4P5QA

Human epha3 kinase domain in complex with quinoxaline derivatives
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
publication title Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 275
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p5qA01
4BGGA 3ATSA 5FP5A 5AIKA 5L2WA 4K2RA 4P90A 4QOXA 1ZZ2A 2JDVA 4FG8A 4H36A 4FG7A 3LQ3A 5FQDC 4WBOA 3LE6A 4NM0A 2C4GA 1LEZA 3ALNA 3FMHA 3HMPA 3OUNB 2R3PA 4J99A 4YP8A 3E62A 3QWKA 4W4XA 5JSMA 2RF9A 2ERKA 3OY3A 4DCEA 1HCKA 3DJ7A 4R78A 2OKRA 2JEDA 2XNOA 4MBJA 3D15A 3NCZA 3UO4A 5IU2A 3QTIA 5EYCA 2H9VA 3B2TA 3Q9WA 2OU7A 3BCEA 3CS9A 4RIWB 3LFEA 5CAOA 1GY3A 5EDPA 1W7HA 1RQQA 4BBMA 3KXHA 3MTFA 2HOGA 3R9OA 5H3QA 2VRXA 3AC2A 2JIVA 1WVXA 3ZYAA 2J50A 3FLQA 5HBJA 4NSTA 4CCUA 2QOHA 2J4ZA 5EDRA 5HTIA 1FVTA 3PXQA 3KRJA 5ACBC 3E92A 4ZIMA 3JR1A 5CEQA 1YOLA 1H0VA 3Q4TA 2JKOA 4CNHA 4ZJVA 4CKRA 4I6BA 4TN6A 3BZ3A 4DBNA 2C1BA 4FIHA 4D9TA 3PJ1A 5LQFA 3L9NA 3D9VA 3LMHA 5I9ZA 3NUPA 5KZIA 3R30A 5D10A 3I7CA 4DGNA 4L42A 4D5HA 4E1ZA 5AUTA 3GU6A 3P23A 3PLAE 5HORA 4XG9A 3E8NA 3VUIA 1ZWSA 2PK9A 3ET7A 3I81A 4J71A 3K2LA 1NA7A 1YDRE 3F5UA 4PDSA 4YJPA 4CV9A 4QMQA 3G0EA 4KS8A 3KVWA 3H9RA 1BUHA 4I5HA 3EN7A 5JMSA 4AU8A 3BYOA 4DINA 1UA2A 5AX3A 3AOXA 5LARA 4BDCA 4R8QA 3UYTA 1FMOE 1TQIA 3HMMA 3NRMA 4YJNA 3E8EA 2C0TA 2J0LA 4UYAA 3ZCLA 2GQSA 4BTKA 4DBXA 4M14A 4O7WA 3MYGA 4C34A 3ORZA 3DAEA 3PG1A 3RWQA 3PXRA 4I0SA 4JR3A 3KULA 3U54A 1GIHA 2PMOX 2R5TA 2VO3A 4Y46A 3CD8A 3KC3A 3ORNA 3NUSA 1FGKA 3P86A 4D4SA 3E64A 5HNBA 5BVFA 4DCAA 1SVEA 4I4EA 1DAWA 4OBQA 4U5JA 3V5JA 3ZFMA 3K3IA 3L9PA 5AUVA 2JD5A 4G6LA 5AP3A 4FTJA 3P79A 3HKOA 2QOLA 3QYZA 4FNWA 5F4NA 4ARKA 2YDIA 3DBFA 3KVXA 3SX9A 3WOWA 4EUUA 4YURA 4QQCA 3CKXA 3ZRMA 3U4UA 2PVHA 3C1XA 4YJOA 3RAIA 4O0WA 4QTBA 3HZTA 3TJCA 3UIUA 4M84A 2YA9A 3O8UA 4MBLA 1H28A 5F95A 3OFMA 2Q83A 5E90A 5GZAA 4BI2A 3D14A 1PXJA 4ZTQA 5KHXA 3CE3A 1IASA 3GOKA 3HRFA 2VD5A 3UP2A 5FM2A 2WMXA 2QQ7A 2W5BA 5JGDA 3EOCA 3OXTA 4RWJA 1HOWA 4M7IA 4QMZA 3ZH8A 4BDJA 4E5AX 1DI8A 4RX5A 4C4HA 4YUQA 2PZIA 3KRRA 4MHAA 3MA6A 1KE9A 3QQKA 4BCPA 3TNQB 3OWJA 4RIWA 3BLHA 3ODZX 5H8BA 4AA5A 5C8NA 3GFWA 3N51A 3TACA 5K5NA 3PVBA 4AACA 3BIZA 4ZXTA 3RHKA 2GS7A 1OL5A 5CSWA 5CANA 2RFSA 5EW3A 1Q62A 4CT1A 4F09A 2C6LA 4HVHA 4XLIA 1J1CA 4YTFA 4GKHA 5CWZA 4OTHA 4JAIA 2VWYA 2VWUA 4EJNA 5AR8A 4JDHA 2BDWA 4NH1A 1WBVA 2BRNA 2CPKE 3O0GA 3ALOA 3F3WA 5D41A 4AE9A 4Z3VA 2YZAA 5J8IA 3RPOA 4DH3A 5KMOA 4C0TA 4G9RA 4U42A 2QOIA 2ITXA 1KOAA 2BZJA 4IWQA 2YLEA 3O23A 4XYFA 4KBCA 4FF8A 4DT9A 2C6OA 3R2YA 3V5LA 1JSTA 3QWJA 4LQMA 3OCBA 4CTCA 4M69B 3EN6A 2Z02A 3R9RA 3PIYA 3PY1A 2F49A 2W05A 2QR7A 2BZHB 1IAJA 2Z8CA 3CP9A 5IDPA 2FH9A 3NNXA 2BALA 4YHJA 4DTKA 3AC1A 2R3MA 1DAYA 3AXWA 5HCZA 5E8TA 1TVOA 3W16A 4NM7A 4D4RA 3V01A 3NIEA 5EW8A 4IWOA 2GNGA 4EKLA 1K9AA 4UZHA 1J3HA 4EOIA 5EW9A 4GIIA 3MFSA 2PU8A 4WNOA 4CG8A 3C50A 3RI1A 1UVRA 5FLFA 4NWMA 4DC2A 2EB2A 2YIQA 3NEWA 3ZLYA 2XKFA 3PRIA 3MH3A 2BVAA 4EEVA 4GW8A 5M56A 3GQLA 4GU9A 1REKA 4FVRA 4AW0A 2YM4A 4CEGA 3F69A 4WOVA 4E4NA 3ORPA 4XRLA 4JX3A 2AC5A 4KUJA 3JY0A 2BAJA 3HUCA 3LFCA 5E8UA 3SG9A 3S3IA 1XBAA 4O0XA 2QLUA 3TTJA 5L6OA 4IFGA 5AAFA 2BPMA 2KULA 2UW6A 3MBLA 5CY3A 2XH5A 5FEEA 3W33A 4N4SA 2G1TA 3MB6A 5AR7A 5IISA 2H96A 3I0QA 4AW5A 2UZEA 2W5HA 4FIJA 2Z7LA 4FK3A 5FTGA 4IAAA 4P7EA 3SG8A 2OICA 2E9VA 4GT5A 3A61A 4RFYA 2VTOA 3QTWA 4GV1A 5GNKA 1PJKA 2R3OA 4QP1A 3W8LA 4QNYA 3PIXA 4I3ZA 1P5EA 2O3PA 3OWPA 3VRZA 3LKMA 2XIZA 5M09A 4CVAA 5IQEA 3UNKA 4OTWA 4QTDA 5KNJA 1KV1A 4DH7A 4XOZA 1H01A 1UNLA 1X8BA 2QOBA 4TYJA 3MGYA 4QP6A 4ZJJA 4RX8A 3V5WA 4BI1A 4G31A 3BYSA 4AZWA 3HV5A 3QC4A 5CI6A 3LPBA 4BDDA 3RK5A 3SC1A 3ZLWA 5HICA 3F66A 2VGOA 5HCXA 4E6AA 5J9ZA 3GU4A 1MP8A 4FEVA 4KA3A 2C1AA 4FKSA 5HD7A 3GCVA 3ZFYA 2XYNA 4ALVA 4RLLA 4KKEA 2QOKA 5CVGA 5HHWA 1WCCA 4PMMA 2UZLA 3KB7A 5EDQA 4I0TA 3VJOA 3Q9YA 3W2CA 3SVVA 4WSYA 3UJGA 5D1JA 2XIXA 5GZ9A 2WQEA 3NW6A 2WB8A 2WMVA 1PXLA 2PVNA 4ZJIA 4LGDA 2VTNA 2HY0A 4AZVA 4U8ZA 2X6DA 4IM3A 4H39A 4M69A 5DMZA 2PE1A 2A0CX 4TNBA 1U46A 1WFCA 1YDTE 1JWHA 3NUNA 4V04A 4AG8A 5BUIA 4AAAA 3D2KA 3TZ8A 3W2OA 2PUIA 3ORMA 3FLYA 1BKXA 4NCTA 4GT4A 4LRKA 2JGZA 3QCSA 4ANOA 3HLLA 4BKJA 2XYUA 3OMVA 1GZKA 3I79A 3R7EA 4GK2A 5LVMA 3BE9A 5AP7A 4QYYA 3IK3A 2O8YA 4D28A 4WUAA 2OSCA 3GEQA 4O7ZA 4ZLYA 3PXKA 3U9CA 4ZSJA 4RLKA 3F2AA 2W4JA 3IKAA 3E8CA 4MWIA 5I3RA 5L4QA 3JVRA 4QMMA 3C4ZA 2KTYA 3MB7A 4KINA 4UMRA 4GCJA 5E8ZA 3QTSA 3JUHA 4YJQA 2C3IB 2O2UA 3QRUA 3ZDIA 5H8GA 2NNWB 1SMHA 2VX1A 2Z7RA 1PHKA 2UW5A 5I9XA 5JT2A 3C9WA 3ZSHA 2EVAA 2VWVA 4BC6A 4JLCA 4QYHA 2QU5A 5FD2A 3SOAA 2XF0A 2HW7A 4O7YA 4ZEGA 3DKFA 3WZKA 2QHNA 4BI0A 4F08A 1H1QA 1WBPA 4S34A 2E2BA 4IJPA 3UOHA 3NLBA 1OZ1A 4ASDA 5CALA 3LCOA 4FSZA 3LZBA 4AOJA 4BDIA 2E9NA 2P4IA 3HUBA 1AGWA 1ZARA 3ZTXA 3BU6A 4EZ3A 4HGLA 4C7TA 2V22A 5IMXA 4FSWA 3PXYA 3A62A 1XBCA 3FI3A 2ITPA 4WO5A 4G3DA 5AP0A 3TKUA 3CJGA 3W55A 5EM5A 4OGRA 1Y6AA 5CF4A 4ZTHA 3CPBA 5HBEA 4I5PA 2OH0E 1TQMA 2WD1A 4BL1A 5CSHA 4RGJA 2IW6A 3TM0A 2NP8A 2HZNA 5AADA 2AC3A 4QYEA 2WAJA 2R3JA 4ZTMA 1M14A 2W4KA 4E5WA 3EKNA 2JDSA 4M67A 4BB4A 1FINA 4IAZA 2XJ2A 3RWPA 1JNKA 5A46A 3RZFA 2BZKB 4IX6A 4I41A 4JDJA 4TWNA 3V8TA 3QKKA 4Y5QA 4YBJA 5TKDA 5IQBA 4ZTSA 3IECA 4KBKA 4R3CA 3UNZA 5IEYA 3WYXA 3E7OA 3PE2A 5HE0A 3F5XA 4W8EA 1CDKA 2WTKC 1ZYLA 1FGIA 2GNIA 4FYOA 4WBBB 5ETIA 3R8ZA 4U97A 4DEIA 3CJFA 4YHTA 2VGPA 3NW5A 4TYEA 4BTFA 2C30A 4TWCA 5HVJA 1TKIA 2IN6A 1YXVA 3FMEA 4GYGA 1HCLA 2F7EE 1OMWA 2V55A 5D9HA 2P3GX 3QTQA 5F20A 4CQEA 4FV6A 2EXMA 4I0RA 3FEGA 3R0TA 4NKAA 3FY0A 1W83A 2H8HA 2X39A 5HVYA 2YITA 3WZUA 3VRYA 4MXCA 2GFSA 3WF8A 3DTWA 4D1XA 3D5UA 3UPZA 4FV2A 4L67A 2JDOA 5DFPA 4EHVA 1CKIA 3F61A 3EFWA 3IW6A 5J9YA 1G8AA 1PXNA 3LMIA 2EXCX 4QQJA 3IO7A 4ZY4A 1G8SA 4RSSA 3ZXZA 2PVKA 4CGAA 1WVWA 2QNJA 5FM3A 3ULZA 4NEUA 4LG4A 3DLZA 4O86A 3GC7A 4UALA 2G01A 4AOIA 3VC4A 4EJ7A 5DR2A 1Q8WA 2CKEA 5EM7A 1Y8YA 5KMNA 1P4FA 2XK9A 5C8MA 1U59A 4YLKA 4BIBA 4O7RA 5I5ZA 2YLFA 5EI8A 2QG5A 2XM8A 3DAJA 4RJ3A 1H24A 5AA8A 2X4ZA 5EQYA 4PL5A 1Y8GA 1LP4A 1PMNA 1Q41A 4ZTNA 4FBXA 2R64A 3ROYA 3ZLXA 3ZZEA 3A8WA 1KE6A 3FSFA 4HGTA 2WIPA 2IO6A 4UWCA 2JKMA 4AFEA 3BHTA 5J7HA 3ZSGA 2ITZA 4NM3A 3ORKA 4QYGA 3E93A 4EH7A 2F7ZE 3EQRA 5L8LA 4I93A 3O8TA 2VAGA 4HVDA 5HU3A 2GTNA 4FKJA 2RGPA 3D7TA 2HIWA 5BVEA 4FSUA 5HLWA 3TWJA 2V7AA 1Q8TA 4L52A 4BWPA 5A3XA 3D4QA 3SOCA 5CEIA 3JYAA 3G5DA 4ITJA 2GNJA 2VTLA 3V5TA 4C33A 2ERZE 2WZJA 5AUYA 3FJQE 5G6VA 1RJBA 2Y6MA 2PVRA 4F0GA 4IQ6A 3VUDA 4IC7A 1PKDA 4ERKA 4YZCA 3UOJA 2C5OA 2WQOA 4FOCA 5CU6A 3FZ1A 1UKHA 3V6RA 4AUAA 3KF4A 4E4LA 5CF5A 5L2SA 5AP6A 4FEXA 2GFCA 5LMKA 2WNTA 1T46A 4MAOA 4ZSGA 4G1WA 4IH8A 1MRUA 5CAUA 3AC3A 2YABA 3CCNA 3BU5A 4IIRA 5BYZA 2WU7A 5L2IA 5JRQA 4DEDA 3P78A 2PZPA 4R5YA 4RIXA 1Z9XA 3IG7A 5TT7A 4MNEB 3MFTA 3N9XA 3LFFA 3ZOSA 3KMUA 4JVGA 1JKTA 2W17A 4QMXA 2W99B 1Q3DA 5IQHA 2WMAA 4DH1A 4Q9ZA 3II5A 4N0SA 3RAKA 2IVSA 3KF7A 3MTLA 4O7NA 4MD7E 3LQ5A 3GU5A 2CGXA 4PMSA 4JIAA 1V1KA 3QAME 3IDBA 3H4JA 1H1PA 5FDXA 3RP9A 5JGAA 4DTAA 4ZLZA 1IAHA 5A9UA 3OC1A 5CU0A 2B9JA 4Z16A 4C3RA 3PPJA 5TE0A 3FZRA 2PPQA 4ALWA 4KS7A 1R39A 4M8TA 4YJSA 5D7VA 3C4WA 2CSNA 4KWPA 5BUJA 2UZUE 3C4XA 3CQUA 1WBTA 4UXQA 4TTHB 3W2QA 1Z5MA 2F4JA 3GI3A 4I5MA 3V3VA 4I21A 3QHWA 5L8JA 3TIYA 5FTOA 4EHZA 4NM5A 4N70A 2ITTA 2Y4IC 5DIAA 4JI9A 4TYHB 3Q9ZA 4AN2A 4AS0A 5B7VA 5HTCA 3GCUA 4DFNA 4ENXA 3TL8A 4PV0A 3HVCA 2XNNA 3QCXA 4O0YA 3CLYA 4NUSA 2G2IA 2BAQA 5CQUA 2BHHA 3LFBA 4I22A 3R22A 4D0XA 5AR2A 3WE8A 1PXOA 2P2IA 3EZVA 3GCQA 5AJQA 1XBBA 4U0IA 2EWAA 4CV8A 4G6OA 2FSLX 4AE6A 3Q52A 5GJDA 4DN5A 4E20A 4O21A 2CLQA 3RINA 2B9FA 3QKLA 4PDOA 4YJVA 1RDQE 2R3FA 4IVDA 3ROCA 2V5QA 2YM3A 3FPMA 2YM8A 4D4YA 3UE4A 3BPRA 5L2QA 4CFMA 1OKZA 3NDMA 3EMGA 1YW2A 4O83A 3F3VA 3POOA 5CYIA 5T3QA 5FXRA 3R2BA 3ZO3A 3U6JA 3PVGA 1QPJA 4YPDA 2W0JA 2QKWB 4F0IA 3VS0A 4M15A 4LOOA 4C57A 3DB6A 4KKHA 4ANBA 4RJ7A 1FQ1B 4IVCA 3DBCA 4A7CA 4TY1A 4X2GA 4LI5A 4MD8E 4L44A 5GJFA 4B0GA 3R00A 4R7HA 3FWQA 3IDCA 4FYNA 4S31A 3UZTA 3EQFA 4CYJA 4E6QA 2Z2WA 4CZTA 5H2UA 4C36A 2C6EA 3Q32A 4KAOA 3QCYA 5M53A 2ZB1A 4J95A 2VV9A 3A7HA 3R1SA 4MNEA 4BF2A 1OUYA 5HTBA 3NYVA 4GJ2A 4FL2A 5M4FA 3ORTA 2YHVA 5CSXA 4XMOA 3OCSA 2CNVA 2VWXA 5KKRB 5K5XA 5J87A 3R8UA 3BV3A 3E3PA 4RA4A 4BWXA 2BTRA 4U7ZA 4C62A 5IDNA 4DFZE 5CI7A 3OS3A 3G9LX 1H26A 2P2HA 5IF1A 2VN9A 3PP1A 3E88A 3AGLA 3Q96A 4O6LA 5AM6A 3GCPA 3DDPA 3IOPA 3ZU7A 3VUGA 2XKEA 4ZSLA 5B2LA 4OUCA 4FSQA 4CT2A 2XRWA 4PP9A 2W9FB 5ICPA 4I1ZA 4O0VA 3P0MA 2RSVA 4U3YA 3RK9A 4AQCA 4D2SA 5IUIA 3VW8A 2WELA 3UQFA 3NGAA 4FSRA 4DLJA 2CHLA 4FKRA 3QF9A 5J5TA 4A4XA 4ACGA 3DZOA 2XNBA 1P14A 4AZFA 1OIRA 4F9CA 4TYHA 1BL6A 4J96A 4RIYB 5AV0A 2ZV9A 4EZ5A 5DYJA 3FI2A 1U4DA 4RX7A 3VW6A 3DQXA 2WTJA 4PTGA 2QODA 4BZOA 1H0WA 3I0OA 3HA8A 4K33A 4K9YA 4NJDA 4MNFA 3BEAA 3FKOA 5CTPA 1CKJA 3UOKA 3ZUUA 4GYIA 5GJGA 1YXSA 3T3UA 4BKYA 2ZM1A 5J79A 4N6YA 2LAVA 1QPCA 4CFNA 4EH6A 1TQPA 3OTVA 1JKKA 2ETMA 3UZRA 4ID7A 2W1HA 3IOKA 1ZMWA 2PVYA 2X2MA 4E93A 2UVZA 1CKPA 2QONA 2X8DA 3ODYX 4ONAA 2F2UA 5HNGA 5LOHA 3EN4A 2OXXA 3U4WA 2UW0A 1OPJA 3LMGA 4ALUA 5EKNA 1OL1A 2I40A 2WTCA 3PG3A 4JRVA 4EK3A 4IACA 3VBQA 2HZIA 1IA8A 3PJ2A 4J8MA 4MK0A 4G9CA 3E3BX 5EYKA 1YOMA 5IQAA 5M06A 2BILB 4PF4A 3EYGA 4FTOA 4Z9LA 1ZAOA 5B0XA 3ZHPC 4D1SA 4E5BA 2F57A 4HZSA 4N57A 4FTIA 4LRMA 2J7TA 2UVYA 1Q61A 2PULA 4MCVA 2FO0A 3A4PA 1ATPE 3OHTA 5J7BA 5IH4A 4P4CA 2PUNA 3R73A 3KY2A 4O0SA 4RVMA 1G3NA 2XCHA 4AGCA 3RMFA 4PRJA 1UWJA 2FA2A 2UZBA 1YHSA 3RPSA 3UPXA 4QQTA 2J5EA 2ZYBA 1G5SA 3OVVA 5GHVA 3PE1A 4F99A 2B53A 3C7QA 3D5WA 4UEUA 3WE4A 4CQGA 2R7IA 2C3JA 4U80A 5HO6A 3H0ZA 4IB0A 4RC2A 2UZDA 4IZ7A 1ZYSA 5A4EA 2R3RA 2CGVA 3FZOA 3GB2A 4O84A 5KHWA 2NO3A 1APME 3GFEA 4WSQA 5J1WA 1BL7A 3DJ6A 3HV6A 4BCHA 4GT3A 1YRPA 2WO6A 4FE2A 4G3EA 1UU8A 4DEHA 5CEMA 4XUFA 5IH6A 4QP2A 4RZWA 3RNIA 4HPTE 4XBUA 4ZS0A 4DEAA 4GL9A 4NK9A 2CKQA 4GS6A 5CSVA 1GNGA 4JL9A 2HWOA 3QRTA 3CD3A 4CYIA 2YDJA 4NYEA 2OBJA 3P1AA 3I5ZA 2BFXA 4R7IA 4IZ5A 1GZNA 4FV1A 3MA3A 4A4OA 4H3BA 4D1ZA 3R04A 4YO6A 3QX2A 3TNIA 3OBGA 4D5KA 4RIYA 3TUCA 2J0IA 4M13A 3HL7A 3NMUF 3BGPA 3V8WA 5BVOA 4MXOA 1OITA 2B54A 4C4EA 1SYKA 4BVUA 2R2PA 3I6WA 4JX7A 3WZDA 2GNLA 3LXNA 2ACXA 4KSPA 3TNPC 3A60A 5FUTA 4F1TA 5HE1A 5IPJA 2OF2A 3DK6A 4ZMEA 4QMSA 1PMUA 3C0GA 3VN9A 2JC6A 3OCGA 4MYGA 2RG5A 4EWHA 2VO7A 3LIJA 2XIRA 3SW4A 4BR3A 3VS6A 4F6UA 4B8MA 3S95A 3TV6A 5L6PA 5LVOA 5CU3A 3QQLA 1LEWA 2ZB0A 5DWRA 3MPAA 2W1GA 2OI4X 3UZPA 5IA5A 3R8MA 5CVFA 4PNKA 1SNUA 4FG9A 4X3JA 3SXRA 1L8TA 4YJTA 5AUZA 2PZYA 4FKQA 4B4LA 4CFVA 5K4IA 3ENMA 5M57A 4FIEA 3RHXA 3UMWA 3I1AA 3NWWA 2JKQA 3RK7A 2JAVA 3V51A 3LHJA 4L46A 3OT3A 4O22A 4F6SA 3DK7A 4IB5A 4YU2A 2HZ0A 3LJ0A 4L7SA 3VS5A 3SD0A 3Q9XA 3QTXA 1OIQA 1YI4A 2IZTA 2JIUA 3GU7A 4XV2A 5KBQA 4FV8A 1Q8YA 2NPQA 2VWBA 5E1SA 2J0JA 5A6OA 3ZDUA 5H8EA 3S4QA 1FVVA 3LW0A 4TPTA 2OXYA 2B9HA 5AIRA 3D5VA 4G5JA 4J97A 4JQEA 3MV5A 2OZOA 5FEQA 1M52A 1AQ1A 5HGIA 4J7BA 2W4OA 3QC9A 1W84A 3L9LA 1KV2A 4IW0A 4AT3A 4RG0A 2GHMA 2JLDA 4PTEA 4DHFA 2XEZA 4AW2A 3H9OA 3SRVA 4NIFA 4QTAA 4AZTA 4PQNA 2X2LA 2YIYA 3OUKA 3TNWA 4HW7A 5TO8A 4IE9A 4M12A 1ZMVA 4EBWA 4EOLA 1UV5A 3AC4A 3WF9A 3JXWA 3POZA 3TTIA 4X7QA 3CXWA 3R7YA 3W2PA 3JY9A 3EQBA 4H3QA 4HJOA 3H10A 4JNWA 5DN3A 2R3NA 4J98A 3QLFA 4BCQA 3HYHA 5H9BA 3ANQA 3JS2A 4KNBA 4U41A 1QL6A 4FX3A 2R3HA 1OUKA 5DHJA 4F7JA 5HZNA 4H1JA 3I60A 2CN8A 4K18A 2BRMA 3CTQA 1P2AA 4C35A 3BLRA 2PL0A 4U3ZA 4BDFA 2YZLA 2A19B 4MQ1A 3DBDA 4U43A 3CBLA 4D2TA 4W9WA 5IMEA 2PMIA 2QOCA 4BCOA 4F63A 4O0TA 4A9UA 4U9AA 5BMSA 2ETKA 2X7GA 3VBWA 4XS2A 3VS3A 3KREA 3L8VA 1Q5KA 2BROA 3U8WA 3ZRLA 4TWPA 5G1XA 4C4IA 3OP5A 4EUTA 1NT2A 3EQHA 3O51A 2YFXA 5CNNA 4YHFA 4L9IA 5ACKA 2CCHA 3HEGA 3ZO1A 4O7VA 5IQCA 2G2HA 2I0EA 2RG6A 3LFSA 2LGCA 3BHYA 4JS8A 4UY9A 2W1DA 3SV0A 5M4UA 2O64A 3SLSA 2BUJA 2J9MA 3FC1X 4IZYA 3ZS5A 5CXZA 3AGMA 3QQHA 4AGDA 4II5A 5JRSA 4FT5A 2QO2A 3FMDA 4C8BA 5K9IA 3G15A 5GIPE 3ZZWA 5CNOA 5HLPA 3ENHA 4RX9A 2QKRA 3A4OX 1R78A 4UB7A 4G16A 3IW4A 1QMZA 2BR1A 1YVJA 3COIA 2ZMCA 4QO9A 4E6DA 4EC9A 5BQ0A 3COMA 2CKOA 3IGOA 3G33A 4YZ9A 4M68A 1UKIA 3ELJA 3EQGA 4O27B 4RVKA 3IQ7A 5CQWA 3KXNA 4NCTC 4CFUA 5A4CA 3VBVA 2OFUA 3R9HA 2BFYA 2IZRA 2Y8OA 4RMZA 5AEPA 3CY2A 4EOPA 1GAGA 2WQNA 4EL9A 2B7AA 3NX8A 3ZC6A 1WVYA 4FKLA 4RQVA 5CVHA 4F7NA 4OAVB 1S9JA 4ERWA 4TXCA 1YHVA 3FBVA 1ZOGA 3FQHA 2QOQA 3OBJA 5IQDA 1JVPP 4X3FA 2WKMA 3P4KA 3WIGA 3EQCA 2VTAA 4LMUA 2EXEA 3EYHA 1OKWA 4FL1A 4GVAA 4CFWA 1XWSA 1BLXA 2Y4PA 4FGBA 4L3LA 3R83A 2DQ7X 3DLSA 5LCKA 4BKZA 5EI2A 1OBDA 3HP5A 1XO2B 3T3VA 2ZV2A 4QPAA 4WUNA 4A9TA 5J9LA 1ZZLA 3TN8A 4I6FA 4PL4A 5DEYA 3ZUVA 4EK8A 4F1OA 3MY0A 3P08A 3PJCA 3EZRA 4AFJA 3G6GA 4GVJA 1O9UA 2I0HA 3GBZA 4IWDA 4WG4A 5CX9A 1A48A 4F9WA 5JKGA 3DOGA 2VO6A 3FQSA 4ZOGA 2HK5A 2QU6A 5C01A 5KMIA 3TI1A 1JLUE 4MVFA 3SDJA 4FV5A 4KBAA 3ZUTA 3NVKI 1T45A 2WTIA 4G3GA 4L68A 4QMVA 2QG7A 3UOLA 4A9YA 1XKKA 2EB3A 4AZSA 5L2TA 2P33A 3VBYA 2I1MA 3FYKX 4RBLA 5BX0A 4XP2A 1DS5A 2OGVA 1YDSE 4C02A 1IA9A 3CQEA 2VUWA 3DKCA 3NUXA 4OLIA 3R63A 4EHGA 5A6NA 3EFLA 3CQWA 3DGKA 4YNOA 4F0FA 2RIOA 2PSQA 2YN8A 3DT1A 4W9XA 3VWAA 3DZQA 3MW1A 5HD4A 3UNJA 3EN5A 3NZ0A 5HG8A 4IJ9A 5F9EA 4H58A 3N4VA 4D2PA 3TDVA 2A1AB 3TJDA 2X2KA 3REPA 3PSCA 3KXZA 5DG5A 3D94A 5FBNC 3F5GA 3BYVA 3HMNA 3M11A 2VTMA 3NYOA 4MF1A 2YIXA 4BIEA 2JIIA 3GT8A 1ERKA 3HAVA 4W4WA 1PW2A 5ITAA 1SM2A 4RVTA 2BZIB 3R7VA 3DNEA 3EFKA 3HP2A 5CT7A 3LM0A 3HAMA 5FRIA 4IX4A 5HLNA 3C0IA 2WFYA 3HGKA 3QYWA 4RFMA 1GJOA 4GUEA 3R8VA 1PRYA 2J6MA 3PA5A 4EONA 5CEPA 3IW8A 3G2FA 3KEXA 2OIDA 4FV9A 3ZONA 5M4CA 3D7TB 1NVRA 3KRWA 4PUZA 5AV3A 1Q4LA 4BZDA 5IZFA 5AR4A 2XMYA 1UNHA 5DGZA 5HBHA 3E87A 4JDKA 3U87A 3BRBA 2Y9QA 3KRLA 4F65A 3WZJA 1K2PA 3QTRA 3DBQA 1PXIA 4PY1A 4GMYA 3NUUA 3SHEA 2X7FA 4EOKA 2R7BA 3B8QA 4TWOA 4CLJA 2ITVA 1GOLA 4LV5A 4WNMA 3C51A 3ATTA 5LCJA 4QTEA 4OAUC 2IPXA 1PXPA 2X8EA 3GP0A 4FTAA 1UNGA 4KRCA 4ENYA 3QZGA 4IBMA 3F3ZA 3MVJA 4HYSA 4JBOA 2BDFA 4QPMA 5E8YA 5J5SA 5JN2A 4NTSA 2ESMA 2BIKB 3BHUA 2ITOA 4D4VA 4Z7HA 2GQRA 4EOJA 3MWUA 4FODA 2JFMA 4O7SA 3PFQA 4P2KA 3BYUA 3CR0A 4RIXB 4IDTA 3D7ZA 4C2VA 4YLJA 3OG7A 4FVPA 5TF9A 4I4FA 5E91A 4GK3A 3DJ5A 5ANDA 4MD9E 2JITA 4CXAA 4EYJA 5IQIA 3ZO2A 3NAXA 3MY5A 4G34A 4L45A 4O2PA 3TZ9A 3BWJA 4R3PA 4EH9A 4KB8A 4H1MA 4XRJA 4TT7A 4HYUA 2YJSA 3QTUA 2Z7SA 4MXYA 4FZAB 4ACMA 2FSOX 1L3RE 4LFIA 3ZSIA 3AT3A 1JKSA 5AV2A 4R5SA 4BWKA 3HMIA 1IRKA 4EYMA 4FI1A 4BBEA 5AP5A 4QD6A 5BYLA 2B4SB 4FT3A 3KN6A 4APPA 5AX9A 4FTMA 4QMPA 2W1EA 3TEIA 3S00A 4R1VA 3QGWA 5FBOA 3VBXA 4AP7A 5FWKK 4FL3A 4DG2E 5AP4A 4K6ZA 2YAAA 4Y95A 3BLQA 4RJ6A 4CMTA 3LXKA 3TKHA 4O91A 4IVAA 4ZZNA 1UU7A 1ZYJA 2BKKA 3FMNA 2IZSA 4KSQA 2XUUA 2CN5A 2R3LA 3FL5A 3PPKA 3P5KA 3PZHA 4C3FA 4EI4A 3EIDA 4UX9A 3TXOA 4FTNA 5ANJA 1IR3A 3V5PA 2QHMA 1Q8UA 4YC8A 3G6HA 5IG1A 4CKJA 3TT0A 4QP4A 4APCA 5HVKA 5DVRA 2GMXA 4U44A 3KXMA 5LMKC 4UWBA 5EHLA 4YTIA 4EK6A 4C58A 3UMXA 3DXNA 3MJ1A 5HX6A 3QQUA 4RT7A 3A7GA 3EL8A 1O6KA 5IA3A 3UC4A 2IW8A 3FZSA 1UU9A 4KIPA 1U54B 3KMWA 3RBWA 3VS7A 1ND4A 2GDOA 1OIYA 3VQUA 1JAMA 4L3JA 3ZXTA 4BDHA 4LYNA 2ZVAA 3RM7A 4AN3A 3U6IA 3TNHA 4YZBA 4L43A 3DS6A 2F2CB 4NL0A 4NKSA 5DR9A 2C6DA 2GTMA 4KIKA 2IVVA 4LOPA 3VO3A 3FV8A 4RFZA 3QA0A 3UVQA 3VS2A 4EK5A 1XHAA 2IVUA 3CKWA 5B2KA 3KU2A 3OCTA 4V01A 1XJDA 1H1RA 4FKWA 4G6NA 4GG7A 4BDEA 1WMKA 4IMYA 5C4LA 3EN9A 4BY9E 5KO1A 3QFVA 4FZDB 3V6SA 3LFAA 4RWIA 3QRKA 4IM2A 3QBNA 2CLXA 4YJRA 3CY3A 2XB7A 4S33A 4HVSA 4IM0A 5ETCA 2BRGA 2VWIA 3A7JA 4UWYA 3UGCA 3PDTA 2B0QA 3QQJA 2Z7QA 2CMWA 2FUMA 2VU3A 2QVSE 4BHZA 4JBVA 4TW9A 3COKA 4AGUA 4FIFA 4NW6A 2PYWA 4CRLA 3IGGA 1M7NA 3UP7A 1I09A 3IDPA 4DE4A 4CFXA 2FVDA 3IS5A 4WA9A 3CTHA 3OEZA 4IHPA 4ORKA 5I3OA 3PTGA 1YKRA 1ZXEA 5M51A 3WI6A 4L53A 3SXSA 2YDKA 3MSSA 4M66A 3DXQA 3GENA 2XCKA 4IVBA 3A7FA 2YJRA 3EQDA 3GC0A 5M44A 5DRBA 4EH2A 4UN0C 4PWNA 2XVDA 5EQEA 3ZM9A 2XNPA 2C47A 4DTBA 5HU9A 3LCDA 4OTRA 4D2WA 4DFBA 3FC2A 5JZJA 3E7VA 3CGOA 1XH6A 2R0IA 1J91A 2QCSA 4XBRA 4BCGA 4MXAA 3CIKA 4O1PA 3UQGA 3ZRKA 1XH5A 4D55A 3EQIA 4QP7A 5J1VA 5EK7A 3D5XA 3PA4A 4D9UA 2VTSA 4RC3A 1KWPA 2Z60A 2ZOQA 4FKGA 4OTGA 3UDBA 3VUKA 5E92A 4V0GB 3O71A 3VVHA 4E7WA 3EFJA 3AMYA 5B2MA 3W18A 3LCKA 3KK9A 4YBKA 5HX8A 4Q5HA 1PMEA 2C6KA 3KL8A 4QMLA 2X4FA 3BELA 2XK6A 5A4TA 3A8XA 4BICA 3SAYA 4AA0A 3O7LB 3OTUA 2J0MB 5HIBA 3QU0A 3CSVA 2WQBA 1U54A 4IFCA 3RCJA 3CC6A 3KCKA 2XK3A 4W4VA 3Q4UA 1KE7A 3R6XA 4JBPA 4CZUA 2GQGA 1M7QA 1PY5A 3FZPA 3QALE 5EYDA 3ZFXA 2ONLA 4L7FA 2UW9A 3QLGA 1VYZA 2YCRA 2XIYA 5E8VA 5IQGA 4YGAA 1WAKA 2X9EA 4D2VA 3ZBXA 2C68A 3QD0A 4KD1A 3UO5A 2X1NA 4IADA 1M2PA 2OK1A 4BDGA 4E8AA 2GNFA 4ITHA 4EOMA 3DXPA 4H3PA 2RKUA 3OD6X 4RJ8A 4QNAA 4F9AA 3TCPA 1VR2A 1ZY5A 3LLTA 4X0MA 4D58A 3OWLA 4L8MA 4MBIA 3UIXA 4AF3A 5CU4A 4W4YA 3TG1A 2CDZA 3AG9A 3DY7A 4IAKA 4ZSEA 3VHEA 1XH9A 1SNXA 3ITZA 3MDYA 3QUEA 4BDAA 4BTMA 1ZYDA 3OXIA 1REJA 3HX4A 3M1SA 3OROA 2X6EA 4FTLA 4I5CA 4IAIA 4OBPA 5HG9A 2Y6OA 4QMOA 3ZEWA 4U79A 4V05A 4YZNA 3P7BA 2P0CA 4OT5A 1B39A 5GIOE 4P5QA 3Q2JA 5EOBA 3D2IA 4EH8A 5JEBA 5D12A 3DKGA 3V8SA 4BCMA 4LRJA 2ITQA 2HELA 1BX6A 2VX3A 1M2RA 3DU8A 4WRSA 2OZAB 4KRDA 2W1ZA 3RKBA 1M17A 1W98A 4HCTA 2XJ0A 1JBPE 2NRUA 5KBRA 2GCDA 3A99A 4FR4A 4O1OA 3H30A 2C3LA 4QT1A 3G90X 5L3AA 3GC9A 3K3JA 5CF8A 3BI6A 4YR8A 5M07A 2DUVA 4EQCA 5AFVA 4QP8A 3WARA 3K5UA 5ETFA 3BGZA 4W8DA 5D11A 4FIIA 4TYIA 4DF3A 5C9CA 2YAKA 4J1RA 1Q99A 4BDBA 3HA6A 1MRVA 3Q4CA 4BFMA 3FKNA 1IEPA 2JBPA 5HKMA 3RAWA 4ITIA 5JFWA 3VBTA 3L1SA 3KA0A 5I9WA 3BEGA 2HENA 2PVFA 1NXKA 3KGAA 1U5QA 4MKCA 4PNIA 3MS9A 1RW8A 2B52A 2DYLA 2XA4A 3PSDA 5HE2A 4CLIA 2OWBA 1MRYA 3RPYA 4IAYA 5IA4A 2DWBA 1CMKE 3LFQA 4R77A 2B55A 2WTDA 2QURA 2CKPA 5ANIA 1GZ8A 1E9HA 2AYPA 2O63A 3IONA 4PDPA 5LVNA 3N4UA 4LL0A 3G51A 2VTPA 4V0GA 4WT6A 4XG6A 5AUWA 2QOOA 4HCVA 4ZK5A 5JFXA 4QMUA 3RPVA 2REIA 3U6HA 4XV1A 4FEWA 2C3KA 3FLNC 1ZYCA 1JSVA 3GGFA 4N6ZA 1KUTA 3MFRA 3V04A 3EJ1A 3C5IA 3PZEA 3QUPA 4BBFA 3RTPA 3R71A 5AR5A 2GSFA 3FKLA 3S0OA 4M97A 5M08A 4AZEA 3HRBA 5HG5A 3L8SA 4F70A 4J8NA 4NJ3A 5EQPA 2RFDA 5IA2A 5JK3A 4H05A 3GXLA 3ID6C 5C26A 2C69A 4OTPA 4XV9A 3RGFA 4I23A 3LCTA 5LWNA 4RC4A 4EC8A 5KKRC 4BGQA 5CZIA 5KX8A 1O6YA 1OECA 2XEYA 5ANEA 3BGQA 4DH8A 4XH6A 3BYMA 4OTDA 2C0IA 1PXKA 3E8DA 3FHIA 4OR5A 4F6WA 4Q2AA 5CU2A 3OT8A 5C03A 3VQHA 4HZRA 5HO7A 5T68A 1E1VA 3Q5IA 2VTIA 4FOBA 4FEQA 3UODA 4EOQA 1P4OA 1XH4A 2PY3A 4AXAA 3SA0A 3ACKA 2OJ9A 2XBAA 1H00A 4O6EA 2OLCA 5DT4A 1PXMA 1W82A 4HYHA 3KMMA 4EQMA 1W0XC 5DI1A 5KMJA 3B2WA 4JRNA 3NYNA 3FXWA 2QO9A 1J7UA 4PX6A 1YQJA 4Z55A 2IVTA 1OL7A 5JH6A 3LLAA 3WYYA 3CTJA 2OZAA 4K77A 3SRVB 4NIFB 3OY1A 4B6LA 4L01A 3OXZA 2I0YA 3Q6UA 3UIBA 5HNIX 5BVWA 4DFUA 3O7LD 3MVLA 2J0KA 4R6VA 1SVGA 3BKBA 2C5YA 4ANQA 3ZM4A 1R0PA 3TUDA 3WZEA 1YOJA 3AQVA 2UW8A 3HMOA 3LCSA 3AT2A 5EH0A 4ZTLA 5FP6A 4E73A 1IG1A 1YWVA 1FMKA 2ZAZA 4FT7A 4FTQA 4O2ZA 3GUBA 2CNQA 3NNVA 2V62A 2BCJA 3HDMA 5EHYA 5J95A 4USDA 5LMAA 3VF8A 3BBWA 3F6XA 4IANA 3EB0A 3FE3A 1Q3WA 3DFCB 3MPMA 4O0RA 1YI3A 3UVPA 3W10A 4WD5A 2HWPA 3VUMA 4BCFA 5CSPA 1B38A 2OIBA 3NCGA 1GIIA 2VTRA 3VF9A 3F2RA 4B8LA 5JQ8A 1OVEA 2Y7JA 3OWKA 4FSTA 4MX9A 4X6RA 4I92A 3NR9A 5DLSA 5EFQA 5HQ0A 4X21A 4J52A 3DV3A 3P9JA 3R1YA 4MTAA 3BQCA 3FMLA 1QPEA 4YC3A 4FT0A 1BYGA 2PMLX 1XH8A 2QOFA 4HPUE 4GKIA 2I6LA 2UZTA 3BQRA 1YWRA 2JFLA 5HESA 4GK4A 1NY3A 2O65A 2ZDUA 4LUDA 4ZS4A 3MI9A 4BHNA 5HIEA 2R0UA 3UC3A 1J1BA 3FAAA 3HV3A 3RALA 3PVWA 3QXPA 2E9OA 4FNZA 4JAJA 2VTQA 4L3PA 1V0BA 4LGGA 3R28A 2VNYA 3OOMA 5JFSA 5KMLA 5BVKA 3EL7A 3W1FA 4XG4A 5LJJA 4ZMFA 3MIAA 5AP2A 2OJIA 2FSTX 2W1FA 3FLSA 4CMOA 1YWNA 4FTUA 4K1BA 4X2NA 1KOBA 2R3KA 2YIWA 3I6UA 4GH2A 4UYNA 4FTKA 4JIKA 2XNGA 2XBJA 4ANLA 4ANNA 2R4BA 5IKWA 3FMJA 2UW4A 2OIQA 3WF6A 3PP0A 1OKYA 4JG6A 3UTOA 2X9FA 4QMTA 3QCQA 4RA5A 4ZY6A 4EBVA 2RL5A 2WQMA 3I4BA 3QRJA 4CD0A 4K11A 4CTBA 4I6HA 2W9ZB 4C4JA 2QO7A 5HG7A 5AR3A 4E6CA 1OIUA 4HOKA 4Z7GA 2BTSA 4X3FB 1ZY4A 4ASEA 2ZM4A 3TV7A 1A06A 4HCUA 3CEKA 2PMNX 4FMQA 4HNIA 5BMMA 4C2WA 2YEXA 2J5FA 3ZEPA 4DLIA 4A06A 2QD9A 5CAVA 5IH5A 5IUHA 4UXLA 2JBOA 2OJFE 3NIZA 3NSZA 4Q5EA 4EH5A 3WBLA 4R7BA 3UQCA 3I7BA 3QZFA 4JQ8A 1QCFA 4ANMA 5FG8A 4Y72A 5BNJA 5IEVA 5C4KA 3O17A 4ZTRA 2CGUA 4YZMA 4D0WA 3FY2A 4Y83A 4YO4A 2XIKA 1ZMUA 2ZV8A 3D0EA 4FSNA 1PYEA 3Q5ZA 4QMYA 4AX8A 5AAEA 3IW5A 3O96A 2RFEA 2WTVA 4QRCA 4QQ5A 2UW3A 2VX0A 4YPSA 4FA2A 3S1HA 1YI6A 4MF0A 4QMWA 2HZ4A 4U45A 5EOLA 4ASXA 1H08A 4ZAUA 5LVPA 3FI8A 1R0EA 2EU9A 5CT0A 4WIHA 4USFA 2BRBA 2C0OA 3ETAA 3F9NA 4ZP5A 4O7LA 5JZNA 2C6IA 1O6LA 1R1WA 4A4LA 4HVIA 4PL3A 3PPZA 4EK4A 4FZ7A 4OTQA 3ZBFA 4DFLA 2YWPA 3LFNA 4QP9A 5HEZA 1E1XA 5IUGA 3DPKA 4RIOA 1WBWA 4FKVA 4XX9A 1J7IA 4BGHA 1PMVA 3OW3A 1OBGA 2GNHA 3IPHA 4XJ0A 4PPBA 1U5RA 2ITNA 2XK8A 3Q4ZA 4KKGA 1PF8A 3COHA 3BBTB 2ZM3A 3F3TA 3TKIA 4YTCA 1MQ4A 1WZYA 3PJ8A 5K0XA 5KUPA 2G2FA 4O96A 4YSMA 2YIRA 4FK6A 4BTJA 4P5ZA 3ZMMA 1OL2A 2J51A 2WIHA 5DRDA 4CG9A 4YZDA 3PRFA 5I4NA 4FTRA 4X3FC 1DM2A 3GCSA 2RFNA 3P7AA 4C4FA 2UZWE 2BHEA 3Q6WA 3K54A 2XKDA 4IX3A 2HYYA 2W06A 3PYYA 4JOAA 4U6RA 4ASZA 2I7QA 4WNKA 5AV4A 1H4LA 4FKIA 4GG5A 3MH2A 3N4TA 3LJ2A 3UG2A 4GFOA 1V0OA 2WEVA 1H25A 4DEGA 3JPVA 3EWHA 2UZNA 1OKVA 3PWYA 3ZC5A 4ACDA 3EH9A 4GUBA 4LOQA 3PVUA 4Y85A 4FNYA 4XHKB 5BUEA 5C8KA 4IX5A 5GINE 4PPAA 4R1YA 4OBOA 3LFDA 3GU8A 1R3CA 5ETAA 3PLSA 3TZ7A 3OW4A 4I94A 3RPRA 4JT3A 4O7TA 1FPUA 2G9XA 3MFUA 3BHVA 1OL6A 3AMAA 1I44A 1CM8A 1VYWA 3EKKA 4FZ6A 4IEBA 4JDIA 5C1QB 5I0BA 4O38A 4EKKA 4IB3A 5E8XA 3FLZA 4Y73A 3UG1A 4EQUA 3DBEA 3KXXA 3TZMA 2BMCA 3CPCA 3R01A 5BPYA 3FQEA 1Q8ZA 1PYXA 3ORXA 4BN1A 3VUHA 3HNGA 4AA4A 2GHLA 2QI8A 2C5NA 3QD2B 4F4PA 3W2SA 4ZLOA 2BKZA 2YCFA 3MVHA 3KKVA 2J2IB 1JKLA 4HYIA 4MXXA 5DH3A 4UMPA 4QPSA 4DT8A 3QZIA 4EOOA 1GIJA 2ZDTA 3AC5A 3HV7A 1F5QA 4GSBA 1FVRA 4TKSA 3C4CA 4EH3A 4ZZOA 5E8SA 3F2NA 4JR7A 4RPVA 4C4GA 3E63A 3DKOA 5F94A 2YCQA 4FTCA 2W1IA 2XRUA 2W96B 3WF7A 1CTPE 4OW8A 3FXZA 5AA9A 2FYSA 3P7CA 5M4IA 2BIYA 4G17A 2ETRA 3TDWA 4XG8A 3NPCA 2VTTA 4X2KA 2WMTA 4FV7A 4B7TA 2SRCA 5AM7A 3D83A 2EUFB 3QQGA 2ZV7A 2WMUA 4ZZMA 3FXXA 3S2PA 3RCDA 3FYJX 1KE8A 3SXFA 3C4FA 2UZVA 3M42A 3QGYA 4FKUA 4NT4A 4AWIA 5KMKA 1UU3A 2JAMA 4R3RA 2OFVA 3ACJA 5KMMA 2ZJWA 4M0ZA 4FNXA 3UYSA 4RQKA 2PWLA 2YM7A 1JPAA 4JG8A 5AWMA 4G2FA 3KRXA 2UUEA 4IWPA 4MQ2A 2Q0NA 4G3FA 3U51A 4BCKA 3U55A 4JQ7A 3L8PA 4RZVA 2WTKB 3C0HA 4YLLA 4FT9A 5AP1A 4EH4A 1RE8A 1WBSA 4G5PA 3LXLA 3THBA 2IJMA 2WGJA 1BI8A 3Q2MA 4CRSA 2UV2A 3DAKA 3R02A 3WF5A 5FEDA 5IQFA 4PMPA 2BRHA 1PKGA 5BVNA 2FSMX 4BYJA 3MH1A 5K0KA 3C13A 1LPUA 5E4HA 3RM6A 4C61A 4D2RA 3H0YA 5M55A 3QD3A 4UV0A 3ERKA 5BYYA 2GU8A 2QLQA 3LVPA 5KE0A 4UMQA 2WMRA 5A4LA 1XR1A 2R3GA 3QZHA 3FLWA 4KIKB 5E8WA 3W8QA 2YM5A 3AC8A 4LGHA 5CXHA 4CKIA 4F64A 4AGWA 3SW7A 3BHHA 2B1PA 3VIDA 5HIDA 2VNWA 3FPQA 5K3YA 4FV3A 4J53A 3GQIA 2IW9A 3TIZA 5CAQA 3T9TA 5JFVA 3LOKA 4DG0E 4TZRA 4BRXA 5JGBA 4NU1A 3NUYA 3QL8A 1YXTA 2C6MA 2CGWA 1JSUA 2R3QA 3FHRA 3QD4A 4DFXE 3NVMB 4FKTA 2HXQA 5DNRA 2VTHA 5L6WL 4E26A 2YACA 1STCE 2OG8A 4E4XA 4PP7A 3KFAA 2R9SA 2WOTA 4KABA 4C59A 3B8RA 2BDJA 2YM6A 3G0FA 3PA3A 5GZ8A 5I9UA 1ZLTA 5F1ZA 3BWFA 1ZOEA 4BCIA 1MUOA 4PTCA 1F0QA 4UMTA 3VS4A 1VJYA 3ORLA 4O82A 3RZBA 2VTJA 2ZMDA 3NW7A 4RJ5A 4FKPA 3EQPA 5CS6A 4NFMA 4FEUA 1M2QA 3KN5A 3GOPA 3R8PA 4HNFA 5IA0A 3QX4A 4LV8A 1YXXA 2VWZA 1Q24A 2A2AA 4JBQA 4DAWA 2FGIA 2VWWA 2OW3A 4XG7A 4GFMA 2IZUA 3PY0A 4AT5A 1K3AA 4C37A 2WEIA 3DCVA 1KSWA 4JG7A 3ZLSA 2XNMA 3C4EA 4USEA 2OH4A 4K8AA 4KIQA 2HCKA 2XJ1A 3I5NA 4M3QA 4YTHA 2WMBA 4ACHA 5EG3A 3QKMA 1A9UA 2E9PA 2OJGA 3DA6A 3DQWA 4HGEA 4IZAA 4BZNA 4L00A 1J7LA 4FVQA 3UO6A 3WILA 3AD4A 4UMUA 2O0UA 2XK4A 1SZMA 1H27A 3MH0A 4RVLA 4S2ZA 2PZRA 2AUHA 4IC8A 1DI9A 3TUBA 4BYIA 5ANOA 1LR4A 3R7OA 2UZOA 4XLVA 2H6DA 3VHKA 5I9YA 4FGRA 4RWLA 5T6KA 5I9VA 1JQHA 5E1EA 1OM1A 2V0DA 5DOSA 1WBOA 4QP3A 5FTQA 1H07A 3LM5A 4FSMA 4GJ3A 4L6QA 2W5AA 3MPTA 5EM8A 3VJNA 3AMBA 1SVHA 2XZSA 5A54A 3R9DA 4NTTA 2YERA 3R7UA 3VNTA 3NNUA 4YMJA 1NVSA 4C38A 3R1QA 3NS9A 5C27A 2F7XE 4MXZA 2BAKA 2PTKA 3BV2A 4LMNA 3F7ZA 3QHRA 3QRIA 3TV4A 4YNEA 5DT3A 4EHEA 4BCJA 3R21A 3FMKA 5HCYA 1ZOHA 3W2RA 2W7XA 2XK7A 4IXPA 3F82A 3CGFA 3O8PA 2GS6A 4FUXA 2X8IA 3FL4A 5HO8A 4GEOA 4QMNA 3DDQA 4DGMA 4CFFA 5CAPA 2WMWA 4OT6A 2VZ6A 1Y91A 1WBNA 4JJRA 4Y5HA 5EYMA 4F1MA 3U9NA 4UZDA 3O50A 4EZ7A 5IEXA 2Y4IB 4HVGA 3PJ3A 5AUXA 2GPHA 4XG2A 1QPDA 5EM6A 4CCBA 5EI6A 2ITYA 4X2JA 5FXSA 3R8LA 4OTFA 4YC6A 4B99A 2OO8X 3PXFA 4DEBA 4PPCA 3QUDA 4RWKA 2PUPA 1GZOA 2ITUA 3LXPA 4XOYA 2XKCA 3M2WA 2A4LA 4WG3A 4U81A 3L9MA 5CEOA 4QTCA 2DS1A 2E9UA 4F9YA 2WU6A 4WHZA 1FBNA 3PWDA 3H9FA 3LJ1A 4GRBA 2PHKA 4I20A 4S30A 2G15A 5FDPA 3FZTA 1F3MC 3VUTA 5CASA 3BE2A 2X81A 3OOGA 4LUEA 1NVQA 1VEBA 2GHGA 3KK8A 4KIOA 3F3UA 1VZOA 3HV4A 3SGCA 4BDKA 2R3IA 3OEFX 4CSVA 2OJJA 3RNYA 4Y8DA 3MJ2A 3MN3A 4HGSA 3UBDA 3FSKA 4RJ4A 3DK3A 4X6QC 1UWHA 3VS1A 2PE2A 5AV1A 3UVRA 4IAFA 1V0PA 4XV3A 4M0YA 2ONLC 4DGGA 1URCA 5IA1A 3PXZA 4PMTA 3UIMA 3VAPA 3PIZA 3C5UA 3NAYA 4GIHA 4YJUA 1XQZA 4WG5A 4LL5A 2H34A 2PVMA 3MESA 2XP2A 3PSBA 2QC6A 2HW6A 2I0VA 3IW7A 3Q3BA 3RAHA 4E3CA 5A14A 5E9EA 2UW7A 2HXLA 3GVUA 3DB8A 2PVJA 3OZ6A 3MVMA 4CZYB 3ZO4A 2WXVA 2NRYA 4EORA 4FZFB 4DGLC 4NZWB 1H1WA 3FMMA 5CENA 3SQQA 5LXMA 3AD6A 1YHWA 2Q0BA 4FC0A 2VO0A 4MH7A 4S32A 4MEDA 4MWHA 3T9IA 3DFAA 3HDNA 4FV0A 3FI4A 3G9NA 4I24A 3A2CA 3BU3A 3PUPA 1B6CB 3K5VA 4FKOA 4F9BA 5DA3A 1OGUA 5CZHA 2IWIA 3RVGA 2X7OA 2F9GA 2HY81 3A7IA 3QXOA 4WKQA 1ZRZA 2YISA 2WOUA 1BI7A 3VULA 4FIGA 3DTCA 5TOZA 2J90A 3F5PA 5ANKA 2CCIA 2PVLA 2ITWA 4Q9SA 2XNEA 1OB3A 3PY3A 5CF6A 4FSYA 1Y57A 3WIKA 4TL0A 4XG3A 4GFGA 4AT4A 3DNDA 3E5AA 4DGOA 1W8CA 3NNWA 2P55A 5CEKA 1Q97A 2FB8A 1YXUA 2JDRA 4XP3A 4GU6A 3ANRA 4FUYA 1S9IA 4TRLA 2C5VA 1FOTA 5DT0A 3GC8A 3MIYA 5DR6A 2YCSA 3KCFA 5HE3A 3EHAA 5E7RA 4DH5A 1H8FA 4O81A 5AUUA 5KZ0A 4FV4A 5EHOA 3O2MA 4K0YA 4DFYA 3QTZA 4G3CA 3GNIB 3W32A 4UBAA 4C3PA 1CSNA 4CMUA 4TNDA 4AW1A 5EKOA 3NUAA 4IDVA 3L8XA 5FGKA 2PZ5A 4XCUA 4IB1A 1URWA 1BMKA 2PE0A 4A07A 3QQFA 2HAKA 2PUUA 3LQ8A 2WMQA 3RJCA 4ZSAA 2O5KA 5DPVA 2XM9A 5AMNA 5CLPA 4AN9A 4DA5A 5L8KA 4I6QA 3R7GA 2WMSA 4JXFA 1KE5A 1Y6BA 2OF4A 2WPAA 4EOSA 4AOTA 5LVLA 4DEEA 4EWQA 1JOWB 4XNEA 4DITA 3QA8A 1NW1A 3R9NA 3FUPA 2CNUA 2C6TA 3R1NA 4FTTA 2JKKA 4O0UA 5HI2A 4F7LA 4QYFA 2GS2A 3AD5A 4TYGA 5FXQA 2IG7A 5TR6A 1Z57A 2V7OA 4LM5A 3Q53A 1AD5A 3Q60A 4U40A 5DBXA 3V5QA 1LUFA 1OI9A 2Y0AA 4WRGA 4B9DA 4OTIA 3KXGA 5JQ5A 4DG3E 4ANSA 4RRVA 3FDNA 4ZY5A 5BVDA 3AT4A 3MY1A 2CJMA 4BIDA 2C5XA 5KCVA 5HOAA 3F7WA 4A9SA 5DEWA 3F88A 3KULB 2XS0A 4A9RA 4PDYA 1H1SA 5AAGA 3T8OA 1XH7A 2W1CA 1EH4A 4E4MA 5K4JA 4WNPA 3NYXA 4XEYA 5A4QA 5LWMA 3ULIA 3JVSA 5D7AA 2B9IA 3Q04A 2WTWA 3OF0A 5DE2A 2UVXA 4NW5A 4YSJA 2A27A 1MQBA 4X2FA 4BCNA 5ANGA 2X0GA 3ORIA 2WHBA 1OPKA 5LMBA 2YWVA 3H3CA 3HECA 4F7SA 4XP0A 3BX5A 3HRCA 4FICA 2QR8A 2OXDA 4NFNA 3R7IA 1OPLA 2JDTA 3SKCA 3KQ7A 4DYMA 3LAUA 4ACCA
chains in the Genus database with same CATH superfamily
4BGGA 3ATSA 5FP5A 5AIKA 5L2WA 4K2RA 4P90A 4QOXA 1ZZ2A 2JDVA 4FG8A 4H36A 4FG7A 3LQ3A 5FQDC 4LV7A 4WBOA 3LE6A 4NM0A 2C4GA 1LEZA 3ALNA 3FMHA 3HMPA 3OUNB 2R3PA 4J99A 4YP8A 1ST4A 3E62A 3QWKA 4W4XA 5JSMA 2RF9A 2ERKA 3OY3A 4DCEA 1HCKA 3DJ7A 4R78A 2OKRA 2JEDA 2XNOA 4MBJA 3D15A 3NCZA 3UO4A 5IU2A 3QTIA 5EYCA 2H9VA 3B2TA 3Q9WA 2OU7A 3BCEA 3CS9A 4RIWB 3LFEA 5CAOA 1GY3A 5EDPA 1W7HA 1RQQA 4BBMA 4AXFA 3KXHA 3MTFA 3P5JC 2HOGA 3R9OA 5H3QA 2VRXA 3AC2A 2JIVA 1WVXA 3ZYAA 2J50A 3FLQA 5HBJA 4NSTA 4CCUA 2QOHA 2J4ZA 5EDRA 5HTIA 1FVTA 3PXQA 3KRJA 5ACBC 3E92A 4ZIMA 3JR1A 5CEQA 1YOLA 1H0VA 3Q4TA 2JKOA 4CNHA 4ZJVA 4CKRA 4I6BA 4TN6A 3BZ3A 4DBNA 2C1BA 4FIHA 4D9TA 3PJ1A 1G8KA 4QDEA 5LQFA 3L9NA 3D9VA 3LMHA 5I9ZA 3NUPA 5KZIA 3R30A 5D10A 3I7CA 4DGNA 4L42A 4D5HA 4E1ZA 5AUTA 4O4EA 3GU6A 3P23A 3W0MA 3PLAE 5HORA 4XG9A 3E8NA 3VUIA 1ZWSA 2PK9A 3ET7A 3I81A 4J71A 3K2LA 1NA7A 1YDRE 3F5UA 4PDSA 4YJPA 4CV9A 4QMQA 3G0EA 4KS8A 3KVWA 3H9RA 1BUHA 4I5HA 3EN7A 5JMSA 4AU8A 3BYOA 4DINA 1UA2A 5AX3A 3AOXA 5LARA 4BDCA 4R8QA 3UYTA 1FMOE 1TQIA 3HMMA 3NRMA 4YJNA 3E8EA 2C0TA 2J0LA 4UYAA 3ZCLA 2GQSA 4BTKA 4DBXA 4M14A 4O7WA 3MYGA 4C34A 3ORZA 3DAEA 3PG1A 3RWQA 3PXRA 4I0SA 4JR3A 3KULA 3U54A 1GIHA 2PMOX 2R5TA 2VO3A 4Y46A 3CD8A 3KC3A 3ORNA 3BL9A 3NUSA 1FGKA 3P86A 4D4SA 3E64A 5HNBA 5BVFA 4DCAA 1SVEA 4I4EA 1DAWA 4OBQA 4U5JA 3V5JA 3ZFMA 3K3IA 3L9PA 5AUVA 2JD5A 4G6LA 5AP3A 4FTJA 3P79A 3HKOA 2QOLA 3QYZA 4LDTA 4FNWA 5F4NA 4ARKA 2YDIA 3DBFA 3KVXA 3SX9A 3WOWA 4EUUA 4YURA 4QQCA 3CKXA 3ZRMA 3U4UA 2PVHA 3C1XA 4YJOA 3RAIA 4O0WA 4QTBA 3HZTA 3TJCA 3UIUA 4M84A 2YA9A 3O8UA 4MBLA 1H28A 5F95A 3OFMA 2Q83A 5E90A 5GZAA 4BI2A 3D14A 1PXJA 4ZTQA 5KHXA 3CE3A 1IASA 3GOKA 3HRFA 2VD5A 3UP2A 5FM2A 2WMXA 2QQ7A 2W5BA 5JGDA 3EOCA 3OXTA 4RWJA 1HOWA 4M7IA 4QMZA 3ZH8A 4BDJA 4E5AX 1DI8A 4RX5A 4C4HA 4YUQA 2PZIA 3KRRA 4MHAA 3MA6A 1KE9A 3QQKA 4BCPA 3TNQB 3OWJA 4RIWA 3BLHA 3ODZX 5H8BA 4AA5A 5C8NA 3GFWA 3N51A 3TACA 5K5NA 3PVBA 4AACA 3BIZA 4ZXTA 3RHKA 2GS7A 1OL5A 5CSWA 5CANA 2RFSA 5EW3A 1Q62A 4CT1A 4F09A 2C6LA 4HVHA 4XLIA 1J1CA 4YTFA 4GKHA 5CWZA 4OTHA 4JAIA 2VWYA 2VWUA 4EJNA 5AR8A 4JDHA 2BDWA 4NH1A 3AKKA 1WBVA 2BRNA 2CPKE 3O0GA 3ALOA 3F3WA 5D41A 4AE9A 4Z3VA 2YZAA 5J8IA 3RPOA 4DH3A 5KMOA 4C0TA 4G9RA 4U42A 2QOIA 2ITXA 1KOAA 2BZJA 4IWQA 2YLEA 3O23A 4XYFA 4KBCA 4FF8A 4DT9A 2C6OA 3R2YA 3V5LA 1JSTA 3QWJA 4LQMA 3OCBA 4CTCA 4M69B 3EN6A 2Z02A 3R9RA 3PIYA 3PY1A 2F49A 2W05A 2QR7A 2BZHB 1IAJA 2Z8CA 3CP9A 5IDPA 2FH9A 3NNXA 2BALA 4YHJA 4DTKA 3AC1A 2R3MA 1DAYA 3AXWA 5HCZA 5E8TA 1TVOA 3W16A 4NM7A 4D4RA 3V01A 3BLAA 3NIEA 5EW8A 4IWOA 2GNGA 4EKLA 1K9AA 4UZHA 1J3HA 4EOIA 5EW9A 4GIIA 3MFSA 2PU8A 4WNOA 4CG8A 3C50A 3RI1A 1UVRA 5FLFA 4NWMA 4DC2A 2EB2A 2YIQA 3NEWA 3ZLYA 2XKFA 3PRIA 3MH3A 2BVAA 4EEVA 4GW8A 5M56A 3GQLA 4GU9A 1REKA 4FVRA 4AW0A 2YM4A 4CEGA 3F69A 4WOVA 4E4NA 3ORPA 4XRLA 4JX3A 2AC5A 4KUJA 3JY0A 2BAJA 3HUCA 3LFCA 5E8UA 3SG9A 3S3IA 1XBAA 4O0XA 2QLUA 3TTJA 5L6OA 4IFGA 5AAFA 2BPMA 2KULA 2UW6A 3MBLA 5CY3A 2XH5A 5FEEA 3W33A 4N4SA 2G1TA 3MB6A 5AR7A 5IISA 2H96A 3I0QA 4AW5A 2UZEA 2W5HA 4FIJA 2Z7LA 4FK3A 5FTGA 4IAAA 4P7EA 3SG8A 2OICA 2E9VA 4GT5A 3A61A 4RFYA 2VTOA 1OGYA 3QTWA 4GV1A 5GNKA 1PJKA 2R3OA 4QP1A 3W8LA 4QNYA 3PIXA 4I3ZA 1P5EA 2O3PA 3OWPA 3VRZA 3LKMA 2XIZA 5M09A 4CVAA 5IQEA 3UNKA 4OTWA 4QTDA 5KNJA 1KV1A 4DH7A 4XOZA 1H01A 1UNLA 1X8BA 2QOBA 4TYJA 3MGYA 4QP6A 4ZJJA 4RX8A 3V5WA 4BI1A 4G31A 3BYSA 4AZWA 3HV5A 3QC4A 5CI6A 3LPBA 4BDDA 3NFFB 3RK5A 3SC1A 3ZLWA 5HICA 3F66A 2VGOA 5HCXA 4E6AA 5J9ZA 3GU4A 1MP8A 4FEVA 4KA3A 2C1AA 4FKSA 5HD7A 3GCVA 3ZFYA 2XYNA 4ALVA 4RLLA 4KKEA 2QOKA 5CVGA 5HHWA 1WCCA 4PMMA 2UZLA 3KB7A 5EDQA 4I0TA 3VJOA 3Q9YA 3W2CA 3SVVA 4WSYA 3UJGA 5D1JA 2XIXA 5GZ9A 2WQEA 3NW6A 2WB8A 2WMVA 1PXLA 2PVNA 4ZJIA 4LGDA 2VTNA 2HY0A 4AZVA 4U8ZA 3W0QA 2X6DA 4IM3A 4H39A 4M69A 5DMZA 2PE1A 2A0CX 4TNBA 1U46A 1WFCA 1YDTE 1JWHA 3NUNA 4V04A 4AG8A 5BUIA 4AAAA 3D2KA 3TZ8A 1ST0A 4AQKA 3W2OA 2PUIA 3ORMA 3FLYA 1BKXA 4NCTA 4GT4A 4LRKA 2JGZA 3QCSA 4ANOA 3HLLA 4BKJA 2XYUA 3OMVA 1GZKA 3I79A 3R7EA 4GK2A 5LVMA 3BE9A 5AP7A 4QYYA 3IK3A 2O8YA 4D28A 4WUAA 2OSCA 3GEQA 4O7ZA 4ZLYA 3PXKA 3U9CA 4ZSJA 4RLKA 3F2AA 2W4JA 3IKAA 3E8CA 4MWIA 5I3RA 5L4QA 3JVRA 4QMMA 3C4ZA 2KTYA 3MB7A 4KINA 4UMRA 4GCJA 5E8ZA 3QTSA 3JUHA 4YJQA 2C3IB 2O2UA 3QRUA 3ZDIA 5H8GA 2NNWB 1SMHA 2VX1A 2Z7RA 1PHKA 2UW5A 5I9XA 5JT2A 3C9WA 3ZSHA 5BV3A 2EVAA 2VWVA 4BC6A 4JLCA 4QYHA 2QU5A 5FD2A 3SOAA 2XF0A 2HW7A 4O7YA 4ZEGA 3DKFA 3WZKA 2QHNA 4BI0A 4F08A 1H1QA 1WBPA 4S34A 2E2BA 4IJPA 3UOHA 3NLBA 1OZ1A 4ASDA 5CALA 3LCOA 4FJVA 4FSZA 3LZBA 4AOJA 4BDIA 2E9NA 2P4IA 3HUBA 1AGWA 1ZARA 3ZTXA 3BU6A 4EZ3A 4HGLA 4C7TA 2V22A 5IMXA 4FSWA 3PXYA 3A62A 1XBCA 3FI3A 2ITPA 4WO5A 4G3DA 5AP0A 3TKUA 3CJGA 3W55A 5EM5A 4OGRA 1Y6AA 5CF4A 4ZTHA 3CPBA 5HBEA 4I5PA 2OH0E 1TQMA 2WD1A 4BL1A 5CSHA 4RGJA 2IW6A 3TM0A 2NP8A 2HZNA 5AADA 2AC3A 4QYEA 4O4BB 2WAJA 2R3JA 4ZTMA 1M14A 2W4KA 4E5WA 3EKNA 4BJJB 2JDSA 4M67A 4BB4A 1FINA 4IAZA 2XJ2A 4O4DA 3RWPA 1JNKA 5A46A 3RZFA 2BZKB 4IX6A 4I41A 4JDJA 4TWNA 3V8TA 3QKKA 4Y5QA 4YBJA 5TKDA 5IQBA 4ZTSA 3IECA 4KBKA 4R3CA 3UNZA 5IEYA 3WYXA 3E7OA 3PE2A 5HE0A 3F5XA 4W8EA 1CDKA 2WTKC 1ZYLA 1FGIA 2GNIA 4FYOA 4WBBB 5ETIA 3R8ZA 4U97A 4DEIA 3CJFA 4YHTA 2VGPA 3NW5A 4TYEA 4BTFA 2C30A 4TWCA 5HVJA 1TKIA 2IN6A 1YXVA 3FMEA 4GYGA 1XMMA 1HCLA 2F7EE 1OMWA 2V55A 5D9HA 2P3GX 3QTQA 5F20A 4CQEA 4FV6A 2EXMA 4I0RA 3FEGA 3R0TA 4NKAA 2A98A 1W83A 2H8HA 2X39A 3FY0A 5HVYA 2YITA 3WZUA 3VRYA 4MXCA 2GFSA 3WF8A 3DTWA 4D1XA 3D5UA 3UPZA 4FV2A 4L67A 2JDOA 5DFPA 4EHVA 1CKIA 3F61A 3EFWA 3IW6A 5J9YA 1G8JA 1G8AA 1PXNA 3LMIA 2EXCX 4QQJA 3IO7A 4ZY4A 1G8SA 2X0PA 4RSSA 3ZXZA 2PVKA 4CGAA 1WVWA 2QNJA 5FM3A 3ULZA 4NEUA 4LG4A 3DLZA 4O86A 3GC7A 4UALA 2G01A 4AOIA 3VC4A 4EJ7A 5DR2A 1Q8WA 2CKEA 5EM7A 1Y8YA 5KMNA 1P4FA 2XK9A 5C8MA 1U59A 4YLKA 4BIBA 4O7RA 5I5ZA 2YLFA 2IF8A 5EI8A 2QG5A 2XM8A 3DAJA 4RJ3A 1H24A 5AA8A 2X4ZA 5EQYA 4PL5A 1Y8GA 1LP4A 1PMNA 1Q41A 4ZTNA 4FBXA 2R64A 3ROYA 3ZLXA 3ZZEA 3A8WA 1KE6A 3FSFA 4HGTA 2WIPA 2IO6A 4UWCA 2JKMA 4AFEA 3BHTA 5J7HA 3ZSGA 2ITZA 4NM3A 3ORKA 4QYGA 3E93A 4EH7A 2F7ZE 3EQRA 5L8LA 4I93A 3O8TA 2VAGA 4HVDA 5HU3A 2GTNA 4FKJA 2RGPA 3D7TA 2HIWA 5BVEA 4FSUA 5HLWA 3TWJA 2V7AA 1Q8TA 4L52A 3AKJA 4BWPA 5A3XA 3D4QA 3SOCA 5CEIA 3JYAA 3G5DA 4ITJA 2GNJA 2VTLA 3V5TA 4C33A 2ERZE 2WZJA 5AUYA 3FJQE 5G6VA 1RJBA 2Y6MA 2PVRA 4F0GA 4IQ6A 3VUDA 4IC7A 1PKDA 4ERKA 4YZCA 3UOJA 2C5OA 2WQOA 4FOCA 5CU6A 3FZ1A 1UKHA 3V6RA 4AUAA 3KF4A 4E4LA 5CF5A 5L2SA 5AP6A 4FEXA 2GFCA 5LMKA 2WNTA 1T46A 4MAOA 4ZSGA 4G1WA 4IH8A 1MRUA 5CAUA 3AC3A 2YABA 3CCNA 3BU5A 4IIRA 5BYZA 2WU7A 5L2IA 5JRQA 4DEDA 3P78A 2PZPA 4R5YA 4RIXA 1Z9XA 3IG7A 5TT7A 4MNEB 3MFTA 3N9XA 3LFFA 3ZOSA 3KMUA 4JVGA 1JKTA 2W17A 4QMXA 2W99B 1Q3DA 5IQHA 2WMAA 4DH1A 4Q9ZA 3II5A 4N0SA 3RAKA 2IVSA 3KF7A 2XARA 3MTLA 4O7NA 4MD7E 3LQ5A 3GU5A 2CGXA 4PMSA 4JIAA 1V1KA 3QAME 3IDBA 3H4JA 1H1PA 5FDXA 3RP9A 5JGAA 4DTAA 4ZLZA 1IAHA 5A9UA 3OC1A 5CU0A 2B9JA 4Z16A 4C3RA 3PPJA 5TE0A 3FZRA 2PPQA 4ALWA 4KS7A 1R39A 4M8TA 4YJSA 5D7VA 3C4WA 2CSNA 4KWPA 5BUJA 2UZUE 3C4XA 3CQUA 1WBTA 4UXQA 4TTHB 3UDZA 3W2QA 1Z5MA 2F4JA 3GI3A 4I5MA 3V3VA 4I21A 3QHWA 5L8JA 3TIYA 5FTOA 4EHZA 4NM5A 1XMLA 4N70A 2ITTA 2Y4IC 5DIAA 4JI9A 4TYHB 3Q9ZA 4AN2A 4AS0A 5B7VA 5HTCA 1TFFA 3GCUA 4DFNA 4ENXA 3TL8A 4PV0A 3HVCA 2XNNA 3QCXA 4O0YA 3CLYA 4NUSA 2G2IA 2BAQA 5CQUA 2BHHA 3LFBA 4I22A 3R22A 4D0XA 5AR2A 3WE8A 1PXOA 2P2IA 1VLRA 3EZVA 3GCQA 5AJQA 1XBBA 4U0IA 2EWAA 4CV8A 4G6OA 2FSLX 4AE6A 3Q52A 5GJDA 4DN5A 4E20A 4O21A 2CLQA 3RINA 2B9FA 3QKLA 4PDOA 4YJVA 1RDQE 2R3FA 4IVDA 3ROCA 2V5QA 2YM3A 3FPMA 2YM8A 4D4YA 3UE4A 3BPRA 5L2QA 4CFMA 1OKZA 3NDMA 3EMGA 1YW2A 4O83A 3F3VA 3POOA 5CYIA 5T3QA 5FXRA 3R2BA 3ZO3A 3U6JA 3PVGA 1QPJA 2AQXA 4YPDA 2W0JA 2QKWB 4F0IA 3VS0A 4M15A 4LOOA 4C57A 3DB6A 4KKHA 4ANBA 4RJ7A 1FQ1B 4IVCA 3DBCA 4A7CA 4TY1A 4X2GA 4LI5A 4MD8E 4L44A 5GJFA 4B0GA 3R00A 4R7HA 3FWQA 3IDCA 4FYNA 4S31A 3UZTA 3EQFA 4CYJA 4E6QA 2Z2WA 4CZTA 5H2UA 4C36A 2C6EA 3Q32A 4KAOA 3QCYA 5M53A 2ZB1A 4J95A 2VV9A 3A7HA 3R1SA 4MNEA 4BF2A 1OUYA 5HTBA 3NYVA 4GJ2A 4FL2A 5M4FA 3ORTA 2YHVA 5CSXA 4XMOA 4AXCA 3OCSA 2CNVA 2VWXA 5KKRB 5K5XA 5J87A 3R8UA 3BV3A 3E3PA 4RA4A 4BWXA 2BTRA 4U7ZA 4C62A 5IDNA 4DFZE 5CI7A 3OS3A 3G9LX 1H26A 2P2HA 5IF1A 2VN9A 3PP1A 3E88A 3AGLA 3Q96A 4O6LA 5AM6A 3GCPA 3DDPA 3IOPA 3ZU7A 3VUGA 2XKEA 4ZSLA 5B2LA 4OUCA 4FSQA 4CT2A 2XRWA 4PP9A 2AEGA 2W9FB 5ICPA 4I1ZA 4O0VA 3P0MA 2RSVA 4U3YA 3RK9A 4AQCA 4D2SA 5IUIA 3VW8A 2WELA 3UQFA 3NGAA 4FSRA 4DLJA 2CHLA 4FKRA 3QF9A 5J5TA 4A4XA 4ACGA 3DZOA 2XNBA 1P14A 4AZFA 1OIRA 2NYAA 4F9CA 4TYHA 1BL6A 4J96A 4RIYB 5AV0A 2ZV9A 4EZ5A 5DYJA 3FI2A 1U4DA 4RX7A 3VW6A 3DQXA 2WTJA 4PTGA 2QODA 4BZOA 1H0WA 3I0OA 3HA8A 4K33A 4K9YA 4NJDA 4MNFA 3BEAA 3FKOA 5CTPA 1CKJA 3UOKA 3ZUUA 4GYIA 5GJGA 1YXSA 3T3UA 4BKYA 2ZM1A 5J79A 4N6YA 2LAVA 1QPCA 4CFNA 4EH6A 1TQPA 3OTVA 1JKKA 2ETMA 3UZRA 4ID7A 2W1HA 3IOKA 1ZMWA 2PVYA 2X2MA 4E93A 2UVZA 1CKPA 2QONA 2X8DA 3ODYX 4ONAA 2F2UA 5HNGA 5LOHA 3EN4A 2OXXA 3U4WA 2UW0A 1OPJA 3LMGA 3W0OA 4ALUA 5EKNA 1OL1A 2I40A 2WTCA 4I6LA 3PG3A 4JRVA 4EK3A 4IACA 3VBQA 2HZIA 1IA8A 3PJ2A 4J8MA 4MK0A 4G9CA 3E3BX 5EYKA 1YOMA 5IQAA 5M06A 2BILB 4PF4A 3EYGA 4FTOA 4Z9LA 1ZAOA 5B0XA 3ZHPC 4D1SA 4E5BA 2F57A 4HZSA 4N57A 4FTIA 4LRMA 2J7TA 2UVYA 1Q61A 2PULA 4MCVA 2FO0A 3A4PA 1ATPE 3OHTA 5J7BA 5IH4A 4P4CA 2PUNA 3R73A 3KY2A 4O0SA 4RVMA 1G3NA 2XCHA 4AGCA 3RMFA 4PRJA 1UWJA 2FA2A 2UZBA 1YHSA 4DDIA 3RPSA 3UPXA 4QQTA 2J5EA 2ZYBA 1G5SA 3OVVA 5GHVA 3PE1A 4F99A 2B53A 3C7QA 3D5WA 4UEUA 3WE4A 4CQGA 2R7IA 2C3JA 4U80A 5HO6A 3H0ZA 4IB0A 4RC2A 2UZDA 4IZ7A 1ZYSA 5A4EA 2R3RA 2CGVA 3FZOA 3GB2A 4O84A 4AAYA 5KHWA 2NO3A 1APME 3GFEA 4WSQA 5J1WA 1BL7A 3DJ6A 3HV6A 4BCHA 4GT3A 1YRPA 2WO6A 4FE2A 4G3EA 1UU8A 4DEHA 5CEMA 4XUFA 5IH6A 4QP2A 4RZWA 3RNIA 4HPTE 4XBUA 4ZS0A 4DEAA 4GL9A 4NK9A 2CKQA 4GS6A 5CSVA 1GNGA 4JL9A 2HWOA 3QRTA 3CD3A 4CYIA 2YDJA 4NYEA 2OBJA 3P1AA 3I5ZA 2BFXA 4R7IA 4IZ5A 1GZNA 4FV1A 3MA3A 4A4OA 4H3BA 4D1ZA 3R04A 4YO6A 3QX2A 3TNIA 3OBGA 4D5KA 4RIYA 3TUCA 2J0IA 4M13A 3HL7A 3NMUF 3BGPA 3V8WA 5BVOA 4MXOA 1OITA 2B54A 4C4EA 1SYKA 4BVUA 2R2PA 3I6WA 4JX7A 3WZDA 2GNLA 3LXNA 2ACXA 4KSPA 3TNPC 3A60A 5FUTA 4F1TA 5HE1A 5IPJA 2OF2A 3DK6A 4ZMEA 4QMSA 1PMUA 3C0GA 3VN9A 2JC6A 3OCGA 4MYGA 2RG5A 4EWHA 2VO7A 3LIJA 2XIRA 3SW4A 4BR3A 3VS6A 4F6UA 4B8MA 3S95A 3TV6A 3W0PA 5L6PA 5LVOA 5CU3A 3QQLA 1LEWA 2ZB0A 5DWRA 3MPAA 2W1GA 2OI4X 3UZPA 5IA5A 3R8MA 5CVFA 4PNKA 1SNUA 4FG9A 4X3JA 3SXRA 1L8TA 4YJTA 5AUZA 2PZYA 4FKQA 4B4LA 4CFVA 5K4IA 3UDSA 3ENMA 5M57A 4FIEA 3RHXA 3UMWA 3I1AA 3NWWA 2JKQA 3RK7A 2JAVA 3V51A 3LHJA 4L46A 3OT3A 4O22A 4F6SA 3DK7A 4IB5A 4YU2A 2HZ0A 3LJ0A 4L7SA 3VS5A 3SD0A 3Q9XA 3QTXA 1OIQA 1YI4A 2IZTA 2JIUA 3GU7A 4XV2A 5KBQA 4FV8A 1Q8YA 2NPQA 2VWBA 5E1SA 2J0JA 5A6OA 3ZDUA 5H8EA 3S4QA 1FVVA 3LW0A 4TPTA 2OXYA 2B9HA 5AIRA 3D5VA 4G5JA 4J97A 4JQEA 3MV5A 2OZOA 5FEQA 1M52A 1AQ1A 5HGIA 4J7BA 2W4OA 3QC9A 1W84A 3L9LA 1KV2A 4IW0A 4AT3A 4F78A 4RG0A 2GHMA 2JLDA 4PTEA 4DHFA 2XEZA 4AW2A 3H9OA 3SRVA 4NIFA 4QTAA 4AZTA 4PQNA 2X2LA 2YIYA 3OUKA 3TNWA 4HW7A 5TO8A 4IE9A 4M12A 1ZMVA 4EBWA 4EOLA 1UV5A 3AC4A 3WF9A 3JXWA 3POZA 3TTIA 4X7QA 3CXWA 3R7YA 3W2PA 3JY9A 3EQBA 4H3QA 4HJOA 3H10A 4JNWA 5DN3A 2R3NA 4J98A 3QLFA 4BCQA 3HYHA 5H9BA 3ANQA 3JS2A 4KNBA 4U41A 1QL6A 4FX3A 2R3HA 1OUKA 5DHJA 4F7JA 5HZNA 4H1JA 3I60A 2CN8A 4K18A 2BRMA 3CTQA 1P2AA 4C35A 3BLRA 2PL0A 4U3ZA 4BDFA 2YZLA 2A19B 4MQ1A 3DBDA 4U43A 3CBLA 4D2TA 4W9WA 5IMEA 2PMIA 2QOCA 4BCOA 4F63A 4O0TA 4A9UA 4U9AA 5BMSA 2ETKA 2X7GA 3VBWA 4XS2A 3VS3A 3KREA 3L8VA 1Q5KA 4DDGA 2BROA 3U8WA 3ZRLA 4TWPA 5G1XA 4C4IA 3OP5A 4EUTA 1NT2A 3EQHA 3O51A 2YFXA 5CNNA 4YHFA 4L9IA 5ACKA 2CCHA 3HEGA 3ZO1A 4O7VA 5IQCA 2G2HA 2I0EA 2RG6A 3LFSA 2LGCA 3BHYA 4JS8A 4UY9A 2W1DA 3SV0A 5M4UA 2O64A 3SLSA 2BUJA 2J9MA 3FC1X 4IZYA 3ZS5A 5CXZA 3AGMA 3QQHA 4AGDA 4II5A 5JRSA 4FT5A 2QO2A 3FMDA 4C8BA 5K9IA 3G15A 5GIPE 3ZZWA 5CNOA 5HLPA 3ENHA 4RX9A 2QKRA 3A4OX 1R78A 4UB7A 4G16A 3IW4A 1QMZA 2BR1A 1YVJA 3COIA 2ZMCA 4QO9A 4E6DA 4EC9A 5BQ0A 3COMA 2CKOA 3IGOA 3G33A 4YZ9A 4M68A 1UKIA 3ELJA 3EQGA 4O27B 4RVKA 3IQ7A 5CQWA 3KXNA 4NCTC 4CFUA 5A4CA 3VBVA 2OFUA 3R9HA 2BFYA 2IZRA 2Y8OA 4RMZA 5AEPA 3CY2A 4EOPA 1GAGA 2WQNA 4EL9A 2B7AA 3NX8A 3ZC6A 1WVYA 4FKLA 4RQVA 5CVHA 4F7NA 4OAVB 1S9JA 4ERWA 4TXCA 1YHVA 3FBVA 1ZOGA 3FQHA 2QOQA 3OBJA 5IQDA 1JVPP 4X3FA 2WKMA 3P4KA 3WIGA 3EQCA 2VTAA 4LMUA 2EXEA 3EYHA 1OKWA 4FL1A 4GVAA 4CFWA 1XWSA 1BLXA 2Y4PA 4FGBA 4L3LA 3R83A 2DQ7X 3DLSA 5LCKA 4BKZA 5EI2A 1OBDA 3HP5A 1XO2B 3T3VA 2ZV2A 4QPAA 4WUNA 4A9TA 5J9LA 1ZZLA 3TN8A 4I6FA 4PL4A 5DEYA 3ZUVA 4EK8A 4F1OA 3MY0A 3P08A 3PJCA 3EZRA 4AFJA 4DHIB 3G6GA 4GVJA 1O9UA 2I0HA 3GBZA 4IWDA 4WG4A 5CX9A 1A48A 4F9WA 5JKGA 3DOGA 2VO6A 3FQSA 4ZOGA 2HK5A 2QU6A 5C01A 5KMIA 3TI1A 1JLUE 4MVFA 3SDJA 4FV5A 2X0OA 4KBAA 3ZUTA 1T45A 2WTIA 4G3GA 4L68A 4QMVA 2QG7A 3NVKI 3UOLA 4A9YA 1XKKA 2EB3A 4AZSA 5L2TA 2P33A 3VBYA 2I1MA 3FYKX 4RBLA 5BX0A 4XP2A 1DS5A 2OGVA 1YDSE 4C02A 1IA9A 3CQEA 2VUWA 3DKCA 3NUXA 4OLIA 3R63A 4EHGA 5A6NA 3EFLA 3CQWA 3DGKA 4YNOA 4F0FA 2RIOA 2PSQA 2YN8A 3DT1A 4W9XA 3VWAA 3DZQA 3MW1A 5HD4A 3UNJA 3EN5A 3NZ0A 5HG8A 4IJ9A 5F9EA 4H58A 3N4VA 4D2PA 3TDVA 2A1AB 3TJDA 2X2KA 3REPA 3PSCA 3KXZA 5DG5A 3D94A 5FBNC 3F5GA 3BYVA 3HMNA 3M11A 2VTMA 3NYOA 4MF1A 2YIXA 4BIEA 2JIIA 3GT8A 1ERKA 3HAVA 4W4WA 1PW2A 5ITAA 1SM2A 4RVTA 2BZIB 3R7VA 3DNEA 3EFKA 3HP2A 5CT7A 3LM0A 3HAMA 5FRIA 4IX4A 5HLNA 3C0IA 2WFYA 3HGKA 3QYWA 4RFMA 1GJOA 4GUEA 3R8VA 1PRYA 2J6MA 3PA5A 4EONA 5CEPA 3IW8A 3G2FA 3KEXA 2OIDA 4FV9A 3ZONA 5M4CA 3D7TB 1NVRA 3KRWA 4PUZA 5AV3A 1Q4LA 4BZDA 5IZFA 5AR4A 2XMYA 1UNHA 5DGZA 5HBHA 3E87A 4JDKA 3U87A 3BRBA 2Y9QA 3KRLA 4F65A 3WZJA 1K2PA 3QTRA 3DBQA 1PXIA 4PY1A 4GMYA 3NUUA 3SHEA 2X7FA 4EOKA 2R7BA 3B8QA 4TWOA 4CLJA 2ITVA 1GOLA 4LV5A 4WNMA 3C51A 3ATTA 5LCJA 4QTEA