4P5QA

Human epha3 kinase domain in complex with quinoxaline derivatives
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 3
publication title Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 275
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p5qA01
3WE8A 4BCNA 4UALA 4BF2A 5FLFA 4FZAB 3FY2A 5M4IA 3FZRA 3QC9A 4AQCA 3C5UA 5IUGA 2E9VA 4FKTA 4I5HA 1XBBA 3S0OA 2XJ0A 3EFJA 3NR9A 3FSFA 4HW7A 2IPXA 3PYYA 5EOLA 1J7IA 1H8FA 2IZTA 3BRBA 4I22A 5HOAA 1ZOHA 5D12A 2XJ2A 5ANKA 4JBOA 2J5EA 2QU6A 1KOAA 3U55A 3BYVA 3K5UA 5EFQA 1W82A 3ANRA 5AJQA 4DFYA 3R04A 4WG3A 2WTIA 2W1DA 4IWOA 1QL6A 5K4IA 2NO3A 3NDMA 2CSNA 3P9JA 3CY2A 4UBAA 5BVKA 4OUCA 1Z5MA 4L46A 2YCFA 4FSWA 1FMKA 5B0XA 2RL5A 5ANOA 5JFWA 4E3CA 4FE2A 3BIZA 3PDTA 3E8NA 5AAEA 2WQMA 2JIVA 5AP3A 2Z02A 4A9SA 4CYIA 3I6WA 2VO6A 4OTIA 2W5BA 3IG7A 3ZFYA 2GSFA 5AADA 4L68A 3QA8A 2REIA 4AGDA 3BBTB 5AAFA 2W1ZA 4K8AA 1SNUA 2CGWA 3AC8A 5CSVA 4YNEA 1YXXA 2JITA 3FQEA 3IW5A 4O0WA 2W9FB 3D2IA 4FTNA 3RPVA 2H9VA 2AUHA 4AFEA 4J7BA 4ITJA 2Z7LA 3O71A 2EWAA 4NTTA 3HV3A 4O6LA 3ORPA 4CRLA 4MKCA 2ZMDA 2DYLA 3LJ0A 3TIYA 2HZIA 1QMZA 1XR1A 1LR4A 2OK1A 4FKOA 4M67A 5G6VA 4B99A 4C57A 3BLHA 4YJQA 1OMWA 3IGOA 2O65A 2PUUA 3UYTA 3ZONA 4GL9A 4DT8A 5ANEA 1PXOA 5KKRC 3DQWA 3R2YA 5HG9A 2F7XE 2UV2A 2CLXA 3AXWA 3R02A 2Y4PA 2PY3A 2YZAA 4XRLA 5CEQA 4AN9A 4FKSA 4DINA 4MBJA 5AV2A 4WNPA 4EEVA 5GZAA 5JK3A 5KO1A 4O81A 5FXSA 5M07A 2C3KA 5A9UA 5FM2A 4DITA 4I41A 3N4UA 3MIYA 1Y8YA 4ZSAA 4RIXB 4DGOA 3P7BA 3OROA 4FTJA 3LAUA 2GFCA 2LGCA 2CKOA 4N6ZA 3KXGA 3VS5A 4BCFA 2EUFB 4D2RA 3UOKA 5LCJA 2CCHA 2XK9A 3TTIA 2W1FA 2R9SA 4E5BA 4DT9A 4U0IA 5EHLA 3ZRMA 4OTHA 4J52A 4I4FA 3FQSA 3TT0A 3A4PA 3DA6A 1E1VA 1UU7A 3C4FA 3QHRA 4HOKA 4IEBA 1H0WA 1ZYCA 2CN8A 3CIKA 3TNPC 5KMLA 3W2SA 4E4LA 3WOWA 5DYJA 3VBXA 4K1BA 3MH3A 4WIHA 1OPKA 1R3CA 3A8XA 5DRBA 1T46A 4X2KA 3I60A 5GJFA 4DH1A 2F7ZE 4AT5A 1M52A 2WIHA 3FPQA 5D1JA 1OBDA 3JXWA 4FTQA 2YM6A 2FSMX 3I7BA 4QMUA 4DFXE 3NVMB 3VW8A 3S00A 4FVQA 4PL5A 3GCSA 4YC8A 4E4NA 4TKSA 5L2TA 2W1CA 3IW7A 4RWLA 4B0GA 4G16A 4C59A 2XNEA 3CJFA 4W9WA 1ZY5A 2R0IA 4LMNA 4LUDA 1H0VA 4A9TA 2W1GA 5IQDA 2QD9A 2I0VA 3ORTA 1H24A 4QP9A 4RT7A 5AP4A 4F9AA 4I5PA 3TL8A 3QQGA 4FSZA 4FUYA 4V0GA 3PVUA 4FV1A 4FODA 4DFNA 4EJNA 3LXLA 4O38A 3A60A 4CTCA 3ZYAA 5FWKK 4FTAA 3DZOA 4E6DA 2YWVA 2R4BA 2VNYA 5HG5A 4PTEA 4FZFB 4M14A 3FEGA 4GFGA 1G5SA 1Q62A 5AV3A 2VTHA 4FTRA 4D2PA 4BI2A 3PA3A 4L8MA 4FVPA 2ITVA 3ANQA 3D5XA 4ANQA 5AR7A 1YDTE 2YM7A 5I9XA 4PRJA 3OBGA 4U6RA 3COKA 2XK3A 5AUYA 1MRVA 5EYMA 1A06A 4G34A 2UZNA 5CU0A 1XJDA 2OFUA 2RG6A 4AT4A 4I6BA 4FBXA 5GZ9A 3QZGA 4YHFA 3TNHA 2UZWE 5CSXA 4EK5A 1FGKA 4U45A 3VQHA 1ZYSA 4QTCA 3RPSA 4CFVA 4DH5A 2XKEA 4ZLOA 4I6QA 4NSTA 4BTJA 2UZBA 2EXEA 3HZTA 4O2ZA 5FD2A 3K5VA 2OJGA 1OL2A 1KOBA 2WB8A 3PY3A 5H8EA 5ANGA 2VGPA 3PA4A 4CLJA 4DTBA 2JAVA 5HO8A 3DBCA 1BI7A 5IEXA 2QODA 2OF4A 3KCFA 3PPZA 5AP1A 4OTWA 3OY3A 4LG4A 3A7HA 3V51A 2CJMA 4PP9A 2I0YA 3ZEWA 5EG3A 5HCYA 4ZSLA 3LQ5A 4XG3A 3PE1A 2WMQA 4JJRA 3PTGA 4U7ZA 5CSHA 4FT7A 4F7JA 5EQYA 3VS4A 2CLQA 3BYOA 4LRMA 4ZS0A 5M06A 3ROCA 4EZ7A 3ZXZA 4EWQA 3EQRA 2R3OA 4RWIA 2WQBA 4DEAA 4TZRA 3L9MA 4MXOA 2YITA 1GIHA 3GCQA 1APME 3SKCA 3VUTA 3RK9A 4AP7A 4CFMA 3NCGA 4E6QA 2YM3A 2XUUA 3SRVB 4ANSA 1NVRA 4FSQA 4U5JA 3A7IA 4HJOA 2BZHB 5KZ0A 2CNVA 5HG8A 4QMNA 1XBAA 2XK8A 4OAUC 3PJ1A 4RJ5A 4YU2A 3FLWA 3QC4A 4UXLA 2V22A 5JH6A 1PXNA 1VR2A 1J1CA 4YBKA 5K3YA 3U51A 2XIYA 4GFMA 4L7FA 4UWBA 5BYYA 4FKQA 4FV7A 2BROA 2PZIA 3FMKA 1VYWA 2W06A 4FL2A 2QONA 1RE8A 4YP8A 2PVKA 3IW6A 4PL4A 3MFUA 2WIPA 4FV5A 4C4EA 2Q0BA 4B6LA 1FINA 3I1AA 4NIFB 3PG1A 3R9DA 1WBTA 3O51A 3CXWA 4XS2A 3LFBA 3QUEA 3W2PA 4FNWA 5FBOA 4EHVA 3ZM4A 4MD9E 4UEUA 2OW3A 3TUDA 1U54B 3Q4UA 2WTDA 2IWIA 2IW8A 3ZXTA 4BDAA 4AUAA 2JDTA 4O7YA 4HVIA 1PXKA 1PYEA 1M2PA 4Y95A 5DEWA 5KNJA 4QMTA 4RX9A 4R7IA 2B53A 2I0HA 3G2FA 4NKSA 2YCRA 3AC2A 3RM6A 3GC0A 5LVOA 4RJ7A 4RX5A 4QP1A 5J79A 4N70A 3ZS5A 4FGRA 4RIYB 3E8CA 3PXYA 1E1XA 3DB8A 4GUBA 3VS2A 3DDQA 4HGTA 1KE6A 2PVMA 2GHMA 5EM7A 1F0QA 2C5NA 4O96A 4RJ6A 3JPVA 4CV9A 2VAGA 2O2UA 1KWPA 3Q52A 3QLGA 4I21A 4BYJA 4BDJA 3IS5A 2VD5A 3A61A 3UNJA 2W4JA 1ZYLA 3QD3A 3DKCA 2BDJA 4RIXA 4IACA 2W5AA 4EI4A 3SVVA 2PVRA 3QWKA 4YTCA 3ZO2A 5HVKA 5C27A 5C4KA 2YHVA 1YDSE 4R78A 2R64A 4G3DA 2GNHA 3BYMA 3HA6A 4MEDA 3TV6A 4L9IA 3QTRA 2CGVA 3ZEPA 1PYXA 1BL7A 3QQUA 4GSBA 4ANBA 1AGWA 3DLSA 4G31A 4QPMA 2B54A 3O2MA 4FTLA 4G3FA 5CU2A 4BGGA 3PVWA 2VN9A 3TNIA 5J5TA 3L9PA 3FKNA 4DE4A 2BUJA 3RPOA 1H26A 1YXVA 5HE1A 3NRMA 3ACKA 3BBWA 4KSPA 1ZYDA 3TEIA 4ONAA 3QRTA 5AP2A 4KS7A 4GUEA 1WFCA 4NZWB 3FMNA 3T3UA 5LMBA 5JMSA 4L42A 4CG8A 2JLDA 3NNVA 4NL0A 1IR3A 2RFNA 5EM8A 4BDDA 3PSDA 4I93A 4M0YA 5K5NA 4XV1A 4G6LA 3IK3A 3HMPA 2WMTA 3S4QA 3KFAA 3WZKA 3DXQA 3QX2A 3R1SA 3QYWA 4QNAA 2YCQA 4FTMA 3V04A 5C9CA 4XRJA 2WU6A 3LLTA 2X8IA 3A7FA 1YHWA 3GGFA 4OR5A 5CTPA 3PXQA 3BKBA 2PUIA 4CZTA 4ZJJA 5EYDA 1ZRZA 3A4OX 5M08A 2R3HA 4IZYA 2BFXA 2F4JA 3FHRA 4EOSA 3DFCB 4FEVA 3EN7A 3LE6A 2P33A 2OJFE 2YDJA 4UMTA 4OBQA 1KUTA 1BYGA 3HP5A 2BCJA 3R8MA 1YOJA 3D94A 3R22A 3RAHA 3NS9A 5EW8A 4C4JA 1P4OA 1LUFA 3KN5A 3EHAA 5EDQA 4I6FA 4IDVA 2ESMA 4HPUE 4YR8A 4QTDA 2UZTA 3IDBA 5FDXA 3CQEA 3MH0A 3R7VA 3ZLXA 2WO6A 4BDIA 1UVRA 3PP1A 3OBJA 1PW2A 2VTQA 4U43A 5AR5A 1GIIA 4D4YA 4L67A 4FTOA 4WHZA 3MVHA 1OB3A 2BDFA 2Q83A 3QD0A 4PWNA 2WTJA 3F66A 4YZBA 3V01A 4H39A 1CMKE 5K5XA 3HLLA 3CPBA 3DJ6A 3NYXA 4FZ7A 4TYGA 4GG5A 2HWOA 2XNOA 3R0TA 4ZTQA 4KNBA 4ZY4A 3V3VA 4LRJA 2O0UA 5HLNA 2ZB1A 4DEDA 4DFUA 1K2PA 2O5KA 3V5PA 3S1HA 3PIZA 3B8QA 4BCGA 4Y46A 3SV0A 4BKJA 5CU3A 5KUPA 3CY3A 2GTMA 4GJ3A 4APCA 5E91A 4EHGA 3N4TA 3HVCA 4ASXA 4O7NA 3EQCA 1DAYA 5DR9A 4H3BA 4LOQA 5AM7A 1Q8YA 3ZUVA 2BIKB 4YJOA 3FBVA 5HHWA 4JLCA 2YIQA 4A9RA 3FYJX 5AP7A 3MPAA 5EHOA 3DLZA 5CXHA 4DN5A 3RBWA 3QTZA 2E9OA 3L8VA 3G5DA 3VHEA 4BC6A 3F3TA 4YZNA 3MY1A 2J0IA 4KIKB 2WQNA 3ZH8A 4M66A 1UKIA 3U54A 5JRQA 3BYUA 3ENMA 4HZRA 3SRVA 4P7EA 1ZZ2A 3II5A 5BUEA 3SC1A 4HVGA 2WELA 4AAAA 4QMMA 4RQVA 4BBEA 4NFNA 3FLSA 3I5ZA 3ZHPC 4DTKA 3AMBA 4GH2A 1R0PA 2XMYA 3QCYA 3IW4A 1JSTA 4QPAA 3C4CA 4IANA 1R78A 3SOAA 4R6VA 1JWHA 1WBSA 3BU6A 4ZOGA 3H9FA 3BWFA 1GZ8A 2VX3A 2XYNA 2VWXA 3GU4A 4R5YA 3R7YA 4RWKA 3FKLA 4Y83A 1ZMUA 3U4WA 3RCJA 5JT2A 3VJNA 4PNKA 1IAHA 4YC6A 2C3IB 3Q9YA 1BI8A 4XBUA 4UMRA 3E8DA 2YABA 2BRMA 3NIEA 5FGKA 4DLIA 4FNZA 1UU8A 4U81A 1OITA 2YJRA 3VNTA 2WU7A 4C36A 1OL7A 1Y6AA 5B2KA 4CFNA 2OLCA 3R1QA 1Y91A 2OF2A 5CANA 3QA0A 1OKZA 1U54A 3FZTA 3WI6A 5IQFA 3LIJA 2OI4X 3K2LA 3ODZX 4ZJIA 4BB4A 3BI6A 3ULIA 3C4XA 2F7EE 4F6SA 5FQDC 3POOA 3QL8A 4U3YA 3BHHA 2X7OA 2WOTA 4NM0A 5ACBC 5C8KA 3IKAA 5EI8A 4AF3A 5JGDA 2HAKA 1YXSA 4ZAUA 5IUHA 3O7LD 5IA1A 1JQHA 3GU6A 4RIYA 5CEMA 3O8TA 2J0KA 2FA2A 4D5KA 3DAKA 3AMYA 4JRVA 5M53A 3PXRA 5LWNA 3P7AA 2NPQA 4J1RA 3LPBA 3DJ7A 4YMJA 2R3LA 3BX5A 3EH9A 2QKWB 1Q61A 4FIEA 4XP2A 3IO7A 5DBXA 4FEQA 4ERKA 3G51A 4BWKA 2HXLA 2JAMA 2XRUA 3Q4ZA 4PF4A 4ALVA 2VTOA 5FEDA 4J99A 2QOFA 3PXKA 4FOCA 2C5YA 4IIRA 4D5HA 2ZJWA 3ELJA 5AR8A 2OICA 5EH0A 3WILA 4ZXTA 4TNDA 3NAXA 3W2OA 1WBNA 3MBLA 3UOLA 1OM1A 2ZMCA 3MFSA 3MV5A 2PYWA 3ZLSA 2VTIA 3LJ1A 4QOXA 3UQFA 1R1WA 2XM8A 4KBAA 2XNMA 4X21A 4B9DA 3U87A 4FKPA 3GT8A 1PXJA 4ACMA 4H3QA 4JQEA 3T8OA 2DWBA 4KINA 1H4LA 1YRPA 4GU9A 2YIXA 3NLBA 5HX8A 2OXYA 2WMBA 3CTHA 3QXPA 5HBJA 3UQGA 5M4FA 2CKEA 3QU0A 2PMOX 4TPTA 2C3JA 4F1MA 5ITAA 4KRDA 2GNFA 2ETRA 4IB1A 5C4LA 4WG5A 4RC2A 5FEQA 4C33A 4ZS4A 1YKRA 2XJ1A 2VTTA 4II5A 5IZFA 4GKHA 1JKLA 2OH4A 4XG8A 5AV0A 3ZC5A 5E92A 2HCKA 5HE2A 4ZY5A 1KV2A 4L53A 2F57A 1OL1A 5IMEA 1AQ1A 2C0OA 2VGOA 4DA5A 3AMAA 4LUEA 4NKAA 4A9UA 2ZAZA 3LOKA 4Z3VA 4JNWA 1ZYJA 2C6IA 3E92A 3KK9A 3MFRA 2RF9A 4KKGA 3BELA 4UV0A 5CS6A 2RFDA 3ORIA 4N6YA 5DWRA 4FG7A 4XG9A 1DAWA 3GQIA 3MVLA 4UY9A 1SZMA 5JZNA 4EH6A 3ZRKA 4TL0A 5JZJA 3FL4A 4I5CA 2QOQA 2QOIA 4FIHA 4FKWA 3WYXA 5HTCA 5LVNA 4BWPA 5LWMA 1WBVA 4MVFA 4GEOA 4DG3E 3TJDA 5GINE 3QTIA 2YM8A 3R7UA 1OBGA 2BMCA 3QYZA 4XEYA 3KL8A 5AIKA 4N0SA 3ROYA 5ANIA 2CN5A 4YPDA 3C4EA 2BIYA 4XV9A 3DQXA 4UX9A 2G2FA 3Q4TA 4FSTA 3G0EA 1WBWA 4OT5A 1GZNA 3E5AA 4RFYA 4OBPA 5C03A 5EI6A 2ZOQA 2W4OA 4LOOA 4AA5A 4HNIA 4HYUA 3TV7A 3RMFA 2CHLA 2UW7A 3UMXA 4BN1A 5HZNA 4JIAA 4U8ZA 2C5XA 4LV5A 3FZSA 2IZUA 2X2KA 5ICPA 4EKLA 3IDCA 1Q5KA 2JDRA 5AUXA 5D11A 3NUUA 3OWJA 4GIHA 4V0GB 4C2VA 5IQBA 2VNWA 3HDMA 3OEFX 1RQQA 5JFXA 3QZFA 3BU5A 4JDIA 4C7TA 3OC1A 1NXKA 5E1EA 4FZDB 2ONLA 3SOCA 2WOUA 3CGOA 3CLYA 3GU5A 4FKRA 4L44A 4NCTC 4BKZA 5CEPA 4KIKA 4QMVA 2PK9A 2XVDA 3QGYA 5HBHA 1JOWB 3TWJA 2IN6A 3TZ8A 5J1WA 1PF8A 2YAKA 4TYIA 3W10A 3C5IA 4JAJA 5IF1A 3COIA 3Q04A 4C4FA 3VS6A 2GS6A 1Q8TA 2WTWA 3UIMA 2I40A 5DI1A 5CAVA 2C47A 3PXFA 4MH7A 1H1RA 4WUAA 4IX5A 5CQUA 4AZWA 1WBPA 3MA3A 4BHZA 1KE9A 4FIGA 4X2FA 4C3RA 4EK3A 5BUJA 5L2IA 3WF5A 3Q9WA 3R6XA 4OGRA 3MESA 5DPVA 5ACKA 3MTLA 4BCJA 5B7VA 5AR3A 5DVRA 2W99B 2WMVA 4O91A 1HOWA 1BMKA 4KKEA 5HNBA 4E4MA 4OAVB 3I6UA 2YZLA 5FEEA 3R9OA 3I4BA 3UNKA 2A4LA 5HQ0A 2G01A 1SVEA 3LCDA 3MTFA 3GFWA 2H6DA 3Q6WA 1UWHA 3ORZA 3O96A 2IVTA 3MPTA 3KXMA 3F2NA 5AP5A 4AG8A 2CNUA 4EH9A 1H1PA 3BZ3A 3NUSA 3L8XA 5ANJA 3V8SA 5KMNA 2B0QA 5E8SA 3D5VA 5DMZA 1W83A 2XCKA 4B4LA 2WMUA 3PXZA 3PIYA 1M7QA 4CEGA 1OKWA 1PXMA 4XBRA 5KCVA 4JRNA 4F6WA 4FTUA 1SVHA 2YIRA 4LMUA 5HGIA 4IADA 1XH9A 2X7GA 3UODA 3KF7A 3O0GA 1Z9XA 4K0YA 4D1XA 2J2IB 1J7LA 5A4EA 4PPBA 3W33A 2QR7A 4FYNA 3CCNA 3FMJA 1GZKA 3VQUA 2WGJA 1KV1A 1YI3A 5C26A 3FXWA 2O64A 5E7RA 3THBA 3ZUTA 4KBCA 4TYHA 4YJPA 3EFWA 5TR6A 3F88A 3R8PA 2FSLX 4AX8A 3NCZA 2QOBA 3PY0A 2WQEA 4EYJA 4ZTNA 1WVXA 2P2HA 5E8XA 2R2PA 3LFFA 4X6RA 2HZ0A 1ZAOA 3OD6X 4QMSA 4GW8A 1PKDA 4F09A 2XM9A 3KK8A 3EQFA 3H0YA 4QMLA 5IQCA 3L8PA 3WF7A 4EOOA 2J0JA 4QNYA 4CCUA 3HMOA 2C0IA 4GK3A 2GNJA 2SRCA 3C50A 4O1OA 4FV6A 5DIAA 5FTOA 5HNIX 4DTAA 2GHGA 4DEBA 3NW6A 2W4KA 4IAKA 2Z2WA 5FG8A 4ANNA 4NM3A 2W9ZB 4U40A 5E8TA 4C4GA 3LQ8A 3RHXA 1OIQA 5I9WA 2XNBA 2GNIA 3EJ1A 3OFMA 3V8WA 3KQ7A 3IOPA 1PMVA 4F08A 4P4CA 2Y0AA 3UE4A 4MXCA 5E1SA 3QHWA 4ITIA 4YO4A 5JN2A 2XNPA 4RJ4A 2ZB0A 3NUXA 2C4GA 4R1VA 4AGUA 4V01A 4IZ7A 4G3GA 2C1BA 4TRLA 3R21A 3TNWA 5CEOA 3GU8A 3EQDA 3LJ2A 3W2RA 3WIGA 3GB2A 4OTPA 3RAWA 4A4XA 2Y9QA 3R00A 4G6NA 4IX4A 2H34A 4NUSA 4IVAA 4FICA 4RSSA 2WKMA 4CKRA 2Z8CA 3VBWA 3DV3A 5BYLA 3ZTXA 4RA4A 4RIWB 4IX3A 3R8UA 5CYIA 2QOHA 3M11A 3G9NA 2B9JA 2WEVA 3R9NA 4XHKB 2J6MA 3DY7A 3LFNA 1BLXA 4FT9A 3H9OA 1OUYA 4DHFA 3W8LA 4L45A 5GNKA 2CGUA 3BPRA 4RG0A 3HAMA 2ITTA 3ZMMA 1SMHA 3SDJA 4C3PA 5A46A 3HGKA 3VF8A 4JOAA 2W05A 3W18A 4Y73A 3FMDA 2KTYA 4XG6A 3G9LX 5IQGA 2ETKA 3AC4A 4FV8A 3LFEA 3TXOA 4TWPA 5L6OA 3LMIA 3UZTA 3E62A 4QTEA 4BDGA 2PZRA 3T9IA 4UYAA 4X6QC 2C0TA 4FIIA 3EYGA 4PTCA 5LVMA 1OKVA 1U4DA 3G90X 5JEBA 1P2AA 3UG2A 2FB8A 4AW5A 2AC5A 1U5QA 2YISA 3LFAA 4JG8A 1OIRA 4EQCA 3GUBA 5CVGA 3ITZA 2BAQA 3DKOA 2JD5A 2BKZA 4EC9A 3LXPA 3KN6A 3F2AA 4I0TA 2PULA 4YLKA 3MY5A 5B2LA 3F69A 4PV0A 3FLYA 4NJDA 2ERKA 2J5FA 3IDPA 4HVSA 4S33A 2JFLA 2HY81 3LQ3A 3UQCA 2XCHA 3OT8A 4DG2E 2PU8A 3D83A 1XH5A 4F0GA 4MK0A 2JKKA 1AD5A 3EKNA 3H30A 4W8EA 1GAGA 1O6LA 2QHMA 2UW4A 4U80A 4USFA 4LL0A 1KE7A 4H58A 3MN3A 2GNLA 5JQ5A 1CDKA 3ALOA 4V04A 2OZOA 5T6KA 3ZU7A 5I9VA 4XP3A 3DFAA 4PMSA 3VHKA 1PJKA 5CI7A 1QPDA 5IEYA 4PL3A 5DRDA 3HV5A 2JDOA 1Q97A 4C58A 4PDYA 5A4TA 3Q5IA 3V5WA 4IZAA 3ZCLA 1P5EA 2RKUA 4OBOA 4S32A 2W1HA 4BZNA 4F6UA 3U6JA 3LKMA 4HGSA 2KULA 4OTGA 1CM8A 2PWLA 3JUHA 3JVSA 4MXXA 1M2RA 3NGAA 4O7TA 4FSYA 5K4JA 3ZLWA 2ITPA 3ULZA 5BVFA 2FH9A 5M4UA 4FKJA 4BBMA 5HLWA 4YJTA 4IJ9A 5M44A 4ZSJA 2NRYA 3NYOA 5CQWA 4GV1A 4NU1A 3V5QA 2UW3A 5AEPA 3TUCA 5AX9A 2PL0A 5IA4A 5E8WA 4R8QA 2ITWA 1NW1A 4AZFA 4O7VA 4X3FC 5KBRA 1BX6A 4L01A 4YTHA 4ENYA 4TY1A 3TDWA 2OBJA 2CPKE 2WMRA 3OCBA 2QNJA 4RWJA 5AWMA 3W8QA 4F0IA 4JQ7A 3RK7A 5DHJA 4O86A 2QKRA 4M7IA 4QYGA 2GPHA 4UYNA 4AW1A 4BGQA 1DI9A 2QG5A 4KIQA 5C1QB 4LI5A 3DBQA 3QF9A 3NNXA 4Q2AA 3ZO1A 2R3RA 2QR8A 3ACJA 4AGWA 5TOZA 4CXAA 2X9FA 5JSMA 4TT7A 2YIWA 4RFZA 2V0DA 3L1SA 3R28A 2VTPA 5AR4A 4QQJA 4M69B 4ZTSA 3RAKA 4BR3A 4A4LA 5HESA 4ERWA 3R9HA 2Y6OA 4RBLA 3SA0A 3DAEA 5HU9A 3TIZA 5H8GA 4G9CA 3Q32A 3RKBA 3E7VA 4AWIA 5JFSA 2PZ5A 3R71A 2QHNA 5DT4A 1H1QA 2ITUA 2JIIA 1HCLA 4AA0A 3TI1A 4NEUA 2P0CA 4MNFA 4JI9A 3BU3A 2H8HA 3B2TA 2BILB 4AOJA 4DFLA 4ZLYA 1LEZA 2JGZA 1Q24A 1Y8GA 1XQZA 3FUPA 3UNZA 4CCBA 5J7BA 2YLEA 4BICA 3FSKA 4GIIA 2QURA 3EN6A 3Q6UA 3QXOA 3W2QA 4C61A 4C34A 2OG8A 2XBAA 4HCUA 3UIBA 4NWMA 5JFVA 5L2QA 3R1NA 4FV0A 5AMNA 4O7WA 5CSWA 5LJJA 1G8SA 1R0EA 2VRXA 4O7RA 1Q4LA 3PP0A 5HD7A 4EH3A 4Z16A 4CYJA 3SX9A 4L52A 5DR2A 4QP2A 2ITXA 3EOCA 3I5NA 3DJ5A 4MBLA 4FIJA 4LFIA 3F5UA 3QD4A 4Q5HA 2V5QA 4PUZA 2PVLA 4EC8A 4U44A 5IA3A 5JRSA 3R30A 4EORA 3F7WA 2BHEA 4JG6A 3QCXA 2XNNA 3DS6A 5KKRB 1FMOE 3PLSA 3KULB 4UZDA 1FPUA 3VF9A 4RIWA 1DS5A 4UMPA 4S31A 4E5WA 3NYVA 4RIOA 4AA4A 3UO4A 2CNQA 1XH6A 4G2FA 3PFQA 1K3AA 1RJBA 2XYUA 3TJCA 3ZLYA 4O0SA 4UB7A 3IOKA 3RTPA 3FMLA 4D2VA 4N57A 2PUPA 1ZARA 3OOMA 1MP8A 2HELA 4I20A 4CQEA 3QRJA 3E93A 2BTRA 4LL5A 3VUMA 4E73A 4E7WA 3W55A 4FMQA 4BCHA 4QO9A 3HRCA 1VEBA 3O8UA 2BRBA 2ZM4A 4RVKA 2XIZA 3D2KA 4D1ZA 1UU3A 4DBNA 3DXPA 3F61A 3VAPA 3FZOA 2X81A 5DT0A 3VN9A 4BCQA 3NZ0A 1NVQA 3EMGA 5G1XA 1OPJA 4IFGA 4R3RA 5L4QA 4W4YA 1ZOEA 2HK5A 2OXDA 2JKMA 4TWCA 5F1ZA 4EONA 2BRNA 2W1EA 3PVBA 3LLAA 4R77A 4DF3A 3KMWA 3KRJA 1IASA 3BE9A 4F63A 4C4IA 3WZJA 5CI6A 4EUTA 5CSPA 5J7HA 3EKKA 2VWYA 5ETFA 3U9CA 1UA2A 2PSQA 3P23A 3NUAA 5HVYA 4EOQA 4KWPA 1L8TA 3ZDUA 2R7IA 4BDCA 3OMVA 4MD7E 5AA9A 1R39A 3CQWA 2XIRA 5L2SA 1RW8A 3Q3BA 3DB6A 2GTNA 3VRZA 2ZVAA 4ZIMA 3UGCA 4AOTA 3IQ7A 4IE9A 4PDOA 4BGHA 2A2AA 2OJ9A 5J1VA 4GT3A 3ET7A 4PPCA 5IH6A 2VTRA 1FVRA 3TNQB 2WTKC 5F9EA 4AS0A 4RRVA 4PTGA 4WBOA 1Q99A 4X0MA 4ZTHA 4XOYA 3C7QA 4NCTA 2UVYA 4FK6A 4BBFA 1YQJA 4CT1A 4IAFA 3E64A 3KKVA 2ITOA 3CKXA 3C0IA 5KZIA 1TQIA 1YHVA 2OZAA 2VWBA 3CD3A 3VC4A 4DLJA 1B6CB 3MH1A 5HD4A 4LM5A 5CWZA 4UMUA 1M14A 2OIBA 3LXNA 2BALA 5M51A 2YAAA 4XOZA 3RI1A 2PZPA 3DK7A 4MBIA 2CMWA 3HYHA 5BX0A 3QZIA 3RPYA 4OLIA 1GOLA 3D15A 3QGWA 3UZPA 2W1IA 3TKUA 3C0HA 3FZPA 3VBYA 5BPYA 4QMWA 5IQIA 1CTPE 4M68A 5IU2A 5CU4A 4QP8A 2JBPA 3R7IA 2R3QA 5LXMA 3BHVA 2WEIA 3WYYA 4MX9A 4M97A 4YZ9A 2QO7A 3QRIA 5IKWA 3I7CA 3F2RA 5GJDA 4UMQA 1UV5A 5CXZA 2HW6A 5DH3A 2BR1A 3VS7A 1H01A 3ENHA 2QQ7A 4M3QA 4IC8A 5BMMA 4WSQA 4ASZA 4DYMA 1VZOA 1JBPE 3A8WA 4XMOA 2B1PA 2BZIB 5DG5A 2C1AA 2G1TA 4QYFA 4BI0A 3SW7A 5C8MA 4IB0A 1XWSA 4G17A 4FEXA 3MB7A 4YLLA 4IBMA 5HICA 1JLUE 1QPJA 5TE0A 3SG8A 3F7ZA 4M69A 2EXMA 3E8EA 3PJ3A 4YZDA 1Y57A 1GIJA 4HGLA 2QOOA 4DBXA 4JDHA 3DBDA 1BUHA 4KS8A 4GRBA 3UBDA 4F4PA 4I3ZA 2QU5A 3O7LB 4PMTA 5KMOA 1G3NA 2YCSA 5HVJA 2QG7A 2IVSA 3TDVA 1H25A 3UP7A 4GVAA 3UYSA 3DKGA 3R7EA 4CG9A 4ZMFA 3LFSA 2UW9A 2PMIA 3Q9XA 4QPSA 3UZRA 2F9GA 3QQKA 5B2MA 1YVJA 4IM3A 2VX0A 4NJ3A 2R7BA 4BYIA 2HW7A 1LEWA 4GJ2A 3CR0A 4FG8A 4RMZA 5CAOA 3MIAA 5HIBA 4DH3A 4KB8A 4WO5A 4I24A 2G2IA 3DK6A 4XLIA 4AT3A 5IG1A 3ETAA 4BZOA 4FEWA 3SG9A 2FGIA 2B7AA 3FLNC 3VBVA 4YZCA 2W5HA 2XNGA 3HMNA 4A07A 3F5PA 2OKRA 3ORLA 1DI8A 3PSCA 5FP5A 3AT3A 1URWA 3JYAA 1UWJA 2X9EA 5CVHA 2B9FA 2OJIA 2X0GA 2BAJA 3EIDA 4LYNA 4NT4A 3FHIA 1GZOA 3GU7A 3C51A 2BRGA 4ACGA 5IA0A 4ITHA 2J90A 4FUXA 4UWYA 3D7ZA 3EYHA 2XEZA 3K3IA 3FI2A 4TYHB 4XV2A 1WVYA 3GXLA 3NUNA 4CQGA 2V7OA 4FNYA 3KXZA 3HECA 4WKQA 4CLIA 2WTVA 3FMMA 4AACA 4D58A 5HG7A 5HO7A 1LP4A 2XF0A 3QBNA 2C6TA 3DAJA 4JAIA 4YTIA 2B9IA 3G15A 3HL7A 2QOLA 4YZMA 2Z7QA 3NMUF 4WUNA 1GJOA 3KULA 3KMUA 3WF9A 4GVJA 3GC9A 4X3JA 3GI3A 4F7NA 5IDPA 1KE5A 3E63A 3FAAA 4BDHA 4CNHA 2J0MB 3D14A 4ZP5A 4MNEA 3C4WA 3AC3A 3FQHA 3CTJA 2R5TA 3HRFA 2XIKA 3EQIA 4ANMA 3CEKA 2PE0A 2XP2A 3KF4A 1GY3A 4O0UA 5AP0A 4GU6A 4BCKA 2CKQA 5IQHA 2IZSA 2IW9A 3AD5A 5EK7A 1U46A 5LOHA 3PWYA 3CBLA 3TTJA 3MVJA 4I4EA 3UMWA 4EL9A 4CSVA 2QLUA 3OW4A 3QQLA 5E8YA 4EZ3A 2R3FA 4HCVA 4YO6A 5CZHA 3P08A 2RSVA 3LCSA 1V1KA 4RA5A 1YI6A 2A27A 2OGVA 2QOKA 4O0RA 4WD5A 4AOIA 4F64A 5IH4A 2IZRA 4ZTLA 5K0XA 4FSNA 4GT5A 5FTQA 4FNXA 4E1ZA 5HLPA 3D7TB 4HGEA 5KBQA 3EQGA 4GMYA 4QMPA 3DTCA 4DCAA 3QQFA 5HKMA 3SXRA 2J7TA 3E88A 3T3VA 1JPAA 5HIDA 1U59A 3Q60A 3POZA 5E8ZA 2I7QA 5GJGA 2X8DA 2QCSA 5J8IA 3UC4A 1OVEA 2VV9A 5KMKA 2WTCA 4FKVA 4DFBA 3ZZEA 3T9TA 4QP4A 5AUVA 2QC6A 3BEAA 4L3JA 4X2GA 3LCTA 3DOGA 3U6IA 3MA6A 3ZM9A 4G6OA 2RIOA 4FV9A 5M09A 5KE0A 3Q2JA 2J4ZA 2ITZA 2OJJA 5AUTA 2OIDA 3DZQA 4ALWA 5J5SA 2YJSA 4O21A 5F95A 2R0UA 4BTFA 2VWVA 3NWWA 4EBVA 5IEVA 4QP6A 4L43A 1S9JA 3EQHA 3VUGA 2FYSA 5CALA 1UNGA 4I94A 5CY3A 4KIOA 4U97A 3D4QA 1W7HA 2WMWA 3WZDA 3E3BX 2JDVA 4HPTE 3QTUA 3FJQE 3PY1A 4A7CA 4DCEA 4ZSEA 3KVWA 2HIWA 3VS3A 4ASDA 3ZO4A 4O0YA 4USEA 4BIDA 2WD1A 5GZ8A 4OTFA 2R3GA 3KMMA 4BIEA 2B4SB 4P2KA 3QQHA 5IH5A 4I0RA 3U6HA 4BDBA 4BFMA 4YJSA 4JBQA 3VVHA 2Z60A 2R3KA 1A48A 2PVFA 4EOPA 3TUBA 5H9BA 4WRGA 4IMYA 4NM5A 4RFMA 4RJ3A 2WHBA 5IMXA 2UZEA 3P0MA 2NRUA 4I23A 5AX3A 4W9XA 3UOHA 3QTXA 2P4IA 1YI4A 3ZFXA 4FX3A 1XBCA 4O6EA 4A9YA 2C6OA 5BVEA 4AZTA 4JDKA 4CFFA 3P5KA 5LMKC 4D9UA 3HDNA 1OI9A 3MI9A 1MRUA 2PMNX 4GT4A 4IB3A 3VBQA 4A4OA 4BRXA 3OW3A 3ZSIA 4I1ZA 2HOGA 4KSQA 4EBWA 3C1XA 4WBBB 4S34A 3PRFA 4M15A 3PJ2A 4XNEA 3IECA 4BHNA 1FQ1B 2ZM1A 2VTSA 4DGLC 4WOVA 4R1YA 2NP8A 4K2RA 3GC7A 5A54A 2XH5A 2BRHA 4MWIA 2YN8A 5EYKA 1L3RE 2UW6A 4IQ6A 4CTBA 2GFSA 3DXNA 1ND4A 5IQEA 5CT0A 3BCEA 2X1NA 2VWZA 2WMXA 5TF9A 3G6HA 3WZEA 4DH8A 1OL6A 3KVXA 4HYSA 3UDBA 1BL6A 3CTQA 3MVMA 3RHKA 3MDYA 3UVRA 2QVSE 3LXKA 4J53A 3CD8A 4FGBA 3BLRA 1PY5A 1V0PA 1OPLA 1EH4A 2C5OA 2HYYA 4J8MA 4RC4A 4TNBA 3QAME 2ITQA 5CT7A 3UG1A 4FL1A 3RINA 3S3IA 1ERKA 3NIZA 3ODYX 4UXQA 2CGXA 3M42A 4EK4A 4IAZA 2C69A 3RAIA 4ACHA 2C6LA 5H2UA 3MWUA 4KIPA 3AC1A 5CF6A 4TWNA 4C37A 5LMAA 5AA8A 5CF4A 4EKKA 3U8WA 5L6PA 4E4XA 5CAPA 4YSMA 3LFDA 1YXTA 2WXVA 1XH7A 4RJ8A 2ZM3A 2X7FA 3NX8A 3OP5A 2A1AB 2Q0NA 4C62A 2C5VA 4E6AA 3KXHA 4CFUA 1G8AA 3UIUA 2GMXA 2OIQA 2BPMA 2X4ZA 5DN3A 3ATTA 4I5MA 4JS8A 2ZDTA 5D9HA 1J7UA 4WNKA 3ZOSA 2BVAA 3O23A 3QUDA 4KKHA 4CD0A 4MXYA 3G33A 2UVZA 2X4FA 2YDKA 3MW1A 3ZSGA 2RGPA 3TM0A 4H3PA 3OWKA 4OW8A 3O50A 1JAMA 4IJPA 3W1FA 4YJRA 1JVPP 3PG3A 5AFVA 4S2ZA 4DEIA 5J9ZA 3BLQA 4JT3A 2NNWB 3SGCA 3K3JA 4RVTA 4BIBA 3A2CA 5I9YA 4QT1A 4W8DA 4Y5QA 4UZHA 4GYIA 3KB7A 3VO3A 4XCUA 2UZVA 1CSNA 3LCOA 4RVLA 4HNFA 4J96A 4X2JA 5DNRA 4C38A 3RZBA 2VU3A 3UO5A 4I6HA 4YHJA 3FMHA 3NPCA 4MF1A 3Q4CA 2G2HA 3E3PA 1ZWSA 3R63A 4AN3A 3R73A 2VWUA 3B8RA 4BCMA 1T45A 3ZUUA 5HI2A 3JVRA 4JDJA 4QQCA 5E9EA 1J3HA 1DM2A 2GQGA 3GC8A 4PQNA 3NW5A 4BVUA 3EQBA 3FKOA 4D9TA 2F49A 2PVHA 2QO2A 3NUYA 3BV2A 2PUNA 3LMHA 5AIRA 3PPJA 5LVLA 1TKIA 1X8BA 4YNOA 5GIPE 1IA8A 4F1OA 3FLZA 2V62A 3B2WA 4IW0A 5ETCA 1STCE 4IWDA 4DEHA 1NT2A 2BZJA 4C02A 1H28A 3DTWA 2GHLA 3PA5A 4FG9A 3DK3A 1WZYA 2VTLA 3QTSA 3AQVA 4GS6A 3FI4A 3QKKA 4MD8E 4M13A 2YDIA 4EOIA 2Y4IC 1U5RA 5BNJA 2C6KA 3ZC6A 2R3NA 5BUIA 4DAWA 5KMMA 3P79A 5ANDA 1P4FA 4BI1A 4D4VA 4MHAA 2CKPA 3G0FA 4BCIA 3D7TA 2G9XA 3C9WA 4JVGA 4Y85A 3VS0A 3ZBFA 4O7LA 3TV4A 1JKKA 4CMTA 5A6NA 1SYKA 3DKFA 3O17A 3PRIA 2ETMA 2OH0E 5E8VA 2X2LA 2VX1A 4FTTA 3OG7A 2H96A 1JKSA 2W0JA 3C13A 4GFOA 4KAOA 5D10A 2YA9A 4B8MA 5ETIA 2V55A 3OTUA 3RP9A 1I09A 3KY2A 4D55A 3R7OA 3C0GA 2UZLA 3R1YA 2AYPA 5TT7A 5FDPA 4RX7A 3WF6A 4H1JA 3VWAA 4YURA 3LW0A 1NA7A 4PDPA 4XLVA 2XB7A 3RJCA 5DOSA 4F65A 3OY1A 2IVUA 5HE3A 4FF8A 5DLSA 1WMKA 1XH4A 1F5QA 2PVYA 1TVOA 3HP2A 3HRBA 5F4NA 3SD0A 1VJYA 2I0EA 1IRKA 3EL8A 3KREA 4AZSA 4YJNA 4BL1A 3OVVA 2RG5A 1M17A 4N4SA 1XO2B 1YWVA 2OSCA 1REJA 3H0ZA 3MFTA 4FOBA 3SAYA 3N9XA 2PHKA 3OOGA 5FP6A 4WSYA 4RPVA 2DS1A 3KC3A 2P2IA 3FDNA 2HY0A 3OEZA 3DBEA 3M2WA 4QYEA 4JR7A 3TKIA 1PXLA 1MUOA 3HMIA 1XHAA 5FM3A 4D2TA 4PY1A 5F20A 3MJ1A 5EDPA 5BMSA 2V7AA 4H36A 3AGLA 2IJMA 5J9YA 3MH2A 1ZLTA 5EOBA 4C8BA 4FIFA 4PMPA 3CS9A 4JX3A 4CZUA 5FUTA 3ALNA 4EOKA 1JSVA 1OGUA 2R3PA 3GVUA 2VO7A 5AP6A 5TKDA 3KEXA 3Q53A 2P3GX 4U42A 2UW0A 4J97A 2X2MA 2ZV2A 3FXXA 5LARA 4E6CA 4CGAA 4QYYA 5K0KA 1TQPA 4YPSA 3Q96A 3QZHA 3V6SA 3G6GA 4IXPA 4MCVA 1VYZA 4F7SA 4EH8A 4D2SA 4AE6A 3IONA 4LGGA 2UW5A 3UVQA 2BFYA 5BVDA 2Z7SA 3HMMA 4GK2A 4IB5A 5EW3A 3F3VA 4TYJA 5CX9A 1PHKA 4RLKA 3TG1A 5IISA 3HUCA 4FKIA 5IA2A 1B39A 4C0TA 3V5LA 3KRLA 5FBNC 3HA8A 3MJ2A 3L9NA 1JNKA 1OIYA 2OZAB 4IAYA 4PX6A 5FXQA 3QALE 4XG2A 1ATPE 3JY9A 4O7SA 3LM5A 2ZDUA 4R3CA 2WMAA 3FZ1A 3AT2A 5E90A 4IC7A 4ENXA 5KMJA 2OU7A 2CCIA 2YERA 3AOXA 3HAVA 4HYIA 3LM0A 3QCSA 3AD6A 4D0XA 1OKYA 4USDA 5HBEA 1XH8A 4B7TA 3EN9A 4ASEA 3RZFA 2UZOA 3P78A 5HCXA 4FT5A 5CLPA 2ONLC 4NK9A 2YLFA 4I92A 4FKUA 4FZ6A 4O22A 3PZHA 5HCZA 4D28A 5CASA 4EHZA 2FSTX 3FC1X 3OHTA 2XIXA 1YDRE 3P7CA 5D41A 4B8LA 4BTKA 3KRRA 5FTGA 4AZEA 2ZV7A 5LCKA 4FSUA 4XH6A 3COHA 1W8CA 3HEGA 3QKMA 4FSMA 4U9AA 5I3OA 1V0BA 3DU8A 4F9WA 4W4XA 5I9UA 4LGHA 1IG1A 4TW9A 5EM5A 3CQUA 3DNEA 3LFCA 2ZV9A 4CKJA 2X8EA 2YACA 5GHVA 4ORKA 4FYOA 4FKGA 4G5PA 3WF8A 5HORA 4BWXA 3OXTA 2XKFA 4FKLA 3VJOA 3L9LA 4GYGA 2FSOX 5FRIA 5HNGA 1ZOGA 4O83A 3R2BA 1O9UA 2FVDA 4AFJA 2F2UA 4WRSA 1OECA 4R7HA 1J91A 4KUJA 4EK6A 5A3XA 2XKCA 3R9RA 5EQEA 4DH7A 4RLLA 2W17A 3FV8A 3FE3A 5JKGA 5J9LA 3KRWA 3E87A 4K33A 2Y6MA 3HUBA 5HO6A 3VUKA 3EWHA 4EHEA 5L8KA 3LMGA 4YJUA 2VTJA 4UN0C 2WFYA 4H05A 2HWPA 5DR6A 2EVAA 3TZMA 5A4LA 3FPMA 4QD6A 4MQ2A 5K9IA 4D1SA 3KRXA 2PE1A 4QQ5A 5EM6A 4AXAA 3A99A 4YBJA 2P55A 4YGAA 3F3ZA 4E93A 4EZ5A 4O7ZA 2GU8A 2ZV8A 3QQJA 2E9UA 5L6WL 2BTSA 3UVPA 1NVSA 3EFKA 1KSWA 4EOJA 3BGZA 1W0XC 1REKA 3OWPA 5CU6A 4C35A 5CAQA 1Q8WA 4QQTA 3MB6A 4QMQA 5TO8A 3ZZWA 5C8NA 5AR2A 3ORNA 3JR1A 3MPMA 2YWPA 2UW8A 4TXCA 1YWNA 1TQMA 4ARKA 1IAJA 3BE2A 2EB3A 5CNOA 3TKHA 3H4JA 2X6EA 3W32A 4FTCA 4FK3A 4TTHB 1OUKA 3ZBXA 4HVDA 3KXXA 3WZUA 5IQAA 4BY9E 3RPRA 5AAGA 3GOPA 4FTIA 4P5QA 2ZYBA 2JFMA 3P1AA 5EKOA 4EH2A 5I5ZA 2CDZA 2GDOA 2C6DA 4CT2A 1FOTA 2B55A 1WVWA 2Y4IB 3DDPA 4QRCA 5J87A 4ZTMA 4MNEB 5EDRA 4DC2A 4ZZOA 4LOPA 3PWDA 4Z9LA 3GQLA 3H3CA 3EFLA 4ZK5A 4JG7A 3I0QA 4F99A 1ZY4A 4U79A 1WBOA 1PKGA 1H07A 3ZDIA 2VTAA 3QTQA 5E8UA 5AM6A 5IUIA 2E2BA 4R3PA 5M55A 4EH7A 3PZEA 4FL3A 4FT3A 4CV8A 4DGNA 2XRWA 3QKLA 5BVNA 3CJGA 3IGGA 3VS1A 3FI8A 3S95A 1MQ4A 4MAOA 4YSJA 1H00A 2FUMA 5JQ8A 3PSBA 3DPKA 3A62A 4NTSA 4XUFA 4F0FA 1WAKA 3I79A 1I44A 4XX9A 2E9PA 4PNIA 2Y7JA 4AN2A 2R3MA 4MYGA 2JEDA 4BZDA 4O82A 4K77A 2C30A 3H10A 3FL5A 4QMYA 3WE4A 1YWRA 4ZEGA 3VUDA 2VO3A 2VWWA 1SM2A 1JSUA 3BHTA 5H3QA 5L3AA 3RM7A 2YM4A 2AC3A 3GP0A 2XEYA 2UZDA 4CRSA 5CNNA 5JGAA 2I6LA 2XA4A 4WA9A 2JKQA 4GK4A 3BHYA 4CKIA 3KCKA 5A4QA 4PPAA 4QTBA 3UIXA 5AV1A 3LZBA 3FWQA 2QLQA 4J8NA 4RQKA 3CE3A 3BGQA 4C3FA 4AU8A 1PXPA 4NM7A 1V0OA 3KU2A 2XBJA 2F2CB 4FC0A 3ZFMA 3OXIA 3SXSA 2WPAA 3S2PA 3TN8A 2EXCX 3O8PA 1H1WA 3D5UA 3QD2B 5CZIA 4ZZMA 2GCDA 4FSRA 2O8YA 4CFWA 3BWJA 4MXZA 4UWCA 4Y8DA 4AW0A 4LGDA 2GS2A 4YTFA 4XG4A 2YM5A 3SQQA 4FA2A 4IFCA 1PMNA 5LMKA 5D7AA 3CP9A 5HX6A 2OFVA 2B52A 3ORXA 4GG7A 4M8TA 4APPA 2XK4A 4EOMA 4E20A 3I0OA 4HCTA 5CENA 2QI8A 5T68A 3JY0A 3K54A 4IM2A 4Q9SA 3MGYA 1IA9A 3FLQA 4FV3A 3MSSA 4BKYA 4I0SA 3BQRA 3F6XA 3R7GA 5L8JA 2A0CX 3OTVA 3CSVA 3AT4A 2C68A 4WT6A 4EQMA 5I0BA 2UUEA 2W7XA 4M0ZA 2VZ6A 3OT3A 2IG7A 3V6RA 1Y6BA 2QO9A 1E9HA 2FO0A 3RCDA 4JX7A 4Y5HA 3N51A 3COMA 2PVNA 1JKTA 2BAKA 3Q2MA 3ZRLA 1FVTA 3AGMA 3VIDA 2WNTA 4IAIA 3UJGA 3F5XA 4ANLA 3D5WA 2XKDA 2C6EA 4A06A 4AW2A 3L8SA 4HYHA 2X6DA 4EK8A 3W16A 3QX4A 3DBFA 3U9NA 4ZLZA 3UO6A 3D9VA 2BKKA 4F9YA 3NW7A 3DNDA 1YW2A 3F82A 5AUUA 5EW9A 4BTMA 4M84A 3QRKA 2PVJA 4DG0E 2WQOA 4IX6A 4PDSA 2ITYA 2J50A 1OZ1A 3ERKA 5DGZA 5HTIA 1K9AA 1M2QA 3HV6A 4Y72A 4JQ8A 4X3FB 5I4NA 2ITNA 3VBTA 4FV2A 4DGGA 1ZXEA 1FGIA 3I81A 3BV3A 3QWJA 1P14A 2J0LA 1YXUA 1B38A 5L8LA 4LRKA 4BDEA 4G9RA 5EYCA 3FMEA 3OUNB 5CF8A 3NVKI 2WMSA 3OZ6A 3QFVA 4KA3A 2BHHA 4YLJA 5HE0A 4CMUA 4Z55A 1YOMA 5H8BA 1O6YA 3UOJA 3RK5A 1IEPA 4RZWA 1KE8A 3FYKX 4YC3A 2UVXA 3SHEA 5LQFA 3HV7A 5AV4A 4R7BA 1H08A 3KXNA 3UTOA 1OL5A 4AGCA 4DFZE 4OT6A 4F1TA 2O63A 4JIKA 4K18A 4AE9A 4H1MA 4IHPA 3LVPA 3GNIB 3VUIA 4EQUA 5HTBA 4OTQA 4OTRA 1Z57A 5EI2A 3ZO3A 3HKOA 4G3EA 3F5GA 3PE2A 3UPZA 4CZYB 3EN4A 4NIFA 4WNMA 4E5AX 2OXXA 4JXFA 3QTWA 3SXFA 2XZSA 2PZYA 3OCSA 4E26A 4G5JA 4F70A 5A4CA 4J95A 2JKOA 4L3LA 4LV8A 2YFXA 4EH4A 5KMIA 2WAJA 4KD1A 4U41A 4L00A 3GEQA 2J9MA 4RZVA 4F9CA 4JR3A 4D4SA 3FXZA 3V5JA 5CEIA 2G15A 4KBKA 3UPXA 4CMOA 4J71A 1Q41A 5F94A 5EKNA 1H27A 3REPA 4O27B 3GOKA 3A7GA 4BDFA 4K11A 4YHTA 5DT3A 4XG7A 4JL9A 3OUKA 3PVGA 3LCKA 2I1MA 2XS0A 3GBZA 2Y8OA 4IWQA 3VULA 5I9ZA 3N4VA 1ZZLA 5I3RA 2X39A 4ACCA 3QUPA 2RFEA 5DA3A 5KHWA 3BGPA 3GCVA 3P86A 4EYMA 1WCCA 3DGKA 4QMXA 4FV4A 3RGFA 4EOLA 4KRCA 2VTNA 4TWOA 4WG4A 3RWPA 4NYEA 4RGJA 5AUWA 5CF5A 5C01A 4O0VA 4C4HA 4G3CA 1YHSA 3QRUA 1CKIA 1RDQE 3OCTA 4FR4A 4ZSGA 3C4ZA 4FTKA 4NH1A 3BYSA 3V5TA 2C3LA 3FC2A 3GCUA 3NNWA 1Q3DA 3WIKA 3D0EA 3CC6A 4IVDA 2ACXA 2Z7RA 4L3PA 1M7NA 4D4RA 3CGFA 3RVGA 1CKJA 2HENA 3WBLA 5DFPA 3ORKA 2VTMA 2DUVA 3RNYA 4C2WA 3R83A 5J95A 3QLFA 5HU3A 4O0TA 3OS3A 3DT1A 2EB2A 3M1SA 1HCKA 2IW6A 3NSZA 2VUWA 2YEXA 4E8AA 2HZNA 2R3JA 3NUPA 4NFMA 2BDWA 4LQMA 3VRYA 4F9BA 1O6KA 1UNHA 3R8LA 3AC5A 3HV4A 3U4UA 1QPCA 4IH8A 4D2WA 3SW4A 4EWHA 3VW6A 1UNLA 1SVGA 3MS9A 5IPJA 5M57A 3TCPA 3GENA 3F3WA 4MQ1A 4TYEA 2OO8X 2PE2A 3GFEA 4IVBA 1OIUA 3BEGA 4IWPA 4KABA 3V8TA 2PMLX 3NNUA 1GNGA 4IAAA 4FVRA 4TN6A 2WZJA 2VO0A 3F3UA 1MQBA 5CEKA 3AD4A 5IDNA 3SLSA 1UKHA 4JBVA 3EL7A 3UC3A 4Q5EA 1H1SA 3Q5ZA 3PUPA 4XYFA 1NY3A 2IO6A 1A9UA 4EH5A 5FXRA 5BQ0A 3IW8A 4J98A 4RVMA 5T3QA 2ERZE 3PIXA 3PJ8A 4FI1A 4K9YA 3TZ7A 1W98A 4O0XA 3VUHA 4JBPA 1BKXA 4DGMA 4FT0A 1CKPA 4BCOA 1UU9A 5IA5A 3GCPA 3BQCA 3NEWA 4PMMA 3EN5A 4Z7HA 4AZVA 4QMOA 4MXAA 4L7SA 4XP0A 1PRYA 1F3MC 2B9HA 3CPCA 2IVVA 2W96B 3ORMA 4D0WA 2E9NA 2UZUE 3NYNA 4QTAA 4BDKA 4Q9ZA 2WTKB 1J1BA 3EZVA 3FI3A 4S30A 4CFXA 4MF0A 2C6MA 3QCQA 5DE2A 4P90A 2O3PA 4XV3A 2XK6A 4GKIA 1PMUA 4IM0A 4HZSA 4MWHA 4NW5A 4ACDA 4X2NA 4O1PA 1S9IA 2GS7A 3FY0A 5M4CA 1QPEA 2BZKB 3CKWA 3NAYA 2HZ4A 3UP2A 5A14A 5GIOE 5LVPA 2RFSA 4O2PA 4HVHA 4QYHA 1W84A 4ZMEA 4IVCA 4XJ0A 1Q8ZA 2YIYA 3OXZA 4Z7GA 2JIUA 3EZRA 3W2CA 4PP7A 5BVWA 5EHYA 3TACA 5D7VA 1MRYA 3A7JA 3DCVA 4QP3A 1FBNA 2JDSA 5CVFA 5AUZA 5E4HA 3MY0A 4M12A 4NW6A 5ETAA 1Q3WA 3ATSA 3EB0A 4W4VA 2GNGA 1PMEA 5HEZA 4IZ5A 4W4WA 4YUQA 2LAVA 5A6OA 4L6QA 4ANOA 4X7QA 5BVOA 4YJVA 2JC6A 3HNGA 4F7LA 4X3FA 2PTKA 4IDTA 3WARA 2J51A 1ZMWA 4BCPA 4EUUA 3H9RA 3ID6C 3F9NA 3KGAA 4K6ZA 1QCFA 3BHUA 2A19B 3R8VA 4ALUA 3RWQA 1XKKA 4ZTRA 2GQRA 1Q8UA 4O84A 4V05A 1ZMVA 5KX8A 2JBOA 4ZJVA 4WNOA 4GCJA 4ID7A 3OF0A 1LPUA 3MYGA 4DEGA 4MTAA 2OWBA 5M56A 3P4KA 3R8ZA 3KA0A 1SNXA 2R3IA 2EU9A 5KHXA 1PXIA 1URCA 3PJCA 4CVAA 4FEUA 4G1WA 3OWLA 3LFQA 3RALA 5HIEA 1YOLA 2GQSA 3R01A 3IPHA 1FVVA 4ZY6A 2DQ7X 3EQPA 4RX8A 4DEEA 5EQPA 2PPQA 4QP7A 5BYZA 3ZSHA 2QOCA 3RNIA 3TZ9A 3PLAE 3Q9ZA 2HXQA 3E7OA 3HX4A 4QMZA 2VWIA 2XK7A 4U3ZA 5DEYA 5L2WA 4OTDA 4R5SA 4ZZNA 3LHJA 4RC3A 3PPKA 4EJ7A 4P5ZA 5CAUA 3JS2A 5JGBA 3AG9A 3OCGA
chains in the Genus database with same CATH superfamily
3WE8A 4BCNA 4UALA 4BF2A 5FLFA 4FZAB 3FY2A 5M4IA 3FZRA 3QC9A 4AQCA 3C5UA 5IUGA 2E9VA 4FKTA 4I5HA 1XBBA 3S0OA 2XJ0A 3EFJA 3NR9A 3FSFA 4HW7A 2IPXA 3PYYA 5EOLA 1J7IA 1H8FA 2IZTA 3BRBA 4I22A 5HOAA 1ZOHA 5D12A 2XJ2A 5ANKA 4JBOA 2J5EA 2QU6A 1KOAA 3U55A 3BYVA 3K5UA 5EFQA 1W82A 3ANRA 5AJQA 4DFYA 3R04A 4WG3A 2WTIA 2W1DA 4IWOA 1QL6A 5K4IA 2NO3A 3NDMA 2CSNA 3P9JA 3CY2A 4UBAA 5BVKA 4AXFA 4OUCA 1Z5MA 4L46A 2YCFA 4FSWA 1FMKA 5B0XA 2RL5A 5ANOA 5JFWA 4E3CA 4FE2A 3BIZA 3PDTA 3E8NA 5AAEA 2WQMA 2JIVA 5AP3A 2Z02A 4A9SA 3UG1A 4CYIA 3I6WA 2VO6A 4OTIA 2W5BA 3IG7A 3ZFYA 2GSFA 5AADA 4L68A 3QA8A 2REIA 4AGDA 3BBTB 5AAFA 2W1ZA 4K8AA 1SNUA 2CGWA 3AC8A 5CSVA 4YNEA 1YXXA 2JITA 3FQEA 3IW5A 4O0WA 2W9FB 3D2IA 4FTNA 3RPVA 2H9VA 2AUHA 4AFEA 4J7BA 4ITJA 2Z7LA 3O71A 2EWAA 4NTTA 3HV3A 4O6LA 3ORPA 4CRLA 4MKCA 2ZMDA 2DYLA 3LJ0A 3TIYA 2HZIA 1QMZA 1XR1A 1LR4A 2OK1A 4FKOA 4M67A 5G6VA 4B99A 4C57A 3BLHA 4YJQA 1OMWA 3IGOA 2O65A 2PUUA 3UYTA 3ZONA 4GL9A 4DT8A 5ANEA 1PXOA 5KKRC 3DQWA 3R2YA 5HG9A 2F7XE 2UV2A 2CLXA 3AXWA 3R02A 2Y4PA 2PY3A 2YZAA 4XRLA 5CEQA 4AN9A 4FKSA 4DINA 4MBJA 5AV2A 4WNPA 4EEVA 5GZAA 5JK3A 5KO1A 4O81A 5FXSA 5M07A 2C3KA 5A9UA 5FM2A 4DITA 4I41A 3N4UA 3MIYA 1Y8YA 4ZSAA 4RIXB 4DGOA 3P7BA 3W0NA 3OROA 4FTJA 3LAUA 2GFCA 2LGCA 2CKOA 4N6ZA 3KXGA 3VS5A 4BCFA 2EUFB 4D2RA 3UOKA 5LCJA 2CCHA 2XK9A 3TTIA 2W1FA 2R9SA 4E5BA 4DT9A 4U0IA 5EHLA 3ZRMA 4OTHA 4J52A 4I4FA 3FQSA 3TT0A 4BJJA 3A4PA 3DA6A 1E1VA 1UU7A 3C4FA 3QHRA 4HOKA 4IEBA 1H0WA 1ZYCA 2CN8A 3CIKA 3TNPC 5KMLA 3W2SA 4E4LA 3WOWA 5DYJA 3VBXA 4K1BA 3MH3A 4WIHA 1OPKA 1G8KA 1R3CA 3A8XA 5DRBA 1T46A 4X2KA 3I60A 5GJFA 4DH1A 2F7ZE 4AT5A 1M52A 2WIHA 3FPQA 5D1JA 1OBDA 2XARA 3JXWA 4FTQA 2YM6A 2FSMX 3I7BA 4QMUA 4DFXE 3NVMB 3VW8A 3S00A 4FVQA 4PL5A 3GCSA 4YC8A 4E4NA 4TKSA 5L2TA 2W1CA 3IW7A 4RWLA 4B0GA 4G16A 4C59A 2XNEA 3CJFA 4W9WA 1ZY5A 2R0IA 4LMNA 4LUDA 1H0VA 4A9TA 2W1GA 5IQDA 2QD9A 2I0VA 3ORTA 1H24A 4QP9A 4RT7A 5AP4A 4F9AA 4I5PA 3TL8A 3QQGA 4FSZA 4FUYA 4V0GA 3PVUA 4FV1A 4FODA 4DFNA 4EJNA 3LXLA 4O38A 3A60A 4CTCA 3ZYAA 5FWKK 4FTAA 3DZOA 4E6DA 2YWVA 2R4BA 2VNYA 5HG5A 4PTEA 4FZFB 4M14A 3FEGA 4GFGA 1G5SA 1Q62A 5AV3A 2VTHA 4FTRA 4D2PA 4BI2A 3PA3A 4L8MA 4FVPA 2ITVA 3ANQA 3D5XA 4ANQA 5AR7A 1YDTE 2YM7A 5I9XA 4PRJA 3OBGA 4U6RA 3COKA 2XK3A 5AUYA 1MRVA 5EYMA 4FJVA 1A06A 4G34A 2UZNA 5CU0A 1XJDA 2OFUA 2RG6A 4AT4A 4I6BA 4FBXA 5GZ9A 3QZGA 4YHFA 3TNHA 3NFGB 2UZWE 5CSXA 4EK5A 1FGKA 4U45A 3VQHA 1ZYSA 4QTCA 3RPSA 4CFVA 4DH5A 2XKEA 4ZLOA 4I6QA 4NSTA 4BTJA 2UZBA 2EXEA 3HZTA 4O2ZA 5FD2A 3K5VA 2OJGA 1OL2A 1KOBA 2WB8A 3PY3A 5H8EA 5ANGA 2VGPA 3PA4A 4CLJA 4DTBA 2JAVA 5HO8A 3DBCA 1BI7A 5IEXA 2QODA 2OF4A 3KCFA 3PPZA 5AP1A 4OTWA 3OY3A 4LG4A 3A7HA 3V51A 2CJMA 4PP9A 2I0YA 3ZEWA 5EG3A 5HCYA 4ZSLA 3LQ5A 4XG3A 3PE1A 2WMQA 4JJRA 3PTGA 4U7ZA 5CSHA 4FT7A 4F7JA 5EQYA 3VS4A 2CLQA 3BYOA 4LRMA 4ZS0A 5M06A 3ROCA 4EZ7A 3ZXZA 4EWQA 3EQRA 2R3OA 4RWIA 2WQBA 4DEAA 4TZRA 3L9MA 4MXOA 2YITA 1GIHA 3GCQA 1APME 3SKCA 3VUTA 3RK9A 4AP7A 4CFMA 3NCGA 4E6QA 2YM3A 2XUUA 3SRVB 4ANSA 1NVRA 4FSQA 4U5JA 3A7IA 4HJOA 2BZHB 5KZ0A 2CNVA 5HG8A 4QMNA 1XBAA 2XK8A 4OAUC 4FRFA 3PJ1A 4RJ5A 4YU2A 3FLWA 3QC4A 4UXLA 2V22A 5JH6A 1PXNA 1VR2A 1J1CA 2AEGA 4YBKA 5K3YA 3U51A 2XIYA 4GFMA 4L7FA 4UWBA 5BYYA 4FKQA 4FV7A 2BROA 2PZIA 3FMKA 1VYWA 2W06A 4FL2A 2QONA 1RE8A 4YP8A 2PVKA 3IW6A 4PL4A 3MFUA 2WIPA 4FV5A 4C4EA 2Q0BA 4B6LA 1FINA 3I1AA 4NIFB 3PG1A 3R9DA 1WBTA 3O51A 3CXWA 4XS2A 3LFBA 3QUEA 3W2PA 4FNWA 5FBOA 4EHVA 3ZM4A 4MD9E 4UEUA 2OW3A 3TUDA 1U54B 3Q4UA 2WTDA 2IWIA 2IW8A 3ZXTA 4BDAA 4AUAA 2JDTA 4O7YA 4HVIA 1PXKA 1PYEA 1M2PA 4Y95A 5DEWA 5KNJA 4QMTA 4RX9A 4R7IA 2B53A 2I0HA 3G2FA 4NKSA 2YCRA 3AC2A 3RM6A 3GC0A 5LVOA 4RJ7A 4RX5A 4QP1A 5J79A 4N70A 3ZS5A 4FGRA 4RIYB 3E8CA 3PXYA 1E1XA 3DB8A 4GUBA 3VS2A 3DDQA 4HGTA 1KE6A 2PVMA 2GHMA 5EM7A 1F0QA 2C5NA 4O96A 4RJ6A 3JPVA 4CV9A 2VAGA 2O2UA 1KWPA 3Q52A 3QLGA 4I21A 4BYJA 4BDJA 3IS5A 2VD5A 3A61A 3UNJA 2W4JA 1ZYLA 3QD3A 3DKCA 2BDJA 4RIXA 4IACA 2W5AA 4EI4A 3SVVA 2PVRA 3QWKA 4YTCA 3ZO2A 5HVKA 5C27A 5C4KA 4MUQA 2YHVA 1YDSE 4R78A 2R64A 4G3DA 2GNHA 3BYMA 3HA6A 4MEDA 3TV6A 4L9IA 3QTRA 2CGVA 3ZEPA 1PYXA 1BL7A 3QQUA 4GSBA 4ANBA 1AGWA 3DLSA 4G31A 4QPMA 2B54A 3O2MA 4FTLA 4G3FA 5CU2A 4BGGA 3PVWA 2VN9A 3TNIA 5J5TA 3L9PA 3FKNA 4DE4A 2BUJA 3RPOA 1H26A 1YXVA 5HE1A 3NRMA 3ACKA 3BBWA 4KSPA 1ZYDA 3TEIA 4ONAA 3QRTA 5AP2A 4KS7A 4GUEA 1WFCA 4NZWB 3FMNA 3T3UA 5LMBA 5JMSA 4L42A 4CG8A 2JLDA 3NNVA 4NL0A 1IR3A 2RFNA 5EM8A 4BDDA 3PSDA 4I93A 4M0YA 5K5NA 4XV1A 4G6LA 3IK3A 3HMPA 2WMTA 3S4QA 3KFAA 3WZKA 3DXQA 3QX2A 3R1SA 3QYWA 4QNAA 2YCQA 4FTMA 3V04A 5C9CA 4XRJA 2WU6A 3LLTA 2X8IA 3SGCA 3A7FA 1YHWA 3GGFA 4OR5A 5CTPA 3PXQA 3BKBA 2PUIA 4CZTA 4ZJJA 5EYDA 1ZRZA 3A4OX 5M08A 2R3HA 4IZYA 2BFXA 2F4JA 3FHRA 4EOSA 3DFCB 4FEVA 3EN7A 3LE6A 2P33A 2OJFE 2YDJA 4UMTA 4OBQA 1KUTA 1BYGA 3W0PA 3HP5A 2BCJA 3R8MA 1YOJA 3D94A 3R22A 3RAHA 3NS9A 5EW8A 4C4JA 1P4OA 1LUFA 3KN5A 3EHAA 5EDQA 4I6FA 4IDVA 2ESMA 4HPUE 4YR8A 4QTDA 2UZTA 3IDBA 5FDXA 3CQEA 3MH0A 3R7VA 3ZLXA 2WO6A 4BDIA 1UVRA 3PP1A 3OBJA 1PW2A 2VTQA 4U43A 5AR5A 1GIIA 4D4YA 4L67A 4FTOA 4WHZA 3MVHA 3W0MA 1OB3A 2BDFA 2Q83A 3QD0A 4PWNA 2WTJA 3F66A 4YZBA 3V01A 4H39A 1CMKE 5K5XA 3HLLA 3CPBA 3DJ6A 2XANA 3NYXA 4FZ7A 4TYGA 4GG5A 2HWOA 2XNOA 3R0TA 4ZTQA 4KNBA 4ZY4A 3V3VA 4LRJA 2O0UA 5HLNA 2ZB1A 4DEDA 4DFUA 1K2PA 2O5KA 3V5PA 3S1HA 3PIZA 3B8QA 4BCGA 4Y46A 3SV0A 4BKJA 5CU3A 5KUPA 3CY3A 2GTMA 4GJ3A 4APCA 5E91A 4EHGA 3N4TA 3HVCA 4ASXA 4O7NA 3EQCA 1DAYA 5DR9A 4H3BA 4LOQA 5AM7A 1Q8YA 3ZUVA 2BIKB 4YJOA 3FBVA 5HHWA 4JLCA 2YIQA 4A9RA 4DHIB 3FYJX 5AP7A 3MPAA 5EHOA 3DLZA 3PFYA 5CXHA 4DN5A 3RBWA 3QTZA 2E9OA 3L8VA 3G5DA 3VHEA 4BC6A 3F3TA 4YZNA 3MY1A 2J0IA 4KIKB 2WQNA 3ZH8A 4M66A 1UKIA 3U54A 5JRQA 3BYUA 3ENMA 4HZRA 3SRVA 4P7EA 1ZZ2A 3II5A 5BUEA 3SC1A 4HVGA 2WELA 4AAAA 4QMMA 4RQVA 4BBEA 4NFNA 3FLSA 3I5ZA 3ZHPC 4DTKA 3AMBA 4GH2A 1R0PA 2XMYA 3QCYA 3IW4A 1JSTA 4QPAA 3C4CA 4IANA 1R78A 3SOAA 4R6VA 1JWHA 1WBSA 3BU6A 4ZOGA 3H9FA 3BWFA 1GZ8A 2VX3A 2XYNA 2VWXA 3GU4A 4R5YA 3R7YA 4RWKA 3FKLA 4Y83A 1ZMUA 3U4WA 3RCJA 5JT2A 3VJNA 4PNKA 1IAHA 4YC6A 2C3IB 3Q9YA 1BI8A 4XBUA 4UMRA 2IF8A 3E8DA 2YABA 2BRMA 3NIEA 5FGKA 4DLIA 4FNZA 1UU8A 4U81A 1OITA 2YJRA 3VNTA 2WU7A 4C36A 1OL7A 1Y6AA 5B2KA 4CFNA 2OLCA 3R1QA 1Y91A 2OF2A 5CANA 3QA0A 1OKZA 1U54A 3FZTA 3WI6A 5IQFA 3LIJA 2OI4X 3K2LA 3ODZX 4ZJIA 4BB4A 3BI6A 3ULIA 3C4XA 2F7EE 4F6SA 5FQDC 3POOA 3QL8A 4U3YA 3BHHA 2X7OA 2WOTA 4NM0A 5ACBC 5C8KA 1XMMA 3IKAA 5EI8A 4AF3A 5JGDA 2HAKA 1YXSA 4ZAUA 5IUHA 3O7LD 5IA1A 1JQHA 3GU6A 4RIYA 5CEMA 3O8TA 2J0KA 2FA2A 4D5KA 3DAKA 3AMYA 4JRVA 5M53A 3PXRA 5LWNA 3P7AA 2NPQA 4J1RA 3LPBA 3DJ7A 4YMJA 2R3LA 3BX5A 3EH9A 2QKWB 1Q61A 4FIEA 4XP2A 3IO7A 5DBXA 4FEQA 4ERKA 3G51A 4BWKA 2HXLA 2JAMA 2XRUA 3Q4ZA 4PF4A 4ALVA 1OGYA 2VTOA 5FEDA 4J99A 2QOFA 3VONA 3PXKA 4FOCA 2C5YA 4IIRA 4D5HA 2ZJWA 3ELJA 5AR8A 2OICA 5EH0A 3WILA 4ZXTA 4TNDA 3NAXA 3W2OA 1WBNA 3MBLA 3UOLA 1OM1A 3TMOA 2ZMCA 3MFSA 3MV5A 2PYWA 3ZLSA 2VTIA 3LJ1A 4QOXA 3UQFA 1R1WA 2XM8A 4KBAA 2XNMA 1ST0A 4X21A 4B9DA 3U87A 4FKPA 3GT8A 1PXJA 4ACMA 4H3QA 4JQEA 3T8OA 2DWBA 4KINA 1H4LA 1YRPA 4GU9A 2YIXA 3NLBA 5HX8A 2OXYA 2WMBA 3CTHA 3QXPA 5HBJA 3UQGA 5M4FA 2CKEA 3QU0A 2PMOX 4TPTA 2C3JA 4F1MA 5ITAA 4KRDA 2GNFA 2ETRA 4IB1A 5C4LA 4WG5A 4RC2A 5FEQA 4C33A 4ZS4A 1YKRA 2XJ1A 2VTTA 4II5A 5IZFA 4GKHA 1JKLA 2OH4A 4XG8A 5AV0A 3ZC5A 5E92A 2HCKA 5HE2A 4ZY5A 1KV2A 4L53A 2F57A 1OL1A 5IMEA 1AQ1A 2C0OA 2VGOA 4DA5A 3AMAA 4LUEA 4NKAA 4A9UA 2ZAZA 3LOKA 4Z3VA 4JNWA 1ZYJA 2C6IA 3E92A 3KK9A 3MFRA 2RF9A 4KKGA 3BELA 4UV0A 5CS6A 2RFDA 3ORIA 4N6YA 5DWRA 4FG7A 4XG9A 1DAWA 3GQIA 3MVLA 4UY9A 1SZMA 5JZNA 4EH6A 1G8JA 3ZRKA 4TL0A 5JZJA 3FL4A 4I5CA 2QOQA 2QOIA 4FIHA 4FKWA 3WYXA 5HTCA 5LVNA 4BWPA 5LWMA 1WBVA 4MVFA 4GEOA 4DG3E 3TJDA 5GINE 3QTIA 2YM8A 3R7UA 1OBGA 2BMCA 3QYZA 4XEYA 3KL8A 5AIKA 4N0SA 3ROYA 1TFFA 5ANIA 2CN5A 4YPDA 3C4EA 2BIYA 4XV9A 3DQXA 4UX9A 2G2FA 3Q4TA 4FSTA 3G0EA 1WBWA 4OT5A 1GZNA 3E5AA 4RFYA 4OBPA 5C03A 5EI6A 2ZOQA 2W4OA 4LOOA 4AA5A 4HNIA 4HYUA 3TV7A 3RMFA 3ML1A 2CHLA 2UW7A 3UMXA 4BN1A 5HZNA 4JIAA 4U8ZA 2C5XA 4LV5A 3FZSA 2IZUA 2X2KA 5ICPA 4EKLA 3IDCA 1Q5KA 2JDRA 5AUXA 5D11A 3NUUA 3OWJA 4GIHA 4V0GB 4C2VA 5IQBA 2VNWA 3HDMA 3AKKA 3OEFX 1RQQA 5JFXA 3QZFA 3BU5A 4JDIA 4C7TA 3OC1A 1NXKA 5E1EA 4QDEA 4FZDB 2ONLA 3SOCA 2WOUA 3CGOA 3CLYA 3GU5A 4FKRA 4L44A 4NCTC 4BKZA 5CEPA 4KIKA 4QMVA 2PK9A 2XVDA 3QGYA 5HBHA 1JOWB 3TWJA 2IN6A 3TZ8A 5J1WA 1PF8A 2YAKA 4TYIA 3W10A 3C5IA 4JAJA 5IF1A 3COIA 3Q04A 4C4FA 3VS6A 2GS6A 1Q8TA 2WTWA 3UIMA 2I40A 5DI1A 5CAVA 2C47A 3PXFA 4MH7A 1H1RA 4WUAA 4IX5A 5CQUA 4AZWA 1WBPA 3MA3A 4BHZA 1KE9A 4FIGA 4X2FA 4C3RA 4EK3A 5BUJA 5L2IA 3WF5A 3Q9WA 3R6XA 4OGRA 3AKLA 3MESA 5DPVA 5ACKA 3MTLA 4BCJA 5B7VA 5AR3A 5DVRA 2W99B 2WMVA 4O91A 1HOWA 1BMKA 4KKEA 5HNBA 4E4MA 4OAVB 3I6UA 2YZLA 5FEEA 3R9OA 3I4BA 3UNKA 2A4LA 5HQ0A 2G01A 1SVEA 3LCDA 3MTFA 3GFWA 2H6DA 3Q6WA 1UWHA 3ORZA 3O96A 2IVTA 3MPTA 3KXMA 3F2NA 5AP5A 4AG8A 2CNUA 4EH9A 1H1PA 3BZ3A 3NUSA 3L8XA 5ANJA 3V8SA 5KMNA 2B0QA 5E8SA 3D5VA 5DMZA 1W83A 2XCKA 4B4LA 4DDGA 2WMUA 3PXZA 4JMQA 3PIYA 1M7QA 1ST4A 4CEGA 3O5AA 1OKWA 1PXMA 4XBRA 5KCVA 4JRNA 4F6WA 4FTUA 1SVHA 2YIRA 4LMUA 5HGIA 4IADA 1XH9A 2X7GA 3UODA 3KF7A 3O0GA 1Z9XA 4K0YA 4D1XA 4O4BB 2J2IB 1J7LA 5A4EA 4PPBA 3W33A 2QR7A 4FYNA 3CCNA 3FMJA 1GZKA 3VQUA 2WGJA 1KV1A 1YI3A 5C26A 3FXWA 2O64A 5E7RA 3THBA 3ZUTA 4KBCA 4TYHA 4YJPA 3EFWA 5TR6A 3F88A 3R8PA 2FSLX 4AX8A 3NCZA 2QOBA 3PY0A 2WQEA 4EYJA 4ZTNA 1WVXA 2P2HA 5E8XA 2R2PA 3LFFA 4X6RA 2HZ0A 1ZAOA 3OD6X 4QMSA 4GW8A 1PKDA 4F09A 2XM9A 3KK8A 3EQFA 3H0YA 4QMLA 5IQCA 3L8PA 3WF7A 4EOOA 2J0JA 4QNYA 4CCUA 3HMOA 2C0IA 4GK3A 2GNJA 2SRCA 3C50A 4O1OA 4FV6A 5DIAA 5FTOA 5HNIX 4DTAA 2GHGA 4DEBA 3NW6A 2W4KA 4IAKA 2Z2WA 5FG8A 4ANNA 4NM3A 2W9ZB 4U40A 5E8TA 4C4GA 3LQ8A 3RHXA 1OIQA 5I9WA 2XNBA 2GNIA 3EJ1A 3OFMA 3V8WA 3KQ7A 3IOPA 1PMVA 4F08A 4P4CA 2Y0AA 3UE4A 4MXCA 5E1SA 3QHWA 4ITIA 4YO4A 5JN2A 2XNPA 4RJ4A 2ZB0A 3NUXA 2C4GA 4R1VA 4AGUA 4V01A 4IZ7A 4G3GA 4QDVA 2C1BA 4TRLA 3R21A 3TNWA 5CEOA 3GU8A 3EQDA 3LJ2A 3W2RA 3WIGA 3GB2A 4OTPA 3RAWA 4A4XA 2Y9QA 3R00A 4G6NA 4IX4A 2H34A 4NUSA 4IVAA 4FICA 4RSSA 2WKMA 4CKRA 2Z8CA 3VBWA 3DV3A 5BYLA 3ZTXA 4RA4A 4RIWB 4IX3A 3R8UA 5CYIA 2QOHA 3M11A 3G9NA 2B9JA 2WEVA 3R9NA 4LV7A 4XHKB 2J6MA 3DY7A 3LFNA 1BLXA 4FT9A 3H9OA 1OUYA 4DHFA 3W8LA 4L45A 5GNKA 2CGUA 3BPRA 4RG0A 3HAMA 4I6LA 2ITTA 3ZMMA 1SMHA 1W2FA 3SDJA 4C3PA 3HGKA 5A46A 3VF8A 4JOAA 2W05A 3W18A 4Y73A 3FMDA 2KTYA 4XG6A 3G9LX 5IQGA 2ETKA 3AC4A 4FV8A 3LFEA 3TXOA 4TWPA 5L6OA 3LMIA 3UZTA 3E62A 4QTEA 4BDGA 2PZRA 3T9IA 4UYAA 4X6QC 2C0TA 4FIIA 3EYGA 4PTCA 5LVMA 1OKVA 1U4DA 3G90X 5JEBA 1P2AA 3UG2A 2FB8A 4AW5A 2AC5A 1U5QA 2YISA 3LFAA 4JG8A 1OIRA 4EQCA 3GUBA 5CVGA 3ITZA 2BAQA 3DKOA 2JD5A 2BKZA 4EC9A 3LXPA 3KN6A 3F2AA 4I0TA 2PULA 4AXDA 4YLKA 3MY5A 5B2LA 3F69A 4PV0A 3FLYA 4NJDA 2ERKA 2J5FA 3IDPA 4HVSA 4S33A 2JFLA 2HY81 3LQ3A 3UQCA 2XCHA 3OT8A 4DG2E 2PU8A 3D83A 1XH5A 4F0GA 4MK0A 2JKKA 1AD5A 3EKNA 3H30A 4W8EA 1GAGA 1O6LA 2QHMA 2UW4A 4U80A 4USFA 4LL0A 1KE7A 3UDZA 4H58A 3MN3A 2GNLA 5JQ5A 1CDKA 3ALOA 4V04A 2OZOA 5T6KA 3ZU7A 5I9VA 4XP3A 3W0SA 3DFAA 4PMSA 3VHKA 1PJKA 5CI7A 1QPDA 5IEYA 4PL3A 5DRDA 3HV5A 2JDOA 1Q97A 4C58A 4PDYA 5A4TA 3Q5IA 3V5WA 4IZAA 3ZCLA 1P5EA 2RKUA 4OBOA 4S32A 2W1HA 4BZNA 4F6UA 3U6JA 3LKMA 4HGSA 2KULA 4OTGA 1CM8A 2PWLA 3JUHA 3JVSA 4MXXA 1M2RA 3NGAA 4O7TA 4FSYA 5K4JA 3ZLWA 2ITPA 3ULZA 4AQKA 5BVFA 2FH9A 5M4UA 4FKJA 4BBMA 5HLWA 4YJTA 4IJ9A 5M44A 4ZSJA 2NRYA 3NYOA 5CQWA 4GV1A 4NU1A 3V5QA 2UW3A 5AEPA 3TUCA 5AX9A 2PL0A 5IA4A 5E8WA 4R8QA 2ITWA 1NW1A 4AZFA 4O7VA 4X3FC 5KBRA 1BX6A 4L01A 4YTHA 4ENYA 4TY1A 3TDWA 2OBJA 2CPKE 2WMRA 3OCBA 2QNJA 4RWJA 5AWMA 3W8QA 4F0IA 4JQ7A 3RK7A 5DHJA 4O86A 2QKRA 4M7IA 4QYGA 2GPHA 4UYNA 4AW1A 4BGQA 1DI9A 2QG5A 4KIQA 5C1QB 4LI5A 3DBQA 3QF9A 3NNXA 4Q2AA 3ZO1A 2R3RA 2QR8A 3ACJA 4AGWA 5TOZA 4CXAA 2X9FA 5JSMA 4TT7A 2YIWA 4RFZA 2V0DA 3L1SA 3R28A 2VTPA 5AR4A 4QQJA 4M69B 4ZTSA 3RAKA 4BR3A 4A4LA 5HESA 4ERWA 3R9HA 2Y6OA 4RBLA 3SA0A 3DAEA 5HU9A 3TIZA 5H8GA 4G9CA 3Q32A 3RKBA 3E7VA 4AWIA 5JFSA 2PZ5A 3R71A 2QHNA 5DT4A 1H1QA 2ITUA 2JIIA 1HCLA 4AA0A 3TI1A 4NEUA 2P0CA 4MNFA 4JI9A 3BU3A 2H8HA 3B2TA 2BILB 4AOJA 4DFLA 4ZLYA 1LEZA 2JGZA 1Q24A 1Y8GA 1XQZA 3FUPA 3UNZA 4CCBA 5J7BA 2YLEA 4BICA 3FSKA 4GIIA 2QURA 3EN6A 3Q6UA 3QXOA 3W2QA 4C61A 4C34A 2OG8A 2XBAA 4HCUA 3UIBA 4NWMA 5JFVA 5L2QA 3R1NA 4FV0A 5AMNA 4O7WA 5CSWA 5LJJA 1G8SA 1R0EA 2VRXA 4O7RA 1Q4LA 3PP0A 5HD7A 4EH3A 4Z16A 4CYJA 3SX9A 4L52A 5DR2A 4QP2A 2ITXA 3EOCA 3I5NA 3DJ5A 4MBLA 4FIJA 4LFIA 3F5UA 3QD4A 4Q5HA 2V5QA 4PUZA 2PVLA 4EC8A 4F78A 2IEWA 4U44A 5IA3A 5JRSA 3R30A 4EORA 3F7WA 2BHEA 4JG6A 3QCXA 2XNNA 3DS6A 5KKRB 1FMOE 3PLSA 3KULB 4UZDA 1FPUA 3VF9A 4RIWA 1DS5A 4UMPA 4S31A 4E5WA 3NYVA 4RIOA 4AA4A 3UO4A 2CNQA 1XH6A 4G2FA 3PFQA 1K3AA 1RJBA 2XYUA 3TJCA 3ZLYA 4O0SA 4UB7A 3IOKA 3RTPA 3FMLA 4D2VA 4N57A 2PUPA 1ZARA 3OOMA 1MP8A 2HELA 4I20A 4CQEA 3QRJA 3E93A 2BTRA 4LL5A 3VUMA 4E73A 4E7WA 3W55A 4FMQA 4BCHA 4QO9A 3HRCA 1VEBA 3O8UA 2BRBA 2ZM4A 4RVKA 2XIZA 3D2KA 4D1ZA 1UU3A 4DBNA 3DXPA 3F61A 3VAPA 3FZOA 2X81A 5DT0A 3VN9A 4BCQA 3NZ0A 1NVQA 3EMGA 2AQXA 5G1XA 1OPJA 4IFGA 4R3RA 5L4QA 4W4YA 1ZOEA 2HK5A 2OXDA 2JKMA 4TWCA 5F1ZA 4EONA 2BRNA 2W1EA 3PVBA 3LLAA 4R77A 4DF3A 3KMWA 3KRJA 1IASA 3BE9A 4F63A 4C4IA 3WZJA 5BV3A 5CI6A 4EUTA 5CSPA 5J7HA 3EKKA 2VWYA 5ETFA 3U9CA 1UA2A 2PSQA 3P23A 3NUAA 5HVYA 4EOQA 4KWPA 1L8TA 3ZDUA 2R7IA 4BDCA 3OMVA 4MD7E 5AA9A 1R39A 3CQWA 2XIRA 5L2SA 1RW8A 3Q3BA 3DB6A 2GTNA 3VRZA 2ZVAA 4ZIMA 3UGCA 4AOTA 3IQ7A 4IE9A 4PDOA 4BGHA 2A2AA 2OJ9A 5J1VA 4GT3A 2ZFYA 3ET7A 4PPCA 5IH6A 2VTRA 1FVRA 3TNQB 2WTKC 5F9EA 4AS0A 4RRVA 4PTGA 4WBOA 1Q99A 4X0MA 4ZTHA 4XOYA 3C7QA 4NCTA 2UVYA 4FK6A 4BBFA 1YQJA 4CT1A 4IAFA 3E64A 3KKVA 2ITOA 3CKXA 3C0IA 5KZIA 1TQIA 1YHVA 2OZAA 2VWBA