2KULA

Solution structure of human vaccinia related kinase 1(vrk1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
360
structure length
360
Chain Sequence
b'MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase VRK1
publication title Solution structure of human vaccinia related kinase 1(VRK1)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 360
sequence length 360
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2kulA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2kulA01
4O81A 2C3LA 4CT1A 3LLAA 2OICA 5HU9A 4PTCA 4HGLA 3BIZA 1HCKA 4X2FA 3DXPA 2JKKA 3UBDA 5KO1A 4XP0A 4C3FA 2XP2A 1UU3A 2CNQA 3AD6A 3UVRA 3BV2A 4R77A 4AE6A 2X81A 4FSRA 4TWNA 3F5GA 3UP2A 1XBBA 4L3PA 5HX6A 3QCXA 2R3FA 3MW1A 3OTVA 3LPBA 4AAAA 5C26A 4ALUA 4EC8A 1AD5A 3UC3A 3FMNA 3MWUA 4RZVA 4L00A 3KY2A 3PUPA 4FIHA 1JAMA 3W2PA 2LAVA 2Y0AA 4O83A 2J2IB 4YTFA 3DU8A 2PVLA 3WILA 1UV5A 2W0JA 4LYNA 3W2QA 1YXTA 2Y4PA 4KIPA 1E9HA 4ZZMA 1NVQA 4L7FA 3FZRA 3P7AA 3TNQB 2OH4A 4V05A 1WVWA 3JVRA 3QTIA 5BYYA 3T8OA 4A9TA 2E9OA 4RJ5A 4DEIA 4GEOA 3KQ7A 2QKRA 5AUYA 4CNHA 2CGXA 3LMHA 3LIJA 5DVRA 1M2QA 4WBOA 1IRKA 4W4VA 5CAVA 3TI1A 4AGDA 2WTCA 4CCUA 2X2MA 4RGJA 2UVXA 4J53A 3BU3A 4FT7A 4YC6A 3SV0A 2OXXA 3EQBA 1UU7A 2UW5A 4BBFA 2OIBA 4DHFA 4KSPA 4ZS4A 2Y4IB 2UW6A 1R0PA 1U46A 2YHVA 4F9WA 2WOUA 5A3XA 5HZNA 5KMIA 3GCPA 3UZPA 4ZZOA 1GIJA 3CSVA 3MFUA 3PJ3A 3V8SA 4ZSAA 3QRKA 1OPJA 4D2SA 4D4SA 3U4WA 4C0TA 4KKGA 1IA8A 4KIOA 3U6JA 2J5FA 4MF1A 1IG1A 4B9DA 4FK6A 5CY3A 4ITJA 4RJ3A 5HVJA 3PWYA 2J5EA 2XK3A 3MIAA 4D28A 3NCGA 2VTLA 4YC8A 3OF0A 5HESA 2G2FA 4QMVA 4GRBA 2QR8A 2JGZA 2WMSA 4BCIA 4C58A 4Y83A 3CQWA 4GSBA 2PE2A 3G51A 5F95A 3FY0A 2CN5A 5HCYA 3C1XA 2C6KA 3CC6A 4MCVA 2YABA 2ZV7A 5DRDA 4OTFA 5D12A 3WYXA 1OIRA 2XNMA 3VJOA 5DRBA 3A8XA 1JSTA 4FNXA 3FV8A 3KL8A 1Q8ZA 4BIEA 2ITUA 4YTHA 2QG5A 3VF9A 4ASDA 2PUIA 2JD5A 3RWQA 4JBVA 3I5NA 4ANBA 2JBOA 3VBTA 3W10A 4OAVB 3I0OA 5GIOE 3RGFA 4NL0A 3WF6A 2W1FA 1OKYA 3VUMA 4I5HA 2W1EA 4BCNA 3K5VA 3MPAA 4PDSA 5D10A 4XMOA 1XH9A 4YJOA 3ZC6A 5CAQA 1FMKA 4CZUA 2QOFA 3VRZA 4H3PA 3ZRKA 4N6ZA 4JG7A 1VR2A 4K6ZA 4L44A 3BHYA 5CZIA 4A07A 1RJBA 2V22A 3PTGA 2F2UA 3QXOA 1OKWA 4JX3A 3TJDA 1NA7A 3CJGA 4AGUA 5IA1A 4FEUA 3FMDA 3MY1A 4PDOA 4MH7A 4XS2A 4O7ZA 3UDBA 3ZOSA 2BTRA 4C57A 5I9ZA 4D2TA 3U87A 4CLJA 1UWHA 4MEDA 4MYGA 4DTKA 3SX9A 4WUNA 5CEIA 4C38A 4FV8A 4KBKA 4A9SA 3Q5IA 3QUEA 4FSTA 3U51A 3HV5A 3W8LA 4I4FA 4OTHA 4ONAA 3DT1A 4W4XA 2LGCA 3QTSA 3IW4A 1V0BA 5ANIA 2UZEA 4ZTHA 4ARKA 3LFSA 3BEGA 3GCVA 3DCVA 4O82A 4FSUA 3EQIA 1OGUA 5AUWA 3MDYA 4X0MA 2CGUA 2O2UA 2XYUA 5FD2A 3DV3A 5KZIA 3QGWA 2OZAB 3VBQA 4BDEA 1Q99A 1Y6AA 2HZNA 1UU8A 3K5UA 2BRGA 2VTAA 4NTSA 2OJJA 4AGCA 4F0FA 4UMUA 3H0YA 3HA6A 4HYUA 2YM3A 4TXCA 5J9ZA 3D94A 4ACHA 2VWWA 2I0EA 4CRSA 3BHHA 5HE3A 2YERA 2XF0A 5CENA 4D5KA 2ITNA 4RIYB 2VTJA 4CG8A 1K9AA 4LQMA 3BE9A 4FODA 5BVKA 4FTUA 3CPCA 4HZRA 5CVHA 2QONA 4DEHA 3SOCA 2QOQA 3DDQA 2WEVA 3ZSGA 3ACJA 3ORKA 5DBXA 4BDDA 2GFSA 5M44A 2BKZA 3D15A 2BPMA 3FY2A 3JS2A 1ZARA 4GUBA 3SKCA 4D4RA 2C3IB 2I0HA 4H3QA 2RFSA 3D7TA 3VN9A 5AUTA 2J0JA 3QTRA 4EYJA 4RZWA 4XLVA 1V0OA 4WOVA 4Y46A 4D58A 4PDYA 4XBUA 3FI4A 3QQGA 3AC1A 4I94A 3SXFA 2GS2A 1UNHA 5JZJA 2H34A 1DAWA 3CGFA 1J1BA 3H10A 1Q61A 1HCLA 4KRCA 4BGGA 5LMKC 4RJ8A 2G9XA 4ZTMA 4YGAA 1M7QA 2BALA 4L45A 3NR9A 1IR3A 4FV3A 4ACCA 4I24A 3K2LA 4FT9A 4ZEGA 4CGAA 4KAOA 1KOAA 3U9CA 2WMUA 5LVNA 2QD9A 4B99A 3EFLA 3H0ZA 2H96A 1PXNA 2WTKC 4WNOA 3OCGA 3C4ZA 1JNKA 2XRUA 4QOXA 5HICA 5AUZA 2PE1A 3UNJA 4IBMA 3S3IA 3MN3A 4TYGA 4FZAB 3QLFA 2IVUA 2XKDA 4AF3A 4RRVA 1OI9A 3GT8A 4O21A 3Q2JA 3VAPA 3KULB 2JAVA 3RWPA 1BI8A 4JS8A 4R5YA 3TCPA 2VUWA 5BYZA 3F2NA 5JEBA 4EQUA 1LR4A 5C8NA 5KMKA 3I79A 4FOBA 3BYUA 4M12A 5FBNC 4O7TA 4UMRA 3RPSA 5CWZA 4D2VA 5EYDA 2ZDUA 3G9LX 4HCVA 2WAJA 4I92A 2XK8A 4EH4A 3MESA 5CEOA 4YUQA 4PY1A 3SW4A 3R73A 3ZC5A 2JKQA 3L8PA 3O71A 1JKLA 5E92A 4ACDA 2YIYA 4OAUC 3TV4A 3E3BX 3PXQA 4KIKA 2XM8A 3FI8A 5A4EA 3D0EA 3OY1A 4DLIA 4DGGA 5AUUA 4RIXA 3OWJA 4RPVA 4HJOA 3ENMA 2WGJA 2YN8A 3VO3A 3LFAA 4PUZA 2HW6A 1H01A 4GU9A 3TIZA 4IZ5A 1MRYA 1OL7A 3LXNA 1GZNA 4EOPA 4QMOA 2XCHA 1ZMVA 2C6DA 2QODA 3ZBXA 3QD2B 4IMYA 4YNEA 3EN9A 2ETRA 4NFMA 4BDGA 2C5YA 5CAUA 1YI6A 4OW8A 4MD9E 1H8FA 2CMWA 3AC2A 3WF7A 4CTBA 5CXZA 2JFMA 5FTGA 1P2AA 4CFXA 2B9HA 2ETKA 3R8UA 1O6YA 2GNLA 2FUMA 4FT3A 2CLQA 4FL1A 4BIBA 1OBDA 5C4LA 4FNYA 4CQGA 3QXPA 4ACMA 4AU8A 1NVSA 3TWJA 1NT2A 3RCDA 4FX3A 4AX8A 2OXYA 5LCKA 5T3QA 4APCA 1V1KA 1VYZA 3PIXA 3MA3A 5DHJA 1U59A 5HBEA 2WMAA 5BUJA 5JFWA 2BFYA 5K4JA 4YC3A 3F5PA 2O64A 4ZJVA 2OI4X 4AOIA 2QHNA 5IUHA 3WZUA 2HY81 4FEXA 4YTCA 4CG9A 4NJ3A 4RVKA 4E5WA 1YDSE 3WE8A 3NUXA 1OL1A 4K8AA 3G2FA 4W9XA 5CEQA 4RIWA 4XYFA 5HLNA 2BIYA 3DJ7A 3PXRA 3HX4A 5AV1A 3P7CA 3T9IA 3CEKA 4FZ6A 4IVBA 4IB3A 3ET7A 4CFWA 3C4CA 5HEZA 4TT7A 3LFDA 4GT3A 4YZDA 1S9JA 3VS4A 3FEGA 2WTDA 2A0CX 1KOBA 4EZ7A 5HLWA 4BY9E 3OWKA 4FICA 4GJ2A 5DT4A 3W2RA 4QMPA 2YAAA 4EL9A 4FGRA 2IWIA 5AFVA 4DH7A 3Q6WA 4EH6A 4HYHA 1G8SA 4C61A 5FLFA 3N4TA 4FSQA 5K5XA 4DINA 1UKHA 3C7QA 4O0WA 3LQ3A 3A7JA 5DE2A 3B2WA 1CKPA 2BZIB 3LXPA 3BLHA 1M52A 2XBJA 2ITTA 5C03A 2QOOA 4I41A 3KVXA 4R1YA 4BDJA 3DTWA 4JDHA 4L42A 5HD4A 4FL3A 1FVRA 2WO6A 1LP4A 4G2FA 4C4IA 4HW7A 2HXQA 3IKAA 1Y57A 2OG8A 4BDCA 3D5UA 3FAAA 4M67A 1KE8A 1TQPA 1WAKA 2HOGA 1UWJA 3TKIA 2R64A 3DAKA 3HMNA 4GUEA 3R21A 5JSMA 4IVDA 4M13A 4QQTA 3GU6A 1VJYA 3SC1A 3NWWA 1PY5A 3N4UA 2OK1A 2GS7A 2UW3A 5EKOA 5HIDA 3QD3A 3EYGA 3ORPA 3OUNB 2A2AA 2J0IA 4NIFA 4BZDA 2XB7A 1KV1A 3AD5A 4IX4A 4XUFA 2WMTA 3OC1A 3WZJA 4EK6A 4HOKA 2QOIA 3A8WA 3JPVA 2QQ7A 3KEXA 3REPA 4PV0A 3MA6A 4ANOA 4QP3A 3GGFA 2P55A 4JLCA 3HRCA 3H9RA 2ONLC 1Q62A 2WMXA 4OTGA 5CQUA 5L2WA 1Q4LA 1M17A 5HCZA 4DH5A 4X3FC 5EOBA 4A4LA 4BCJA 2ITQA 3Q9XA 2G2IA 4ASXA 3A7HA 3ZSIA 4FTRA 4YJNA 2RFEA 3BV3A 4M66A 4BYJA 2EXCX 4Q9ZA 3RMFA 4BFMA 3V8WA 4O7NA 2F9GA 3EZVA 5DMZA 5M57A 4KRDA 1Q3WA 4JIAA 4QMZA 3LAUA 4AT3A 4AZWA 4GL9A 2IW8A 3GVUA 3HYHA 5IUIA 4O7WA 2CDZA 2CJMA 4IAIA 4AG8A 3NNUA 2HELA 3HAMA 2PY3A 5D41A 5HTBA 4JBQA 4MWHA 3DTCA 4EQCA 1PW2A 1JSVA 2GNIA 3Q96A 5A4LA 5CXHA 3RM6A 4U42A 5ICPA 2QU6A 1JVPP 3QUDA 5J7BA 3Q4TA 3KXGA 4OTDA 4KABA 3AT3A 4TN6A 2UW7A 3JY9A 3CY3A 4P5QA 2G15A 3PXKA 3QRJA 5ETFA 4I23A 1ZY5A 4DT9A 4EOQA 2Y7JA 4O7SA 3HUBA 4PP9A 4U80A 4EHVA 4FKJA 1REKA 2W05A 1JWHA 1W8CA 5IA4A 2VO3A 4O22A 1OB3A 4FZFB 3ROCA 3DLZA 3TV7A 3FL5A 5CNOA 4M0ZA 4MX9A 4O1PA 3CQEA 2JDOA 4RQKA 3CJFA 1BYGA 1GJOA 3P0MA 4QP4A 1J7IA 3EFKA 3D7ZA 2XNNA 4FEVA 5HG7A 3GC7A 3VUHA 4EOLA 5K5NA 2OF4A 3TDVA 2UZDA 5I3OA 5KKRB 4NJDA 4WKQA 4PF4A 2QVSE 3ZU7A 4MBLA 1YDTE 1SVHA 3FMKA 2IO6A 3NYXA 4N57A 4TWCA 3EOCA 5EQYA 3F9NA 4FKOA 3Q9ZA 2R0IA 4PX6A 4M15A 1QCFA 4F65A 2OZAA 2YCFA 4C4EA 4EOIA 4C4GA 3EFJA 3FI2A 3PZHA 4FTLA 2YFXA 4FYOA 3RAHA 2BIKB 2V7OA 4C7TA 5HTIA 5K4IA 3PE2A 2PYWA 1M7NA 3NSZA 2CHLA 3H9FA 3PY0A 1ZYSA 4G3CA 4UBAA 3GCSA 3V3VA 4L67A 3C0HA 2WTVA 3IO7A 4I93A 5ANDA 2VRXA 3GFEA 4IZYA 4OR5A 4RIYA 4XOZA 2XMYA 2QURA 3IOPA 5E91A 2PVKA 4J7BA 3NPCA 3TUDA 2CCHA 1FVVA 2WB8A 4LRJA 3ZLYA 4JI9A 5AP0A 2C69A 3DQWA 3FZ1A 4UZHA 1TKIA 2ERKA 1WBPA 2IW6A 4ANQA 1MP8A 4MNFA 1QPEA 4B7TA 5FXRA 3KN5A 3QWKA 4R7BA 2WMVA 5AV2A 4YJRA 3H9OA 4BC6A 4OBQA 5HX8A 3BYMA 4MD7E 5LARA 4XRJA 3LQ8A 4XV1A 4R7IA 2KTYA 4I20A 3F61A 1WMKA 1UNLA 2PVRA 3ZM4A 2XJ2A 3PPKA 2R3MA 5HBHA 2GHGA 3UQGA 2PMLX 5L2SA 2QO9A 5CLPA 2CGVA 4AZEA 2X4FA 5IQIA 2FSOX 5BMMA 5CYIA 3ROYA 3G6HA 4IFCA 2YDIA 3GC0A 4FG7A 5DG5A 3UIBA 3PP1A 5DEYA 4KUJA 2ZB1A 5KBQA 2ZV9A 3RAWA 2VO0A 4W8EA 5E8UA 2B7AA 4RWKA 3UG1A 4DC2A 4RC2A 1FINA 3GUBA 4PRJA 3A99A 4P4CA 1DI9A 3L9PA 4PL4A 4BF2A 1H1WA 4X2KA 3M42A 2BRHA 4NM7A 4MD8E 1SYKA 3OFMA 4EHEA 4BCOA 3QRTA 4HNFA 4TYJA 5CQWA 5DPVA 3R9DA 4BDAA 4Y5HA 4AA4A 2H6DA 3GU8A 4B6LA 5HIBA 3AXWA 3QTZA 4IM0A 2HZIA 4TKSA 1OECA 3KGAA 3PY1A 5CSXA 4CFNA 4BCGA 4D4VA 3KCKA 3VUTA 3E64A 3MPMA 3RP9A 3K3IA 3OP5A 5FG8A 4BI0A 4EK3A 1JQHA 4IXPA 4F6SA 5KBRA 3QQUA 3SG8A 2IZUA 2Y6MA 4GFMA 4X6RA 3ZEPA 2Y9QA 4BDIA 5I3RA 4GYGA 5HO6A 3QWJA 3QCSA 3OVVA 4EH2A 1H1SA 4P5ZA 3MJ2A 5D11A 2XK4A 4O0TA 2UVZA 5A6OA 4RQVA 3A61A 2B0QA 4UN0C 2WQBA 3UTOA 3D5VA 5DR6A 1H1PA 2FSMX 4J95A 5A4TA 3POOA 1Y8GA 1SNUA 4PMMA 1YRPA 4LL0A 3N4VA 4ZJIA 2F57A 1WCCA 1ZAOA 4GS6A 4MKCA 2EXMA 5FEDA 5IZFA 1WBSA 4C35A 2Z7LA 2C0TA 2X2LA 4G31A 5BVWA 4MXZA 3EFWA 2WMQA 3E7OA 4KIKB 4EYMA 4E6QA 5CNNA 5L4QA 3CE3A 2YDKA 4RIXB 1LEWA 1WZYA 3PPZA 3KXMA 4FZDB 5J1VA 3EN6A 4HNIA 3RPYA 2VTSA 3R00A 2UW9A 5LVMA 4G3GA 4KS7A 2YZLA 1TQIA 3Q9YA 3D83A 4O7YA 4Y73A 5AP3A 3KA0A 4AN2A 3VBYA 2BHHA 4DFXE 3MSSA 1IAJA 4NFNA 3KMWA 2B53A 1SNXA 2WXVA 3NIZA 4E20A 3JUHA 3DKGA 4GFGA 5HNIX 2PZIA 4BI2A 4X2NA 3NAYA 5M4CA 4MAOA 4C62A 2VTRA 2GHMA 4RFZA 4ZLZA 4E4LA 1PXOA 2YA9A 2R5TA 3COHA 3DY7A 2PTKA 2YACA 4FTTA 5FP5A 1QMZA 1R78A 2PE0A 3QC9A 4S32A 4F1MA 4UXLA 3N9XA 2C5NA 2GPHA 2PWLA 3KF7A 4JDIA 5IU2A 4M8TA 4O27B 5HHWA 1OL2A 2WNTA 3FC1X 5CU4A 3QD4A 3O7LB 5KMJA 1GZKA 5CF5A 3NUNA 1YI4A 2OF2A 4BDFA 1OKVA 3RJCA 5A6NA 3W18A 4MQ1A 2YITA 2BRBA 5I9XA 4ACGA 3AMBA 1MRUA 4JQ7A 3EL8A 5E90A 3R8ZA 3TEIA 3FKNA 3M2WA 4FVPA 4M14A 4YHJA 3EN7A 1CKIA 3I6WA 1F5QA 2XNPA 4ALWA 4TNDA 5TKDA 4KKEA 5E8TA 5AP7A 3E93A 4RIWB 3HMOA 1IAHA 4FKQA 4DFNA 2FSTX 5G1XA 3ZUVA 3UJGA 1GZ8A 2CSNA 2OU7A 2JKOA 4LRMA 2Y4IC 4H58A 2GTNA 3FQHA 1Y6BA 4AZSA 5J87A 3L8SA 4IX5A 4QTDA 4CQEA 3CP9A 3R1YA 5M53A 1Y91A 3GC8A 4RSSA 2XEYA 2VWVA 3BELA 4LV8A 5B2KA 1KUTA 5A9UA 3NUYA 4EHGA 2IPXA 4FSMA 4LOPA 4V0GA 2CKPA 4JBPA 4E7WA 1F3MC 1YXUA 4F08A 4RX5A 5DGZA 4Y85A 3CPBA 4FKVA 5K0XA 4D9TA 3E87A 4EK8A 2HIWA 2YIQA 4HVHA 1WFCA 4FSNA 4QMQA 4BDBA 3ODYX 3LM5A 4I4EA 4U3ZA 4PPCA 3PYYA 3LXLA 4OGRA 3OXZA 1EH4A 1NY3A 4C2VA 1ZRZA 3M1SA 4QPSA 3Q3BA 2PHKA 2XKFA 1OITA 2HZ0A 3OW4A 4BZOA 4R78A 3O7LD 3C0GA 2PZRA 2O5KA 2UVYA 3R02A 3IDBA 4HZSA 4L9IA 4MNEA 2XEZA 3FMJA 3VBVA 3QA0A 3DJ5A 3PJ1A 4LOOA 1P5EA 2PVYA 3QX4A 3ZLSA 2B55A 4WG5A 4WHZA 4BI1A 3O51A 1NW1A 4O0UA 2C6MA 3KB7A 4RVMA 4R3PA 5HOAA 2VTPA 4G6LA 3R63A 5HD7A 2ETMA 2WQEA 4I6HA 3RM7A 4BTFA 3BHTA 4DCEA 2CGWA 2JKMA 1XBCA 5FUTA 3C4EA 4JAIA 4F4PA 4U3YA 3VS1A 5AADA 4FE2A 2HY0A 4KD1A 4NIFB 3QD0A 3O96A 1TVOA 4RFMA 5DH3A 3KREA 3R6XA 1BI7A 2JIUA 5E8SA 2GS6A 3QLGA 4RFYA 5CI6A 2OJGA 4FG9A 4HPTE 3R8MA 5HQ0A 5JKGA 4NZWB 4FTAA 4KIQA 5J5SA 2G01A 4M69B 3Q4ZA 5EQPA 5B2MA 4V01A 4C34A 3VQHA 1KSWA 3BBWA 4D55A 5A46A 3OXTA 2X7GA 4HGSA 1G5SA 2FGIA 2BKKA 4KS8A 1OIQA 4YMJA 5EOLA 5J8IA 3SHEA 3RPVA 3D5XA 3LFBA 1FGKA 1W84A 2Z7RA 3HDMA 3TIYA 5J79A 3RZBA 3BZ3A 3NVKI 4X7QA 4G3EA 3TZMA 3C4FA 3RINA 4LGHA 4MXYA 5KX8A 3R7IA 5JGAA 4PTGA 2IVTA 3CTQA 3TNIA 2YAKA 3W32A 2XZSA 3PDTA 1OUYA 1TQMA 2QCSA 4LV5A 4F9YA 5JK3A 3PY3A 2H9VA 4D5HA 1FPUA 5BVNA 2VX1A 4C36A 5CANA 4I5CA 2QHMA 3TKHA 1KWPA 4O7RA 5EI6A 4NYEA 3FLWA 3DZOA 4MWIA 4QD6A 5K9IA 3RBWA 3QYWA 4ANSA 2HENA 5LMBA 2O63A 3MVLA 3PG3A 2BR1A 5JFXA 5EHLA 3EH9A 2OSCA 2BDFA 5BYLA 1H08A 3R9NA 1OKZA 3IGGA 4Y8DA 5HO8A 3PRIA 4AE9A 2R0UA 3SQQA 2WOTA 4FKSA 1MQBA 2W1HA 2R3KA 4H3BA 3AC4A 5H3QA 4QP1A 4YBKA 2GNJA 3M11A 3TACA 4B8LA 5K0KA 4DEBA 3CD3A 4II5A 4FKRA 4ZSEA 5AV0A 3ANRA 3I5ZA 4PL3A 3I60A 4F09A 3BBTB 3BHUA 1QL6A 3IGOA 3ULZA 4P2KA 3LMIA 3NIEA 3CBLA 3LFCA 1YOLA 4IDTA 3HMMA 3KCFA 4UZDA 4C3PA 3NYVA 2F7EE 4GH2A 2XUUA 2P4IA 3DQXA 3NYOA 1WBWA 4YLLA 4DG3E 3EKNA 2X6EA 4O0YA 3U4UA 3GB2A 5IQDA 3DNEA 4PMTA 5L8JA 1BL7A 3PG1A 2YJSA 5M4UA 4CT2A 3IONA 4USFA 4HVSA 4YBJA 3VS5A 2PVJA 1URCA 3C4XA 3DBEA 4C59A 3BWFA 5CZHA 2B1PA 1YWVA 5EH0A 2YLFA 4AFJA 2CKEA 2OH0E 4FV2A 5H8GA 3UGCA 5FQDC 3P9JA 4KBCA 4RJ4A 2B54A 2VTOA 3KRJA 1JBPE 4WNMA 1FQ1B 4KINA 3BYSA 1IASA 4QQJA 5HIEA 3R0TA 3CTHA 1GIIA 2ERZE 4N70A 2VTHA 2WU7A 4YJTA 4ZSLA 3RAKA 3G15A 1UVRA 2EU9A 1BMKA 3VC4A 3VRYA 4C8BA 5E8XA 4G17A 1PMUA 2JBPA 3HLLA 3GOKA 4DITA 3TV6A 3PJ8A 4FTNA 5IA5A 1ZWSA 2A19B 4FTQA 1X8BA 4QQCA 2GHLA 4FT5A 3GBZA 4HYIA 4M97A 3RK9A 3RVGA 3ZRMA 4XG9A 4PPAA 3RZFA 4GKHA 2V55A 2J7TA 4Z9LA 2C5VA 3NX8A 4QP7A 5AP1A 4XBRA 5AR7A 2HCKA 1XJDA 4C37A 5LMAA 4Q9SA 4D0XA 3OD6X 2WQOA 4D1ZA 3FMMA 4EEVA 5IEYA 4LMUA 3LMGA 2WMWA 4YZNA 4QYGA 5HO7A 5IDNA 2W4JA 4AOJA 2AC3A 4FNZA 5FEQA 4ZXTA 2VNYA 5BMSA 3MFTA 2YM5A 4TYHB 4YZBA 5E8YA 4JDKA 2HZ4A 3E92A 4BKYA 5AIRA 3HV7A 5L6OA 4QMTA 2XK7A 3COKA 3FMEA 3ZZWA 1Q24A 3WF8A 3ORNA 4L3JA 4APPA 1OL5A 2BAQA 3BKBA 3R8VA 3V5PA 2JLDA 5GZ8A 4FTOA 3NNWA 4ZSJA 3LQ5A 1PKGA 4I5MA 4U43A 5T6KA 5DYJA 3TUCA 4CXAA 5IG1A 3HVCA 3P5KA 3KFAA 3ZO2A 2Z7SA 5ITAA 2W99B 4FNWA 4R7HA 2PSQA 5EYKA 4EOMA 5A4CA 1PXIA 5A4QA 4G3DA 3HEGA 4EOJA 3A7GA 4YO4A 2HAKA 1W7HA 3DOGA 4NH1A 4RWLA 4ZMFA 4WSYA 4ENXA 4Z7GA 4YTIA 1YHWA 3BQRA 4NK9A 3CTJA 1ZXEA 2X8EA 2ESMA 3PFQA 4ITIA 2FO0A 4I22A 1XH8A 3F3UA 1BL6A 2PMNX 4LRKA 4U6RA 1NXKA 2AC5A 3KKVA 4EOSA 3PSDA 3PJ2A 4L43A 5HORA 2EB2A 3C0IA 2YJRA 1R3CA 2BZJA 5KHXA 3R1NA 5IMXA 3QRIA 3PZEA 2PVNA 3QHRA 4IM2A 4IM3A 4WG4A 4IX3A 5CT0A 3VHKA 2V62A 4CFUA 4J71A 1E1VA 3Q53A 3TNHA 4GJ3A 1PKDA 4ZJJA 2O0UA 3ZM9A 4FV9A 4DFLA 3QUPA 5IF1A 5IPJA 3PXYA 5EHYA 3QKKA 4XH6A 1A9UA 1L3RE 4BB4A 4AZTA 2WTJA 1YWRA 4QMWA 2P3GX 4TWOA 3ZDUA 4EWQA 3O8UA 5DT0A 3R7OA 3OBGA 4QP6A 4QTCA 1G8AA 4FUXA 3FL4A 4UMQA 4ERWA 3LOKA 2PUNA 3GFWA 3IQ7A 3Q60A 4PNIA 5B7VA 5AP4A 4H05A 2OW3A 1V0PA 2VWIA 4NKAA 4NKSA 4J1RA 5AUXA 4NT4A 4U7ZA 4XG8A 4BGQA 4DYMA 4J98A 4JRNA 4N6YA 3I7CA 4GVAA 5BVOA 2YIRA 3QCQA 1E1XA 4LUDA 3FZTA 4XEYA 4ALVA 3V5TA 1XR1A 3NW7A 3RHXA 2XNEA 5F94A 3RNIA 5DT3A 2ZM1A 3FLQA 4O7VA 2X7FA 3Q52A 3PLAE 4PPBA 3DA6A 4BKZA 4KBAA 5KMOA 3FI3A 3IECA 3DNDA 3LCOA 5HVYA 4M7IA 3A4PA 3H3CA 3QGYA 2PZYA 3QFVA 2WEIA 3FQEA 1RDQE 3MH3A 3R71A 4HGTA 2I7QA 4HPUE 4B4LA 3ZXZA 1Y8YA 2DYLA 2YZAA 3QRUA 5LQFA 4JQEA 3NMUF 3AC8A 4GT5A 3VS6A 3QU0A 3H4JA 4X21A 2RF9A 3NUPA 3PIZA 3KMUA 4LL5A 5LVLA 3P86A 4Z55A 4UYNA 4XJ0A 5FBOA 2RFNA 3TM0A 5EM8A 1PXJA 4U0IA 4B0GA 4M84A 2XKCA 2X7OA 4FL2A 4QNYA 3GENA 5BPYA 4Y72A 4WG3A 2E9NA 4M0YA 3OUKA 5E7RA 1CM8A 5CEMA 2E9PA 1H1RA 3TNWA 4YJUA 4ERKA 3CS9A 3ZYAA 4DEEA 5CAPA 1GZOA 2WMBA 4L52A 2RIOA 2ZV2A 1XKKA 3CR0A 4FT0A 4S34A 5L2IA 2XK9A 2W4KA 5LCJA 2IVSA 5T68A 2OJIA 2VU3A 3O0GA 4V0GB 1JOWB 3R7YA 4FGBA 2GTMA 4LGDA 3EQPA 3FSKA 4G5PA 2C68A 3LKMA 2XKEA 4CSVA 2XNOA 5D7VA 3WARA 3COMA 1PF8A 5DLSA 5IUGA 2OJFE 2BTSA 2X4ZA 3UPXA 2C6LA 3HV6A 1PHKA 1SZMA 3I4BA 4P7EA 5AP6A 1YW2A 4EK4A 3MVHA 4RWIA 3PVBA 5EYCA 4D2PA 1GOLA 4DG0E 2PMOX 3FBVA 2IN6A 3ZONA 3CQUA 1GAGA 2OWBA 3LW0A 5E1SA 3ZSHA 3COIA 4PWNA 3R7UA 3V5WA 1XWSA 5AAEA 5JH6A 2PPQA 5L2QA 4EKKA 4TWPA 2EWAA 2BCJA 4EHZA 1HOWA 3WF9A 3HMIA 1ATPE 2OBJA 4MNEB 3RHKA 5CEKA 2OO8X 4A7CA 3OROA 1BUHA 1OBGA 4IHPA 4PL5A 2GQSA 4E3CA 3UMXA 3FSFA 4W8DA 1OPLA 2WZJA 3MTFA 4IIRA 1ZZ2A 2E2BA 4FSYA 1APME 2ZB0A 4K1BA 4FIEA 5IKWA 2EXEA 3S1HA 4UWCA 2BMCA 1K3AA 4IB0A 1YVJA 4RMZA 2WELA 4M69A 4ZY6A 1J7LA 4S31A 4F70A 2ITZA 3EN5A 1GNGA 4U8ZA 5CT7A 2QOKA 3EQDA 4G16A 4MQ2A 3ORMA 3PE1A 3FYJX 1Z5MA 3MVMA 4MVFA 5KKRC 4FIGA 4I3ZA 3HRBA 4IE9A 4IFGA 5F4NA 2XS0A 3PSCA 3D14A 4L8MA 1W0XC 4YZ9A 4FZ7A 1A48A 2JFLA 4JQ8A 1H4LA 1O6LA 2C30A 2EB3A 3O2MA 3QQLA 4IANA 3W2OA 3VHEA 3F2AA 5IQEA 3ZZEA 1CKJA 2F7XE 2QOHA 4F6UA 4DCAA 2I6LA 2O3PA 4F7NA 5CALA 5BQ0A 2WU6A 3DKOA 3MB6A 4DH3A 3DFCB 5F20A 4FOCA 4F63A 4FSWA 3OZ6A 4WNPA 4UB7A 5EQEA 5AV4A 3PLSA 4H36A 5GJFA 4PMSA 5DWRA 4CV9A 1A06A 1YQJA 5G6VA 4EC9A 3RNYA 4IZ7A 4ZZNA 4AACA 4FV5A 1I44A 2OFUA 4XV2A 4TNBA 2ZYBA 2BAJA 3IW7A 3FZOA 1ZOHA 3GOPA 3EIDA 3IW8A 4O0RA 2C6OA 5B0XA 4FF8A 4QT1A 4WUAA 4BWXA 5HTCA 4DBXA 4IB5A 3UPZA 2QO7A 4XG2A 1PJKA 5E8VA 1UA2A 2C0OA 4CFVA 4CLIA 3P78A 2XNGA 5EDRA 2UW4A 2PU8A 3A2CA 2P0CA 4D9UA 3UQFA 4GIHA 4S30A 3ZMMA 3C5IA 4IC8A 4I0SA 4HVGA 5CU2A 5AM6A 3ZXTA 1H28A 3Q5ZA 4LUEA 3KF4A 2C6IA 4E4NA 3OEFX 5H8BA 1QPCA 3HRFA 3LCSA 5LWMA 3S0OA 3DK3A 2J0LA 2J90A 3E88A 1SMHA 2F7ZE 3V5QA 3DDPA 4A9YA 4XV3A 1OIUA 3UQCA 2X8DA 2CCIA 2YM8A 4KA3A 4FI1A 2VNWA 1XH5A 2CPKE 1KE9A 1WBTA 2X9EA 4G9RA 2J9MA 2IZTA 2VD5A 5EW3A 4FYNA 2Q83A 1JPAA 5M07A 1RQQA 4WA9A 4FKUA 4IAKA 5HNBA 1ZOGA 2OIQA 3I0QA 3ZUUA 3KVWA 2PULA 4CZTA 4U79A 2OIDA 4WIHA 2A1AB 3FQSA 4AW1A 3ACKA 3LE6A 4UWBA 1H26A 2FA2A 1KE7A 4GG7A 2ZJWA 2VZ6A 3QTXA 4YLKA 3ZLXA 1CTPE 4WRGA 3U6HA 3TTIA 4F99A 3EQGA 4IACA 2B4SB 2QU5A 3R28A 4XG7A 3PVUA 3VF8A 3SD0A 4OTWA 4E8AA 4F9CA 5JGBA 3LXKA 3MYGA 2X1NA 1U5RA 1O6KA 3BI6A 3C4WA 3SAYA 4DTBA 3WE4A 1JLUE 2BUJA 2QOBA 1YWNA 5HGIA 3TKUA 4CKIA 4QMYA 3KK9A 3ZCLA 5AA8A 2RFDA 1WBVA 3QTUA 4RX9A 4A06A 4YHFA 1PYEA 3BWJA 1BKXA 5M55A 5M4IA 4H1JA 4KWPA 5EW8A 3E3PA 4JG8A 4BBMA 3UMWA 1SVEA 4ASEA 1OIYA 5BUEA 5AAFA 2Q0NA 3VBWA 2ZVAA 5CASA 3BCEA 1VYWA 4CV8A 3NGAA 3ZLWA 5JQ8A 3BLRA 4NCTA 2ZMCA 4TYHA 3AC3A 2OZOA 5D9HA 4UMPA 5JRQA 4QP9A 2JAMA 4XP3A 3ORLA 2W5HA 4J8NA 5LXMA 5I9YA 5FWKK 3BU6A 2BFXA 4O2ZA 2V7AA 3RK7A 5AA9A 3L9MA 4E1ZA 3AGLA 4O0SA 2A27A 4JDJA 1PXLA 4ZTSA 5DI1A 3Q6UA 4ZTRA 3DKCA 4C3RA 4ZTNA 3TZ8A 2XRWA 2C0IA 4RJ7A 3F5XA 4AN9A 2JDVA 4F7SA 5JMSA 5HG9A 4FIFA 2UV2A 5J95A 4WT6A 4HCUA 1PXKA 2YCSA 3LZBA 3MFSA 2YM4A 4TRLA 5FEEA 2R3HA 4DG2E 2UZTA 3AMYA 1M14A 3ODZX 4RJ6A 4TL0A 3HV4A 2FVDA 2JITA 4JJRA 3WIGA 4LG4A 4X6QC 4EONA 3AG9A 5A54A 4N0SA 4EKLA 5ETAA 5AR4A 1H0VA 2XK6A 4U9AA 5E4HA 2NRUA 4QTBA 1STCE 1ZOEA 1T46A 5CI7A 1Q41A 3EKKA 4GYIA 4ANMA 2ZDTA 2BHEA 2I0YA 2XNBA 4GCJA 4GK2A 1ZYCA 4U81A 1O9UA 5C4KA 4UY9A 3ETAA 4Z3VA 5IDPA 4DE4A 3FXXA 4IAFA 4LOQA 2R3NA 2Z2WA 4K77A 3W2SA 1KE6A 4J99A 2UUEA 3CGOA 5I5ZA 3E62A 3A62A 1YXXA 2ZAZA 2BRMA 4BHNA 4R8QA 4D1XA 2BDWA 4F9BA 3ZHPC 3FUPA 3TT0A 3ALOA 5TT7A 2QOLA 3EWHA 4RLKA 4DFYA 3PP0A 5IA0A 4G6NA 4J97A 4EZ5A 2WTIA 3ERKA 3HV3A 4BN1A 5DFPA 2J6MA 3GQIA 3V51A 2XIXA 5AV3A 3DBDA 4FTCA 1Q5KA 4EBWA 2V5QA 3R2BA 1G3NA 5KNJA 3U9NA 4DFUA 2VX3A 2CLXA 2OFVA 2VWZA 3QQJA 5H8EA 4NSTA 3MPTA 2R3JA 5J1WA 3KXNA 2Q0BA 3ZO3A 4O1OA 4AQCA 5CAOA 3VW8A 4E93A 4BDKA 4F1TA 2WTWA 4LI5A 3HGKA 4YJVA 3IG7A 4OTPA 2XIZA 3HDNA 3WOWA 3CKWA 4E5BA 1LPUA 3PRFA 1QPDA 2AUHA 3W1FA 4F64A 4CKRA 2GFCA 1YOMA 3UO4A 4WBBB 4QRCA 4CTCA 3PXFA 5CSVA 3WYYA 4FVRA 5LJJA 2C5XA 4ZS0A 3C51A 3NW6A 3DAEA 2VWUA 5EM5A 3BX5A 3MH2A 3R8PA 5K3YA 1Z57A 3R7VA 3MFRA 1FVTA 3F3ZA 5CU0A 4K9YA 3F6XA 3DLSA 2CNUA 4IJPA 4EWHA 4WRSA 3LFEA 2W1GA 4FUYA 1H00A 1KE5A 3UNZA 4C4JA 1U5QA 2DQ7X 4GV1A 4I6BA 2NO3A 1XHAA 2KULA 3ORTA 3DBQA 5GHVA 2VWXA 4CMUA 4BCQA 4AW2A 5F9EA 4E5AX 3IW6A 2VTIA 4FBXA 5HI2A 1OPKA 2DUVA 3BE2A 3S4QA 4OTIA 4GIIA 4USDA 2YCRA 4DT8A 3A4OX 3IW5A 3BQCA 2QOCA 2PZPA 3F3TA 4K0YA 1XO2B 3C9WA 5KE0A 1Q8YA 3AC5A 3LFFA 3LJ0A 3VUGA 4FA2A 2SRCA 3QCYA 3PVWA 3CLYA 3ORIA 3ANQA 4O6EA 5FGKA 2CKOA 5M09A 3AD4A 2C1AA 3KXZA 1JKKA 1AQ1A 4X2GA 3GEQA 3HUCA 4OBOA 2F4JA 2W1ZA 3Q4CA 4DFZE 4GK4A 1WVYA 2Z8CA 2XIKA 1CSNA 3F88A 3UVQA 3S2PA 2W9FB 4XG4A 5TE0A 4K11A 2UW8A 3UIMA 2ZOQA 5EM7A 4CMOA 3FLZA 5FRIA 3LM0A 3GU7A 4I5PA 5LVOA 2ZM4A 5EHOA 2W96B 4UWYA 4IAYA 3JVSA 1PXPA 4UXQA 5F1ZA 3ZBFA 2P2HA 3OHTA 3P1AA 1REJA 4JR3A 4QPAA 2R3LA 3PVGA 4QPMA 4QYEA 4HCTA 4QMMA 4UALA 3TDWA 4IEBA 4S33A 2XJ0A 3ENHA 4JOAA 4FKPA 4FKLA 4NTTA 3NW5A 5HLPA 3RAIA 1W82A 3RCJA 2QC6A 2VAGA 4YPDA 2WMRA 4I0RA 4YZMA 3NUSA 3VUIA 4E4MA 3DK7A 4AXAA 4EOOA 4BCKA 4PMPA 4NW6A 4JL9A 5JZNA 5HE0A 4FR4A 3U8WA 3QF9A 3WIKA 3E8CA 5AAGA 5CEPA 2XM9A 1ZMUA 3L1SA 3S00A 1J3HA 4FTJA 2R3IA 5CSHA 4NW5A 3KXXA 4P90A 4AWIA 4QTEA 3Q4UA 2CNVA 3JXWA 3P23A 5C8MA 4GW8A 5C1QB 3DB6A 1BX6A 3MB7A 5TOZA 4LFIA 2IJMA 5ANOA 2J4ZA 3MS9A 3L8VA 3O8PA 5CX9A 5GZAA 3FMHA 5DIAA 3QZFA 2W5AA 4DH1A 1R39A 3LVPA 4CKJA 4BRXA 4R1VA 2ACXA 2JC6A 3MGYA 2RSVA 4G34A 1URWA 2IVVA 4C4FA 4U97A 3ZS5A 4AA5A 3NYNA 2O65A 2DWBA 2W06A 3KK8A 2WHBA 4Z7HA 2HK5A 3FWQA 2JDSA 2WFYA 3KRLA 3KRWA 4AOTA 1IEPA 2VGPA 3MH0A 3PPJA 4YHTA 5DR2A 4CRLA 2VV9A 4I6QA 3VW6A 4BTKA 4ZLOA 4X3JA 3BHVA 5HCXA 3U6IA 2F2CB 2ITXA 2VTMA 3T9TA 5IISA 3V01A 4NM5A 4EZ3A 1WVXA 3PWDA 3WZDA 5BX0A 4BCFA 2FB8A 4QP2A 2WKMA 3LFNA 4BR3A 1OMWA 5CSPA 1CDKA 3IDPA 2ITOA 4HVDA 3CCNA 2X9FA 5ANJA 3UOKA 3ZH8A 4O6LA 1YHVA 4R3CA 3UO5A 3SXSA 5HG5A 5ANGA 2BILB 3HMPA 3L8XA 4IZAA 3II5A 4BCPA 4DTAA 5AUVA 4IDVA 3EHAA 3KXHA 4EK5A 3D9VA 4G6OA 3ZO1A 1RW8A 2ONLA 2WQMA 4MXCA 4RG0A 5AP2A 3R8LA 3UZRA 3QZHA 3TG1A 4IH8A 4F0IA 3UIUA 4E4XA 4X3FA 3VQUA 4FVQA 2WD1A 3O8TA 4N4SA 4W9WA 4YPSA 3RPOA 3SLSA 4FIIA 1B38A 3AQVA 4ZP5A 4I21A 5M4FA 5CF8A 3U55A 3EJ1A 4KKHA 4IVCA 4NCTC 4B8MA 3Q2MA 4DGLC 3O50A 5IQGA 5FP6A 4QP8A 5IQFA 3MY5A 3W8QA 3FLYA 2JIIA 4BDHA 4MXAA 3GI3A 4GG5A 5ANKA 2VGOA 2VN9A 4I6FA 3MH1A 3UYSA 3VS2A 2UZVA 3VIDA 4ZLYA 1F0QA 2C5OA 2BZKB 3ELJA 4FV0A 5DEWA 4D0WA 4HYSA 4TZRA 4XLIA 1KV2A 5IMEA 1YXVA 4JR7A 3BU5A 5FXQA 4C33A 3QX2A 5AEPA 5DR9A 5EI2A 2VWBA 4DEAA 4ANLA 5D1JA 1Q3DA 5FTQA 3V8TA 5AMNA 4F6WA 3DFAA 4BCHA 3SOAA 4C2WA 2GU8A 3FXWA 3VUKA 3HA8A 4BZNA 3FJQE 3ATSA 3N51A 3F3VA 5LOHA 3PJCA 4AZVA 1XBAA 4QMSA 4XRLA 4Q5HA 5L8KA 5IQBA 4FC0A 3QKMA 2EVAA 5C9CA 3F7WA 4ANNA 5TF9A 1P4OA 3SW7A 3PSBA 3POZA 4AS0A 5JFSA 3VNTA 2QO2A 2B9JA 4WNKA 3T3UA 3TL8A 3W2CA 2W1CA 4L68A 3ITZA 4ZAUA 3ZTXA 4UMTA 3RI1A 2OGVA 4DLJA 5AR5A 3EB0A 5EDQA 3DS6A 4LGGA 3DGKA 5JFVA 1JKTA 1PMEA 3CD8A 4F0GA 3OWPA 3NS9A 4FTMA 3E8NA 3MJ1A 4Z16A 3R1QA 5E8WA 4J96A 3TZ7A 4DGMA 5KMLA 3IOKA 3JYAA 3MV5A 2YIWA 5DN3A 3I1AA 4MF0A 3CXWA 5E9EA 4DEGA 2IG7A 2EUFB 2QNJA 3UP7A 2W9ZB 2GNFA 3OCSA 3R7GA 3E7VA 4C02A 2ZMDA 3BGZA 2G1TA 4UYAA 2XYNA 4W4YA 3GXLA 2RG5A 3Q9WA 1YXSA 3QTWA 3GCQA 3FPMA 3SGCA 1K2PA 2RGPA 3PA3A 3MY0A 4QQ5A 3V5LA 3UNKA 3R04A 3A7IA 5CF4A 3R9RA 4XV9A 2ZM3A 1PRYA 5ETCA 4MXXA 4EJNA 2JDTA 3OXIA 2IZSA 5HVKA 3BYOA 4DH8A 3DKFA 3DZQA 2J50A 3FLSA 3FHRA 4S2ZA 4YJQA 2W1DA 2FH9A 1U54B 4IVAA 2ITVA 3UE4A 1XQZA 3PIYA 5LWNA 4RVLA 5GIPE 4O38A 2W17A 3QALE 2A4LA 4MTAA 3CIKA 3L9NA 2FYSA 3LJ1A 2J0KA 2I40A 5IQHA 5AIKA 2B52A 2VO6A 5GZ9A 5JT2A 4O91A 3GU5A 2PZ5A 3QL8A 4KB8A 5KMNA 3AOXA 2Z60A 4BTMA 3EYHA 5M51A 3G9NA 3NRMA 4YJPA 2UW0A 3LCKA 3OT3A 4G5JA 2UZWE 5GINE 1B6CB 4FKGA 4JRVA 3I81A 4RT7A 2VWYA 1MUOA 2XIRA 4ZOGA 3F82A 4QMNA 5IQAA 2B9FA 1VZOA 1UKIA 3LHJA 4ZTQA 3H30A 4EH9A 3EMGA 3LJ2A 4QMLA 3R9HA 5M06A 2REIA 3R2YA 5FM3A 3QHWA 1PMNA 4I1ZA 4IQ6A 1J91A 2GNHA 4IWPA 4QMXA 3NVMB 1OM1A 3TTJA 5L2TA 3V04A 2R4BA 2CKQA 2X0GA 3IS5A 3G90X 4AW5A 2PUPA 3DPKA 5A14A 4J52A 5J9LA 3QKLA 2WTKB 5AWMA 4BICA 3QBNA 3F2RA 4XHKB 4QO9A 1M2PA 2W4OA 2XBAA 2PMIA 3F3WA 2HWPA 4FTIA 5CU6A 4DN5A 5HE1A 5L3AA 3RALA 4EH5A 1M2RA 5TR6A 3HP2A 2UZUE 4EORA 3GU4A 5HKMA 2I0VA 3E8EA 3EN4A 3JY0A 3MIYA 4PNKA 3DK6A 4OLIA 2UZOA 5DNRA 4ORKA 3P7BA 4EOKA 3G6GA 3F5UA 4Y95A 3AT2A 4MHAA 2XH5A 5H9BA 4R3RA 3NCZA 3UYTA 5EI8A 3AT4A 3QZIA 2GNGA 4IADA 3G33A 4GMYA 2YLEA 5ACBC 3THBA 4ENYA 3SRVA 5ETIA 3EQRA 4X2JA 1VEBA 4GFOA 3DB8A 5GNKA 4BBEA 2BRNA 4E73A 4ASZA 1XH7A 3QQKA 2FSLX 3ORZA 3QC4A 4EUTA 3TUBA 5EYMA 5C8KA 5GJGA 5HG8A 5DOSA 5BVEA 5C27A 1CMKE 1YHSA 2OJ9A 3R30A 4HGEA 2HW7A 5CS6A 4ZSGA 5EK7A 4BTJA 4E6DA 4AUAA 5J5TA 3HECA 2I1MA 2PVFA 2E9UA 3A60A 1T45A 3RKBA 4YU2A 4DF3A 2R9SA 2R2PA 2ZV8A 3DJ6A 4HVIA 5AR3A 3NNVA 5AR2A 3HAVA 1R1WA 4O0XA 3DXNA 5TO8A 5E8ZA 2NP8A 3B8QA 4QNAA 3G0FA 3ZEWA 5BVFA 3DXQA 4FK3A 3ZFMA 1H07A 2YIXA 3B2TA 4PTEA 4AT5A 3R22A 5FM2A 1AGWA 3SDJA 4A4OA 3CY2A 4TYEA 2WQNA 3B8RA 2XA4A 4FIJA 5B2LA 1YDRE 3FPQA 1P14A 3G5DA 4FKWA 3VS0A 5J9YA 3VJNA 1SM2A 2QLUA 2YM6A 3KRXA 4U5JA 2AYPA 4F1OA 5IH5A 5AX3A 3WF5A 2W7XA 3NZ0A 4BHZA 5HBJA 1FOTA 3VUDA 3C5UA 1YI3A 2HWOA 2C1BA 4F7LA 2WPAA 3SA0A 4EUUA 4YSJA 2IW9A 4EQMA 5BVDA 2BAKA 2P2IA 2VTQA 3R1SA 4IW0A 4U44A 3UVPA 4F7JA 4JXFA 2C47A 3Q32A 3VWAA 4DGNA 3EQFA 3NUAA 3AMAA 5FXSA 5CU3A 4NM3A 4R5SA 5L8LA 4AGWA 4GVJA 2V0DA 1S9IA 4K2RA 3PXZA 5HU3A 3ORXA 2R7IA 2B9IA 4YR8A 3OWLA 4IWDA 1ZYJA 4BWKA 4YURA 1ND4A 2BVAA 2UZBA 2E9VA 4RWJA 5BUIA 2JIVA 4KSQA 4DGOA 3VS3A 4IX6A 1IA9A 4FV1A 3VS7A 5EM6A 3ZO4A 3UODA 3FLNC 3HL7A 3ID6C 4DFBA 3QAME 1H25A 3E63A 3LLTA 2PUUA 3MVJA 3QYZA 4G9CA 5AX9A 4ZIMA 4A9RA 4JBOA 4RIOA 3LFQA 3GCUA 2HXLA 4XCUA 3TJCA 5IQCA 5FDXA 4CYJA 4ZY5A 3QQHA 2GCDA 4CZYB 3MBLA 2C6TA 1L8TA 3FYKX 4CEGA 3ATTA 1ERKA 3P79A 4JX7A 2NPQA 2Y8OA 3R9OA 1J1CA 1MQ4A 5KCVA 1WBNA 3D4QA 2CN8A 5JGDA 2QI8A 2YCQA 2YDJA 3OS3A 3R7EA 4D4YA 1DAYA 2R3OA 3F66A 1YKRA 4G3FA 4JIKA 2ITWA 1RE8A 1FGIA 3JR1A 5AJQA 5I9UA 4YO6A 3FKOA 2RKUA 4NU1A 1ZYLA 4O0VA 4U40A 4D2RA 3FMLA 4DBNA 3GQLA 4JG6A 2QG7A 2C6EA 2YWVA 4OTQA 4YLJA 3FC2A 3BYVA 3NDMA 4CMTA 3HP5A 3O17A 3UIXA 1H24A 5HNGA 3P08A 4IJ9A 1UNGA 4RBLA 3TNPC 4IAAA 1J7UA 2UZLA 4A9UA 4IB1A 2BZHB 3ZDIA 1LEZA 1DI8A 3OCTA 3RK5A 2WIHA 1P4FA 4XP2A 2R3PA 4L3LA 5KMMA 4CFFA 5JQ5A 3OOMA 4LMNA 5GJDA 5I9WA 3NAXA 4USEA 3OEZA 3HNGA 4BVUA 3L9LA 4NM0A 4OUCA 1PYXA 1H1QA 3I6UA 3UOHA 3CKXA 4E6AA 4DEDA 3SG9A 4MK0A 3UOJA 3W55A 5J7HA 4D2WA 4O86A 4WD5A 5JRSA 3DBFA 4RC4A 3R01A 1DS5A 2R3QA 4QYFA 4X3FB 1GIHA 2VTTA 2Z7QA 2IZRA 3DAJA 5I9VA 3IK3A 2QKWB 4FTKA 4L6QA 2XVDA 3EZRA 5ANEA 2X8IA 4IC7A 5EDPA 4IWQA 4YSMA 3QQFA 3ULIA 2C3KA 3NUUA 2W5BA 3R83A 1NVRA 1GY3A 1Q97A 2HYYA 3G0EA 2BROA 4AT4A 1PMVA 4G1WA 1OUKA 2XCKA 3GC9A 4TTHB 4WSQA 4CD0A 4RX8A 3OCBA 2C3JA 3KMMA 4JVGA 5AM7A 4F9AA 4CYIA 5HE2A 2RL5A 5DA3A 2PVHA 3A7FA 3F7ZA 5EW9A 4AA0A 2NNWB 4RA5A 4GK3A 4E26A 3NNXA 3W33A 1FMOE 2PL0A 2YM7A 3UOLA 1XH6A 2XIYA 3WBLA 4W4WA 4YP8A 4BGHA 5IEVA 4XX9A 4AZFA 3E5AA 3FHIA 4YZCA 5KZ0A 3TZ9A 5CVFA 4A4XA 5I0BA 2VTNA 3V6SA 1JKSA 3LCDA 1JSUA 4M68A 2OXDA 5M56A 5CSWA 5EKNA 4QTAA 5L6PA 3TN8A 5EG3A 1MRVA 4GU6A 4TPTA 2YISA 2GMXA 4RLLA 3V5JA 4D1SA 4EI4A 3SVVA 2XJ1A 2VO7A 2GSFA 2JEDA 1FBNA 1QPJA 4ZMEA 4AFEA 5M08A 5FTOA 4QYHA 4MBIA 4ZK5A 2R3GA 2X2KA 3UO6A 4EH8A 4BCMA 1H27A 4L01A 3E8DA 3BEAA 3IPHA 4LM5A 4FEWA 3D7TB 4ID7A 3UZTA 3K3JA 3DBCA 3IDCA 4O2PA 3ALNA 2C4GA 5E1EA 2G2HA 5BNJA 4AN3A 5JN2A 3OOGA 4O84A 2WIPA 1UU9A 4QMUA 2QR7A 4OBPA 1XH4A 2O8YA 3OTUA 4O96A 3OY3A 4YJSA 3D2KA 1U4DA 2X6DA 3KN6A 4O7LA 4XOYA 1OZ1A 1Q8TA 5CTPA 4CCBA 3EQCA 4PQNA 5IEXA 3QA8A 4PDPA 2W1IA 4PP7A 5I4NA 3NEWA 1YOJA 2GQRA 3MTLA 4EBVA 3VBXA 4DA5A 3C13A 4FKTA 1U54A 3EQHA 2OKRA 3PA4A 4UEUA 3U54A 4J8MA 4Q5EA 4GKIA 2J51A 5IH4A 4CFMA 3GNIB 3KULA 3OBJA 5ACKA 2PVMA 3WZEA 2ITPA 5FDPA 1B39A 4Q2AA 4L7SA 2Y6OA 4GT4A 3OMVA 4FV4A 5KUPA 4NWMA 3FKLA 2BDJA 3K54A 3KU2A 3O23A 4FMQA 1WBOA 1W83A 5L6WL 4EH7A 5EFQA 2OLCA 3FE3A 3Q04A 4FEQA 5IA3A 3VVHA 3W16A 1ZYDA 2VX0A 3OG7A 3BGQA 3EL7A 3MI9A 2QLQA 4XG3A 3VULA 3SXRA 1ZLTA 3FDNA 3HZTA 4QYYA 1R0EA 4MXOA 3D2IA 3BRBA 3UC4A 5KHWA 3FXZA 5LMKA 1H0WA 4JNWA 4RA4A 5LVPA 4FKIA 4JAJA 5CF6A 4BYIA 3D5WA 3C50A 4BWPA 1SVGA 4C4HA 4I0TA 2UZNA 2R3RA 4IWOA 4U41A 4UX9A 2P33A 4XG6A 3WZKA 2X39A 3PA5A 3BLQA 3KRRA 2GDOA 3WI6A 1PXMA 2PK9A 3BGPA 4AW0A 4YNOA 3UG2A 2Z02A 5D7AA 2RG6A 1Z9XA 3KC3A 3ZFXA 1LUFA 2JDRA 2YEXA 4NUSA 4CVAA 5IH6A 3T3VA 4H1MA 2H8HA 3I7BA 3BPRA 4IAZA 4EH3A 3NLBA 3TXOA 2J0MB 1I09A 1OVEA 4RVTA 4K18A 3QZGA 4TW9A 3ZFYA 4TY1A 5H2UA 3FZPA 4FSZA 1ZY4A 4K33A 3ZUTA 4EJ7A 3QTQA 4L53A 5CVGA 4MBJA 2F49A 2GQGA 4TYIA 4NEUA 4UV0A 1BLXA 4JT3A 2YWPA 5C01A 1ZMWA 4FV7A 4AP7A 4BL1A 4RX7A 3P4KA 3FZSA 4ZY4A 1OL6A 4XNEA 3RPRA 3F69A 4RC3A 4BKJA 4ITHA 3OW3A 3AGMA 4U45A 4DAWA 4M3QA 5AR8A 4WO5A 4R6VA 3GP0A 3ZRLA 4E6CA 4FV6A 4KNBA 3S95A 3SRVB 4FG8A 2ITYA 3LCTA 3OT8A 1ZZLA 3RTPA 3V6RA 1W98A 3HKOA 4V04A 5AP5A 2NRYA 4H39A 4Y5QA 4OT6A 2R7BA 4L46A 5IA2A 2DS1A 4OTRA 4OT5A 1Q8UA 4ZTLA 1DM2A 4BIDA 1Q8WA
chains in the Genus database with same CATH superfamily
4O81A 2C3LA 4CT1A 3LLAA 2OICA 5HU9A 4PTCA 4HGLA 3BIZA 1HCKA 4X2FA 3DXPA 3PFYA 2JKKA 3UBDA 5KO1A 4XP0A 4C3FA 2XP2A 1UU3A 2CNQA 3AD6A 3UVRA 3BV2A 4R77A 4AE6A 2X81A 4FSRA 4TWNA 3F5GA 3UP2A 1XBBA 4L3PA 5HX6A 3QCXA 2R3FA 3MW1A 3OTVA 3LPBA 4AAAA 5C26A 4ALUA 4EC8A 1AD5A 3O5AA 3UC3A 3FMNA 3MWUA 4RZVA 4L00A 3KY2A 3PUPA 4FIHA 1JAMA 3W2PA 2LAVA 2Y0AA 4O83A 2J2IB 4YTFA 3DU8A 2PVLA 3WILA 1UV5A 2W0JA 4LYNA 3W2QA 1YXTA 2Y4PA 4KIPA 1E9HA 2X0QA 4ZZMA 1NVQA 4L7FA 3FZRA 3P7AA 3TNQB 2OH4A 4V05A 1WVWA 3JVRA 3QTIA 5BYYA 3T8OA 4A9TA 2E9OA 4RJ5A 4DEIA 4GEOA 3KQ7A 2QKRA 5AUYA 4CNHA 2CGXA 3LMHA 3LIJA 5DVRA 1M2QA 4WBOA 1IRKA 4W4VA 5CAVA 3TI1A 4AGDA 2WTCA 4CCUA 2X2MA 4RGJA 2UVXA 4J53A 3BU3A 4FT7A 4YC6A 3SV0A 2OXXA 3EQBA 1UU7A 2UW5A 4BBFA 2OIBA 4DHFA 4KSPA 4ZS4A 2Y4IB 2UW6A 1R0PA 1U46A 2YHVA 4F9WA 2WOUA 5A3XA 5HZNA 5KMIA 3GCPA 3UZPA 4ZZOA 1GIJA 1G8KA 3MFUA 3PJ3A 3CSVA 3V8SA 4ZSAA 3QRKA 1OPJA 4D2SA 4D4SA 3U4WA 4C0TA 4KKGA 1IA8A 4KIOA 3U6JA 2J5FA 4MF1A 1IG1A 4B9DA 4FK6A 5CY3A 4ITJA 4RJ3A 5HVJA 3PWYA 2J5EA 2XK3A 3MIAA 4D28A 3NCGA 2VTLA 4YC8A 3OF0A 5HESA 2G2FA 4QMVA 4GRBA 2QR8A 2JGZA 2WMSA 4BCIA 4C58A 4Y83A 3CQWA 4GSBA 2PE2A 3G51A 5F95A 3FY0A 2CN5A 5HCYA 3C1XA 2C6KA 3CC6A 4MCVA 2YABA 2ZV7A 5DRDA 4OTFA 5D12A 3WYXA 1OIRA 2XNMA 3VJOA 5DRBA 3A8XA 1JSTA 4FNXA 3FV8A 3KL8A 1Q8ZA 4BIEA 2ITUA 4YTHA 2QG5A 3VF9A 4ASDA 2PUIA 2JD5A 3RWQA 4JBVA 3I5NA 4ANBA 2JBOA 3VBTA 3W10A 4OAVB 3I0OA 5GIOE 3RGFA 4NL0A 3WF6A 2W1FA 1OKYA 3VUMA 4I5HA 2W1EA 4BCNA 3K5VA 3MPAA 4PDSA 5D10A 4XMOA 1XH9A 4YJOA 3ZC6A 5CAQA 1FMKA 4CZUA 2QOFA 3VRZA 4H3PA 3ZRKA 4N6ZA 4JG7A 1VR2A 4K6ZA 4L44A 3BHYA 5CZIA 4A07A 1RJBA 2V22A 3PTGA 2F2UA 3QXOA 1OKWA 4JX3A 3TJDA 1NA7A 3CJGA 4AGUA 5IA1A 4FEUA 3FMDA 3MY1A 4PDOA 4MH7A 4XS2A 4O7ZA 3UDBA 3ZOSA 2BTRA 4C57A 5I9ZA 3W0QA 4D2TA 3U87A 4CLJA 1UWHA 4MEDA 4MYGA 4DTKA 3SX9A 4O4EA 4WUNA 5CEIA 4C38A 4FV8A 4KBKA 4A9SA 3Q5IA 3QUEA 4FSTA 3U51A 3HV5A 3W8LA 4I4FA 4OTHA 4ONAA 3DT1A 4W4XA 2LGCA 3QTSA 3IW4A 1V0BA 5ANIA 2UZEA 4ZTHA 4ARKA 3LFSA 3BEGA 3GCVA 3DCVA 4O82A 4FSUA 3EQIA 1OGUA 5AUWA 3MDYA 4X0MA 2CGUA 2O2UA 2XYUA 5FD2A 3DV3A 5KZIA 3QGWA 2OZAB 3VBQA 4BDEA 1Q99A 1Y6AA 2HZNA 1UU8A 3K5UA 2BRGA 2VTAA 4NTSA 2OJJA 4AGCA 4F0FA 4UMUA 3H0YA 3HA6A 4HYUA 2YM3A 4TXCA 5J9ZA 3D94A 4ACHA 2VWWA 2I0EA 4CRSA 3BHHA 5HE3A 2YERA 2XF0A 4BJJA 5CENA 4D5KA 2ITNA 4RIYB 2VTJA 4CG8A 1K9AA 4LQMA 3BE9A 4FODA 5BVKA 4FTUA 3CPCA 4HZRA 5CVHA 2QONA 4DEHA 3SOCA 2QOQA 3DDQA 2WEVA 3ZSGA 3ACJA 3ORKA 5DBXA 4BDDA 2GFSA 5M44A 2BKZA 3D15A 2BPMA 3FY2A 3JS2A 3AKLA 1ZARA 4GUBA 3SKCA 4D4RA 2C3IB 2I0HA 4H3QA 2RFSA 3D7TA 3VN9A 5AUTA 2J0JA 3QTRA 4EYJA 4RZWA 4XLVA 1V0OA 4WOVA 4Y46A 4D58A 4PDYA 3VONA 4XBUA 3FI4A 3QQGA 3AC1A 4I94A 3SXFA 2GS2A 1UNHA 5JZJA 2H34A 1DAWA 3CGFA 1J1BA 3H10A 1Q61A 1HCLA 4KRCA 4BGGA 5LMKC 4RJ8A 2G9XA 4ZTMA 4YGAA 1M7QA 2BALA 4L45A 3NR9A 1IR3A 4FV3A 4ACCA 4I24A 3K2LA 4FT9A 4ZEGA 4CGAA 4KAOA 1KOAA 3U9CA 2WMUA 5LVNA 2QD9A 4B99A 3EFLA 3H0ZA 2H96A 1PXNA 2WTKC 4WNOA 3OCGA 3C4ZA 1JNKA 2XRUA 4QOXA 5HICA 5AUZA 2PE1A 3UNJA 4IBMA 3S3IA 3MN3A 4TYGA 4FZAB 3QLFA 2IVUA 2XKDA 4AF3A 4RRVA 1OI9A 3GT8A 4O21A 3Q2JA 3VAPA 3KULB 2JAVA 3RWPA 1BI8A 4JS8A 4R5YA 3TCPA 2VUWA 5BYZA 3F2NA 5JEBA 4EQUA 1LR4A 5C8NA 5KMKA 3I79A 4FOBA 3BYUA 4M12A 5FBNC 1ST4A 4O7TA 4UMRA 3RPSA 5CWZA 4D2VA 5EYDA 2ZDUA 3G9LX 4HCVA 2WAJA 4I92A 2XK8A 4EH4A 3MESA 5CEOA 3BL9A 4YUQA 4PY1A 3SW4A 3R73A 3ZC5A 2JKQA 3L8PA 3O71A 1JKLA 5E92A 4ACDA 2YIYA 4OAUC 3TV4A 3E3BX 3PXQA 4KIKA 2XM8A 3FI8A 5A4EA 3D0EA 3OY1A 4DLIA 4DGGA 5AUUA 4RIXA 3OWJA 4RPVA 4HJOA 3ENMA 2WGJA 2YN8A 3VO3A 3LFAA 4PUZA 2HW6A 1H01A 4GU9A 3TIZA 4IZ5A 1MRYA 1OL7A 3LXNA 1GZNA 1ST0A 4EOPA 4QMOA 2XCHA 1ZMVA 2C6DA 2QODA 3ZBXA 3QD2B 4IMYA 4YNEA 3EN9A 2ETRA 4NFMA 4BDGA 2C5YA 5CAUA 1YI6A 4OW8A 4MD9E 1H8FA 2CMWA 3AC2A 3WF7A 4CTBA 5CXZA 2JFMA 5FTGA 1P2AA 4CFXA 2B9HA 2ETKA 3R8UA 1O6YA 2GNLA 2FUMA 4FT3A 2CLQA 4FL1A 4BIBA 1OBDA 5C4LA 4FNYA 4CQGA 3QXPA 4ACMA 4AU8A 2XAMA 1NVSA 3TWJA 1NT2A 3RCDA 4FX3A 4AX8A 2OXYA 5LCKA 5T3QA 4APCA 1V1KA 1VYZA 3PIXA 3MA3A 5DHJA 1U59A 5HBEA 2WMAA 5BUJA 5JFWA 2BFYA 5K4JA 4YC3A 3F5PA 2O64A 4ZJVA 2OI4X 4AOIA 2QHNA 5IUHA 3WZUA 2HY81 4FEXA 4YTCA 4CG9A 4NJ3A 4RVKA 4E5WA 1YDSE 3WE8A 3NUXA 1OL1A 4K8AA 3G2FA 4O4FA 4W9XA 4RIWA 5CEQA 4XYFA 5HLNA 2BIYA 3DJ7A 3PXRA 3HX4A 5AV1A 3P7CA 3T9IA 3CEKA 4FZ6A 4IVBA 4IB3A 3ET7A 4O4DA 4CFWA 3C4CA 5HEZA 4TT7A 3LFDA 4GT3A 4YZDA 1S9JA 3VS4A 3FEGA 2WTDA 2A0CX 1KOBA 4EZ7A 5HLWA 4BY9E 3OWKA 4FICA 4GJ2A 5DT4A 3W2RA 4QMPA 2YAAA 4EL9A 4FGRA 2IWIA 5AFVA 4DH7A 3Q6WA 4EH6A 4HYHA 1G8SA 4C61A 5FLFA 3N4TA 4FSQA 5K5XA 4JMQA 4DINA 1UKHA 3C7QA 4O0WA 3LQ3A 3A7JA 5DE2A 3B2WA 1CKPA 2BZIB 3LXPA 3BLHA 1M52A 2XBJA 2ITTA 5C03A 2QOOA 4I41A 3KVXA 4R1YA 4BDJA 3DTWA 4JDHA 4L42A 5HD4A 4FL3A 1FVRA 2WO6A 1LP4A 4G2FA 4C4IA 4HW7A 2HXQA 3IKAA 1Y57A 2OG8A 4BDCA 3D5UA 3FAAA 4M67A 1KE8A 1TQPA 1WAKA 2HOGA 1UWJA 3TKIA 2R64A 3DAKA 3HMNA 4GUEA 3R21A 5JSMA 2XARA 4IVDA 4M13A 4QQTA 3GU6A 1VJYA 3SC1A 3W0SA 3NWWA 1PY5A 3N4UA 2OK1A 2GS7A 2UW3A 5EKOA 5HIDA 3QD3A 3EYGA 3ORPA 3OUNB 2A2AA 2J0IA 4NIFA 4BZDA 2XB7A 1KV1A 3AD5A 4IX4A 4XUFA 2WMTA 3OC1A 3WZJA 4EK6A 4HOKA 2QOIA 3A8WA 3JPVA 2QQ7A 3KEXA 3REPA 4PV0A 3MA6A 4ANOA 4QP3A 3GGFA 2P55A 4JLCA 3HRCA 3H9RA 2ONLC 1Q62A 2WMXA 4OTGA 5CQUA 5L2WA 1Q4LA 1M17A 5HCZA 4DH5A 4X3FC 5EOBA 4A4LA 4BCJA 2ITQA 3Q9XA 2G2IA 4ASXA 3A7HA 3ZSIA 4FTRA 4YJNA 2RFEA 1XMMA 3BV3A 4M66A 4BYJA 2EXCX 4Q9ZA 3RMFA 4BFMA 3V8WA 4O7NA 2F9GA 3EZVA 5DMZA 5M57A 4KRDA 1Q3WA 4JIAA 4QMZA 3LAUA 4AT3A 4AZWA 4GL9A 2IW8A 3GVUA 3HYHA 5IUIA 4O7WA 2CDZA 2CJMA 4IAIA 4AG8A 3NNUA 2HELA 3HAMA 2PY3A 5D41A 5HTBA 4JBQA 4MWHA 3DTCA 4EQCA 1PW2A 1JSVA 2GNIA 3Q96A 5A4LA 5CXHA 3RM6A 4U42A 5ICPA 2QU6A 1JVPP 3QUDA 5J7BA 4I6LA 3Q4TA 3KXGA 4OTDA 4KABA 3AT3A 4TN6A 4QDVA 2UW7A 3JY9A 3CY3A 4P5QA 2IEWA 2G15A 3PXKA 3QRJA 5ETFA 4I23A 1ZY5A 4DT9A 4EOQA 2Y7JA 4O7SA 3HUBA 4PP9A 4U80A 4EHVA 4FKJA 1REKA 2W05A 1JWHA 1W8CA 5IA4A 2VO3A 4O22A 1OB3A 4FZFB 3ROCA 3DLZA 3TV7A 3FL5A 5CNOA 4M0ZA 4MX9A 4O1PA 3CQEA 2JDOA 4RQKA 3CJFA 1BYGA 1GJOA 3P0MA 4QP4A 1J7IA 3EFKA 3D7ZA 2XNNA 4FEVA 5HG7A 3GC7A 3VUHA 4EOLA 5K5NA 2OF4A 3TDVA 2UZDA 5I3OA 5KKRB 4NJDA 4WKQA 4PF4A 2QVSE 3ZU7A 4MBLA 1YDTE 1SVHA 3FMKA 2IO6A 3NYXA 4FJVA 4DDGA 4N57A 4TWCA 3EOCA 5EQYA 3F9NA 4FKOA 3Q9ZA 2R0IA 4PX6A 4M15A 1QCFA 4F65A 2OZAA 2YCFA 4C4EA 4EOIA 4C4GA 3EFJA 3FI2A 3PZHA 4FTLA 2YFXA 4FYOA 3RAHA 2BIKB 2V7OA 4C7TA 5HTIA 5K4IA 3PE2A 2PYWA 1M7NA 3NSZA 2CHLA 3H9FA 3PY0A 1ZYSA 4G3CA 4UBAA 3GCSA 3V3VA 4L67A 3C0HA 2WTVA 3IO7A 4I93A 5ANDA 2VRXA 3GFEA 4IZYA 4OR5A 4RIYA 4XOZA 2XMYA 2QURA 3IOPA 5E91A 2PVKA 4J7BA 3NPCA 3TUDA 2CCHA 1FVVA 2WB8A 4LRJA 3ZLYA 4JI9A 5AP0A 2C69A 3DQWA 3FZ1A 4UZHA 1TKIA 2ERKA 1WBPA 2IW6A 4ANQA 1MP8A 4MNFA 1QPEA 4B7TA 5FXRA 3KN5A 3QWKA 4R7BA 2WMVA 5AV2A 4YJRA 3H9OA 4BC6A 4OBQA 5HX8A 3KIOC 3BYMA 4MD7E 5LARA 4XRJA 3LQ8A 4XV1A 4R7IA 2KTYA 4I20A 3F61A 1WMKA 1UNLA 2PVRA 3ZM4A 2XJ2A 3PPKA 2R3MA 5HBHA 2GHGA 3UQGA 2PMLX 5L2SA 2QO9A 5CLPA 2CGVA 4AZEA 2X4FA 5IQIA 2FSOX 5BMMA 5CYIA 3ROYA 3G6HA 4IFCA 4AXDA 2YDIA 3GC0A 4FG7A 5DG5A 3UIBA 3PP1A 5DEYA 4KUJA 2ZB1A 5KBQA 2ZV9A 3RAWA 2VO0A 4W8EA 5E8UA 2B7AA 4RWKA 3UG1A 4DC2A 4RC2A 1FINA 3GUBA 4PRJA 3A99A 4P4CA 1DI9A 3L9PA 4PL4A 4BF2A 1H1WA 4X2KA 3M42A 2BRHA 4NM7A 4MD8E 1SYKA 3OFMA 4EHEA 4BCOA 3QRTA 4HNFA 4TYJA 5CQWA 5DPVA 3R9DA 4BDAA 4Y5HA 4AA4A 2H6DA 3GU8A 4B6LA 5HIBA 3AXWA 3QTZA 4IM0A 2HZIA 4TKSA 1OECA 3KGAA 3PY1A 5CSXA 4CFNA 4BCGA 4D4VA 3KCKA 3VUTA 3E64A 3MPMA 3BL7A 3RP9A 3K3IA 3OP5A 5FG8A 4BI0A 4EK3A 1JQHA 4IXPA 4F6SA 5KBRA 3QQUA 3SG8A 2IZUA 2Y6MA 4GFMA 4X6RA 3ZEPA 2Y9QA 4BDIA 5I3RA 4GYGA 5HO6A 3QWJA 3QCSA 3OVVA 4EH2A 1H1SA 4P5ZA 3MJ2A 5D11A 1XMLA 2XK4A 4O0TA 2UVZA 5A6OA 4RQVA 3A61A 2B0QA 3UDTA 4UN0C 2WQBA 3UTOA 3D5VA 5DR6A 1H1PA 2FSMX 4J95A 5A4TA 3POOA 1Y8GA 1SNUA 4PMMA 1YRPA 4LL0A 3N4VA 4ZJIA 2F57A 1WCCA 1ZAOA 4GS6A 4MKCA 2EXMA 5FEDA 5IZFA 4AAYA 1WBSA 4C35A 2Z7LA 2C0TA 2X2LA 4G31A 5BVWA 4MXZA 3EFWA 2WMQA 3E7OA 4KIKB 4EYMA 4E6QA 5CNNA 5L4QA 3CE3A 2YDKA 4RIXB 1LEWA 1WZYA 3PPZA 3KXMA 4FZDB 5J1VA 3EN6A 4HNIA 3RPYA 2VTSA 3R00A 2UW9A 5LVMA 4G3GA 4KS7A 2YZLA 1TQIA 3Q9YA 3D83A 4O7YA 4Y73A 5AP3A 3KA0A 4AN2A 3VBYA 2BHHA 4DFXE 3MSSA 1IAJA 4NFNA 3KMWA 2B53A 1SNXA 2WXVA 3NIZA 4E20A 3JUHA 3DKGA 4GFGA 5HNIX 2PZIA 4BI2A 4X2NA 3NAYA 5M4CA 4MAOA 4C62A 2VTRA 2GHMA 4RFZA 4ZLZA 4E4LA 1PXOA 2YA9A 2R5TA 3COHA 3DY7A 2PTKA 2YACA 4FTTA 5FP5A 1QMZA 1R78A 2PE0A 3QC9A 4S32A 4F1MA 4UXLA 3N9XA 2C5NA 2GPHA 2PWLA 3KF7A 4JDIA 5IU2A 4M8TA 4O27B 5HHWA 1OL2A 2WNTA 3FC1X 5CU4A 3QD4A 3O7LB 5KMJA 1GZKA 5CF5A 3NUNA 1YI4A 2OF2A 4BDFA 1OKVA 3RJCA 5A6NA 3W18A 4MQ1A 2YITA 2BRBA 5I9XA 4ACGA 3AMBA 1MRUA 4JQ7A 3EL8A 5E90A 3R8ZA 3TEIA 3FKNA 3M2WA 4FVPA 4M14A 4YHJA 3EN7A 1CKIA 3I6WA 1F5QA 2XNPA 4ALWA 4TNDA 5TKDA 4KKEA 5E8TA 5AP7A 3E93A 4RIWB 3HMOA 1IAHA 4FKQA 4DFNA 2FSTX 5G1XA 3ZUVA 3UJGA 1GZ8A 2CSNA 2OU7A 2JKOA 4LRMA 2Y4IC 4H58A 2GTNA 3FQHA 1Y6BA 4AZSA 5J87A 3L8SA 4IX5A 4QTDA 4CQEA 3CP9A 3R1YA 5M53A 1Y91A 3GC8A 4RSSA 2XEYA 2VWVA 3BELA 4LV8A 5B2KA 1KUTA 5A9UA 3NUYA 4EHGA 2IPXA 4FSMA 4LOPA 4V0GA 2CKPA 4JBPA 4E7WA 1F3MC 1YXUA 4F08A 4RX5A 5DGZA 4Y85A 3CPBA 4FKVA 5K0XA 4D9TA 3E87A 4EK8A 2HIWA 2YIQA 4HVHA 1WFCA 4FSNA 4QMQA 4BDBA 3ODYX 3LM5A 4I4EA 4U3ZA 4DHJA 4PPCA 3PYYA 3LXLA 4OGRA 3OXZA 1EH4A 1NY3A 4C2VA 1ZRZA 3M1SA 4QPSA 3Q3BA 2PHKA 2XKFA 1OITA 2HZ0A 3OW4A 4BZOA 4R78A 3O7LD 3C0GA 2PZRA 2O5KA 2UVYA 3R02A 3IDBA 4HZSA 4L9IA 4MNEA 2XEZA 3FMJA 3VBVA 3QA0A 3DJ5A 3PJ1A 4LOOA 1P5EA 2PVYA 3QX4A 3ZLSA 2B55A 4WG5A 4WHZA 4BI1A 3O51A 1NW1A 4O0UA 2C6MA 3KB7A 4RVMA 4R3PA 5HOAA 2VTPA 4G6LA 3R63A 5HD7A 2ETMA 2WQEA 4I6HA 3RM7A 4BTFA 3BHTA 4DCEA 2CGWA 2JKMA 1XBCA 5FUTA 3C4EA 4JAIA 4F4PA 4U3YA 3VS1A 4AQKA 5AADA 4FE2A 2HY0A 4KD1A 4NIFB 3QD0A 3O96A 1TVOA 4RFMA 5DH3A 3KREA 3R6XA 1BI7A 2JIUA 5E8SA 2GS6A 3QLGA 4RFYA 5CI6A 2OJGA 4FG9A 4HPTE 3R8MA 5HQ0A 5JKGA 4NZWB 4FTAA 4KIQA 5J5SA 2G01A 4M69B 3Q4ZA 5EQPA 5B2MA 4V01A 4C34A 3VQHA 1KSWA 3BBWA 4D55A 5A46A 3OXTA 2X7GA 4HGSA 1G5SA 2FGIA 2BKKA 4KS8A 1OIQA 4YMJA 5EOLA 5J8IA 3SHEA 3RPVA 3D5XA 3LFBA 1FGKA 1W84A 2Z7RA 3HDMA 3TIYA 5J79A 3RZBA 3BZ3A 3NVKI 4X7QA 4G3EA 3TZMA 3C4FA 3RINA 4LGHA 4MXYA 5KX8A 3R7IA 5JGAA 4PTGA 2IVTA 3CTQA 3TNIA 2YAKA 3W32A 2XZSA 3PDTA 1OUYA 1TQMA 2QCSA 4LV5A 4F9YA 5JK3A 3PY3A 2H9VA 4D5HA 1FPUA 5BVNA 2VX1A 4C36A 5CANA 4I5CA 2QHMA 3TKHA 1KWPA 4O7RA 5EI6A 4NYEA 3FLWA 3DZOA 4MWIA 4QD6A 5K9IA 3RBWA 3QYWA 4ANSA 2HENA 5LMBA 2O63A 3MVLA 3PG3A 2BR1A 5JFXA 5EHLA 3EH9A 2OSCA 2BDFA 5BYLA 1H08A 3R9NA 1OKZA 3IGGA 4Y8DA 5HO8A 3PRIA 4AE9A 2R0UA 3SQQA 2WOTA 4FKSA 1MQBA 2W1HA 2R3KA 4H3BA 3AC4A 5H3QA 4QP1A 4YBKA 4O4BB 2GNJA 3M11A 3TACA 4B8LA 5K0KA 4DEBA 3CD3A 4II5A 4FKRA 4ZSEA 4F78A 5AV0A 3ANRA 3I5ZA 4PL3A 3I60A 4F09A 3BBTB 3BHUA 1QL6A 3IGOA 3ULZA 4P2KA 3LMIA 3NIEA 3CBLA 3LFCA 1YOLA 4IDTA 3HMMA 3KCFA 4UZDA 4C3PA 3NYVA 2F7EE 4GH2A 2XUUA 2P4IA 3DQXA 3NYOA 1WBWA 4YLLA 4DG3E 3EKNA 2X6EA 4O0YA 3U4UA 3GB2A 5IQDA 3DNEA 4PMTA 5L8JA 1BL7A 3PG1A 2YJSA 5M4UA 4CT2A 3IONA 4USFA 4HVSA 4YBJA 3VS5A 2PVJA 1URCA 3C4XA 3DBEA 4C59A 3BWFA 5CZHA 2B1PA 1YWVA 5EH0A 2YLFA 4AFJA 2CKEA 2OH0E 4FV2A 5H8GA 3UGCA 5FQDC 3P9JA 4KBCA 4RJ4A 2B54A 2VTOA 3KRJA 1JBPE 4WNMA 1FQ1B 4KINA 3BYSA 1W2FA 1IASA 4QQJA 5HIEA 3R0TA 3CTHA 1GIIA 2ERZE 4N70A 2VTHA 2WU7A 4YJTA 4ZSLA 3RAKA 3G15A 1UVRA 2EU9A 1BMKA 3VC4A 3VRYA 4C8BA 5E8XA 4G17A 1PMUA 2JBPA 3HLLA 3GOKA 4DITA 3TV6A 3PJ8A 4FTNA 5IA5A 1ZWSA 2A19B 4FTQA 1X8BA 4QQCA 2GHLA 4FT5A 3GBZA 4HYIA 4M97A 3RK9A 3RVGA 3ZRMA 4XG9A 4PPAA 3RZFA 4GKHA 2V55A 2J7TA 4Z9LA 2C5VA 3NX8A 4QP7A 5AP1A 4XBRA 5AR7A 2HCKA 1XJDA 4C37A 5LMAA 4Q9SA 4D0XA 3OD6X 2WQOA 4D1ZA 3FMMA 4EEVA 5IEYA 4LMUA 3LMGA 2WMWA 4YZNA 2XAOA 4QYGA 5HO7A 5IDNA 2W4JA 4AOJA 2AC3A 4FNZA 5FEQA 4ZXTA 2VNYA 5BMSA 3MFTA 2YM5A 4TYHB 4YZBA 5E8YA 4JDKA 2HZ4A 3E92A 4BKYA 5AIRA 3HV7A 5L6OA 4QMTA 2XK7A 3COKA 3FMEA 3ZZWA 1Q24A 3WF8A 3ORNA 4L3JA 4APPA 1OL5A 2BAQA 3BKBA 3R8VA 3V5PA 2JLDA 5GZ8A 4FTOA 3NNWA 4ZSJA 3LQ5A 3W0RA 1PKGA 1TZDA 4I5MA 4U43A 5T6KA 5DYJA 3TUCA 4CXAA 5IG1A 3HVCA 3P5KA 3KFAA 3ZO2A 2Z7SA 5ITAA 2W99B 4FNWA 4R7HA 2PSQA 5EYKA 4EOMA 5A4CA 1PXIA 5A4QA 4G3DA 3HEGA 4EOJA 3A7GA 4YO4A 2HAKA 1W7HA 3DOGA 4NH1A 4RWLA 4ZMFA 4WSYA 4ENXA 4Z7GA 4YTIA 1YHWA 3BQRA 4NK9A 3CTJA 1ZXEA 2X8EA 2ESMA 3PFQA 4ITIA 2FO0A 4I22A 1XH8A 3F3UA 1BL6A 2PMNX 4LRKA 4U6RA 1NXKA 2AC5A 3KKVA 4EOSA 3PSDA 3PJ2A 4L43A 5HORA 2EB2A 3C0IA 2YJRA 1R3CA 2BZJA 5KHXA 3R1NA 5IMXA 3QRIA 3PZEA 2PVNA 3QHRA 4IM2A 4IM3A 4WG4A 4IX3A 5CT0A 3VHKA 2V62A 4CFUA 4J71A 1E1VA 3Q53A 3TNHA 4LDTA 4GJ3A 1PKDA 4ZJJA 2O0UA 3ZM9A 4FV9A 4DFLA 3QUPA 5IF1A 5IPJA 3PXYA 5EHYA 3QKKA 4XH6A 1A9UA 1L3RE 4BB4A 4AZTA 2WTJA 1YWRA 4QMWA 2P3GX 4TWOA 3ZDUA 4EWQA 3O8UA 4AXCA 5DT0A 3R7OA 3OBGA 4QP6A 4QTCA 1G8AA 4FUXA 3FL4A 4UMQA 4ERWA 3LOKA 2PUNA 3GFWA 3IQ7A 3Q60A 4PNIA 5B7VA 5AP4A 4H05A 2OW3A 1V0PA 2VWIA 4NKAA 4NKSA 4J1RA 5AUXA 4NT4A 4U7ZA 4XG8A 4BGQA 4DYMA 4J98A 4JRNA 4N6YA 3I7CA 4GVAA 5BVOA 2YIRA 3QCQA 1E1XA 4LUDA 3FZTA 4XEYA 4ALVA 3V5TA 1XR1A 3NW7A 3RHXA 2XNEA 5F94A 3RNIA 5DT3A 2ZM1A 3FLQA 4QDEA 4O7VA 2X7FA 3Q52A 3PLAE 4PPBA 3DA6A 4BKZA 4KBAA 5KMOA 3FI3A 4DHZA 3IECA 3DNDA 3LCOA 5HVYA 4M7IA 3A4PA 3H3CA 3QGYA 2PZYA 3QFVA 2WEIA 3FQEA 1RDQE 3MH3A 3R71A 4HGTA 2I7QA 4HPUE 4B4LA 3ZXZA 1Y8YA 2DYLA 2YZAA 3QRUA 5LQFA 4JQEA 3NMUF 3AC8A 4GT5A 3VS6A 3QU0A 3H4JA 4X21A 2RF9A 3NUPA 3PIZA 3KMUA 4LL5A 5LVLA 3P86A 4Z55A 4UYNA 4XJ0A 5FBOA 2RFNA 3TM0A 5EM8A 1PXJA 4U0IA 4B0GA 4M84A 2XKCA 2X7OA 4FL2A 4QNYA 2A98A 3GENA 5BPYA 4Y72A 4WG3A 2E9NA 4M0YA 3OUKA 5E7RA 1CM8A 5CEMA 2E9PA 1H1RA 3TNWA 4YJUA 4ERKA 3CS9A 3ZYAA 4DEEA 5CAPA 1GZOA 2WMBA 4L52A 2RIOA 2ZV2A 1XKKA 3CR0A 4FT0A 4S34A 5L2IA 2XK9A 2W4KA 5LCJA 2IVSA 5T68A