3E8DA 4IW0A 4EQCA 4CZYB 3CQUA 3D2IA 3L8VA 3QALE 3R0TA 3A8XA 4XOZA 4D4VA 3S95A 3IGGA 3TUBA 5CENA 4UX9A 4K9YA 4LM5A 2EUFB 1KE8A 4U8ZA 2XK9A 3KC3A 4I20A 4U41A 1FBNA 3TZ7A 3JPVA 3R7EA 4Z7HA 4CRSA 1FVRA 3KRLA 2RFSA 2QLUA 4GV1A 4OBOA 3W0OA 5FQDC 4LG4A 4APCA 1WBSA 2B9JA 2YM6A 1FPUA 2XMYA 4KUJA 3PJ8A 3UE4A 2JIIA 3BYOA 2BRHA 5BVOA 3GU8A 4RGJA 4CXAA 5HVKA 4M68A 1JKKA 5K5NA 3SXRA 3ZLWA 4EJ7A 3COHA 1KSWA 4M13A 3D7TA 4XOYA 4WA9A 4ITHA 4QYGA 5DPVA 5JRQA 2DUVA 2J7TA 1YWVA 2F2CB 3MPTA 4K2RA 1SMHA 2BPMA 3HA6A 4LRKA 3FYJX 5C26A 3ZTXA 3C13A 4L00A 2V5QA 4WSQA 1GIIA 3TV4A 1OECA 4HVIA 5EQYA 3IK3A 3ERKA 3BBTB 3FQEA 4JX7A 4LI5A 3OW3A 1PJKA 4UV0A 1AD5A 4WRGA 2IZRA 5C01A 4C61A 5I9VA 2I7QA 3QTQA 4I5MA 4MNFA 2Q83A 5CZHA 3SW4A 3RMFA 4D2WA 5BVFA 2VNYA 2HY81 5D7VA 3FZTA 3R1SA 1OL5A 3SQQA 3DBFA 2IW6A 3EN4A 3NGAA 4CMTA 4EYJA 4QD6A 2F9GA 4TKSA 4U3YA 4TWCA 1KUTA 3OC1A 4W9WA 3CS9A 4LGDA 5B2LA 2WMBA 4H58A 1UKHA 4IB1A 4D1ZA 4GIIA 2WTIA 3D5XA 4KNBA 3VQHA 3KMMA 3F3WA 1OB3A 3HV4A 4WD5A 5EYMA 2X4ZA 3KVXA 1KWPA 3OUNB 3H30A 3F2RA 4BDAA 4W4YA 5DT4A 5BYLA 1VR2A 3R1NA 3D4QA 2NRYA 2WGJA 3RHXA 1WZYA 1H1QA 3EQRA 4FYNA 4RQVA 1W2CA 2J90A 4QYFA 5EG3A 5KE0A 3FDNA 3JYAA 5AR3A 1W98A 4F65A 3V5TA 5L6WL 4AXFA 4BR3A 1NVRA 2C69A 2ZJWA 3G9NA 3LFBA 3LQ5A 3ZHPC 3W0RA 4PMSA 4EC9A 3KMWA 3POZA 4FEXA 2ITZA 2BRBA 2DYLA 4OBQA 5EH0A 4IX4A 2ITPA 3LFFA 5E8YA 5ETFA 3JVSA 3KRRA 1H1WA 2J4ZA 3RGFA 3T8OA 4RVKA 3PG3A 4EZ5A 5KMOA 3FWQA 2JLDA 4I4EA 3QCXA 3CJFA 3PY0A 4D5KA 4DBNA 4GUBA 4QP4A 2WQBA 1YOJA 5L3AA 5CY3A 2QU6A 3DFAA 3BE2A 4G34A 2XA4A 4IAFA 1WBVA 5AMNA 4AZTA 5K9IA 2DS1A 1ST4A 4QMSA 4D1SA 4IDTA 4FTUA 4BFMA 4XBUA 4CMUA 4O7RA 4EH8A 4B9DA 3IS5A 2WTKC 3E8CA 4JDJA 5DWRA 2WTVA 3S3IA 1TVOA 2I0VA 3LFAA 3QGYA 5T6KA 4DC2A 3FAAA 4JRNA 2QC6A 4M66A 4BCPA 4BDIA 3NYVA 3DK7A 2PMOX 5J1WA 2NNWB 4FV3A 4AW5A 1H01A 3QD4A 3EH9A 3C0HA 2R3KA 4I24A 3O0GA 3EWHA 4G6LA 2GSFA 4I5CA 4YJRA 2VTHA 3DJ7A 4MXYA 4IFCA 5HD7A 4ALUA 1YOLA 3EQCA 4KA3A 3QD2B 4FVPA 1DAYA 3BWJA 4FIJA 4GKIA 4P4CA 3SD0A 5EW9A 3KN5A 2XRUA 4N6ZA 4QP7A 2CSNA 3BLRA 2C30A 2WHBA 3FUPA 3OOMA 2VTJA 4FT5A 1OMWA 3U9CA 2UZVA 3EKNA 3P08A 3F3UA 3KL8A 4IB5A 4RIOA 4YGAA 3FSFA 4Z7GA 4AACA 3A8WA 3VBYA 4U43A 5FD2A 3AOXA 2EXEA 5BUIA 5JK3A 3TDVA 3FY2A 3F9NA 2XNPA 4IAAA 5AUVA 4FZAB 3GCSA 3A7FA 1AGWA 4AT5A 3GU7A 1U5RA 3BYUA 2O64A 1FVVA 4JBVA 1OIRA 3PSBA 2PE0A 3NNUA 3VS0A 3W32A 1BL7A 4AF3A 5KCVA 5LVNA 4HNIA 4XX9A 1ZRZA 4HYHA 4J95A 5IQAA 4ERKA 5HG5A 2F49A 4JS8A 2QOHA 5LCJA 2BIYA 2YAKA 3DQWA 4FI1A 5HNBA 2XIYA 3ORZA 4FVRA 4PNIA 3AKKA 4WG4A 3BLQA 4NCTA 5CVGA 3W33A 3WBLA 2XKEA 4I3ZA 5JZNA 3HUCA 4QMUA 4X6RA 3UGCA 4WG5A 3FLWA 3W16A 2UW0A 4O4BB 3TZMA 4BKZA 5AR8A 3ZU7A 3AQVA 4EK6A 4EI4A 5CLPA 3KULB 2G2FA 2YLFA 4PDPA 2HYYA 5G6VA 1GIHA 2YM4A 4ZZMA 4W4WA 3R9DA 5CSPA 2OIQA 5JFSA 2RKUA 3FMLA 3WF9A 4DT8A 3U9NA 3WE4A 2GQRA 3TJDA 4X3FB 1HCLA 3D5UA 5HBJA 1Y6BA 2B53A 3E93A 5AP7A 5J8IA 4DFZE 4NM5A 2BRMA 3KF7A 1WVWA 3HX4A 4DG3E 4DG2E 1OIYA 1TQMA 4OTQA 4J1RA 4O21A 1FOTA 4UMQA 4I22A 3IONA 4RWLA 2GU8A 2R2PA 3A7IA 1KOBA 5DLSA 4DHZA 3VWAA 4RVTA 4R78A 3FQHA 3BWFA 4CQGA 5B7VA 3MH2A 5FTGA 3D7ZA 2E9OA 4UB7A 2RFDA 5CASA 4E4XA 4UYAA 2Y6MA 1YQJA 1JLUE 2ZM1A 5LJJA 4LFIA 4F7SA 4CSVA 4ENYA 4FZ6A 1J1CA 4USFA 4A9RA 3RVGA 4KIQA 3L8SA 4PL4A 4ZTLA 4AFJA 4ZLZA 5J7BA 4J53A 1VYZA 1P4OA 4ZAUA 4LOOA 4C02A 1BYGA 5E8XA 2BRGA 3RCJA 3ZLXA 4EQUA 2RIOA 5H2UA 4BJJB 4A06A 4B99A 3HEGA 1TZDA 2R3NA 3QGWA 2QO9A 4BCFA 2REIA 3KN6A 4UYNA 4EZ3A 4DE4A 4X2FA 2PZRA 3ZC5A 1ND4A 4HNFA 1M52A 4Q2AA 4E8AA 3LMHA 1M2RA 5EW8A 5EI2A 1YKRA 4BIEA 4O1OA 1Q8UA 3ANRA 3FI4A 4JG8A 4QO9A 5H3QA 1PXJA 2UW5A 2BCJA 4NK9A 4Y46A 5M4FA 2HW6A 4FODA 4AXCA 3ZOSA 4JG6A 4YLKA 1PHKA 3DB6A 4TT7A 2O3PA 1M17A 3ENMA 1BI8A 3KU2A 3KXNA 3VUHA 3FL4A 5FRIA 4RJ5A 2XKDA 2X2MA 1GZ8A 2EB3A 3F66A 3HECA 4EONA 1WVXA 2R3IA 4L3LA 3R71A 4QPMA 4A9TA 1H8FA 3FHIA 4QMTA 1OL2A 5E8UA 5FTOA 4AGUA 1DI9A 4J7BA 4D4RA 5L6OA 4I5PA 3VC4A 5AIKA 4I41A 1CDKA 1SVGA 3NW7A 3UDTA 5CQWA 3V5QA 2QOFA 2ZMDA 4RZWA 2OIBA 4BCJA 4U44A 3EFWA 5FEDA 2X81A 4DA5A 4USDA 5AR4A 1KOAA 1DAWA 3F5XA 4U9AA 2I0YA 3KCKA 5H8GA 3KB7A 3SVVA 4OTHA 1XO2B 3QQHA 4FL2A 5BX0A 4UALA 2BTSA 3FMJA 4DEHA 4E6AA 4YO4A 2UZLA 3BI6A 3M42A 5EI8A 5GJDA 4BZDA 3R7YA 5IQCA 2QOLA 3KK9A 3CGOA 3V3VA 2CLQA 5JGDA 3QHRA 3AT3A 5L8KA 3COMA 4L52A 2F2UA 5L8LA 4PQNA 3VBXA 4IVCA 3EYHA 1YHSA 1V0OA 2HCKA 4YJTA 3ZZWA 4FTKA 3FLYA 3Q32A 3F5PA 3QTWA 4DGLC 4BTJA 4G5JA 4DBXA 5EM5A 5AA9A 3TDWA 5I4NA 4BYIA 4MWHA 3G6HA 4YC6A 4Y5QA 4BIDA 5M4CA 3VRZA 3W2QA 2WKMA 4O7WA 4Z55A 3BLHA 4O7LA 1F0QA 3PRFA 2NP8A 4PPCA 5FEQA 3KRWA 5HE3A 3WARA 4PNKA 3E8NA 3WF7A 3PJ3A 4DHJA 4X6QC 4EOMA 4ZJIA 4GFMA 4XV3A 4MEDA 2WU7A 4EKLA 5IDPA 1WBNA 3GFEA 4WIHA 1G5SA 5HO6A 3VULA 3LLAA 5HLPA 5B0XA 3DAJA 1RW8A 3O5AA 5E1EA 1YRPA 2WPAA 2PHKA 5CU6A 3REPA 2GTMA 4QQTA 3PA5A 3FI2A 4RIXB 2QG7A 3GC8A 3OCSA 2PMLX 2YDJA 3Q4ZA 4FKUA 4P7EA 5BYYA 3U6IA 2X9FA 4J99A 4QMPA 4DH1A 3E5AA 4B8LA 4GCJA 3FYKX 2GFCA 1KE6A 3FXZA 2UW9A 2VU3A 3NIEA 4RVLA 4EWHA 1XBBA 1O6KA 4JXFA 1FQ1B 3BYMA 2IVUA 3K5VA 3NUXA 4E5AX 3FBVA 1NT2A 5E90A 3EFJA 3QLGA 4ZTSA 2ITOA 3ORPA 4PX6A 4C4GA 5AJQA 5TF9A 3HMOA 4QP2A 4UZHA 5CEIA 5A4QA 3CSVA 2H9VA 4L01A 3L9LA 3CY3A 2J51A 3ODYX 2OICA 4GEOA 5CEMA 4F0FA 2B0QA 1QCFA 3AG9A 3TT0A 5B2MA 4CZTA 2WXVA 4FTIA 4FIEA 5CT0A 2WAJA 4GVAA 4YNEA 4NM7A 1Q97A 2R9SA 3EQBA 4EZ7A 4OTFA 4YZMA 5A9UA 3RAHA 1PKGA 4F6UA 5ETCA 2V7AA 2OJIA 5HU9A 3ZONA 1NA7A 4GK2A 3RCDA 3VUGA 3MV5A 4AT3A 2O65A 3SGCA 2PPQA 3TM0A 4JR7A 3QD0A 4G5PA 1PKDA 4O38A 1OUYA 3AT4A 3PPKA 3C51A 3OG7A 1Q62A 5D9HA 3CQWA 2W4KA 3LFNA 1TQPA 3CTQA 2RFEA 1BUHA 1YI3A 1HCKA 4EH7A 3CLYA 2C6LA 2P33A 4IH8A 1CMKE 2GNIA 4UMUA 2C5XA 2PVYA 2BHHA 4D0XA 1B6CB 5LMAA 4MD9E 4TWOA 5CXHA 5ITAA 4XYFA 5AP2A 4U5JA 1OKWA 2BZKB 4RIWA 4FR4A 4I94A 3C4EA 4YZCA 2J0MB 3W8LA 4AGCA 5BNJA 3PWYA 3JXWA 3UVRA 3HP2A 3BKBA 4FKQA 3VBTA 4ID7A 4JQ8A 5J87A 2BHEA 1OL6A 2CCIA 4FSZA 5F1ZA 1OIQA 1YXXA 4IWOA 3AXWA 5HCYA 1E9HA 1YI6A 1JNKA 4TNDA 3C7QA 3S2PA 2VX1A 5IH5A 3KA0A 5FXRA 5BVNA 4E3CA 4G2FA 2CMWA 5LVLA 4R5YA 4YO6A 1KE7A 2B4SB 4JNWA 4L46A 5BPYA 2ZV9A 5JSMA 3AC8A 3Q60A 4H1MA 3VUDA 3HDNA 4QMNA 1ATPE 4FKIA 5FP5A 2NYAA 2PUNA 3QLFA 3MFRA 5LMBA 5GZ9A 5EHYA 3R8VA 4BWXA 4CKIA 3DNDA 3RM7A 1Q99A 4BI0A 4L9IA 4PY1A 4OAUC 3LCTA 1LEZA 3BHYA 4QYHA 3R9HA 3NUAA 3A99A 3ET7A 3HMNA 3P9JA 4YJOA 3IG7A 5IEVA 1TQIA 3LIJA 4LOQA 5HTIA 2PK9A 2IEWA 3OXTA 4JX3A 3ZCLA 5J7HA 4E26A 4FKWA 3MS9A 2BAJA 3RJCA 3EYGA 2YZLA 1WFCA 4TWNA 5DEYA 4HGSA 3FC2A 4PPBA 5HX8A 3BIZA 1JSUA 4V0GB 5FM3A 3VHKA 5BVDA 4IWPA 3WOWA 5J79A 3AC2A 3NNXA 4OW8A 5AUYA 4OT6A 3RBWA 3K3JA 4R8QA 4ZY5A 2WD1A 2QD9A 1XH8A 3RPRA 2Y4IC 1R39A 3I6UA 2Q0NA 3CD8A 5CU3A 3G0FA 4M0YA 2GMXA 1A48A 3A7HA 1PXOA 3ORXA 4FMQA 4YJVA 2VN9A 2Y8OA 1GIJA 2EXMA 4X7QA 2WNTA 3EL8A 4RFZA 5AP5A 3FLZA 3PFYA 4XG8A 2PVRA 1CM8A 3ORMA 2ZV7A 2ZDUA 5FGKA 5GJFA 4L43A 3OT8A 3ZRMA 2WEVA 4FUYA 3CGFA 3O8PA 2VWXA 3K5UA 4R7HA 4CCUA 4FIFA 5CVHA 4TYHA 2GCDA 4MYGA 3O23A 2W9FB 4IVBA 4K0YA 2XVDA 3AC3A 4ZTNA 5J5SA 4FV6A 2ONLA 3PG1A 3SV0A 3A61A 3VBWA 2V0DA 2CKPA 2XRWA 1ZAOA 3F5UA 2YLEA 2BROA 2CN8A 4CTCA 1YDTE 2C6MA 2B52A 2GS6A 3JY0A 1MRVA 3BELA 3GU4A 4R3RA 4CGAA 2GHGA 4KB8A 4HYSA 3RK7A 4C4EA 4FTRA 2IG7A 5FDPA 5J9LA 4AOJA 4W8EA 4F9YA 3PZEA 4L42A 4DYMA 1H4LA 4CNHA 1XHAA 2PVHA 3MPMA 4APPA 2VWZA 4EOOA 4GH2A 3UP2A 4FZDB 3R63A 4ZEGA 2CHLA 2X8DA 5FP6A 3FEGA 2CJMA 4NIFB 3MY1A 5D12A 4YU2A 3OW4A 4MBJA 5GNKA 1ZOGA 4ACDA 2GNLA 2W1IA 3OCTA 4GVJA 5LWMA 3EFLA 1IASA 1YOMA 2WEIA 4RA5A 4TYEA 5EI6A 2W5HA 4Y72A 3H0YA 3E8EA 5HO8A 2XK8A 3LFCA 4JG7A 2RG6A 4GJ2A 4IB0A 1GY3A 2UW8A 5KBQA 5KKRC 3QA8A 3DU8A 2F7ZE 2OJFE 4HYUA 1ZY4A 5AR5A 4J8NA 4BCIA 5EYCA 3BHHA 3FZOA 4QP6A 4JJRA 4B8MA 1SVEA 2Y9QA 4M97A 4XBRA 4ZY6A 4AA0A 3LFQA 4G9CA 4BCGA 4BCQA 4IX5A 4DGOA 5DRBA 4RWKA 2YA9A 4DFLA 4O0SA 4DEIA 3VS5A 3ZUUA 4F7LA 3NUUA 4RJ6A 2C1BA 3MN3A 2XZSA 4YJPA 5C9CA 2OFVA 3RPVA 1YXTA 3UTOA 4C4HA 5EQPA 2QOQA 3MTFA 3EQIA 2XK7A 1M2QA 2WQEA 4WUNA 1IR3A 2HK5A 3OEFX 1UU7A 1PRYA 3TNWA 2WTKB 3A7JA 3SOAA 1OUKA 4G3CA 2GQSA 4PTEA 3PVWA 4JLCA 3BHUA 4YTHA 1U54B 2X0QA 2XJ1A 3FMKA 2XP2A 2BDFA 4X0MA 4EH3A 3U54A 5E8ZA 4GIHA 4H3PA 4F9WA 3MTLA 4PPAA 1LUFA 3UG1A 2OK1A 4AN3A 2C6DA 2VO0A 4RC2A 2FH9A 4ANBA 3B8QA 5GZAA 5KMNA 3OP5A 1Q8TA 5L2QA 4QEBA 4JMQA 2HZNA 3NNWA 4JDIA 4LRMA 5J1VA 5EDPA 3ZFXA 4ZMFA 4A9YA 3DK3A 4AZVA 5M08A 1XH9A 2H96A 3R7VA 3KRXA 2QOIA 3O8UA 3PRIA 2XS0A 3WIGA 3W55A 1PW2A 5FWKK 5J95A 5LVPA 3BE9A 2VTOA 2XCKA 5E4HA 3LFEA 3R9OA 3EN9A 4IANA 3GT8A 3OD6X 3Q5ZA 3QZFA 4DEBA 5DGZA 2JBOA 4QTBA 4WBBB 3SAYA 2XKFA 2X0GA 4K8AA 1B38A 3B8RA 3DXNA 3DAEA 1GOLA 2W96B 2KULA 2X8EA 1IAHA 4FSTA 1R3CA 2C5VA 4JI9A 3NVMB 3ZSHA 1JPAA 4FKTA 3DA6A 1OKYA 2IVSA 1NW1A 1SNUA 2BFXA 2J0JA 3BEGA 4FKOA 5IQIA 2QOOA 5ETIA 3P78A 2G2IA 4O4FA 5BYZA 3MSSA 3O8TA 4ANLA 5AP4A 3NAYA 3ROCA 4ZSEA 2QNJA 2JFLA 4R3PA 4C2VA 2YEXA 3QWJA 4EH9A 3UO4A 4FSYA 4MNEB 5ANOA 1J7IA 4U97A 4GS6A 4TL0A 3DQXA 3WYXA 3MVHA 3UC3A 2WZJA 4HVGA 3Q9WA 1MUOA 3A2CA 5E7RA 1JKSA 1FMKA 1WCCA 1ZXEA 4HCTA 5AUUA 1OKZA 3QD3A 3U55A 3DGKA 4LUDA 2XM8A 3B2WA 2HZ0A 5LVOA 3TUDA 1SYKA 2E2BA 3SHEA 4HCVA 5GJGA 4Z16A 2JKOA 2IPXA 5DIAA 3RPYA 3OVVA 1H08A 3VHEA 5DRDA 2H34A 3CJGA 4ZTQA 4MXAA 4EH6A 3S1HA 4EHVA 2VTLA 4IWDA 2BFYA 4R77A 3Q9YA 3CEKA 4FTLA 2I6LA 3R8ZA 3RAWA 3UYTA 3OCBA 2HWPA 2X39A 2W4OA 4Y85A 5G1XA 4WSYA 1XH7A 3QYZA 4I92A 2XYUA 2VX3A 2VD5A 4LL5A 2DQ7X 3TEIA 4FNYA 4F09A 4AXDA 5HBHA 4H05A 4EUUA 4YSMA 3ZXTA 5CS6A 4IAZA 4PP9A 3NMUF 1XH4A 3RALA 4C0TA 3QTRA 2R5TA 4I21A 4O7NA 3CR0A 4BZOA 2ZB1A 3F3VA 2HAKA 3A60A 3SRVA 3UNZA 2ONLC 3ZEPA 2PUIA 2WO6A 2E9VA 1H1PA 3E62A 3HA8A 3L1SA 3DKOA 4ASEA 4OTGA 3LM0A 5M4IA 3FHRA 5IA1A 1AQ1A 3TI1A 2BDWA 2QO2A 2RL5A 5LCKA 3ALOA 3V51A 2AC3A 2XNNA 3CC6A 4IADA 3ULIA 4RLKA 3QUPA 2YWVA 2CCHA 4LGHA 3VO3A 4BCHA 3C0IA 4EBVA 3H9FA 5D11A 2I1MA 1QL6A 1QPJA 2YERA 3KK8A 5HG8A 3VS6A 4BDJA 2Z7QA 1URCA 3BLAA 3QYWA 4R3CA 3HRFA 4AG8A 4AOTA 4YJUA 4U0IA 4DFYA 4RIYB 4X2KA 3UYSA 4X2GA 3UODA 3EMGA 5I9UA 4XEYA 5HQ0A 4UY9A 4L7SA 5CQUA 4OUCA 2JDVA 4G17A 3CPBA 3LE6A 5HVYA 3TTJA 3UQGA 4C58A 5CEKA 2ITQA 4XUFA 5HNIX 4XG6A 2W0JA 2IVTA 3NPCA 4RG0A 4PL5A 3FI8A 5HE2A 2P4IA 4FG7A 1S9JA 3WZJA 3K54A 4RC4A 2I0HA 3PXZA 4QOXA 4OTPA 2RGPA 3IOPA 5D41A 1H1RA 4RT7A 3MA6A 4IHPA 5CAOA 2VTTA 1MQ4A 3KXXA 4FV0A 4W4VA 4AN2A 3I0QA 3F7WA 3PY1A 4F63A 3EQGA 4F7JA 4IM2A 4F1MA 4MVFA 2QQ7A 3LKMA 1ZYLA 3OCGA 3HV3A 3QZGA 4ASXA 4ALVA 4GYGA 3KKVA 3QQJA 4XG9A 4DF3A 2AEGA 3UIUA 3HL7A 4QYYA 3V5LA 4Q9SA 2IW8A 5L6PA 3JUHA 3O17A 4F64A 3SXSA 2C5NA 4TY1A 1CSNA 4M8TA 5CVFA 4FX3A 4YR8A 3I7CA 5IA0A 4IXPA 5HKMA 3ZRLA 3QCYA 4O4DA 4CFMA 5DNRA 4E4MA 2W06A 5JFVA 2R7IA 3BBWA 5HEZA 3TL8A 5J9YA 2Z7RA 3WZUA 3ZDIA 5FUTA 3GCQA 3BEAA 3TCPA 4IZ7A 1W2DA 3MH3A 4O22A 3R8LA 3VF8A 2WELA 4KWPA 3HMMA 5JRSA 2C0OA 3GCUA 1IRKA 2P2IA 4NSTA 5CYIA 5ANKA 5EYKA 3DKFA 3GCVA 2YM8A 3P7AA 3QKLA 4ACGA 4E5BA 4NWMA 4IFGA 4EOPA 4O1PA 3UPZA 3QRTA 1ZMUA 3OFMA 2W1EA 3UMXA 4QPAA 4RWIA 3G90X 4ANOA 2F4JA 3CTHA 3FKOA 3DZOA 4BGHA 4CFNA 1LR4A 2C68A 4JT3A 4PUZA 5HG7A 2XNGA 2C0IA 3D5WA 3IW5A 3OF0A 3TNQB 1A9UA 4F78A 4DLJA 3ID6C 4CG9A 2GFSA 2X9EA 3ATTA 1W8CA 2UVZA 5K0XA 2J2IB 4OTRA 3ORKA 4EHGA 4AN9A 1JSVA 2XIZA 4O7TA 4ACHA 4YSJA 2ESMA 4GMYA 4AQCA 4PL3A 2VX0A 3BGQA 4JQ7A 1VEBA 2R3JA 3EKKA 4ONAA 3WILA 3PA3A 1OL7A 2UW3A 3P7BA 1BI7A 3QQKA 4UBAA 4O0YA 2C6IA 4AA4A 4BHNA 3ACJA 3QCQA 4OT5A 3VUKA 3HAMA 3JS2A 1W2FA 3A4PA 2FSMX 2QR7A 1U4DA 4NH1A 2BIKB 1PYEA 4BDEA 5CXZA 5HCZA 4BTMA 4DFXE 2W1FA 4D55A 3A4OX 4UWYA 1Q4LA 1Q5KA 1Q61A 2QO7A 4QTDA 4R6VA 4LMNA 4C4FA 4FZ7A 4D4YA 4CT1A 5EHOA 1RE8A 5CWZA 3UG2A 4C4IA 3C5UA 3VAPA 3ZSGA 4W9XA 2OJ9A 4UWCA 4O7ZA 3DXQA 4WNOA 5M4UA 1XMMA 2QURA 4C3PA 5DI1A 4JAJA 4OTWA 5T3QA 4BI1A 3PVGA 4EOJA 2Y4PA 3PZHA 5BMMA 1V1KA 4O0RA 2X0OA 5BVWA 4IQ6A 4QPSA 3TWJA 4ZSJA 3II5A 5FG8A 3ZRKA 4XG3A 4KKHA 3R7UA 3VW6A 2PUUA 3D9VA 4TXCA 5IQHA 3BHTA 3WYYA 4W4XA 3OROA 1SZMA 3OOGA 3QUDA 2BUJA 3LW0A 3CIKA 4WUAA 4YJSA 4LYNA 4TYJA 3UNJA 4AXEA 1OKVA 4FV8A 5LXMA 4JR3A 2BKKA 4D4SA 3R7GA 4Y8DA 1R0PA 4FK3A 5C27A 4AS0A 4BZNA 2P2HA 2CNQA 2OJJA 4GJ3A 4NU1A 3GENA 4DEDA 1XH5A 4QDEA 2Z02A 5EKNA 5C1QB 1IEPA 4L3JA 4MBLA 5ANJA 4QMXA 5EKOA 1Z57A 2R7BA 2W9ZB 4NZWB 2OO8X 3KULA 3PJ1A 4JBQA 3GC7A 4AA5A 3CPCA 3QA0A 1UA2A 2R3MA 3EJ1A 4U42A 1PMEA 2BRNA 3R1YA 2IZTA 4G3FA 1OITA 4X3FA 3ZUTA 2EVAA 3PLSA 1GNGA 3PWDA 3QHWA 4P2KA 3UOLA 4ANNA 4FA2A 3EZVA 3T3UA 2XB7A 3O51A 4JRVA 5KZIA 1W84A 2Z60A 4E6CA 5A6OA 4O82A 2E9NA 2W99B 2AUHA 3C4ZA 4ZXTA 3NW6A 4GG5A 3HP5A 1Y8GA 5CF4A 3TTIA 3K3IA 1IA9A 1STCE 4C57A 2X1NA 2BAKA 3MVMA 3PIYA 3KVWA 3W2CA 2HWOA 2QODA 1SVHA 4Q5EA 2XYNA 4O0VA 5IUIA 2C3LA 3D15A 4D9TA 3QFVA 2ITVA 3PP0A 4FIIA 5KHXA 2B9FA 4CFUA 2P0CA 3ZZEA 4CFWA 3P79A 4O81A 1W0XC 3R7IA 1VZOA 4X2NA 4QP9A 1T46A 3L9NA 1WVYA 4YPSA 5CEPA 2UVXA 3QRIA 4K77A 4I0SA 4WHZA 2UV2A 3LCOA 2HZ4A 4AZWA 1PY5A 4BJJA 3TIYA 3MDYA 4KD1A