2KULA

Solution structure of human vaccinia related kinase 1(vrk1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
360
structure length
360
Chain Sequence
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase VRK1
publication title Solution structure of human vaccinia related kinase 1(VRK1)
rcsb
source organism Homo sapiens
total genus 93
structure length 360
sequence length 360
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2kulA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2kulA01
4GYGA 4UZDA 5E90A 5CY3A 3LMHA 4BDJA 4H05A 1XH6A 1L8TA 4M0YA 2ITVA 1SM2A 3EIDA 2WMAA 2F4JA 2XZSA 4I0RA 5AP7A 3GEQA 3Q32A 4IC8A 3FXZA 4C4GA 4M8TA 1IEPA 2PVYA 4TPTA 1H0VA 3LXLA 3MS9A 2HWPA 2NP8A 3F5GA 5DRBA 2ZDTA 3ODYX 4G34A 4QP3A 4A06A 4BL1A 4JDJA 4ERKA 4FUYA 4G1WA 2Z7QA 4PMSA 2J2IB 2C6MA 2BRHA 2DUVA 2BR1A 4FT9A 4IEBA 4C3FA 4NU1A 3POZA 1CKJA 4E26A 2EU9A 5DI1A 4E4NA 1XHAA 3PA5A 4PDYA 4N4SA 5CAOA 4F7JA 4PDPA 1RE8A 5L6OA 4RWLA 4D2SA 4EOKA 5G1XA 4QQTA 2YIWA 1Q8YA 3FI4A 3RM7A 3HVCA 4WT6A 2F49A 5JH6A 4UYAA 1SMHA 1WCCA 4PMMA 2X7GA 5B2MA 4Y5QA 4A4OA 4I5HA 1BI7A 4XV3A 5AP6A 4EH5A 2JFMA 3NAYA 2W5HA 5IH5A 3KC3A 4FVRA 4ID7A 3QD3A 5A4QA 4LOQA 2QURA 3EZRA 3HYHA 4JS8A 4D28A 1PXLA 2ITXA 3ORPA 3R22A 2PK9A 3KB7A 3T3VA 2R5TA 5CI6A 4WOVA 3FYJX 3V5TA 5CSVA 2UZBA 5L8LA 4H1MA 4A4LA 4CFXA 5L8KA 4BY9E 4CSVA 4R3CA 1T46A 3A62A 4JIKA 3NVKI 3QLGA 4AN9A 3ZRMA 2PE1A 4TWOA 3UODA 4WHZA 4F9WA 5TOZA 1TQMA 3ULIA 3PWYA 3VW8A 2JDTA 2BHHA 4IM3A 3RPOA 3QCQA 2IN6A 4MK0A 3T3UA 4E5WA 4I94A 2HY81 4HYHA 1NVRA 3ZZWA 4Y83A 4BI2A 2GQSA 4YC3A 3OY3A 2WHBA 3PPKA 1U5QA 4M84A 3F2NA 2I0HA 5J7HA 4O7NA 4CKRA 3Q9ZA 4F9CA 1ATPE 2O2UA 4ZSEA 2UW4A 4OTWA 5T3QA 3RI1A 4A4XA 4A9UA 5LMBA 2PUPA 4IW0A 2JKMA 4J71A 3RAWA 3MESA 4GJ2A 1PYXA 3IECA 2C6EA 4O0WA 4Y95A 5CXHA 4BDBA 1GIHA 3QA0A 4CTCA 1GIIA 3N9XA 4PY1A 4OTGA 4QMVA 5HU9A 5IDPA 4M69B 4H39A 4P2KA 3D94A 4CEGA 3NAXA 4EC8A 5LOHA 2GHLA 3ENMA 5HG9A 3R8PA 4NYEA 4KSPA 4F9AA 3QHRA 4WG4A 3HECA 4ONAA 2QHMA 4XP0A 4O38A 1Q5KA 4JQ7A 4FIHA 3E63A 2Y4IC 4YZMA 5A4CA 4I4EA 3NMUF 5LVMA 2RFSA 4EZ3A 4ZSAA 2R3MA 3O8UA 3KY2A 3K2LA 4F7LA 2CGXA 5ANKA 3FL5A 4EBWA 3DJ7A 1Q41A 2RL5A 2W1FA 2OJIA 5D7VA 4B99A 3SW7A 3W8LA 3NUXA 1RW8A 3C9WA 2XEZA 1I44A 2C4GA 2JITA 3PJ2A 4ZZOA 3E92A 4TNDA 5L2WA 5IEYA 4YURA 4DG2E 4C0TA 2Y6MA 4O7YA 4XH6A 3DTWA 4FG9A 3N4UA 4M0ZA 3SOCA 3TG1A 2WQNA 1JKLA 4B8MA 3LFFA 5A4LA 4MXYA 5C4LA 5E7RA 4CKIA 4PL5A 1GY3A 2WIPA 5HCXA 3SRVB 3HL7A 2I7QA 4M7IA 3QALE 5FUTA 3FQEA 5FLFA 3O2MA 4AA0A 4N6YA 3G9NA 4BWKA 4EC9A 4C3PA 3DGKA 2QOFA 4L52A 1PXNA 2J6MA 4IQ6A 4QP2A 4V01A 2B9FA 4YPDA 5L8JA 3SQQA 2WQMA 4J1RA 4IJ9A 5LVLA 4Z16A 3MY1A 3ZFYA 2R7IA 5M4UA 2IZTA 2OH0E 3KU2A 2GNGA 3QLFA 2FUMA 3GCSA 5IQDA 1DI8A 3E93A 4ALVA 3BU3A 5C1QB 4WUAA 4BCHA 4XG8A 3A7JA 2C6DA 4H58A 4BCOA 3F3WA 4U79A 1V0BA 4NTTA 4QP9A 4F6UA 2VWIA 2YIQA 3U9CA 3UDBA 4PX6A 4FSZA 3BHVA 4K18A 4YZCA 5IA4A 4AF3A 2XB7A 2X9EA 4XP3A 3DDPA 4JX7A 5ETCA 3WF6A 4AOIA 3HAMA 4IWDA 3VS1A 2DWBA 4MNFA 4RMZA 4D0WA 4DFYA 4E1ZA 4NZWB 3DQWA 1YOMA 2YACA 3AXWA 4IXPA 4KSQA 2W99B 3TUDA 3W10A 3PXZA 4BKJA 1WVYA 2UZNA 2X9FA 3HX4A 4CZYB 5I3OA 4A9YA 3HKOA 4AS0A 2C68A 2R0UA 1Q99A 2OI4X 2OIBA 1I09A 2WQEA 3FC2A 3JVRA 3SDJA 3ZYAA 3DNEA 4ZY4A 4CFFA 5KHWA 3SVVA 2P3GX 4JIAA 1OM1A 3Q3BA 2BFYA 4X2JA 5AFVA 3I7BA 4ACDA 3JY0A 3LXNA 3R8UA 4EOIA 4FT0A 3NUSA 3QTIA 3COIA 4BCMA 3DK6A 1OKWA 2XK9A 2YWVA 3I6WA 2W1DA 5FM3A 3PG1A 4AX8A 3ROCA 3W16A 2Z60A 1JNKA 4FT3A 4RVLA 2GTNA 4L7SA 4CVAA 4GRBA 4MXZA 3CD3A 3D4QA 5EHYA 4FODA 1G8SA 4J53A 1J1CA 3MB6A 5H8GA 2JKKA 3BX5A 3FMHA 4PDSA 4W4VA 3A7IA 5EYCA 2XBJA 3GCPA 1OBDA 5CT0A 2ZV9A 3N4TA 3N51A 4CTBA 2I0EA 5DT3A 1FVTA 3NRMA 3QKLA 4CLJA 3VUMA 5TO8A 4C4JA 3TUBA 5G6VA 3C4FA 3NYVA 3QC4A 3QZFA 5DEWA 3A60A 4QMYA 2W06A 2BIYA 4FKTA 5CU4A 4ITHA 4QMTA 4JI9A 3AC5A 2HYYA 3QQUA 5EDPA 5M07A 2VTNA 3R30A 3W2RA 3G5DA 1H07A 5H2UA 3MVHA 3ZLXA 3EWHA 4L53A 2WTCA 4B6LA 4RZWA 3W33A 4C61A 1PYEA 5GIOE 5HLNA 3GI3A 2IVTA 5CVFA 3NUAA 3KN6A 3GXLA 3HUBA 3FZPA 3BYMA 2XKFA 3NWWA 4L43A 4BIBA 2BHEA 4DGLC 3MGYA 2UW5A 3VS4A 3ALNA 4RJ8A 4DITA 3GQIA 4JBVA 2EB2A 1FPUA 4MYGA 1W84A 3UNKA 5HNGA 1LEZA 4O7TA 2Z2WA 1L3RE 4OBQA 4U41A 2G15A 2PMOX 4X7QA 2VTJA 4YJUA 5D12A 2WQOA 5BVEA 4G6OA 5ANJA 4EHEA 5HX8A 2QC6A 4NWMA 4MNEA 1XR1A 4TNBA 1R0EA 4FT7A 1VR2A 5AUUA 3BPRA 5IKWA 4AW5A 4USEA 4DGMA 1B38A 2CKEA 2W96B 3MBLA 4O0YA 1U59A 3DNDA 3R7IA 4YP8A 4DH5A 3OCTA 4B8LA 3FPMA 3EN9A 5HTIA 4U44A 3LCTA 4WSYA 4J98A 5KZ0A 5FDPA 3UNZA 3H3CA 4JRVA 2GS6A 2GPHA 2ITOA 2IWIA 1IRKA 4JVGA 4BR3A 3H9OA 3RMFA 2W4JA 2GU8A 3OWLA 4EHZA 4WRSA 2AC3A 4JOAA 3VW6A 1NW1A 1ZYCA 4AW0A 5HVYA 4E20A 4UZHA 4XRLA 4WBBB 4YZDA 2R3NA 2R3KA 2A1AB 4BTMA 4EKLA 1RJBA 1Q4LA 2IZUA 3QTUA 3QWKA 4AZSA 3GU7A 5HGIA 5HOAA 3CEKA 4BCNA 5I0BA 4DEDA 3QUDA 2OO8X 2A2AA 3CCNA 3F5UA 4D1XA 4FNWA 5FBNC 3DKFA 5KE0A 4ZSJA 4QMPA 3JUHA 2J0LA 5IH6A 2YWPA 2CKPA 3PJCA 5HTBA 3FMDA 1ZMUA 5KKRB 4K2RA 3EFKA 2B55A 3AD5A 3MA3A 5EDQA 3UOLA 3U55A 4DEEA 4YNEA 3UMWA 3UPXA 3AT2A 4OTFA 5DA3A 3UOKA 2FSTX 2WTVA 1MQBA 4ZOGA 5HG8A 2FSOX 2E9PA 4TYHB 5ACBC 4DEGA 5CALA 2YABA 1UU9A 2QR7A 2IW6A 5F94A 5E8ZA 3PSBA 2JDVA 3HMMA 4K0YA 5GJGA 4DFZE 4DYMA 5AV4A 5K9IA 3DZQA 4LRKA 5CVGA 2QU5A 3E3BX 3Q5ZA 5D10A 4OBOA 1GZOA 2XK8A 4M15A 3G15A 1Q61A 3P78A 3PLSA 4MCVA 1TVOA 3E8NA 5ANEA 2Y9QA 3CGOA 3UOJA 4J99A 2HWOA 3BI6A 4QO9A 3A7FA 3DQXA 3QQFA 3LM5A 1OL1A 3NR9A 2VTOA 3HV4A 4LRJA 5ETFA 5ICPA 2JAMA 2JIUA 2XIRA 2ZV8A 2EXEA 2J90A 2YJSA 3OWJA 4D2TA 4CFVA 4S34A 4I5MA 2YAAA 1Y8GA 3AC3A 4FTQA 3MY0A 4ZS0A 4BWPA 2YM8A 4FICA 4RA5A 3IDCA 4CGAA 4PUZA 1LR4A 3QUEA 5HE1A 4FV6A 3QTZA 1A9UA 3PTGA 2LAVA 3PE2A 5AUWA 3Q6WA 1MRYA 2XM9A 3WYXA 4BDKA 4E8AA 3TI1A 2XKCA 2B4SB 2OJFE 2C6IA 3QF9A 3OEZA 3GUBA 4G3GA 4FC0A 5K4JA 2C6OA 3HMIA 1YQJA 4V0GA 2QOOA 5KMIA 4BZOA 5TT7A 1M2PA 4MVFA 4PRJA 1ERKA 1WBOA 2BKZA 3KRWA 4CCUA 1PMNA 5GHVA 4O0TA 3KGAA 4CMOA 5KBQA 4FE2A 5EQYA 4K77A 4K33A 3R6XA 4DG3E 1ZYDA 5KO1A 3FKLA 2GFCA 5JGAA 4L68A 3QC9A 4HOKA 2J5FA 3DBDA 4D2PA 3F9NA 3NW5A 5EI8A 2IVUA 3KK9A 3QX2A 4XEYA 3ZU7A 3HRBA 2B9IA 4DG0E 4EEVA 2UW8A 5E8TA 3PRFA 4GK2A 3T9TA 4ASXA 1YW2A 3WIKA 4O6EA 3HV6A 5M51A 2BDFA 4FYOA 2WOTA 1REJA 2O63A 2QNJA 4BHNA 4RIWB 1H24A 5EQPA 4J7BA 3UE4A 2IZSA 2RFNA 1VEBA 3OCSA 4KBKA 4ZXTA 3AMYA 2J5EA 3R04A 4GKHA 3P4KA 4BBFA 3U4WA 5HEZA 4XYFA 4I6BA 3VHKA 4BBMA 3NYOA 5L4QA 4O2ZA 3DS6A 3RHXA 3CR0A 3OP5A 3FMMA 1PKGA 4UX9A 2W5AA 4FL2A 4IX3A 4P90A 4UWYA 4ZJVA 3EFLA 1OIYA 5B2LA 3DKGA 1YI6A 2GSFA 5IMEA 3VUHA 3FQHA 3A61A 2XJ2A 1WBWA 2R3OA 3A4PA 3EQDA 4PWNA 4RZVA 5JFWA 3S00A 3DOGA 1H8FA 3FWQA 3WILA 4RBLA 4ZTLA 1R39A 4F6SA 1ZXEA 1JSVA 2WAJA 5HO6A 2BKKA 4G31A 2BVAA 4ZEGA 1ZMWA 3ERKA 4O83A 4DFUA 2WMUA 5A4TA 5DE2A 4Q5HA 3ZLYA 4IBMA 4XBUA 5I5ZA 4E4LA 3RAHA 2O64A 4MKCA 5M4CA 3DCVA 3HUCA 3IW8A 3FLZA 2RFDA 4P5ZA 4A07A 2B7AA 4XLVA 2FSMX 3IW5A 3QZHA 2VTHA 4QMZA 3QTWA 3VUKA 4ZZNA 4U40A 2QLQA 4Y72A 3OG7A 5TR6A 1OPKA 3E8CA 4HGSA 4S2ZA 2ZMDA 4LUDA 4KBCA 5FEQA 4LGHA 3GP0A 2CCHA 4XMOA 3GNIB 4XG9A 3NW7A 4FKJA 4UY9A 5LVNA 4YHJA 4FZDB 4YJQA 4EWQA 5EHOA 2BZIB 1R3CA 3FSFA 3EL7A 3PZEA 3EN7A 4FTCA 2ITUA 3I0OA 3TKIA 4XG6A 4GK3A 4YPSA 4GG5A 3NCGA 4NIFB 4ZJJA 2I0VA 3P79A 4FTMA 4D58A 3AC8A 3R1SA 2FH9A 3KXGA 2XIXA 3OS3A 3D0EA 4TT7A 2YISA 2Z7LA 4ACCA 4BB4A 1OB3A 5JFSA 3KRJA 4U7ZA 3TZ8A 2E2BA 4M69A 4NK9A 4PMTA 5CU2A 2VWVA 1JWHA 3F2RA 4FTUA 4F9BA 1H27A 3E87A 3LFQA 3LIJA 4G9CA 3MPTA 4GU9A 2BDWA 2VTIA 4JX3A 5DG5A 1CKPA 5KCVA 5KKRC 2X4ZA 1OIQA 3NUYA 1UVRA 4P7EA 3FXXA 3OHTA 4IVBA 4MXOA 4S32A 4RLLA 5F4NA 5CEKA 5E4HA 3GGFA 2WQBA 4U3ZA 4C2VA 3NLBA 2B0QA 5HIBA 4RG0A 4H1JA 3DBQA 4HNFA 4FOCA 1FMKA 3KRRA 1PHKA 5DR9A 5C01A 2H9VA 3QXPA 3MH0A 1H08A 3RKBA 3RZBA 2LGCA 3EZVA 4AT4A 4CZUA 3LE6A 3R7EA 4G5PA 4Y85A 4MD9E 3OUNB 3LLTA 4B0GA 4QP4A 4I41A 4BGHA 4GUEA 3VHEA 1Q8TA 3CY2A 1YXUA 4DGNA 1YWRA 2IW9A 3OW3A 4LMNA 4QRCA 3GOKA 4IZYA 4H3PA 4FSQA 4EQUA 5CANA 4OT5A 4MF0A 3GCVA 4AUAA 5A14A 2HZIA 3VBVA 2VTRA 4R1YA 5CSWA 4ASZA 5DT0A 2IPXA 3V3VA 2VNYA 3VS0A 4XUFA 3BHUA 5JK3A 3PSDA 1LUFA 3MFTA 3TTIA 2JDRA 3SRVA 3CBLA 3I0QA 2GNIA 4L7FA 5M56A 2CKOA 1OL7A 4ZSLA 4EQCA 2QO7A 3EKNA 3ZFMA 4O81A 4APCA 3LFSA 3QQGA 1GJOA 3D5VA 3G6HA 1Y6AA 3D83A 3KF7A 5HBHA 5CSPA 2SRCA 2ITTA 1NVSA 3BBTB 4QP8A 2GFSA 3UPZA 3MIAA 4BDHA 3G51A 2F7ZE 4EK6A 3FZRA 2C0IA 1A48A 1GZNA 4IAZA 5CENA 2IO6A 2C30A 5CU0A 5KZIA 2QOHA 3KK8A 4A9TA 2QOQA 3CQWA 3EJ1A 2XH5A 1UWHA 3C51A 3JVSA 2P33A 3SXSA 3D2IA 4WNOA 4OAVB 3LFDA 4BWXA 2BZKB 3UZPA 3QGWA 2E9OA 1Q8WA 1H26A 2W1ZA 3QHWA 5LXMA 2BFXA 2C47A 3JYAA 3VAPA 3C5UA 3E8DA 3PY1A 4R7IA 1BKXA 1B39A 4ZJIA 3ZC6A 2AC5A 2B9HA 4S30A 2CGUA 3QKKA 2VX0A 4HVIA 4MWIA 5H9BA 4LUEA 3KFAA 5EYDA 4AG8A 4AN2A 3PLAE 2BCJA 4C8BA 4HCTA 5HNIX 3GOPA 4YTCA 1UU8A 5HD4A 5BMSA 2WZJA 5C27A 3QD0A 3IW4A 5JKGA 2WPAA 4PNKA 5LWNA 2HCKA 3CS9A 4GV1A 4IH8A 4ANNA 5ITAA 3MB7A 4RFZA 3WIGA 2CN5A 3KVXA 1KUTA 2UW9A 4KS8A 3CPCA 4NFNA 3MSSA 1S9JA 5J9ZA 4YC6A 3G33A 5DEYA 5BQ0A 3EB0A 4OLIA 3HP2A 3V8TA 1F3MC 3WZUA 4AXAA 2WFYA 2XA4A 3Q6UA 4NW5A 3OBGA 4RC3A 3IONA 4EYMA 2QG5A 4E5BA 5LARA 5EYKA 4X3FB 5CSXA 3L8XA 2WELA 4CFWA 3LOKA 3UBDA 2OJJA 5AIKA 5CSHA 5AV0A 3S4QA 2XNBA 3FYKX 5EKOA 4J97A 3V5QA 4FTLA 4GCJA 4GH2A 3H30A 3LFAA 3FLYA 2XM8A 1CDKA 2BRBA 3R7YA 4Q9ZA 3FMEA 4X2GA 3MJ2A 1ZMVA 5BYZA 2OF4A 4FOBA 3SA0A 5IA0A 4G5JA 5CEIA 5FG8A 2X2KA 4L67A 3SOAA 2PHKA 3ATTA 1WBVA 3VN9A 1YXVA 2VTSA 3GVUA 4XNEA 4ARKA 1OIRA 4NL0A 3R9NA 5AA8A 4ITIA 2CNVA 3LCSA 1DAYA 4JDKA 4BKYA 4BGGA 1YI3A 4LRMA 4P4CA 2BAQA 4IWQA 3II5A 1Z5MA 5CF6A 5KBRA 2ITNA 3MV5A 1KE6A 3IKAA 3KKVA 1YWNA 2XIZA 3QQHA 4GSBA 4M68A 4F70A 4IAYA 2WTDA 3NIEA 2G9XA 3ZM4A 4XHKB 2VX3A 3KVWA 1M2RA 4PP7A 4LGDA 5AX3A 3C7QA 4C35A 3DXPA 4G3CA 3LQ3A 4FSYA 1H0WA 3DKCA 4MWHA 4YJNA 1W7HA 3P9JA 4CMTA 3D9VA 3CKXA 3LZBA 2HOGA 5HNBA 4EOSA 4I20A 3ULZA 4OBPA 2V22A 2UW7A 4PPAA 1Q8ZA 4E93A 2J4ZA 4JAIA 4MD8E 4GFGA 2C1BA 3BE9A 2BTSA 2E9NA 1J3HA 3R7VA 5CF8A 3PDTA 1XH9A 1H01A 2VUWA 2ACXA 2O5KA 4W8EA 4AFJA 5CWZA 3DA6A 3ORNA 1M52A 2ETKA 5J87A 4NJDA 2FSLX 3FHIA 4U0IA 5D11A 3WE4A 2UZEA 2WMXA 2UV2A 3UOHA 3E3PA 5KHXA 2C0TA 2C5OA 3KXZA 1M7QA 5CEPA 2VWWA 3JXWA 3H0ZA 3OT8A 2HZ4A 2XYNA 4JR7A 5FP5A 4F09A 4D4VA 3PRIA 3F7WA 3R01A 4E3CA 4WO5A 5AP0A 1XJDA 4CNHA 4Z55A 4O91A 4R77A 4MHAA 5JT2A 1H4LA 1UA2A 2X7OA 5CU3A 3F2AA 5GNKA 3EQGA 3IS5A 3RAIA 3MH3A 5E92A 4WNKA 2QVSE 1ZY5A 2RIOA 4XBRA 5ANOA 3CC6A 3QD2B 4HVHA 3RJCA 3UC3A 3ZSIA 1F5QA 2PVFA 3NUNA 2WO6A 4D2VA 3THBA 4DLIA 4JDIA 2XK7A 4BCFA 2H96A 4DHFA 2WGJA 3RALA 4TWPA 4HPUE 5EFQA 5J79A 3MA6A 5IQFA 5FXRA 5AAEA 3SG9A 4GIHA 5D1JA 2F2UA 2AUHA 3R2BA 3RK5A 2E9UA 3OTUA 4YJVA 3UVRA 3LM0A 3NNXA 3TN8A 3RAKA 2A0CX 3SLSA 4RC2A 4Y46A 5EW8A 4C4IA 2GNLA 2PUNA 3IGOA 1FVVA 1OMWA 3UJGA 3R9HA 3TWJA 5HU3A 4QTBA 5L6WL 3MW1A 5JQ5A 4TYHA 1M7NA 3MDYA 2PVMA 4DFNA 2WNTA 4GG7A 2WEVA 4JJRA 4FKQA 2B1PA 3R8MA 4AZTA 1PMVA 4IFCA 4I6HA 4K11A 3DLZA 4NM0A 4OUCA 3C50A 5AEPA 2UZTA 5JGBA 3A2CA 3CD8A 2R3PA 4I6QA 4II5A 4WG3A 3H0YA 4RJ4A 3S3IA 3TKUA 4EOLA 1GZKA 5CZIA 3PA4A 1J1BA 3WOWA 4RX7A 5ANIA 2ZM1A 4DCAA 5C9CA 2CN8A 1BLXA 3R7OA 1TQPA 5DFPA 2ITQA 4E5AX 4HYSA 4D4YA 4L6QA 3OCBA 4F0FA 3BHTA 4RX9A 4TTHB 5IQEA 4BVUA 5JZNA 1UV5A 3UQGA 2JGZA 4MXCA 4EJ7A 2ZM3A 3IGGA 4RWIA 4FUXA 4CZTA 5BVNA 1FGIA 3K54A 3NIZA 2IZRA 4O0RA 5DN3A 3ZBXA 5EOBA 4BRXA 3PWDA 4OTHA 3CIKA 3O0GA 4ITJA 2VO6A 2BUJA 1JVPP 5T6KA 3ALOA 3EQPA 5CQWA 2YM7A 3QWJA 4L01A 3BU5A 1OITA 4MQ1A 3OC1A 4OTIA 3RPSA 5IA5A 4A9SA 4GFMA 3GC0A 4O7VA 4HJOA 3P86A 4QP1A 5L2TA 2BZHB 5GJFA 3EOCA 1H28A 2BAJA 5BVOA 5AP2A 4M14A 3EQCA 4UWBA 3ZUVA 5IDNA 4R1VA 4AW2A 4TN6A 4RIYB 1IA8A 2AYPA 2XVDA 3UTOA 2IVSA 3I5ZA 4LGGA 4X3FC 4HVSA 3PIYA 4RFMA 4C37A 3BCEA 3IOKA 3DAEA 4QMQA 5EM5A 2C6KA 5DRDA 4C33A 2C5YA 1NVQA 3LW0A 3FMLA 1APME 5IQIA 4D2WA 4FEQA 3COHA 4L42A 3MFRA 3R2YA 3A99A 1OUYA 1KE8A 1WZYA 3PVWA 1YHSA 1CSNA 2XNGA 3DFAA 4FSUA 4LQMA 4RIWA 3AMAA 3RK7A 4O82A 2C5XA 2XNNA 3PPJA 1FMOE 5EG3A 4FV9A 4I0SA 3PY0A 3QXOA 4PQNA 2QONA 1BL6A 3SXFA 4EK5A 3WF8A 2QI8A 4QYGA 5IQBA 2VWXA 2EUFB 4FMQA 4NUSA 5M55A 4YU2A 4QNAA 2VV9A 5AUYA 2PZPA 3O7LB 4FKVA 4R3PA 4QTDA 3BGPA 2Z7RA 3MJ1A 3TJCA 3O50A 3UZTA 1ZWSA 3HDNA 2BPMA 3U51A 2VX1A 3UYSA 3DK3A 5KUPA 4Z9LA 3ORTA 2CNQA 5DIAA 3GC9A 4G17A 4BDEA 4EOOA 5AAFA 5AR7A 3V5JA 2ZM4A 4G3EA 5GJDA 4C34A 1QL6A 2O8YA 4EOQA 3B2WA 1PW2A 4GT5A 4N0SA 4RQKA 4O84A 2WMVA 2X6EA 5C8KA 4HGTA 2QO2A 3VJOA 2R4BA 2QOKA 5J95A 1MRUA 3EH9A 3OT3A 4PF4A 4U42A 4WSQA 4BCJA 5AADA 4ACGA 3IW6A 3CE3A 2Z02A 3R7GA 3UO5A 5TE0A 3UO6A 4AZVA 3M42A 4G2FA 4BCKA 2I6LA 2UZUE 2X6DA 2HXQA 3O23A 3VO3A 1KE9A 4E73A 4JQEA 4XJ0A 1HOWA 3F61A 3C5IA 4YJPA 5E1SA 4DT9A 2UUEA 4K1BA 4NW6A 3HZTA 5LWMA 2PE2A 2YIRA 2ZV2A 3CGFA 2Q83A 3R9DA 5E8VA 3SW4A 4APPA 1DAWA 2JKQA 3BEGA 5FDXA 4DE4A 2XYUA 3COKA 2W1CA 2QD9A 2BZJA 2R3LA 4YTHA 3ZLSA 1A06A 1OZ1A 2ZV7A 5L3AA 2JEDA 1XO2B 1UNLA 5AV1A 2A4LA 3RPVA 4NIFA 4EONA 4XS2A 3VS7A 4CXAA 4X21A 1FOTA 5EH0A 3IOPA 4FBXA 3JS2A 4AZFA 2XNEA 4F1OA 2WU7A 2WMSA 3LAUA 4BDIA 4CYJA 1OUKA 1Q62A 2QLUA 3AGLA 2HW6A 3AT4A 3VF9A 2V7AA 2VWBA 4YHFA 3WE8A 3IO7A 2NRYA 4EORA 1KSWA 3BIZA 4ZK5A 4FR4A 3GQLA 2WB8A 2DYLA 2WTJA 5EW9A 3H10A 4AP7A 5K5XA 4AGDA 4FNYA 2YCRA 4IAAA 4MTAA 4IX5A 3V04A 1YXXA 3NYNA 4BN1A 2YCQA 1K9AA 1IR3A 2XMYA 4WNMA 4D1SA 2OXDA 3TCPA 5J8IA 1H1WA 2I0YA 4UXQA 4EH3A 4KKHA 5DNRA 2QG7A 5IUHA 1T45A 1ZZLA 1B6CB 2XCHA 3Q60A 4FYNA 4IX4A 3VJNA 3W2SA 3LFEA 4H36A 1OKZA 4PP9A 3PYYA 4RIOA 4XV9A 1XH7A 2ONLC 4Y8DA 3BHHA 1WVXA 1YHVA 5F95A 3R8VA 3F69A 5EHLA 3U54A 5DGZA 2FB8A 2JAVA 2JKOA 2YDKA 5E8UA 4TWNA 5EQEA 5AMNA 1OBGA 3F66A 4FGRA 4IAFA 2VTLA 5DH3A 2IJMA 3V5LA 3PXQA 2ESMA 4QPAA 3AGMA 3IDPA 1IASA 3HV7A 3FEGA 5L2QA 5F20A 5AIRA 4GK4A 3EN4A 1JKTA 1KWPA 3GU8A 4PTEA 4QP6A 4OTQA 4DTBA 4ZAUA 3ZS5A 3CTHA 4WD5A 1NA7A 3UIMA 1U5RA 2WD1A 3BKBA 4FKPA 4DCEA 5JFVA 3GU5A 3TT0A 3VVHA 4E6QA 4YBKA 5BYYA 3FUPA 2HELA 4ZLYA 3I81A 2UVXA 1XWSA 4LOPA 5AX9A 1OL5A 4ALWA 3NYXA 3HA8A 5IQCA 4GT3A 2QQ7A 2XK4A 4BCIA 3K3JA 4EH4A 4R78A 4DT8A 3UC4A 4QYHA 3PG3A 2W7XA 3F7ZA 5HBEA 4BGQA 3HRCA 3E7VA 4XOYA 3DJ6A 2KTYA 2UZLA 3KULB 4FTNA 1URCA 4R5YA 2OJ9A 4BIEA 4L3PA 5JSMA 4AN3A 2X8IA 3AD4A 4GMYA 4FG7A 1OL6A 3ZC5A 1Q3DA 1VYZA 2JIVA 2PMLX 3FLSA 1JSUA 4E6CA 4RJ5A 3RPYA 4U5JA 3LXPA 4U43A 3ZM9A 3LQ5A 5E8XA 3G0FA 5FTOA 3ENHA 3MTFA 3RWQA 4ANSA 4R7HA 3D7ZA 4NKSA 5CX9A 4AA4A 4EOMA 5M4IA 5HCZA 4EOJA 1YDSE 2ZJWA 2XEYA 3DPKA 3FZSA 4CCBA 1WBPA 4DEBA 5HO7A 2XKEA 3OZ6A 4BIDA 2C3KA 2DS1A 1BL7A 2JDSA 2R9SA 3LQ8A 3Q04A 5FEEA 3VUIA 3Q2JA 1MRVA 4FGBA 5HE0A 4GUBA 4M12A 1J91A 5IZFA 3UO4A 5LCJA 1R0PA 2VO3A 4Q5EA 4J8NA 4F99A 4KA3A 5A4EA 2OK1A 4B4LA 4G3FA 2GNFA 3HLLA 3NEWA 4O22A 4U81A 4U45A 4X3FA 1JLUE 1WBSA 5HVJA 3V8WA 4HNIA 4QYEA 4WBOA 3V6RA 4F65A 1LEWA 4MXXA 4O0XA 4HYUA 3VBXA 3I4BA 3EN6A 5AA9A 3QQLA 4IB5A 3SAYA 1YXSA 3AC1A 4KRCA 3ZHPC 3CKWA 3B8QA 3CLYA 2PY3A 5IA3A 3R0TA 4K9YA 4Q9SA 2PE0A 3LCDA 3OOMA 3C4CA 4ZS4A 3EQIA 5T68A 3DAKA 4FKGA 4ZP5A 4GFOA 4LG4A 3UIXA 5BPYA 4RRVA 4ACHA 4D1ZA 5FTQA 4UWCA 3KXXA 5LVOA 4FKLA 3FSKA 3LPBA 2RFEA 3ZRKA 3TDWA 4L00A 4EZ5A 4W4YA 3VIDA 4GW8A 4EK4A 1VZOA 3RNIA 5CAVA 2BILB 2VTAA 3KN5A 3MWUA 4FV1A 4WUNA 5AV2A 5CAQA 2YIXA 3NUPA 3A4OX 4MH7A 3LMGA 2I1MA 2W5BA 5AR8A 3W8QA 5K0XA 3KREA 3SV0A 4RT7A 4O86A 1PMUA 1QPDA 4IDTA 2O3PA 4JQ8A 4KD1A 4R5SA 5FGKA 5HG7A 4YO4A 2V55A 4YTFA 2IG7A 4FEVA 1LPUA 2HZNA 4QMMA 2XK3A 3R21A 1JSTA 2FVDA 4LL5A 4AGUA 3EQRA 3PP0A 5AJQA 3AD6A 4KIQA 1WBNA 5EI6A 2WTWA 4XG7A 2F2CB 5M09A 4EZ7A 2W1IA 5AR4A 4ZY5A 5E8YA 5AP1A 4JR3A 5JRSA 3HV3A 5CQUA 2GS7A 3NSZA 4BC6A 4UYNA 2A19B 1FQ1B 3PXRA 4JAJA 3LFCA 3NNWA 3ORMA 4FKUA 3OMVA 4MBIA 3AOXA 2BMCA 4WA9A 2R2PA 3ZTXA 2X4FA 3A8XA 3GFEA 3VQHA 4CT1A 1ZLTA 4I92A 3D7TB 5IA1A 2C3IB 2C1AA 4EH6A 4YSJA 4QMLA 4CQEA 5AUZA 3VNTA 3ZRLA 2CLXA 2PTKA 3AC4A 5A6OA 5AUVA 3EFJA 3K5VA 3PVBA 1MP8A 4GIIA 2G2IA 3KL8A 3FHRA 1YDRE 4FKSA 4I24A 3NCZA 2XK6A 3TZMA 1OPJA 4Z7GA 3P7BA 3UYTA 3DT1A 4FIIA 4L3LA 4L44A 5FRIA 4EOPA 5JRQA 4IANA 4WIHA 1JBPE 3E5AA 1Z57A 5A6NA 4FT5A 2GNHA 2P2HA 4IX6A 4F08A 2ETRA 1PF8A 1XH5A 4L45A 3ZDUA 4PPCA 4CG9A 3ELJA 4PL3A 3MTLA 2H34A 3UP2A 1FINA 4QD6A 4IADA 5ANGA 4HVGA 5HHWA 5EDRA 4USFA 1OI9A 2X2MA 5K0KA 4AW1A 3FLNC 2W17A 2R3IA 4DH7A 3BEAA 4PTCA 5C03A 4C4EA 3WZJA 3GENA 4HZSA 1Q8UA 4YZBA 3OXZA 3V5WA 4D9UA 4QPSA 3PPZA 4DEAA 3WF7A 2J0MB 3IG7A 3IPHA 3ZUUA 3P1AA 2CCIA 4ZIMA 5AR2A 4WKQA 4ZTNA 5L2IA 1EH4A 3E64A 5E9EA 1URWA 2OF2A 4NJ3A 5JMSA 3BELA 4JBOA 3ZBFA 3QUPA 4XLIA 4NSTA 4FL1A 2UZWE 3SKCA 4OTRA 2WMBA 4O7ZA 1BYGA 3DXNA 2PMIA 2QHNA 2ITWA 4FTTA 4ACMA 2EB3A 2ONLA 2UZOA 2WIHA 5GZAA 3E7OA 1XKKA 4GEOA 1M17A 3Q53A 4LMUA 4QMNA 3O8PA 4AFEA 2Y7JA 3L8SA 4NT4A 5DYJA 5J5TA 4IM0A 1LP4A 1PMEA 4FSNA 2Z8CA 3ATSA 1GNGA 4DEIA 4TL0A 5J9LA 4GKIA 4F0GA 3CTJA 2NRUA 4FV8A 5JGDA 1H00A 4I4FA 4HVDA 5GZ8A 3Q9XA 2NNWB 2RSVA 3BQCA 1PXPA 4PL4A 2JIIA 2QO9A 2CHLA 4CLIA 5EK7A 4IIRA 4EH9A 1SNUA 2YA9A 3L8VA 3QRKA 4O1PA 3CP9A 2WU6A 3CJGA 4FV3A 4JLCA 3P0MA 1NT2A 4XP2A 5BVDA 4FSMA 2PVHA 3I7CA 3TZ7A 3VS2A 4EUUA 1J7UA 4ERWA 4FV0A 4RIYA 3OY1A 4IAKA 3TIYA 1KV2A 1OGUA 5AAGA 2QU6A 4QQJA 1G3NA 4IACA 4I22A 1KOBA 4BHZA 5BUJA 5CEOA 3DK7A 3BBWA 5C26A 3HAVA 1UNGA 3ZZEA 2GCDA 4NKAA 5H8EA 2OSCA 4JRNA 3MFUA 4JBPA 4UEUA 2CMWA 2V7OA 3KXNA 2P55A 3ITZA 4UMQA 3R8ZA 2QCSA 2C3JA 3O96A 1P5EA 2WOUA 3Q9YA 5CU6A 5DBXA 4EJNA 2FYSA 2CDZA 1JKSA 3JPVA 5HD7A 1ZYLA 2YM3A 4D5KA 4YHTA 2XIKA 4FSTA 4ASDA 4FIFA 4LL0A 1SVEA 4BCGA 3FKNA 2YN8A 4YLLA 4KIPA 1DM2A 2QOLA 4AGCA 3UQFA 5BMMA 4YLKA 4QP7A 1O9UA 4C36A 4PNIA 3MH2A 3UVQA 2CKQA 3RZFA 5HIEA 3UGCA 2J0IA 3WI6A 2BRGA 2V62A 4ANMA 5AR3A 3VBYA 5A3XA 2YLEA 3BGQA 1W8CA 3FV8A 4IVDA 3OWKA 4KIOA 3DDQA 4TRLA 1WBTA 3FMKA 3MVLA 3OXIA 5CLPA 5DLSA 3TV4A 4YSMA 4BFMA 4FL3A 4DFBA 4G3DA 3AMBA 5K4IA 1IAJA 3QTXA 2XBAA 5LMAA 4C58A 3V01A 3FY2A 5AP3A 2OU7A 3ZEPA 4FZAB 2R3QA 4L3JA 4QMOA 2B54A 3MN3A 3C0HA 1S9IA 2XP2A 2X39A 4FTRA 3ZDIA 1CKIA 3G9LX 3FI2A 5HZNA 2PMNX 5KMMA 4D4SA 5CAUA 3CTQA 4ENYA 4DTAA 5HE2A 4TXCA 4I93A 3TNWA 3OEFX 1ZOEA 2FA2A 5H8BA 1GAGA 1UNHA 3IW7A 3VS5A 2PZ5A 3UQCA 4AA5A 4LI5A 3KCFA 1YI4A 5L2SA 2EXMA 3LCOA 1PXMA 4O7LA 3R28A 4R7BA 4DF3A 2H8HA 4FX3A 3VBWA 1IA9A 3R83A 3PIZA 4EH8A 3QRJA 4IWPA 2J7TA 4L46A 3GU4A 3CSVA 4EK3A 3BYVA 2BROA 4FKRA 2OG8A 4ZTQA 2J51A 4F9YA 2X8EA 5FD2A 4E6AA 5A46A 5K3YA 5KNJA 2B52A 3DXQA 5M08A 2ITZA 3FE3A 4DGOA 5IMXA 2R3JA 5I9XA 5KMOA 4IWOA 3O51A 5BVKA 3RP9A 2VTPA 1STCE 4FKOA 3BWFA 4I1ZA 4AZWA 3NVMB 5HLPA 3PIXA 2VN9A 4BICA 4DTKA 4D2RA 4RIXB 3ZH8A 4KUJA 3U4UA 5FXSA 4XG2A 3UIBA 1U54A 4XCUA 3TM0A 3PP1A 3PY3A 4C57A 4D0XA 2YITA 4IM2A 3BRBA 3LVPA 5I9WA 5I4NA 1BUHA 5E8WA 1ZY4A 3COMA 1WFCA 2VRXA 4O7WA 4TYGA 1P4OA 2GQGA 4KIKB 2Y8OA 4JL9A 5D9HA 3QZGA 4CV9A 3MPAA 3POOA 3D5WA 1W82A 5IQAA 4NCTC 4L8MA 2X0GA 5KX8A 3JR1A 4RA4A 4IDVA 4C02A 3OFMA 5D7AA 3QYWA 4ZLZA 2O0UA 3ORXA 1AQ1A 3RTPA 5L6PA 4JNWA 3JY9A 4XV1A 4OAUC 5E8SA 2F9GA 4LOOA 1Y57A 2GS2A 2CGWA 4ZTHA 3FZOA 5EKNA 5F1ZA 4UMPA 5CZHA 3P7AA 4TYJA 3ORIA 4IB3A 5AP4A 1QPEA 1YHWA 4G6NA 2F57A 3C0GA 1UU3A 2HK5A 3KRXA 3FMJA 3ACKA 3OOGA 5J5SA 3AQVA 3VWAA 2ITYA 2OFUA 1UU7A 2V0DA 3DKOA 4AZEA 1YOJA 2YM4A 4EBVA 3U6HA 3OF0A 3AG9A 3R63A 5J7BA 2X1NA 4F0IA 2QKRA 4MAOA 3PXFA 3NZ0A 1K2PA 4GVJA 2HW7A 3BLHA 4DBXA 3QYZA 3V51A 3BWJA 3FMNA 3K5UA 4TZRA 5A54A 2YEXA 4NTSA 1WAKA 3S95A 3R9RA 1CM8A 3ZSHA 4FA2A 2VZ6A 1OVEA 1SVHA 5J9YA 4IZAA 3TEIA 4HGLA 4YLJA 3UZRA 1YWVA 3LHJA 1RDQE 5IUIA 4H3QA 2GNJA 3L9PA 3LXKA 3U9NA 1XBBA 5AP5A 2QR8A 4BDGA 2W4KA 2OIDA 3PE1A 3U6JA 4FKWA 4IZ5A 1QMZA 4FZ7A 4OR5A 2YM5A 1M2QA 4I5PA 3QL8A 1PKDA 1JQHA 1UKHA 1PRYA 2PZYA 3KULA 2KULA 4ZTMA 3VBTA 5GZ9A 4UMRA 2OH4A 3SGCA 2JFLA 4YUQA 1V0PA 3F3UA 3BYUA 3QD4A 3UVPA 3WARA 2DQ7X 4UBAA 5HVKA 2WTIA 3G90X 4IZ7A 4PDOA 3F5PA 3LJ2A 2OW3A 4K6ZA 3ZFXA 3ZSGA 2RKUA 3OWPA 3PXKA 2W1EA 3KXMA 5B2KA 5DWRA 3BQRA 3PA3A 2XRUA 2HY0A 1W83A 3ETAA 1QPCA 4NM5A 2VWYA 5FM2A 2W9FB 3ANRA 3TKHA 4BTFA 2YIYA 4KS7A 4RFYA 3WZEA 5A9UA 3BYOA 4QYYA 3FBVA 2RF9A 3QRUA 4CKJA 3H4JA 3KMWA 4FTAA 4GVAA 3LFNA 1PXOA 3H9RA 4E4MA 3CJFA 4CRLA 3TNPC 4M66A 3TXOA 3M2WA 4W8DA 4NH1A 3D5XA 1PY5A 2GHMA 2VTQA 2W1GA 3L9LA 4OT6A 3L9NA 3ID6C 5IEVA 4Z7HA 3UMXA 2WTKB 3S0OA 3DBFA 3VUGA 4MX9A 3MVMA 2UW3A 4FTJA 5KMKA 2WXVA 4K8AA 5IH4A 2BTRA 4FV5A 3TDVA 2PVJA 2XNMA 3FI3A 1OL2A 4AU8A 3VRYA 1CTPE 4D9TA 3HMNA 5I9ZA 4JG6A 2CLQA 5J1WA 4O7SA 3MVJA 4X6QC 2ZB0A 2XNPA 5EM8A 2XJ1A 1XBCA 4Q2AA 2IVVA 5CF4A 4E4XA 3LMIA 3LJ0A 4V05A 5I3RA 3W2PA 4C4FA 4GS6A 4FK6A 4J95A 4RVMA 4EH7A 4HW7A 4FVQA 3BYSA 3ROYA 3OTVA 4M13A 5M4FA 1BMKA 1MQ4A 1Q24A 3D15A 4LYNA 4QPMA 1G5SA 2UVYA 4UV0A 3BV2A 2X2LA 4YTIA 1Q3WA 3E8EA 1XBAA 3NNVA 2ZOQA 4HCUA 1J7IA 2YJRA 4FTKA 5AUXA 5JEBA 2YERA 2VO0A 5CS6A 2Y0AA 2I40A 2G2FA 4OW8A 4D55A 5KMLA 3ZUTA 4BDDA 3PSCA 2UW6A 3FLWA 2XUUA 4N57A 1SYKA 2BRMA 1Q97A 4BYIA 4I23A 1JOWB 4BI1A 3QBNA 4P5QA 3TV7A 4OTPA 3EYGA 4C38A 3GU6A 1YKRA 4O0SA 4ENXA 3FL4A 3R02A 1AD5A 5CAPA 3RINA 3UP7A 1IG1A 5I9UA 4AWIA 2PULA 1SVGA 3KXHA 4M3QA 4BZDA 4ANOA 2GQRA 3R1NA 1GIJA 3W1FA 3OVVA 3FJQE 5AWMA 3K3IA 4BDCA 5EOLA 3BE2A 4BCQA 4DFLA 3DV3A 4UN0C 2PVKA 5BYLA 3HV5A 4X2KA 3P5KA 2EVAA 5DOSA 4PPBA 3D14A 3AT3A 2ZB1A 5LQFA 3NDMA 4XX9A 3RBWA 2J0JA 3D7TA 5CASA 2P2IA 3M11A 4RC4A 5DMZA 1W98A 3DAJA 4JT3A 4MQ2A 1H1RA 1X8BA 2A27A 2HAKA 3O17A 4TW9A 4KB8A 2CPKE 5ETIA 4F7NA 3WZKA 3E88A 1ZRZA 4QT1A 4UMTA 4JXFA 2WKMA 4TKSA 4QMUA 3F82A 3HEGA 3TNHA 3QTQA 4AT5A 4YNOA 3GFWA 3ORLA 4MBLA 3C4WA 5EW3A 3VUDA 4I21A 2J0KA 3C13A 3V8SA 3VUTA 3DZOA 1BX6A 3F3VA 4HCVA 4DC2A 3OW4A 3Q5IA 4EHGA 2W1HA 2PZIA 5JFXA 2JBOA 3QFVA 3FQSA 2UZVA 2HENA 4RPVA 4X3JA 2P4IA 3Q52A 5M06A 1GZ8A 1P14A 2NO3A 3EN5A 3I1AA 3PJ1A 4FZ6A 5CVHA 4HYIA 4QMXA 4R3RA 3ZO2A 2VWZA 5E91A 3SXRA 4FZFB 4QQCA 4W9XA 2WEIA 3I6UA 3VQUA 2Z7SA 3SG8A 3VRZA 2C0OA 5HICA 2JDOA 3O7LD 2FGIA 1U54B 2ZYBA 2E9VA 4HGEA 3TUCA 3TNIA 4O27B 4XV2A 5TF9A 2PUUA 3ZO1A 2CGVA 4RJ6A 2XF0A 4IMYA 5CT7A 2HZ0A 4QYFA 3A7HA 2XIYA 5DPVA 5BVWA 4FIJA 2W0JA 4QOXA 4S33A 3ODZX 4NCTA 4DEHA 5K5NA 4KKEA 4RVTA 4ZTRA 5IUGA 4O6LA 4ZMEA 3L1SA 2PVRA 3P23A 1JPAA 2X8DA 4F7SA 5CI7A 5IA2A 5LMKC 4KNBA 2ZAZA 4FV2A 2G01A 4CFNA 4CRSA 4IB0A 5HE3A 2JLDA 5D41A 3HDMA 3EQHA 3DBEA 2VO7A 3MPMA 3Q96A 3GB2A 4BZNA 5HESA 4A9RA 3EMGA 2R3HA 4LV8A 4CFUA 3FAAA 3PFQA 1P4FA 1ZOGA 3BZ3A 4ANLA 4CQGA 3QGYA 2JD5A 1DI9A 4YZNA 1J7LA 3CY3A 3FDNA 4F6WA 1KE5A 4DGGA 2ETMA 4RLKA 2B9JA 2R0IA 3Q4ZA 1GOLA 3WBLA 1VJYA 4KWPA 5IQGA 1OIUA 1R1WA 5IF1A 3R8LA 1UWJA 2ERKA 4V04A 3HRFA 3NX8A 4NM3A 4F63A 2YCSA 1U4DA 3EFWA 3R1YA 5IG1A 3U6IA 3L9MA 3V5PA 2BDJA 3R73A 2YHVA 3LLAA 4DFXE 2H6DA 4LM5A 5EYMA 5HLWA 3EQBA 3NGAA 4AGWA 5KMJA 3ANQA 3OUKA 2OXXA 2YZLA 3U87A 4QTCA 3ZOSA 3DJ5A 5J1VA 2XJ0A 5ANDA 3QQJA 5HBJA 3P08A 4YZ9A 3UIUA 3SC1A 5GINE 1H1QA 1XH8A 2CSNA 4AE6A 2OFVA 4JDHA 4DAWA 2XCKA 3F3TA 5CEMA 3T9IA 4TYIA 2OWBA 5EM7A 2Q0NA 4C62A 2YFXA 1XH4A 2WTKC 2C6LA 3QAME 1Z9XA 2GMXA 3FXWA 2HIWA 4IE9A 5FQDC 2OLCA 5CTPA 2OXYA 2GHGA 5H3QA 4GL9A 4ZZMA 2PL0A 1O6KA 3EYHA 5CYIA 1AGWA 2PSQA 1ZAOA 2VWUA 4FV7A 3RCDA 1ZOHA 5AUTA 5M44A 2OBJA 3G6GA 2RGPA 2X7FA 3AC2A 4UB7A 3MFSA 2XNOA 3W18A 5BVFA 4XOZA 4IJPA 2WMWA 3SD0A 4NFMA 5DR6A 2C69A 3NPCA 4RWJA 4MEDA 4YGAA 3Q2MA 4RVKA 2JBPA 4MXAA 3DBCA 4G16A 2J9MA 4H3BA 4BDFA 3ZO3A 4FVPA 1NXKA 4TY1A 4TYEA 2REIA 3KMUA 3PVUA 3PZHA 3ZCLA 2QOIA 5HORA 5I9YA 4GT4A 3ZONA 1KE7A 4OGRA 3F6XA 3QA8A 5HI2A 2V5QA 4DH8A 3DTCA 2BRNA 4ANQA 2YZAA 4GU6A 5IPJA 4PTGA 4AOTA 1Y91A 2VU3A 3BLQA 4AOJA 1REKA 5CNOA 4BYJA 4UXLA 4AT3A 4KABA 4D4RA 3EKKA 3SHEA 4MD7E 2YDIA 4X2FA 4IAIA 4FNZA 4CYIA 4FK3A 5IEXA 1H25A 4YJTA 3VS3A 4C4HA 1H1SA 1ND4A 2J50A 4GJ3A 4QTEA 2R3GA 3D2KA 4QTAA 2YLFA 4FNXA 4DBNA 5DT4A 3GT8A 5C8NA 2UW0A 2W9ZB 4C2WA 3CPBA 5CF5A 4U9AA 3LCKA 4IB1A 3EHAA 5B0XA 1XQZA 4U8ZA 5E1EA 2ZMCA 3Q4CA 4WG5A 3ZO4A 2VGOA 5B7VA 4ZTSA 2QKWB 2OZAA 3F5XA 3O8TA 3S2PA 3TL8A 1QCFA 2IW8A 4EL9A 4CMUA 4S31A 4PMPA 1K3AA 2PVNA 3HMOA 4X2NA 5AR5A 5HCYA 4BCPA 4CT2A 4J8MA 5HX6A 5HIDA 3C4EA 3WYYA 3W55A 5HKMA 3C1XA 4WNPA 1IAHA 1ZZ2A 1R78A 3VC4A 3TJDA 3C0IA 2PYWA 3CQUA 3HA6A 4EHVA 3QCSA 3EQFA 1HCKA 5FBOA 5F9EA 5CNNA 1F0QA 3HGKA 4CV8A 2FO0A 4MBJA 2G1TA 3REPA 1Y8YA 2X81A 3KMMA 3KRLA 4W4XA 4YBJA 2BIKB 3EL8A 3PJ8A 4YJRA 2VGPA 3FZ1A 4IVAA 2Y4PA 1YVJA 2R3RA 4RIXA 4FIEA 3G0EA 3LJ1A 4CD0A 1U46A 3MIYA 4TWCA 2NPQA 4B9DA 2F7XE 4EWHA 5M57A 4FTIA 2XKDA 1E1XA 2YCFA 4XG4A 3W2OA 4BKZA 4D5HA 3OBJA 4HZRA 4KIKA 3QTSA 1TQIA 1O6YA 2QOCA 4I6FA 5KMNA 1VYWA 4AAAA 3DB6A 1KV1A 2W05A 4KINA 4CG8A 4F1MA 3D5UA 4FKIA 4YMJA 4GYIA 3FKOA 4I3ZA 5EM6A 4QQ5A 4Z3VA 3FI8A 2OGVA 3DY7A 4I0TA 2BALA 3C4XA 1MUOA 4YR8A 1Y6BA 4RJ3A 4EUTA 2CNUA 4AQCA 5FEDA 4U6RA 4DLJA 2OZOA 4C7TA 2WMQA 1OECA 1H1PA 3H9FA 5TKDA 2VTMA 4F4PA 4PV0A 1V0OA 4E6DA 3R00A 4O21A 5JQ8A 2VD5A 1ZARA 4FEUA 3RCJA 4J52A 2PWLA 1FVRA 3CXWA 3T8OA 3RVGA 3KEXA 3PVGA 4FF8A 5BNJA 3NNUA 4QMSA 4BF2A 4KAOA 5FWKK 3RK9A 4EI4A 1P2AA 3NW6A 3RM6A 3BLRA 5JZJA 2XRWA 4DH3A 5HQ0A 4RGJA 1PXKA 1YDTE 3QU0A 4YC8A 4BDAA 5CXZA 4YJSA 3TNQB 5LMKA 5EI2A 3QCXA 4UALA 3IQ7A 4W9WA 3FY0A 4ASEA 3R71A 2PZRA 3PUPA 3IDBA 2JC6A 4EQMA 3O71A 2WMTA 2ERZE 4RX5A 3LKMA 4FSRA 5HTCA 4JBQA 1FGKA 1KOAA 1M14A 2OICA 3MH1A 3QTRA 3SX9A 4A7CA 3P7CA 4FV4A 4G6LA 5IISA 3R7UA 5FXQA 4WRGA 4J96A 1PXJA 3UG2A 2OIQA 4ZMFA 4BTJA 1WMKA 4R8QA 4M67A 4MNEB 4L9IA 3HMPA 3ZLWA 2Q0BA 5I9VA 3A7GA 4ANBA 3DFCB 3BGZA 5DHJA 2G2HA 1W0XC 3OROA 5AM7A 2CJMA 2ZVAA 4QMWA 1JKKA 3R9OA 4AACA 3QRTA 1RQQA 3NS9A 3RWPA 1YRPA 4IVCA 3TACA 2HXLA 3TIZA 2OJGA 5IU2A 4ZLOA 1HCLA 4YO6A 1G8AA 1E9HA 4RQVA 4FI1A 4BTKA 1TKIA 3DU8A 3GBZA 4O1OA 5LJJA 3QCYA 3CQEA 4KRDA 5DVRA 5BUIA 1ZYJA 3M1SA 3I60A 4EKKA 1V1KA 1OKVA 4MF1A 2YM6A 2EXCX 3C4ZA 4IHPA 4RWKA 4E7WA 1NY3A 2VAGA 3PJ3A 4RX8A 3BU6A 4FIGA 3GCUA 5CEQA 3L8PA 4OTDA 3V6SA 4Y73A 4FG8A 5IQHA 2C5VA 3FC1X 3VF8A 4ALUA 1PJKA 3ET7A 3G2FA 4NM7A 1JAMA 4NEUA 5FTGA 1CMKE 4DN5A 2B53A 3OD6X 2GDOA 3IK3A 4C59A 4DINA 3RGFA 3WZDA 3BHYA 4UMUA 3A8WA 1UKIA 3DLSA 3Q4TA 4USDA 3MYGA 5LVPA 3W2CA 3PXYA 4I5CA 5JN2A 3NUUA 1YOLA 3KQ7A 4W4WA 4X6RA 4U80A 3ORZA 2UVZA 3ACJA 3TTJA 2OKRA 3MY5A 2Y4IB 2C5NA 2O65A 2UZDA 3B2TA 4M97A 3ZXTA 3GC8A 1SNXA 2R3FA 2YAKA 2F7EE 2RG6A 4O2PA 3F3ZA 2QODA 4G9RA 5HO8A 2BAKA 2XS0A 3WF9A 2WMRA 2C6TA 4KBAA 3WF5A 3B8RA 3ORKA 4O96A 1FBNA 2PPQA 2YDJA 2QOBA 4ORKA 3RPRA 3ZEWA 2ZDUA 4FTOA 3FZTA 3R1QA 2R7BA 4KKGA 5AM6A 2R64A 2GTMA 2RG5A 3HP5A 3VULA 3FPQA 5HG5A 4ZY6A 3VBQA 3TV6A 2VNWA 4F1TA 5ACKA 3N4VA 3GCQA 1PXIA 2VTTA 3ZXZA 1ZYSA 4RSSA 5BUEA 3W32A 2PVLA 1OPLA 3KF4A 4JG7A 4O0VA 4QNYA 1YXTA 4RJ7A 5AV3A 5DR2A 4C3RA 4R6VA 3UG1A 1E1VA 2W4OA 4U97A 3LFBA 2P0CA 1BI8A 1O6LA 5LCKA 3QZIA 5C8MA 3KA0A 4CFMA 4EK8A 3HNGA 3QX4A 4N70A 3KCKA 3OCGA 3BV3A 4IFGA 4F64A 3F88A 1QPJA 3VS6A 2EWAA 2Y6OA 5M53A 4YJOA 4Y5HA 3Q4UA 5BX0A 4B7TA 4EYJA 4LV5A 4AE9A 4V0GB 4LFIA 4FSWA 3ZMMA 2OZAB 3QQKA 3RHKA 3Q9WA 5C4KA 4XRJA 2C3LA 2PUIA 3FLQA 4N6ZA 4X0MA 3S1HA 4BI0A 4FEXA 3QRIA 3UNJA 2PU8A 3I79A 1WVWA 4O0UA 4EH2A 5FP6A 3U8WA 4XG3A 4U3YA 3TZ9A 3DB8A 3GC7A 4BBEA 4FEWA 1DS5A 3W2QA 5ETAA 5GIPE 2ITPA 4HPTE 4IC7A 4JG8A 3QKMA 1SZMA 4O7RA 3OXTA 3RNYA 3MI9A 4DA5A 4ZSGA 4DH1A 3I5NA 1OKYA 3E62A
chains in the Genus database with same CATH superfamily
4GYGA 4UZDA 5E90A 5CY3A 3LMHA 4BDJA 4H05A 1XH6A 1L8TA 4M0YA 2ITVA 1SM2A 3EIDA 2WMAA 2F4JA 2XZSA 4I0RA 5AP7A 4QEBA 3GEQA 3Q32A 4IC8A 3FXZA 4C4GA 4M8TA 1IEPA 2PVYA 4TPTA 1H0VA 3LXLA 3MS9A 2HWPA 2NP8A 3F5GA 5DRBA 2ZDTA 3ODYX 4G34A 4QP3A 4A06A 4BL1A 4JDJA 4ERKA 4FUYA 4G1WA 2Z7QA 4PMSA 2J2IB 2C6MA 2BRHA 2DUVA 2BR1A 2X0OA 4FT9A 4IEBA 4C3FA 4NU1A 3POZA 1CKJA 4E26A 2EU9A 5DI1A 4E4NA 1XHAA 3PA5A 4PDYA 4N4SA 5CAOA 4F7JA 4PDPA 1RE8A 5L6OA 4RWLA 4D2SA 4EOKA 5G1XA 4QQTA 2YIWA 1Q8YA 3FI4A 3RM7A 3HVCA 4WT6A 2F49A 5JH6A 4UYAA 1SMHA 1WCCA 4PMMA 2X7GA 5B2MA 4Y5QA 4A4OA 4I5HA 1BI7A 4XV3A 5AP6A 4EH5A 2JFMA 3NAYA 2W5HA 5IH5A 3KC3A 4FVRA 4ID7A 3QD3A 5A4QA 4LOQA 2QURA 3EZRA 3HYHA 4JS8A 4D28A 1PXLA 2ITXA 3ORPA 3R22A 2PK9A 3KB7A 3T3VA 2R5TA 5CI6A 4WOVA 3FYJX 3V5TA 5CSVA 2UZBA 5L8LA 4H1MA 4A4LA 4CFXA 5L8KA 4BY9E 4CSVA 4R3CA 1T46A 3A62A 4JIKA 3NVKI 3QLGA 4AN9A 3ZRMA 2PE1A 4TWOA 3UODA 4WHZA 4F9WA 5TOZA 1TQMA 3ULIA 3PWYA 3VW8A 2JDTA 2BHHA 4IM3A 3RPOA 3QCQA 2IN6A 4MK0A 3T3UA 4E5WA 4I94A 2HY81 4HYHA 1NVRA 3ZZWA 4Y83A 4BI2A 2GQSA 4YC3A 3O5AA 3OY3A 2WHBA 3PPKA 1U5QA 4M84A 3F2NA 2I0HA 5J7HA 4O7NA 4CKRA 3Q9ZA 4F9CA 1ATPE 2O2UA 4ZSEA 2UW4A 4OTWA 5T3QA 3RI1A 4A4XA 4A9UA 5LMBA 2PUPA 4IW0A 2JKMA 4J71A 3RAWA 3MESA 4GJ2A 1PYXA 3IECA 2C6EA 4O0WA 4Y95A 5CXHA 4BDBA 1GIHA 3QA0A 4CTCA 1GIIA 3N9XA 4PY1A 4OTGA 4QMVA 5HU9A 5IDPA 4M69B 4H39A 4P2KA 3D94A 4CEGA 3NAXA 4EC8A 5LOHA 2GHLA 3ENMA 5HG9A 3R8PA 4NYEA 4KSPA 4F9AA 3QHRA 4WG4A 3HECA 4ONAA 2QHMA 4XP0A 4O38A 1Q5KA 4JQ7A 4FIHA 3E63A 2Y4IC 4YZMA 5A4CA 4I4EA 3NMUF 5LVMA 2RFSA 4EZ3A 4ZSAA 2R3MA 3O8UA 3KY2A 3K2LA 4F7LA 2CGXA 5ANKA 3FL5A 4EBWA 3DJ7A 1Q41A 2RL5A 2W1FA 2OJIA 5D7VA 4B99A 2XARA 3SW7A 3W8LA 3NUXA 1RW8A 3C9WA 2XEZA 1I44A 2C4GA 2JITA 3PJ2A 4ZZOA 3E92A 4TNDA 5L2WA 5IEYA 4YURA 4DG2E 4C0TA 2Y6MA 4O7YA 4XH6A 3DTWA 4FG9A 3N4UA 4M0ZA 3SOCA 3TG1A 2WQNA 1JKLA 4B8MA 3LFFA 5A4LA 4MXYA 5C4LA 5E7RA 4CKIA 4PL5A 1GY3A 2WIPA 5HCXA 3SRVB 3HL7A 2I7QA 4M7IA 3QALE 5FUTA 3FQEA 5FLFA 3O2MA 4AA0A 4N6YA 3G9NA 4BWKA 4EC9A 4C3PA 3DGKA 2QOFA 4L52A 1PXNA 2J6MA 4IQ6A 4QP2A 4V01A 2B9FA 4YPDA 5L8JA 3SQQA 2WQMA 4J1RA 4IJ9A 5LVLA 4Z16A 3MY1A 3ZFYA 2R7IA 5M4UA 2IZTA 2OH0E 3KU2A 2GNGA 3QLFA 2FUMA 3GCSA 5IQDA 1DI8A 3E93A 4ALVA 3BU3A 5C1QB 4WUAA 4BCHA 4XG8A 3A7JA 2C6DA 4H58A 4BCOA 3F3WA 4U79A 1V0BA 4NTTA 4QP9A 4F6UA 2VWIA 2YIQA 3U9CA 3UDBA 4PX6A 2XAMA 4FSZA 3BHVA 4K18A 4YZCA 5IA4A 4AF3A 2XB7A 2X9EA 4XP3A 3DDPA 4JX7A 5ETCA 3WF6A 4AOIA 3HAMA 4IWDA 3VS1A 2DWBA 4MNFA 4RMZA 4D0WA 4DFYA 4E1ZA 4NZWB 3DQWA 1YOMA 2YACA 3AXWA 4IXPA 4KSQA 2W99B 3TUDA 3W10A 3PXZA 4BKJA 1WVYA 2UZNA 2X9FA 3HX4A 4CZYB 5I3OA 4A9YA 3HKOA 4AS0A 2C68A 2R0UA 1Q99A 2OI4X 2OIBA 1I09A 2WQEA 3FC2A 3JVRA 3SDJA 3ZYAA 3DNEA 4ZY4A 4CFFA 5KHWA 3SVVA 2P3GX 4JIAA 1OM1A 3Q3BA 2BFYA 4X2JA 5AFVA 3I7BA 4ACDA 3JY0A 3LXNA 3R8UA 4EOIA 4FT0A 3NUSA 3QTIA 3COIA 4BCMA 3DK6A 1OKWA 2XK9A 2YWVA 3I6WA 2W1DA 5FM3A 3PG1A 4AX8A 3ROCA 3W16A 2Z60A 1JNKA 4FT3A 4RVLA 2GTNA 4L7SA 4CVAA 4GRBA 4MXZA 3CD3A 3D4QA 5EHYA 4FODA 1G8SA 4J53A 1J1CA 3MB6A 5H8GA 2JKKA 3BX5A 3FMHA 4PDSA 4W4VA 3A7IA 5EYCA 2XBJA 3GCPA 1OBDA 5CT0A 2AEGA 2ZV9A 3N4TA 3N51A 4CTBA 2I0EA 5DT3A 1FVTA 3NRMA 3QKLA 4CLJA 3VUMA 5TO8A 4C4JA 3TUBA 5G6VA 3C4FA 3NYVA 3QC4A 3QZFA 5DEWA 3A60A 4QMYA 2W06A 2BIYA 4FKTA 5CU4A 4ITHA 4QMTA 4JI9A 3AC5A 2HYYA 3QQUA 5EDPA 5M07A 2VTNA 3R30A 3W2RA 3G5DA 1H07A 5H2UA 3MVHA 3ZLXA 3EWHA 4L53A 2WTCA 4B6LA 4RZWA 3W33A 4C61A 1PYEA 5GIOE 5HLNA 3GI3A 2IVTA 5CVFA 3NUAA 3KN6A 3GXLA 3HUBA 3FZPA 3BYMA 2XKFA 3NWWA 4L43A 4BIBA 2BHEA 4DGLC 3MGYA 2UW5A 3VS4A 3ALNA 4RJ8A 4DITA 3GQIA 4JBVA 2EB2A 1FPUA 4MYGA 1W84A 3UNKA 5HNGA 1LEZA 4O7TA 2Z2WA 1L3RE 4OBQA 4U41A 2G15A 2PMOX 4X7QA 2VTJA 4YJUA 5D12A 2WQOA 5BVEA 4G6OA 5ANJA 4EHEA 5HX8A 2QC6A 4NWMA 4MNEA 1XR1A 4TNBA 1R0EA 4FT7A 1VR2A 5AUUA 3BPRA 5IKWA 4AW5A 4USEA 4DGMA 1B38A 2CKEA 2W96B 3MBLA 4O0YA 1U59A 3DNDA 3R7IA 4YP8A 4DH5A 3OCTA 4B8LA 3FPMA 3EN9A 5HTIA 4U44A 3LCTA 4WSYA 4J98A 5KZ0A 5FDPA 3UNZA 3H3CA 4JRVA 2GS6A 2GPHA 2ITOA 2IWIA 1IRKA 4JVGA 4BR3A 3H9OA 3RMFA 2W4JA 2GU8A 3OWLA 4EHZA 4WRSA 2AC3A 4JOAA 3VW6A 1NW1A 1ZYCA 4AW0A 5HVYA 4E20A 4UZHA 4XRLA 4WBBB 4YZDA 2R3NA 2R3KA 2A1AB 4BTMA 4EKLA 1RJBA 1Q4LA 2IZUA 3QTUA 3QWKA 4AZSA 3GU7A 5HGIA 5HOAA 3CEKA 4BCNA 5I0BA 4DEDA 3QUDA 2OO8X 2A2AA 3CCNA 3F5UA 4D1XA 4FNWA 5FBNC 3DKFA 5KE0A 4ZSJA 4QMPA 3JUHA 2J0LA 5IH6A 2YWPA 2CKPA 3PJCA 5HTBA 3FMDA 1ZMUA 5KKRB 4K2RA 3EFKA 2B55A 3AD5A 3MA3A 5EDQA 3UOLA 3U55A 4DEEA 4YNEA 3UMWA 3UPXA 3AT2A 4OTFA 5DA3A 3UOKA 2FSTX 2WTVA 1MQBA 4ZOGA 5HG8A 2FSOX 2E9PA 4TYHB 5ACBC 4DEGA 5CALA 3ML1A 2YABA 1UU9A 2QR7A 2IW6A 5F94A 5E8ZA 3PSBA 2JDVA 3HMMA 4K0YA 5GJGA 4DFZE 4DYMA 5AV4A 5K9IA 3DZQA 4LRKA 5CVGA 2QU5A 3E3BX 3Q5ZA 5D10A 4OBOA 1GZOA 2XK8A 4M15A 3G15A 1Q61A 3P78A 3PLSA 4MCVA 1TVOA 3E8NA 5ANEA 2Y9QA 3CGOA 3UOJA 4J99A 2HWOA 3BI6A 4QO9A 3A7FA 3DQXA 3QQFA 3LM5A 1OL1A 3NR9A 2VTOA 3HV4A 4LRJA 5ETFA 5ICPA 2JAMA 2JIUA 2XIRA 2ZV8A 2EXEA 2J90A 2YJSA 3OWJA 4D2TA 4CFVA 4S34A 4I5MA 2YAAA 1Y8GA 3AC3A 4FTQA 3MY0A 4ZS0A 4BWPA 2YM8A 4FICA 4RA5A 3IDCA 3AKJA 4CGAA 4PUZA 1LR4A 3QUEA 5HE1A 4FV6A 3QTZA 1A9UA 3PTGA 2LAVA 3PE2A 5AUWA 3Q6WA 1MRYA 2XM9A 3WYXA 4BDKA 4E8AA 3TI1A 2XKCA 2B4SB 2OJFE 2C6IA 3QF9A 3OEZA 3GUBA 4G3GA 4FC0A 5K4JA 2C6OA 3HMIA 1YQJA 4V0GA 2QOOA 5KMIA 4BZOA 5TT7A 1M2PA 4MVFA 4PRJA 1ERKA 1WBOA 2BKZA 3KRWA 4CCUA 1PMNA 5GHVA 4O0TA 3KGAA 4CMOA 5KBQA 4FE2A 5EQYA 4K77A 4K33A 3R6XA 4DG3E 1ZYDA 5KO1A 3FKLA 2GFCA 5JGAA 4L68A 3QC9A 4HOKA 2J5FA 3DBDA 4D2PA 3F9NA 3NW5A 5EI8A 2IVUA 3KK9A 3QX2A 4XEYA 3ZU7A 3HRBA 2B9IA 4DG0E 4EEVA 2UW8A 5E8TA 3PRFA 4GK2A 3T9TA 4ASXA 1YW2A 3WIKA 4O6EA 3HV6A 5M51A 2BDFA 4FYOA 2WOTA 1REJA 2O63A 2QNJA 4BHNA 4RIWB 1H24A 5EQPA 4J7BA 3UE4A 2IZSA 2RFNA 1VEBA 3OCSA 4KBKA 4ZXTA 3AMYA 2J5EA 3R04A 4GKHA 3P4KA 4BBFA 3U4WA 5HEZA 4XYFA 4I6BA 3VHKA 4BBMA 3NYOA 5L4QA 4O2ZA 3DS6A 3RHXA 3CR0A 3OP5A 3FMMA 1PKGA 4UX9A 2W5AA 4FL2A 4IX3A 4P90A 4UWYA 4ZJVA 3EFLA 1OIYA 5B2LA 3DKGA 1YI6A 2GSFA 5IMEA 3VUHA 3FQHA 3A61A 2XJ2A 1WBWA 2R3OA 3A4PA 3EQDA 4PWNA 4RZVA 5JFWA 3S00A 4QDVA 3DOGA 1H8FA 3FWQA 3BL9A 3WILA 4RBLA 4ZTLA 1R39A 4F6SA 1ZXEA 5M44A 1JSVA 2WAJA 5HO6A 2BKKA 4G31A 2BVAA 4ZEGA 1ZMWA 3ERKA 4O83A 4DFUA 2WMUA 5A4TA 5DE2A 4Q5HA 3ZLYA 4IBMA 4XBUA 5I5ZA 4E4LA 3RAHA 2O64A 4MKCA 5M4CA 3DCVA 3HUCA 3IW8A 4AAYA 3FLZA 2RFDA 4P5ZA 4A07A 2B7AA 4XLVA 2FSMX 3IW5A 3QZHA 2VTHA 4QMZA 3QTWA 3VUKA 4ZZNA 4U40A 2QLQA 4Y72A 3OG7A 5TR6A 1OPKA 3E8CA 4HGSA 4S2ZA 2ZMDA 4LUDA 4KBCA 3UDTA 5FEQA 4LGHA 3GP0A 2CCHA 4XMOA 3GNIB 4XG9A 3NW7A 4FKJA 4UY9A 3AKLA 5LVNA 4YHJA 4FZDB 4YJQA 4EWQA 5EHOA 2BZIB 1R3CA 3FSFA 3EL7A 3PZEA 4O4CA 3EN7A 4FTCA 2ITUA 3I0OA 3TKIA 4XG6A 4GK3A 4YPSA 4GG5A 3NCGA 4NIFB 4ZJJA 2I0VA 3P79A 4FTMA 4D58A 3AC8A 3R1SA 2FH9A 3KXGA 2XIXA 2AQXA 3D0EA 3OS3A 2YISA 2Z7LA 4TT7A 4ACCA 1OB3A 4BB4A 5JFSA 3KRJA 4U7ZA 3TZ8A 2E2BA 4M69A 4NK9A 4PMTA 5CU2A 2VWVA 1JWHA 3F2RA 4FTUA 4F9BA 1H27A 3E87A 3LFQA 3LIJA 4G9CA 3MPTA 4GU9A 2BDWA 2VTIA 4JX3A 5DG5A 1CKPA 5KCVA 5KKRC 2X4ZA 1OIQA 3NUYA 1UVRA 4P7EA 3FXXA 3OHTA 4IVBA 4MXOA 4S32A 4RLLA 5F4NA 5CEKA 5E4HA 3GGFA 2WQBA 4U3ZA 4C2VA 3NLBA 2B0QA 5HIBA 4RG0A 4H1JA 3DBQA 4HNFA 4FOCA 1FMKA 3KRRA 1PHKA 5DR9A 5C01A 2H9VA 3QXPA 3MH0A 1H08A 3RKBA 3RZBA 2LGCA 3EZVA 4AT4A 4CZUA 3LE6A 3R7EA 4G5PA 2XAOA 4Y85A 4MD9E 3OUNB 3LLTA 4B0GA 4QP4A 4I41A 4BGHA 4GUEA 3VHEA 1Q8TA 3CY2A 1YXUA 4DGNA 1YWRA 2IW9A 3OW3A 4LMNA 4QRCA 3GOKA 4IZYA 4H3PA 4FSQA 4EQUA 5CANA 4OT5A 4MF0A 3GCVA 4AUAA 5A14A 2HZIA 3VBVA 2VTRA 4R1YA 5CSWA 4ASZA 5DT0A 2IPXA 3V3VA 2VNYA 3VS0A 4XUFA 3BHUA 5JK3A 3PSDA 1LUFA 3MFTA 3TTIA 2JDRA 3SRVA 3CBLA 3I0QA 2GNIA 4FJVA 4L7FA 5M56A 2CKOA 1OL7A 4ZSLA 4EQCA 2QO7A 3EKNA 3ZFMA 4O81A 4APCA 3LFSA 3QQGA 1GJOA 3D5VA 3G6HA 1Y6AA 3D83A 3KF7A 5HBHA 5CSPA 2SRCA 2ITTA 3W0PA 1NVSA 3BBTB 4QP8A 2GFSA 3UPZA 3MIAA 4BDHA 3G51A 2F7ZE 4EK6A 3FZRA 2C0IA 1A48A 1GZNA 2NYAA 4IAZA 5CENA 2IO6A 2C30A 5CU0A 2XANA 5KZIA 2QOHA 3KK8A 4A9TA 2QOQA 3CQWA 3EJ1A 2XH5A 1UWHA 3C51A 3JVSA 2P33A 3SXSA 3D2IA 4WNOA 4OAVB 3LFDA 4BWXA 2BZKB 3UZPA 3QGWA 2E9OA 1Q8WA 1H26A 2W1ZA 3QHWA 5LXMA 2BFXA 2C47A 3JYAA 3VAPA 3C5UA 3E8DA 3PY1A 4R7IA 1BKXA 1B39A 4ZJIA 3ZC6A 2AC5A 2B9HA 4S30A 2CGUA 3QKKA 2VX0A 4HVIA 3PUFC 4MWIA 5H9BA 4LUEA 3KFAA 5EYDA 4AG8A 4AN2A 3PLAE 2BCJA 4C8BA 4HCTA 5HNIX 3TMOA 3GOPA 4YTCA 1UU8A 5HD4A 5BMSA 2WZJA 5C27A 3QD0A 3IW4A 5JKGA 2WPAA 4PNKA 5LWNA 2HCKA 3CS9A 4GV1A 4BJJB 4IH8A 4ANNA 5ITAA 3MB7A 4RFZA 3WIGA 2CN5A 3KVXA 1KUTA 2UW9A 4KS8A 3CPCA 4NFNA 3MSSA 1S9JA 5J9ZA 4YC6A 3G33A 5DEYA 5BQ0A 3EB0A 4OLIA 3HP2A 3V8TA 1F3MC 3WZUA 4AXAA 2WFYA 2XA4A 3Q6UA 4NW5A 3OBGA 4RC3A 3IONA 4EYMA 2QG5A 4E5BA 5LARA 5EYKA 4X3FB 5CSXA 3L8XA 2WELA 4CFWA 3LOKA 4DHIB 3UBDA 2OJJA 5AIKA 5CSHA 5AV0A 3S4QA 2XNBA 3FYKX 5EKOA 4J97A 2IEWA 3V5QA 4FTLA 4GCJA 4GH2A 3H30A 3LFAA 3FLYA 2XM8A 1CDKA 2BRBA 3R7YA 4Q9ZA 3FMEA 4X2GA 3MJ2A 1ZMVA 5BYZA 2OF4A 4FOBA 3SA0A 5IA0A 4G5JA 5CEIA 5FG8A 2X2KA 4L67A 3SOAA 2PHKA 3ATTA 1WBVA 3VN9A 1YXVA 2VTSA 3GVUA 4XNEA 4ARKA 1OIRA 4NL0A 3R9NA 5AA8A 4ITIA 2CNVA 3LCSA 1DAYA 4JDKA 4BKYA 4BGGA 1YI3A 4LRMA 4P4CA 2BAQA 4IWQA 3II5A 1Z5MA 5CF6A 5KBRA 2ITNA 3MV5A 1KE6A 3IKAA 3KKVA 1YWNA 2XIZA 3QQHA 4GSBA 4M68A 4F70A 4IAYA 2WTDA 3NIEA 2G9XA 3ZM4A 4XHKB 2VX3A 3KVWA 1M2RA 4PP7A 4LGDA 5AX3A 3C7QA 4C35A 3DXPA 4G3CA 3LQ3A 4FSYA 1H0WA 3DKCA 4MWHA 4YJNA 1W7HA 3P9JA 4CMTA 3D9VA 3CKXA 3LZBA 2HOGA 5HNBA 4EOSA 4I20A 3ULZA 4OBPA 2V22A 2UW7A 4PPAA 1Q8ZA 4E93A 2J4ZA 4JAIA 4MD8E 4GFGA 2C1BA 3BE9A 2BTSA 2E9NA 1J3HA 3R7VA 5CF8A 3PDTA 1XH9A 1H01A 2VUWA 2ACXA 2O5KA 4W8EA 4AFJA 5CWZA 3DA6A 3ORNA 1M52A 2ETKA 5J87A 4NJDA 2FSLX 3FHIA 4U0IA 5D11A 3WE4A 2UZEA 2WMXA 2UV2A 3UOHA 3E3PA 5KHXA 2C0TA 2C5OA 3KXZA 1M7QA 5CEPA 2VWWA 3JXWA 3H0ZA 3OT8A 2HZ4A 2XYNA 4JR7A 5FP5A 4F09A 4D4VA 3PRIA 3F7WA 3R01A 4E3CA 4WO5A 5AP0A 1XJDA 4CNHA 4Z55A 4O91A 4R77A 4MHAA 5JT2A 1H4LA 3UDZA 1UA2A 2X7OA 5CU3A 3F2AA 5GNKA 3EQGA 3IS5A 3RAIA 3MH3A 5E92A 4WNKA 2QVSE 4JMQA 1ZY5A 2RIOA 4XBRA 5ANOA 1TZDA 3CC6A 3QD2B 4HVHA 3RJCA 3UC3A 3ZSIA 1F5QA 2PVFA 3NUNA 2WO6A 4D2VA 3THBA 4DLIA 4JDIA 2XK7A 4BCFA 2H96A 4DHFA 2WGJA 3RALA 4TWPA 4HPUE 5EFQA 5J79A 3MA6A 5IQFA 5FXRA 5AAEA 3SG9A 4GIHA 5D1JA 2F2UA 2AUHA 3R2BA 3RK5A 2E9UA 4MUQA 3OTUA 4YJVA 3UVRA 3LM0A 3NNXA 3TN8A 3RAKA 2A0CX 3SLSA 4RC2A 4Y46A 5EW8A 4C4IA 2GNLA 2PUNA 4QDEA 3IGOA 1FVVA 1OMWA 3UJGA 3R9HA 3TWJA 5HU3A 4QTBA 5L6WL 3MW1A 5JQ5A 4TYHA 1M7NA 3MDYA 2PVMA 4DFNA 2WNTA 4GG7A 2WEVA 4JJRA 4FKQA 2B1PA 3R8MA 4AZTA 1PMVA 4IFCA 4I6HA 4K11A 3DLZA 4NM0A 4OUCA 3C50A 5AEPA 2UZTA 5JGBA 3A2CA 3CD8A 2R3PA 4I6QA 4II5A 4WG3A 3H0YA 4RJ4A 3S3IA 3TKUA 4EOLA 1GZKA 5CZIA 3PA4A 1J1BA 3WOWA 4RX7A 5ANIA 2ZM1A 4DCAA 5C9CA 2CN8A 1BLXA 3R7OA 1TQPA 5DFPA 2ITQA 4E5AX 4HYSA 4D4YA 4L6QA 3OCBA 4F0FA 3BHTA 4RX9A 4TTHB 5IQEA 3W0OA 4BVUA 5JZNA 1UV5A 3UQGA 2JGZA 4MXCA 4EJ7A 2ZM3A 3IGGA 4RWIA 4FUXA 4CZTA 5BVNA 1FGIA 3K54A 3NIZA 2IZRA 4O0RA 5DN3A 3ZBXA 5EOBA 4BRXA 3PWDA 4OTHA 3CIKA 3O0GA 4ITJA 2VO6A 2BUJA 1JVPP 5T6KA 3ALOA 3EQPA 5CQWA 2YM7A 3QWJA 4L01A 3BU5A 1OITA 4MQ1A 3OC1A 4OTIA 3RPSA 5IA5A 4A9SA 4GFMA 3GC0A 4O7VA 4HJOA 3P86A 4QP1A 5L2TA 2BZHB 5GJFA 3EOCA 1H28A 2BAJA 5BVOA 5AP2A 4M14A 3EQCA 4UWBA 3ZUVA 5IDNA 4R1VA 4AW2A 4TN6A 4RIYB 1IA8A 2AYPA 2XVDA 3UTOA 2IVSA 3I5ZA 4LGGA 4X3FC 4HVSA 3PIYA 4RFMA 4C37A 3BCEA 3IOKA 3DAEA 4QMQA 5EM5A 2C6KA 5DRDA 4C33A 2C5YA 1NVQA 3LW0A 3FMLA 1APME 5IQIA 4D2WA 4FEQA 3COHA 4L42A 3MFRA 3R2YA 3A99A 1OUYA 1KE8A 1WZYA 3PVWA 1YHSA 1CSNA 2XNGA 3DFAA 4FSUA 4LQMA 4RIWA 3AMAA 3RK7A 4O82A 2C5XA 2XNNA 3PPJA 1FMOE 5EG3A 4FV9A 4I0SA 3PY0A 3QXOA 4PQNA 2QONA 1BL6A 3SXFA 1VLRA 4EK5A 3WF8A 2QI8A 4QYGA 5IQBA 2VWXA 2EUFB 4FMQA 4NUSA 5M55A 4YU2A 4QNAA 2VV9A 5AUYA 2PZPA 3O7LB 4FKVA 4R3PA 4AXEA 4QTDA 3BGPA 2Z7RA 3MJ1A 3BLAA 3TJCA 4DHZA 3O50A 3UZTA 1ZWSA 3HDNA 2BPMA 3U51A 2VX1A 3UYSA 3DK3A 5KUPA 4Z9LA 3ORTA 3BL7A 2CNQA 5DIAA 3GC9A 4G17A 4BDEA 4O4DA 4EOOA 4DDGA 5AAFA 5AR7A 3V5JA 2ZM4A 4G3EA 5GJDA 4C34A 1QL6A 2O8YA 4EOQA 3B2WA 1PW2A 4GT5A 4N0SA 4RQKA 4O84A 2WMVA 2X6EA 5C8KA 4HGTA 2QO2A 3VJOA 2R4BA 2QOKA 5J95A 1MRUA 3EH9A 3OT3A 4PF4A 4U42A 4WSQA 4BCJA 4F78A 5AADA 4ACGA 3IW6A 3CE3A 2Z02A 3R7GA 3UO5A 5TE0A 3UO6A 4AZVA 3M42A 4G2FA 4BCKA 2I6LA 2UZUE 2X6DA 2HXQA 3O23A 3VO3A 1KE9A 4E73A 4JQEA 4XJ0A 1HOWA 3F61A 3C5IA 4YJPA 5E1SA 4DT9A 2UUEA 4K1BA 4NW6A 3HZTA 5LWMA 2PE2A 2YIRA 2ZV2A 3CGFA 2Q83A 3R9DA 5E8VA 3SW4A 4APPA 1DAWA 2JKQA 3BEGA 5FDXA 4DE4A 2XYUA 3COKA 2W1CA 2QD9A 2BZJA 2R3LA 4YTHA 3ZLSA 1A06A 1OZ1A 2ZV7A 5L3AA 2JEDA 1XO2B 1UNLA 5AV1A 3PFYA 2A4LA 3RPVA 4NIFA 4EONA 4XS2A 3VS7A 4CXAA 4X21A 1FOTA 5EH0A 3IOPA 4FBXA 3JS2A 4AZFA 2XNEA 4F1OA 2WU7A 2WMSA 3LAUA 4BDIA 4CYJA 1OUKA 1Q62A 2QLUA 3AGLA 2HW6A 3AT4A 3VF9A 2V7AA 2VWBA 4YHFA 3WE8A 3IO7A 2NRYA 4EORA 1KSWA 3BIZA 4ZK5A 4FR4A 3GQLA 2WB8A 2DYLA 2WTJA 5EW9A 3H10A 4AP7A 5K5XA 4AGDA 4FNYA 2YCRA 4IAAA 4MTAA 4IX5A 3V04A 1YXXA 3NYNA 4BN1A 2YCQA 1K9AA 1IR3A 2XMYA 4WNMA 4D1SA 2OXDA 3TCPA 5J8IA 1H1WA 2I0YA 4UXQA 4EH3A 4KKHA 5DNRA 2QG7A 5IUHA 1T45A 1ZZLA 1B6CB 2XCHA 3Q60A 4FYNA 4IX4A 3VJNA 3W2SA 3LFEA 4H36A 1OKZA 4PP9A 3PYYA 4RIOA 4XV9A 1XH7A 2ONLC 4Y8DA 3BHHA 1WVXA 1YHVA 5F95A 3R8VA 3F69A 5EHLA 3U54A 5DGZA 2FB8A 2JAVA 2JKOA 2YDKA 5E8UA 4TWNA 5EQEA 5AMNA 1OBGA 3F66A 4FGRA 4IAFA 2VTLA 5DH3A 2IJMA 3V5LA 3PXQA 2ESMA 4QPAA 3AGMA 3IDPA 1IASA 3HV7A 3FEGA 5L2QA 5F20A 5AIRA 4GK4A 3EN4A 1JKTA 1KWPA 3GU8A 4PTEA 4QP6A 4OTQA 4DTBA 4ZAUA 3ZS5A 3CTHA 4WD5A 1NA7A 3UIMA 1U5RA 2WD1A 3BKBA 4FKPA 4DCEA 5JFVA 3GU5A 3TT0A 3VVHA 4E6QA 4YBKA 5BYYA 3FUPA 2HELA 4ZLYA 3I81A 2UVXA 1XWSA 4LOPA 5AX9A 1OL5A 4ALWA 3NYXA 3HA8A 5IQCA 4GT3A 2QQ7A 2XK4A 4BCIA 3K3JA 4EH4A 4R78A 4DT8A 3UC4A 4QYHA 3PG3A 2W7XA 3F7ZA 5HBEA 4BGQA 3HRCA 3E7VA