4P5QA

Human epha3 kinase domain in complex with quinoxaline derivatives
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
275
Chain Sequence
VHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 3
total genus 90
structure length 275
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p5qA01
3OCSA 3MY1A 3QTSA 4UV0A 4FUYA 1K9AA 4GJ3A 4RA5A 5E8TA 4FEUA 2B54A 5KMLA 3RPSA 4I41A 3HV6A 5F1ZA 2LAVA 3ZU7A 3FZTA 3GB2A 1TVOA 1WAKA 4EH3A 1OKVA 2IN6A 2IVTA 2BDJA 4KNBA 1Q8ZA 4IQ6A 4RZWA 4IZ5A 4ANMA 4F1MA 4PV0A 5EG3A 4ZSEA 5FP5A 2QLQA 5H8EA 3EMGA 5HZNA 1J7IA 2PZYA 4HCVA 3VUIA 4I23A 3OD6X 1OL2A 1J1BA 4I6HA 3C5UA 1CMKE 2EXCX 2OIDA 2SRCA 4PL4A 4WNKA 5C4KA 2OIBA 2PMIA 3NAYA 1NY3A 3F5GA 3QAME 4QP6A 3ZFMA 4F1TA 2CCIA 4ZY4A 4CEGA 5AM7A 4DCEA 1JLUE 3KVXA 2CGVA 3W18A 3H30A 4XG6A 2PZIA 1T46A 2E9NA 3DT1A 3EN5A 5H9BA 4FICA 4F0IA 3QQFA 5I9XA 2J6MA 4DFYA 3HRCA 5IUHA 4CFMA 4ACCA 3EH9A 2GNHA 1U4DA 3F66A 2XEZA 2YACA 3KFAA 1G8SA 4FIGA 2F2UA 2BZIB 3KK8A 3AD6A 5DN3A 2ZOQA 2X4ZA 4H58A 4FKGA 3F82A 3KY2A 1PMNA 4USEA 4O2PA 4PDOA 4XBRA 5EM7A 2ZM3A 5KE0A 4Z7GA 3QZHA 2IVSA 5DMZA 5HNBA 5JKGA 5DA3A 1PMVA 3W2CA 4F99A 3GC9A 2NNWB 5LVNA 5CYIA 5CT7A 4YNOA 4X2JA 1Q5KA 3ORNA 4BYJA 2XB7A 1GIJA 4FG9A 5HG5A 3SC1A 1XHAA 4FEWA 1IEPA 1WBPA 3LAUA 4FKRA 4X3JA 5H8GA 5DG5A 2BHHA 2GFCA 4M0YA 1YDSE 5AP5A 3THBA 5IQFA 3EN9A 3SG8A 4KIOA 4JLCA 4ZSGA 1HOWA 4TTHB 5I3OA 3SOAA 4MD7E 4U43A 3FMNA 4S30A 2BPMA 3C13A 3RK9A 5CVHA 1Q3DA 5EH0A 5FLFA 3QD2B 2Y4IC 5CSXA 3O8PA 2W4JA 3OS3A 1RE8A 3Q4CA 4IAFA 3DCVA 2C3KA 4QMXA 4EOPA 2VTIA 4TWOA 1GZKA 3DLZA 4QTEA 3COMA 3NYNA 2OXDA 3O23A 1UVRA 1XH6A 3QALE 4LI5A 4DLJA 3RPVA 3LHJA 2OSCA 3TZ9A 2A0CX 1PXJA 5CNNA 4DTKA 3QKMA 5JN2A 3ATSA 2R3KA 4KUJA 5AX9A 1GIIA 4K18A 1H0VA 4C4HA 1FOTA 3C0IA 5EM5A 4NIFA 2G01A 4RJ5A 4EYJA 4W4XA 3HRFA 3VULA 4G31A 2OF2A 2XKCA 3DTWA 4H1MA 3KCFA 2HWPA 5DR2A 4QT1A 1CDKA 3NYOA 2VWYA 3T3UA 4BDKA 3HMPA 1ZOGA 5EDPA 3V04A 4O0SA 4CRSA 3QZIA 4MAOA 1OECA 3PE2A 5GHVA 3UNZA 4IWQA 4QPSA 1XH9A 5F20A 4E5WA 5CAQA 1QMZA 4NL0A 3VUGA 3L9MA 2DQ7X 3BHTA 5IUGA 3VS3A 2BKKA 3C0HA 2HXLA 2XNEA 4ZJJA 3ET7A 2BRHA 5HNGA 3KN5A 3ZBXA 4XOYA 3B2TA 3R9OA 1Y6AA 1H00A 3JXWA 1QPDA 3O71A 2BCJA 4J98A 3L9PA 4TYEA 5E8WA 3VF8A 4DFZE 4O7RA 4C7TA 4YLKA 3DV3A 3DU8A 3HV4A 4RG0A 1Q8YA 3CGFA 1A06A 4Z7HA 2FH9A 3GNIB 3ZYAA 4K1BA 3C7QA 4IX4A 2QLUA 2QO7A 1LR4A 2XIXA 4MKCA 5BVKA 4KB8A 3ORKA 3C50A 4J96A 3A61A 1F5QA 3H9FA 3H4JA 4FUXA 3UJGA 1H26A 2E9VA 3DNEA 3VRZA 1WZYA 4WOVA 1KOAA 3MPTA 3LW0A 4L45A 2UVZA 2ZV2A 3EWHA 1OI9A 2HCKA 1BI7A 5H2UA 4HGTA 4WHZA 2W1GA 4EYMA 4Q9ZA 2EWAA 1VYZA 3CTQA 1R1WA 4KIQA 4F70A 5EI8A 5CAOA 5LVMA 5HVYA 3WZUA 3GU5A 3VBXA 2YIRA 3P9JA 3AC4A 1GJOA 2HELA 2HENA 1VEBA 3K3JA 4XV1A 3U9CA 2HZNA 5D1JA 4HZSA 3MFRA 3MA3A 4UYNA 4UN0C 3DXPA 4I20A 3G90X 3EZRA 5FQDC 4EH9A 5GIOE 3LJ1A 1OVEA 5DT0A 4HCTA 5DR6A 1W98A 4BZDA 3QHRA 5AEPA 4GV1A 4HVIA 5EDRA 1JAMA 3HECA 4JR3A 4Y73A 1OKWA 4DH7A 1H1WA 4TYIA 3TJCA 5CEMA 4GEOA 4MH7A 2UZDA 2UW5A 3QZGA 4IAIA 3DJ5A 2WQMA 5DLSA 2QO2A 4E73A 2YEXA 1PYXA 4O1OA 5CWZA 3RINA 4ACMA 2ZDUA 3F3WA 4YR8A 3S95A 2XZSA 2UV2A 4S32A 3FMDA 3VVHA 3W32A 5I3RA 2F7EE 3GFWA 5EFQA 4M15A 4M68A 4FEXA 2UW0A 5AV2A 4EC8A 3DKFA 1OKYA 2VNWA 5GNKA 3PWDA 1YRPA 3PXRA 1URWA 3SGCA 4UB7A 4R3RA 3BHUA 2VO7A 2HOGA 4UZHA 2OO8X 5HG8A 4EQMA 2VTRA 1F3MC 2JEDA 4I92A 4D0WA 1AQ1A 4ENXA 2WMWA 4FZFB 3ULIA 5EOBA 5AWMA 3O7LB 4MNEA 3PZEA 4EHZA 4BDJA 1G5SA 3FMHA 4M13A 5HHWA 3TZ7A 4GS6A 3KXHA 5FM3A 4IDVA 3QWKA 2XNGA 2IZTA 4DFLA 3CKXA 3VUDA 4HVDA 3TTIA 4O7NA 3LKMA 4RJ7A 4DGGA 3DBQA 5C1QB 1M52A 2JC6A 4EK5A 4XH6A 5EHLA 1S9JA 5AUYA 5CU3A 4DBXA 4QTDA 4TRLA 2VNYA 3W2QA 4BDFA 2PMNX 5J8IA 3G15A 5HO8A 4D0XA 4F6UA 4YLJA 4EI4A 4PPAA 2XKEA 2W0JA 3CQUA 4ZP5A 4I94A 4KWPA 1H27A 3NW5A 2Y8OA 2R7IA 5DFPA 5AR7A 4FIHA 4IACA 4RGJA 4DAWA 1W84A 3HV5A 3RHXA 3NUAA 5M08A 2VWBA 3A8WA 4DT9A 1E9HA 4S2ZA 4RMZA 4QMMA 3FDNA 1ZY5A 3E63A 3C51A 1ZRZA 4FV8A 2J5FA 5E1EA 3POOA 4ZSJA 5JT2A 1U54A 4OGRA 2BMCA 4QTBA 4LYNA 4AW1A 1UWHA 3JY0A 1W8CA 4HGSA 5AA9A 2W1CA 3BV3A 3GQIA 3AXWA 3PSDA 3VUTA 4GCJA 3W1FA 1OMWA 3G9LX 2JAMA 2W06A 4I6FA 2QOHA 3LFFA 2ETKA 3TNIA 4BFMA 4JIAA 3SKCA 4F09A 2R2PA 3K2LA 4AA4A 2OFVA 3OCBA 4O7LA 1WFCA 4YURA 3D5VA 3M1SA 4FT3A 4QP1A 3N4VA 3TDWA 1JSTA 3F7WA 3ZONA 3PY1A 4GMYA 4FNWA 2XCKA 3V8TA 4CYJA 3OWPA 3HAVA 1KV1A 4I24A 3P1AA 4II5A 3P7AA 4RQKA 2RFSA 4PNIA 3UODA 3ZLSA 3PP1A 3R30A 4FTTA 2CNVA 5BVNA 1Z57A 2X8DA 4WRSA 1PJKA 4AAAA 3PLAE 3BU6A 1P2AA 2XK4A 4CNHA 4R78A 3TEIA 3MB7A 4XP3A 3NS9A 3NYXA 4FG7A 2Y4PA 3QCYA 4FKLA 4A9SA 4AQCA 5KO1A 1P14A 3GT8A 2GSFA 2W1FA 3I5NA 4PDPA 3RWPA 3IONA 2E9PA 3P79A 3FC1X 4YJPA 3F3ZA 2DYLA 4BB4A 2J5EA 4GFGA 4DA5A 4GFMA 3GCSA 2I0VA 5E9EA 2HIWA 2R3GA 3SRVB 2YM4A 4FL3A 5D9HA 4BIBA 5BPYA 1OL1A 5DE2A 3P0MA 5M55A 1XR1A 2XEYA 2CPKE 4QPMA 3D0EA 4W8DA 3W10A 4BGQA 3LFSA 4A4OA 4CKRA 2DWBA 2Z7LA 5TR6A 2JD5A 4FKPA 4FTAA 1PY5A 4I22A 4IZ7A 3QTXA 4L53A 1BMKA 4V04A 2YM5A 4WUNA 3I0OA 4ZZMA 4CG8A 3IO7A 4IAAA 3BYOA 2IVVA 5DEYA 3EOCA 3NRMA 1W0XC 4AF3A 4CLJA 4PL3A 3KMMA 4RJ4A 3AMAA 3SG9A 2DUVA 3UP7A 3AGMA 5HQ0A 5CI6A 4FV7A 4F9CA 5ETFA 4YTHA 5JSMA 1WVXA 3MJ2A 4JQ8A 3NMUF 3DFAA 4MXZA 5HIDA 4O82A 2ZM1A 3UMWA 2R3JA 2BTSA 4F9AA 3C0GA 2ITXA 4KS8A 1FQ1B 4NU1A 4F0GA 3E8CA 4FIFA 1OUKA 3A4PA 4FYOA 5IMEA 3I81A 3DAKA 4C8BA 5L6PA 2J0KA 3U51A 3FLZA 1MQ4A 4CSVA 1KOBA 1LP4A 2XIYA 2UZUE 3NEWA 4RVLA 4D58A 2PZ5A 5CY3A 4PDYA 2YM6A 4AOJA 4G5PA 4I5MA 4E5BA 3A62A 4FZ7A 4FKUA 5IA3A 4HYHA 3RPRA 1ZYSA 4J8NA 3TV4A 3F5PA 4EK3A 2QOKA 4DG0E 4E3CA 4IFGA 4WIHA 3V5QA 2Z60A 4FSRA 2W17A 4NT4A 1W82A 4Y72A 4BCQA 1OBDA 4QMZA 1IA9A 2YWPA 4JRVA 5E7RA 3UOJA 2J4ZA 3GCQA 4BI0A 5K4JA 4AGUA 3VUMA 4BVUA 1I44A 4LL0A 5F4NA 3VS5A 1RQQA 5HO6A 5EKNA 4I6QA 4BCFA 2BAJA 3PIYA 4G6NA 4MQ2A 2ESMA 3RK5A 2JDRA 4FNYA 4KBCA 4FBXA 1ZMWA 2R3RA 4MVFA 3WYYA 5HTCA 1R3CA 2YJRA 4FF8A 1KWPA 2OKRA 4HNIA 4HYSA 2ZB1A 2OXYA 3FJQE 3F3UA 1KE8A 3QC4A 5J9LA 5I9UA 5JFWA 2VTOA 4BCKA 2C6IA 3WILA 2CCHA 3HUBA 4BCNA 2GTMA 3R21A 2X7FA 2G9XA 2W9ZB 4GK2A 5BYLA 3MW1A 3ZRLA 4AP7A 4PP9A 3OFMA 2WTKC 2OICA 4JDIA 4AZTA 3C4CA 4F64A 1MRUA 4NZWB 3Q52A 3D2KA 4QPAA 4QMTA 4FT5A 3FMJA 5CQUA 4BWPA 5CXZA 4I0SA 2UW3A 5CS6A 4QRCA 4CTCA 3A7IA 3PA4A 3TDVA 3RMFA 5DT3A 1SVGA 3DAJA 2O2UA 4FSTA 4JX7A 5LMAA 2QODA 4BCMA 4UX9A 3MVLA 4FT0A 5FTOA 2BVAA 1Q41A 5HVJA 4LRKA 4QYFA 3ROYA 3V8WA 4KA3A 3FXXA 3UPXA 2IWIA 2R3FA 1IA8A 2HXQA 3LXNA 4D2VA 4EOQA 2W7XA 3LQ8A 3ORMA 4FK3A 5AR2A 2YABA 1CKPA 1YXXA 4DEBA 5CAPA 2OXXA 2XS0A 1H0WA 4C2WA 2YCSA 4XS2A 4E1ZA 4EH8A 1GIHA 4O7WA 4GL9A 4I5CA 1FMKA 2C3JA 2R3NA 2R3QA 3QX2A 3LJ2A 3LXLA 4OTDA 2BALA 3DQWA 3OOMA 4NCTA 3WF9A 4E4MA 5L2IA 1JSUA 3R7GA 2QCSA 2JGZA 3KB7A 3KCKA 4YPDA 4LOOA 5D10A 4X3FC 4GIIA 4WNOA 5DRDA 4CV8A 2GS7A 2R9SA 3HZTA 5IH4A 4KD1A 2FA2A 4WG5A 4XG7A 2X4FA 3VBQA 3R63A 3LFNA 1Q62A 4A4LA 4U40A 2VTSA 2YZAA 4FTMA 4C59A 4E7WA 5FXRA 3LCOA 3A2CA 4IB5A 2ZYBA 2OJFE 3FQEA 4NM3A 3N51A 3ZDUA 1ZYDA 4FGBA 4F9YA 3BHHA 4O0XA 4RA4A 3SQQA 4ASEA 4FKJA 2RFNA 1JSVA 3NYVA 5FP6A 4ARKA 4Z3VA 3DJ7A 2BRNA 1WVYA 5LXMA 3R7VA 1H08A 3KXXA 3EHAA 2B52A 2BAQA 3OXTA 3V5TA 4C36A 3RCDA 4E6CA 5LCJA 3FWQA 1H25A 4QP8A 1JQHA 3R83A 1YHSA 1OIUA 1CSNA 3CY2A 4B7TA 2QOFA 4BRXA 3DK6A 4KIKB 5A14A 5JFXA 1PYEA 4O0VA 3FXZA 3QRKA 4FIIA 4QP4A 5BX0A 1H1QA 1JNKA 1ZYCA 4AGDA 3UOKA 3T3VA 1PKDA 3NAXA 4E8AA 5IKWA 3LVPA 4D4RA 3WBLA 3U6IA 4FT9A 3V8SA 2UUEA 3F3TA 3HA6A 5KZIA 4J8MA 3C4WA 3E3BX 2RIOA 4UMQA 4CXAA 3DKGA 1MRVA 3WE4A 4GUBA 2VO3A 5FBOA 2WEVA 3O51A 2F49A 3Q60A 4D1XA 3ODYX 3PJCA 5HE2A 2FSMX 1XBCA 2PVYA 3C4XA 3V5LA 3Q4TA 3ZH8A 4YMJA 4YP8A 3NGAA 2FGIA 2QI8A 5TT7A 1OIYA 3BV2A 4HVGA 5KBRA 3EQIA 5EM8A 2XK9A 3F69A 2GTNA 4CLIA 4LGHA 4M67A 3W2PA 4NKSA 1TQIA 3PXYA 3I0QA 4JG6A 3Q5ZA 4D2RA 4L44A 5K0XA 3UOHA 5EW3A 3R8ZA 4DEDA 4NJ3A 2A27A 3GXLA 4OBQA 3AT2A 1QPJA 2YZLA 1I09A 1LEWA 2AC3A 3IGOA 2PYWA 1QCFA 3BGZA 4YZ9A 2IG7A 3DBEA 2JDOA 5F9EA 3LQ5A 2R3LA 1B38A 3PPJA 4AX8A 4EH4A 4WG4A 2XNNA 5IEYA 2J2IB 3VW6A 3QFVA 2WQNA 2JAVA 4WG3A 4FTCA 3SLSA 3GBZA 3LLAA 3DBDA 5A3XA 4RFZA 5GZ8A 2IJMA 4O96A 1E1XA 3GU4A 3TM0A 4OLIA 4B6LA 4GT5A 1Q97A 1FPUA 1Q4LA 3CEKA 2QOBA 3P7CA 3KRWA 2X2MA 5F95A 4AU8A 4JJRA 4F63A 4C3RA 4X6QC 2QOCA 1U5QA 1BUHA 3COHA 4NFNA 3Q2JA 2PVNA 3Q9YA 3ZXTA 4QQJA 5HCZA 3MJ1A 2WNTA 4J99A 5FWKK 2A1AB 3ZSIA 4QNYA 1W7HA 3KXZA 5TF9A 2WTKB 3MA6A 4FX3A 2YAAA 5ANOA 2Z8CA 5HE0A 5HX6A 2RGPA 3R71A 3PZHA 3H3CA 3F2AA 4EQCA 5ANKA 4IWPA 2XK6A 3TTJA 4FKIA 4IJPA 3WI6A 2UW4A 5H3QA 4QTAA 2X8EA 4UXLA 3KVWA 4PTEA 2HWOA 5E92A 4RIXB 2WQBA 3FXWA 3DQXA 2VGOA 2XJ2A 2ITQA 4QP9A 3O0GA 5GZAA 2OJ9A 3LOKA 3LFAA 2AYPA 2XCHA 3R8LA 3PPZA 5HBEA 3QKLA 2R3OA 3C1XA 5E1SA 2IW9A 3EQHA 4CRLA 3G5DA 2CGXA 2F9GA 3FMKA 1Y8YA 4CZUA 2XM9A 3KXGA 4GT3A 1Z5MA 5ACKA 4BDGA 3D2IA 3FMEA 2WQEA 3LLTA 3LZBA 3ZLWA 2VTAA 4CFNA 4L42A 5DH3A 4I3ZA 3DY7A 4NJDA 4O81A 3GCVA 5HIEA 3EQBA 3BU3A 5FM2A 4D2WA 4EUTA 4BTKA 3BYVA 5FXQA 2G2IA 2BAKA 3CXWA 4R1YA 2ITNA 5LWMA 4XG3A 3W2OA 4CVAA 4UWCA 1H28A 4WKQA 3EFJA 3LMIA 4RWLA 2Z7RA 4RIWA 1PMUA 2JKMA 3AD4A 5AR5A 5JFSA 1NA7A 2VN9A 4IWOA 3DJ6A 4DITA 4LGDA 3Q5IA 3ZZEA 4FZ6A 4JL9A 4Z16A 4XP2A 2OJIA 5AADA 4JT3A 3ZO2A 3FZSA 4QMLA 2VWUA 3N4TA 2W1IA 2DS1A 5C8NA 4QYGA 5ETCA 4K11A 4RIWB 5K5NA 4O7TA 4R77A 1ZARA 2VO6A 3PA3A 1W83A 4WO5A 3N9XA 3TNPC 5AR8A 4R7IA 3ZDIA 4XG4A 3QQJA 2ERZE 4U81A 4BDDA 4DEAA 2ITPA 5HLPA 2JKOA 2O0UA 2R3IA 1UU8A 4EWQA 2NRUA 1XO2B 2YJSA 3SV0A 3NDMA 4ZZNA 2B9JA 3EQGA 2P33A 2EVAA 3ORZA 5M57A 2IPXA 4YBJA 4IFCA 5TKDA 3RWQA 3OWLA 1YWNA 1JWHA 3RI1A 4JS8A 4BC6A 1K3AA 3RHKA 3MY5A 2H8HA 3KXMA 4XG9A 3AMBA 1PXOA 4DEEA 4CMUA 5IA1A 1L3RE 1UU9A 4HGEA 4JR7A 2A2AA 4NFMA 5K5XA 4YBKA 3LFBA 4IWDA 1S9IA 1E1VA 3R9RA 5J79A 1PXIA 2WOUA 4D1ZA 5T68A 2HK5A 1WMKA 1Q8UA 4J95A 3EYHA 3QL8A 1PW2A 4J97A 3E5AA 3PJ1A 5M4IA 2C4GA 2PE2A 4EKKA 2OF4A 3RKBA 2EUFB 5AUUA 1ZLTA 4GYGA 3BIZA 4Y5HA 3ENHA 4DGOA 3CR0A 3ID6C 5M07A 1PRYA 3QYWA 4Z55A 1WBSA 3ZEWA 4P5QA 3VS0A 3EQFA 3G6GA 5AA8A 3BU5A 2VTMA 2OFUA 3QUPA 3EQRA 5HG7A 2VX1A 4C34A 4BBEA 2ACXA 5CLPA 3H0YA 4ZY5A 3UO6A 1VJYA 3EFKA 5IQDA 3CCNA 2VWZA 1B39A 2PVLA 3G51A 3RCJA 2JFMA 1REJA 4QMSA 4ENYA 2F4JA 3HGKA 5BYYA 3BHVA 3UG2A 4YTCA 3EKKA 2W5BA 4GH2A 1KE5A 3UOLA 1Y57A 5CF4A 3BX5A 4G2FA 4ALVA 2HZIA 4KSQA 4M7IA 4O38A 3VC4A 2YDIA 1B6CB 4X2NA 4EH7A 3QGYA 3S4QA 5J95A 3FE3A 5J7BA 5JGAA 3TG1A 4P2KA 4RIYB 1BI8A 4E26A 2XNOA 4QMWA 4U0IA 2YA9A 2UW8A 5HO7A 3MVJA 4PTGA 4E93A 2C6KA 3G0EA 3UZRA 3HX4A 1UNHA 4QP3A 3PJ8A 3R8UA 4MCVA 3Q32A 2EU9A 5I9ZA 4MHAA 4ZIMA 4EOSA 3SX9A 3FBVA 5KKRC 4ITHA 3IQ7A 3PJ2A 3VS4A 2B1PA 5C03A 3KGAA 4EHGA 1Y8GA 3NIEA 5IQHA 3D7TA 2BROA 5CT0A 1BL7A 4D5KA 5EW9A 4J1RA 1VYWA 3FLNC 4O27B 3UIUA 3R9HA 3Q3BA 4BCOA 4DFBA 5D7AA 2VWWA 3AC5A 3NNUA 3UTOA 2O63A 3FI3A 4O0RA 2W05A 5IQBA 4YC3A 3LQ3A 3U6JA 2OWBA 3LXPA 4Y8DA 5ANEA 3MSSA 4A9YA 5CEPA 3TJDA 3NPCA 2OJGA 4S31A 4YLLA 3LFDA 3UVRA 2V5QA 4EOJA 4F9BA 4ANOA 3DAEA 4X2GA 3UBDA 4AS0A 4F65A 5LVLA 4YO4A 1L8TA 4PF4A 3QQKA 3GCPA 3I5ZA 3GENA 3CS9A 2P3GX 4EHEA 4RC4A 5CU4A 4XRJA 4EH5A 4E6AA 4MX9A 2X39A 4MD9E 4JOAA 3TZ8A 2V7OA 3GEQA 4EC9A 4BYIA 1MP8A 2J90A 5ETAA 4C4FA 1OPJA 4AE9A 3WF5A 3BLHA 4KKHA 4M69A 2WMAA 4E20A 3U9NA 4EZ3A 1SVHA 5KMNA 4O84A 5IA2A 4ANNA 5DOSA 3O8TA 3EZVA 2HY0A 3F5XA 2W4KA 3LFQA 5I0BA 5JK3A 4XLIA 4GKIA 4GVAA 3R2BA 4ZTNA 4IX3A 1Y91A 3OWJA 3G9NA 1XJDA 5E90A 3IOKA 4AGWA 4YJNA 4ONAA 3HEGA 2JDTA 3EN6A 5HG9A 3GQLA 4A9UA 3NCZA 4Y95A 3C5IA 5AP4A 1JPAA 3R7UA 1YOJA 2GNGA 3ZZWA 4ANLA 1GZNA 4TYGA 1YI6A 5G1XA 4WSYA 4AOTA 5DIAA 4GJ2A 5M4FA 4FZAB 1FVRA 4PMMA 1X8BA 2FSTX 4EKLA 2WTDA 2R0IA 3REPA 1U46A 4JXFA 5C8KA 2RKUA 3LCKA 5IH5A 3HMMA 5BQ0A 4HVSA 3CSVA 1SVEA 1CTPE 2I0EA 2XK8A 5CVFA 3U4UA 3WF8A 4JI9A 4ZZOA 2YLEA 5FDPA 3AT3A 3KULB 2JBOA 2WQOA 4IH8A 3BKBA 3ANRA 4JAIA 4QMOA 3DB6A 3TV6A 5DYJA 5C9CA 3MTFA 5KX8A 1ZXEA 3E92A 3GI3A 4RWIA 5CTPA 3WZDA 4QYYA 3ANQA 5IDPA 1Q61A 2NRYA 2W9FB 1ZWSA 4YHFA 4Y46A 4EORA 4NUSA 4FE2A 3OUNB 3C4EA 3LPBA 2BIYA 3DZQA 4NM7A 1P4OA 5FGKA 3S00A 4WUAA 2CMWA 3L9LA 3PYYA 4ZTQA 4RLKA 3TUDA 1DM2A 2WOTA 4ZLOA 5JH6A 4BHNA 1XH8A 5EI2A 2W1EA 3L9NA 3HVCA 3KN6A 5AP2A 4RC2A 4ZTHA 4ALWA 5KMJA 4CKIA 3DTCA 4O2ZA 3G0FA 5HU3A 4UWBA 4YZMA 2IW6A 4M3QA 4U41A 5AV0A 4RRVA 4F1OA 3BYMA 2CNUA 5M06A 4KABA 3HMOA 5DI1A 3SRVA 2XBAA 4HYUA 4NKAA 4C57A 5BUEA 5IDNA 3BLRA 2CHLA 3QXPA 4FV0A 2I1MA 4MEDA 3FQSA 3KRLA 5AP1A 1H07A 4BKJA 4A9RA 3L1SA 4DFNA 2WZJA 5KCVA 4QQCA 4L7FA 4LV5A 3AC2A 1NW1A 3ORTA 4RC3A 4BDEA 2IZUA 5A4CA 4PL5A 2ETRA 4HOKA 3R01A 2F7ZE 3IS5A 4FV3A 5HLNA 3FI2A 3R2YA 4AN2A 2OIQA 3AT4A 3QYZA 4I5HA 4C4JA 5CSPA 3Q6WA 2WMVA 2WKMA 3PXFA 4U45A 5EQPA 3TN8A 4NYEA 4RX5A 4MD8E 3FZPA 4NTTA 3WARA 1BKXA 3TL8A 4DH3A 3NVMB 5I5ZA 2CKEA 2HW7A 3FHIA 4DCAA 2PE0A 3WZJA 4AW0A 2J0LA 2VTQA 5CU0A 4L8MA 4F6WA 3RAHA 4FNXA 2VTHA 4RVMA 5AUWA 5M56A 4JQEA 4MXXA 4FT7A 3WIKA 5A6NA 2BHEA 3POZA 4AUAA 3R02A 2XVDA 5HD7A 4C62A 5AV4A 2WTWA 4ZLZA 2NP8A 5BVEA 3SXRA 2C6DA 4GVJA 5CVGA 5CXHA 4YTFA 2W4OA 3K5VA 5TO8A 4IB3A 3LXKA 2W5HA 3FYKX 3ORIA 4FV2A 3EKNA 5EOLA 5KNJA 2PVKA 4I1ZA 4TT7A 2BKZA 2C5NA 5BUIA 4O7SA 2PU8A 3R04A 3NCGA 3PSBA 4TY1A 4LOPA 3ALNA 3ZC5A 4H36A 1XWSA 3KRRA 4WA9A 5IF1A 4RT7A 2CGWA 3CKWA 4FK6A 2WB8A 4RSSA 3VJOA 4CT1A 4ERWA 4FV1A 4EH2A 2EXEA 3OC1A 4FV4A 4L3PA 1ZAOA 4FV6A 4G5JA 4ALUA 5J1WA 2PHKA 4FA2A 3A7FA 4E5AX 1PF8A 4D4SA 3BE9A 3PUPA 1SZMA 3R28A 1A48A 2PUIA 4JDKA 4XV3A 2YDJA 3E8NA 4HNFA 3R8PA 4RWJA 3QTRA 4YNEA 5L6OA 5L8JA 4FOCA 3QHWA 1WBOA 4TYHA 4A07A 3PXZA 3NNVA 3NUSA 3FLQA 4HPTE 2PVJA 3IDPA 5K3YA 3QTQA 5IQEA 3UYSA 1QPEA 3WF6A 3VN9A 4BDBA 5CU2A 3TNWA 3SHEA 5M44A 4G16A 4EJ7A 2ITOA 4X2KA 2JITA 4B9DA 5CF5A 4XG2A 3KF4A 2O64A 2V22A 2BR1A 4IX6A 4LUEA 4DTBA 1OB3A 3HL7A 5KHWA 3E88A 4IC7A 3C4FA 1ZOHA 4LOQA 5E8SA 3HKOA 4MBLA 3T9TA 3HMIA 3FEGA 4IAKA 4RIXA 4HW7A 2UZLA 4CQGA 3E7OA 3OTVA 4D2TA 4IVCA 2YWVA 2ZVAA 4IEBA 4G1WA 3SW7A 1GY3A 3EJ1A 2GHGA 3ZBFA 2CLXA 4UBAA 4EOMA 4R6VA 2X9EA 4DYMA 4UXQA 4CYIA 5JQ8A 1OPKA 4FKWA 4FTJA 4YJQA 4JNWA 4BZNA 5LMKA 1ZOEA 3MPAA 4M69B 3PVGA 4YJRA 4KSPA 3FPMA 4LM5A 3R7EA 4AZFA 3FPQA 1SNUA 3G33A 3RM7A 4N0SA 3MDYA 2RG6A 2XYNA 4PPCA 5DR9A 1FGIA 3R8MA 4DG2E 2YM3A 2HYYA 2H6DA 2PTKA 3OOGA 4FKSA 5IU2A 5L8LA 2J50A 3PFQA 3Q9ZA 2PULA 4YZNA 2P2HA 1R0PA 3QRJA 5L8KA 2NO3A 3W2RA 3SA0A 2UW7A 3CBLA 3DLSA 4H1JA 4IDTA 4O1PA 5HESA 3RPOA 5ANGA 5E4HA 2ZV8A 1UNLA 5HKMA 4JDHA 4F7SA 2GNIA 3OCGA 5BVWA 5CF8A 3AGLA 3ETAA 5FEQA 1KUTA 4O6LA 1AD5A 4IADA 4HJOA 3TKUA 4ZS0A 2I0YA 4K33A 5KZ0A 4EOLA 5CSWA 3ORXA 3R9DA 4PDSA 4XCUA 4AOIA 4MK0A 4EOIA 4Q2AA 4EHVA 3D9VA 3VJNA 1ND4A 3V5WA 4QNAA 4O83A 3UVQA 3SAYA 2W5AA 2FO0A 4JVGA 2VX3A 3HV7A 1SNXA 5DWRA 4ANBA 1KE7A 2PVRA 1CM8A 3FZOA 5J7HA 3MFSA 4H3PA 4MWHA 3DS6A 2QOOA 2YIXA 3TT0A 5BVFA 3IW8A 3RBWA 1H01A 2ITTA 1OL5A 2REIA 2V0DA 3A99A 3DPKA 5CSHA 3VHEA 1YXUA 2W1HA 3FUPA 2A4LA 4XG8A 2XIKA 5HLWA 1YW2A 2WELA 1G8AA 4MBIA 3ACKA 4O22A 4N6ZA 3E87A 3E64A 3KKVA 4EOKA 4FTRA 3IDCA 2V7AA 4EK8A 3PY0A 3D94A 4FODA 1DI9A 5FDXA 3VS2A 4IVBA 3HDNA 4BL1A 4PWNA 3ZFXA 4H05A 1R39A 4DGLC 4TWPA 3SOCA 3GUBA 3NUYA 3NW6A 4C4GA 3OTUA 5AX3A 2AUHA 2VTNA 1HCKA 4QD6A 4U5JA 3RVGA 3V01A 4QMQA 2VU3A 3KF7A 4OTIA 5AIRA 1M2RA 4LGGA 4ACDA 1CKIA 5I9YA 2WEIA 3BBWA 3S1HA 2XRUA 4BGGA 1O6LA 4LRJA 4RJ8A 5AAFA 2JIUA 5HBJA 4UALA 4G6LA 1JOWB 4G6OA 3RPYA 5M4CA 3IDBA 3PPKA 3ZOSA 1NT2A 2R7BA 4ACHA 2Z7QA 5D7VA 2VTLA 4M12A 3NZ0A 3QRIA 5JZJA 5L2WA 3BCEA 3BEGA 5FD2A 5CENA 3UGCA 1XH5A 4JDJA 2RG5A 3F9NA 5T3QA 3PRFA 2XJ0A 4APPA 5IA4A 5EYMA 4CZTA 2J0IA 3VO3A 3UMXA 4DG3E 3QLFA 3FYJX 4AT3A 1K2PA 2YISA 2XNPA 3BE2A 4TWNA 4D4VA 5IEXA 2NPQA 5FTQA 4FL2A 4IM2A 1STCE 3LJ0A 4EK6A 3TUCA 2P0CA 3FLSA 5BUJA 3VBTA 2C3IB 2OG8A 4XUFA 2C0IA 5D41A 3TWJA 2Y7JA 5HOAA 2ONLC 4FIJA 4BDAA 1PXKA 5EDQA 5H8BA 3VS1A 5LVPA 3IK3A 4QP2A 2IO6A 3RAKA 4L6QA 4X2FA 3H9OA 3BGPA 3DDQA 2VX0A 4KKEA 4DN5A 3UDBA 3HP5A 2X2LA 4I0RA 5IEVA 5LMBA 3U8WA 3F88A 2JIVA 5AP3A 2XM8A 4UMTA 3BI6A 2A19B 3UO4A 3R9NA 4YJSA 1M2QA 1UU3A 4FTIA 4MF1A 1TKIA 5L6WL 4A9TA 2FSLX 2YITA 5LCKA 3A7JA 2WTJA 3W55A 2IW8A 4GFOA 2Y6OA 4GU6A 2F2CB 4IZYA 4XX9A 5HORA 1Q24A 3O17A 4QP7A 2I7QA 2H9VA 3ZUUA 4OTWA 4U7ZA 5LARA 2WIHA 1AGWA 4BKYA 4C38A 4G3GA 1URCA 5AJQA 4ZSLA 3MV5A 3TZMA 5KMKA 3GC0A 5KMMA 3D4QA 3UYTA 4QMNA 3U6HA 3U54A 3QTZA 3PTGA 1J7UA 5AUVA 4LL5A 2Y6MA 4FVPA 4JBOA 4F6SA 5FUTA 1YHWA 4R7HA 3R22A 4IM3A 4DBNA 3QX4A 4RFYA 5T6KA 4P5ZA 3PG1A 4NH1A 3D7ZA 3R7OA 2QOIA 3Q4ZA 2XUUA 1IRKA 2UZEA 3M2WA 4HPUE 5B2MA 1NVSA 2EB2A 2WMQA 3G2FA 2B0QA 2PL0A 1KSWA 5IQCA 3FAAA 3E8EA 4TPTA 4CCBA 4E4NA 2VGPA 2BRBA 4FYNA 3R1QA 4O6EA 1M7NA 2I40A 3BYUA 4MNEB 3V5JA 1UU7A 2XP2A 3OF0A 4LMNA 3OWKA 3ZM9A 4XMOA 3DXNA 5GJDA 2Q83A 4R1VA 2WU7A 1XQZA 4JBQA 4NM0A 5TE0A 3SXSA 5HX8A 5KUPA 2VAGA 3E93A 4Y83A 5CSVA 3SDJA 2XJ1A 4B8LA 5BMSA 2IVUA 4K9YA 5A9UA 4BTFA 3LMGA 4FEQA 2O5KA 3QU0A 3JVSA 4RFMA 4MWIA 1MUOA 3Q9WA 3NX8A 3MVMA 1UV5A 3OP5A 1ERKA 3NUPA 4HCUA 4PPBA 5CZIA 4AT4A 1FINA 4D5HA 3ITZA 5A6OA 3GC7A 2X6EA 5CZHA 3VQHA 4MBJA 4R3PA 3CJGA 3QA0A 4KS7A 4J53A 1H1RA 3AC3A 4U6RA 3WIGA 4AGCA 2YCQA 3HV3A 2E2BA 5AR3A 4H3BA 5AUTA 4QTCA 2Q0BA 3ZLXA 3UVPA 3U87A 3F5UA 3CPBA 2WMBA 3WF7A 3Q2MA 4C4EA 4I0TA 4BZOA 3CQEA 4W9WA 2KULA 1V1KA 4L7SA 3OT8A 3GOKA 5A4QA 1ZMUA 3RAIA 4JQ7A 5C27A 2X1NA 5JFVA 4C3FA 5CX9A 4NIFB 4JG7A 3A8XA 1OZ1A 5HE3A 4L9IA 3SVVA 4GW8A 1J3HA 1REKA 3ACJA 5FEEA 2CKQA 3BLQA 2XH5A 4EBWA 1ZY4A 5JMSA 5EKOA 4IIRA 4K8AA 5IQGA 4TNBA 3ZXZA 4NWMA 4O21A 4BCHA 3QQGA 3ZO3A 2V62A 5KBQA 4O91A 4A4XA 4WNPA 5M53A 3COIA 3FY2A 3NSZA 3P86A 3ULZA 3I4BA 2QKWB 2CSNA 1FGKA 4R7BA 3EN4A 4O7YA 4KBKA 5JQ5A 2OH4A 2VWIA 4KAOA 3R0TA 2YERA 4YHTA 3VQUA 4D55A 4IVDA 2PSQA 1YQJA 3AOXA 4U42A 4X6RA 4YTIA 3OMVA 4BTJA 4YUQA 3HDMA 1HCLA 1JKKA 4FKQA 4AFJA 2YCRA 1WBVA 3CY3A 2C5YA 3DA6A 2JFLA 4PNKA 4H39A 4I4EA 4LRMA 4RVTA 4EOOA 3D5WA 5BYZA 3VBWA 1OUYA 2Z7SA 3GCUA 4C3PA 1IAHA 2UZWE 4MTAA 2WHBA 3VHKA 1YDRE 3ZRMA 4BY9E 4TXCA 3JPVA 5J5TA 2EXMA 4FVQA 4L67A 4V0GA 1H8FA 2ZB0A 4IJ9A 4RX7A 5GJFA 2OZAB 3ZTXA 4OR5A 4AT5A 3GVUA 4CFFA 4D2PA 2XIRA 3QQHA 4IANA 3R1YA 4LMUA 4IB1A 3ZSGA 4CKJA 4BKZA 3OEFX 1PHKA 2ITUA 2XMYA 3P7BA 3VUHA 4FEVA 3I7CA 5DT4A 3BELA 2ERKA 4RX8A 5HIBA 4BI1A 5BVOA 4E4XA 2BUJA 2B9IA 3Q4UA 3K5UA 1ATPE 3ORPA 4QOXA 4USDA 4N6YA 4UYAA 4C58A 3W2SA 2WMRA 3D7TB 4J71A 5FRIA 4C33A 5AFVA 3QTWA 2J7TA 3FC2A 2YDKA 4GIHA 3R7YA 3Q96A 3UC4A 5IPJA 3CD8A 4D4YA 2X6DA 2XK3A 2C68A 3CE3A 3FQHA 4AA5A 4BDHA 2ONLA 4ZTSA 3B8QA 2RFEA 3ZLYA 2YM7A 4CMTA 4C61A 3G6HA 5K9IA 2ZM4A 4IAYA 5HCYA 2BTRA 4ZJIA 3MN3A 3KA0A 5B2KA 4L01A 4ZK5A 3I6WA 5ACBC 2X7OA 2C3LA 4R5YA 1ZYJA 4EZ7A 2ETMA 2F57A 2KTYA 3VNTA 2J9MA 4B8MA 1XBAA 3BPRA 3RTPA 5M09A 2C47A 2GFSA 3MVHA 3UQGA 3NVKI 4BBFA 3BWFA 3QUDA 1YXTA 3NNWA 4OT5A 5IA5A 4AZSA 3N4UA 4G3FA 5AM6A 4BHZA 4IX5A 1Q99A 4PQNA 3EB0A 3VUKA 1KE6A 2QO9A 3O7LD 2BRMA 4JBPA 4WRGA 3HA8A 2R3MA 5AP0A 3T9IA 1OM1A 2XKFA 5L4QA 5EQYA 5I9WA 4YZDA 3GC8A 5AV3A 2XK7A 3CPCA 4IBMA 4RX9A 5ANJA 4CGAA 2JKQA 2X8IA 2PUPA 3AG9A 2PVFA 4Q5EA 4W4WA 1FMOE 1O6KA 2ITWA 4ZOGA 3ATTA 4B0GA 5ETIA 5F94A 4FG8A 3PVUA 4XEYA 3UP2A 5L2SA 3RK7A 2VD5A 4OBOA 4BF2A 4WBBB 4NW5A 2C6TA 2GNLA 4IAZA 2PE1A 1BL6A 4UMUA 3TUBA 3M42A 3O2MA 4O0TA 2E9UA 1R0EA 2ZV7A 4YO6A 3HP2A 3OW3A 2HY81 4TNDA 4W4YA 4FTOA 4AG8A 5J9ZA 3CTJA 4CFUA 2X0GA 5IZFA 2QOQA 1PXMA 2XKDA 4RWKA 3V6SA 3LM5A 2HZ4A 5M51A 1YXVA 4V01A 4QMVA 4EH6A 1FVTA 3RJCA 3PIXA 4QYHA 3BZ3A 3CIKA 4TL0A 3AD5A 3E7VA 3IW4A 1LUFA 4XBUA 4C02A 4IC8A 3NUXA 3PVWA 3UZTA 4F0FA 2UW9A 3RGFA 2CN5A 2WMSA 3QBNA 4BTMA 4QQTA 4ZMEA 1DI8A 3LE6A 1BYGA 1MRYA 4WSQA 4IM0A 2ZAZA 2W96B 4V05A 4ANQA 2QQ7A 2RF9A 2XNMA 4FIEA 3BEAA 3VS7A 4EUUA 5B2LA 5I4NA 4AW5A 4L00A 3EN7A 5HD4A 3JY9A 4TZRA 5E8ZA 3QUEA 1H1SA 1DS5A 2E9OA 1YVJA 4B4LA 2GPHA 2VWXA 2C6EA 3IW5A 4FSZA 3ZSHA 2JKKA 3QCSA 5IISA 4GT4A 4BCJA 3Q9XA 3VWAA 3A7HA 4BIDA 3FSKA 3TNQB 1ZZ2A 2GDOA 2QC6A 4DH8A 5JGDA 5CANA 2WTCA 4IW0A 5FBNC 4AFEA 4RVKA 4U79A 2VV9A 4AW2A 2VTJA 3TCPA 3ZEPA 1WBWA 1NXKA 3M11A 2QHNA 5TOZA 3PG3A 4FTNA 4BDCA 3OXIA 3OVVA 1APME 2YIQA 3VBYA 4ACGA 2WFYA 3L8VA 3OEZA 5CEOA 4CG9A 4O0WA 1M17A 3OBJA 3PIZA 5AV1A 2C6LA 3K3IA 3W8QA 2RL5A 3DK7A 4QMPA 4USFA 4FC0A 2X9FA 4XYFA 3TIZA 4DLIA 2BZHB 2OU7A 4EWHA 2PMLX 1RDQE 3L8SA 2XYUA 3C9WA 3ENMA 3FHRA 4L46A 4QYEA 2UZOA 3FZRA 4BGHA 3EIDA 4F7JA 3HUCA 5JGBA 2PY3A 3PXKA 1IASA 2VUWA 3HMNA 4N57A 2PMOX 1YKRA 2X7GA 5LJJA 4QMYA 2O65A 2YFXA 1OITA 3TV7A 2WTVA 1U54B 1YWVA 1PXPA 3MTLA 3OROA 5HEZA 4U97A 4KBAA 4BDIA 5CI7A 1YOLA 4ZMFA 1JVPP 4U3YA 3FLYA 1IR3A 3EL7A 3KQ7A 1XBBA 4W4VA 4BI2A 3QGWA 5LWNA 3BHYA 2R3HA 1TQMA 4KRCA 5CEQA 3OHTA 4GUEA 4PY1A 3EYGA 4DF3A 3F61A 5HNIX 2BZKB 2UZNA 4L3LA 4BIEA 4CTBA 5L3AA 4OTQA 3OXZA 5A54A 3EL8A 4NCTC 4XJ0A 1GOLA 2VWVA 2QG5A 4ZTRA 3U4WA 5EW8A 4MXCA 5GIPE 1U5RA 3BWJA 4UY9A 3S2PA 3V3VA 1UKHA 3DFCB 4K2RA 3CJFA 2WMTA 1J1CA 4CFXA 4EZ5A 3KREA 5B0XA 3ZC6A 1YXSA 3O50A 3T8OA 4Z9LA 5IH6A 2PUNA 4U80A 3QKKA 4IMYA 5J9YA 3IG7A 4YJVA 4BCGA 2R64A 4P7EA 4PMPA 5HVKA 5K4IA 3V6RA 4YPSA 1G3NA 3BYSA 3UNKA 4S34A 2OGVA 3EQDA 2BDWA 4EONA 4FV9A 2J51A 2C1AA 1TQPA 3D14A 2OK1A 3MS9A 2IZRA 1J91A 4E4LA 5J87A 1XH7A 4FGRA 1OKZA 2F7XE 4XNEA 5EHYA 1WVWA 4FI1A 1H4LA 4OT6A 1Y6BA 3BGQA 1OL7A 4UWYA 4YU2A 5IQIA 3RZBA 3R6XA 5EYCA 5ICPA 1YDTE 2ITZA 4IE9A 1GZ8A 2GMXA 1JKSA 3TI1A 4Q5HA 3P5KA 3QXOA 3ZFYA 3II5A 5KMOA 3KEXA 4DT8A 5M4UA 5I9VA 2XRWA 3ZO1A 4I21A 3RP9A 2YN8A 4UZDA 1H24A 5LVOA 4MXAA 5IMXA 2WO6A 4H3QA 3CLYA 3UIXA 3IKAA 4PP7A 2GQRA 3H9RA 1YHVA 4JX3A 2QVSE 5CEKA 5JZNA 2QKRA 1DAYA 4CQEA 3RM6A 1OPLA 2ITYA 5J1VA 4L3JA 4F7NA 1JKLA 2FUMA 3NWWA 5AUZA 2W99B 3U55A 3Q6UA 3QLGA 4ITIA 3CGOA 4O7VA 1JKTA 4D9UA 3F3VA 4TWCA 3F2RA 3QQUA 1UA2A 1F0QA 4FTKA 1M7QA 3PRIA 4MXYA 2G1TA 2X81A 3DBFA 3L8XA 4OTRA 4FVRA 3S0OA 3QZFA 1QL6A 2C5OA 3FI4A 1OL6A 3IW7A 4PX6A 5EM6A 2GHMA 4BICA 1FVVA 2WPAA 4I4FA 2OH0E 1ZYLA 4IXPA 5D11A 4FSYA 1OIQA 3LM0A 4W8EA 3JR1A 3CP9A 2GU8A 4FNZA 3KRJA 1LEZA 3NW7A 3P08A 3MPMA 4NW6A 3FSFA 3GU6A 4C4IA 1GAGA 4ANSA 5LOHA 5A4TA 2ITVA 4I5PA 3PLSA 1NVRA 2FSOX 3UC3A 4C35A 3KRXA 3QRUA 5E8UA 5BMMA 1IAJA 2B4SB 5AR4A 3B8RA 3QCQA 2P2IA 5EYDA 1OGUA 3NIZA 4CV9A 1BX6A 4XLVA 1P5EA 2CGUA 3A4OX 4F4PA 2VRXA 4JBVA 3OZ6A 4YJTA 2YIYA 2C6MA 3UO5A 2GNJA 3DZOA 2CJMA 3CQWA 4I93A 2JIIA 3LFEA 2XA4A 3KMWA 3HAMA 5DNRA 2CLQA 4ORKA 5DEWA 2OW3A 2BFXA 4FR4A 5DBXA 4PMSA 3WE8A 1KE9A 3HRBA 5JRQA 5AP7A 3LCTA 5FXSA 4E6DA 4DH5A 3ZHPC 3R73A 4X3FB 2QONA 2JDVA 3BRBA 1WBNA 2YIWA 3NUUA 2PK9A 2BIKB 2EB3A 3DOGA 5EK7A 4GRBA 2QU6A 1RW8A 4AE6A 1PKGA 2UW6A 2HAKA 4YSMA 3EQPA 2GQSA 3MH0A 5EYKA 4ZEGA 5HTBA 5CAVA 4QMUA 5KKRB 3IOPA 3I60A 3P4KA 3EQCA 2B55A 2FVDA 3R00A 4K77A 4EQUA 2WMXA 4OAUC 2CNQA 4KIKA 3I7BA 3I1AA 3ZM4A 2FB8A 4D28A 5A4EA 4X21A 2WU6A 4X3FA 1V0PA 4LFIA 3ROCA 1GNGA 1ZMVA 2WGJA 2C0TA 2VTTA 5ANIA 3VS6A 4YSJA 4UEUA 4ID7A 3HLLA 4TW9A 4LG4A 4FZDB 1ZZLA 4QO9A 5FG8A 1Q8TA 3FV8A 1XKKA 1M14A 5CQWA 4ZTMA 4WBOA 3WZEA 2JDSA 4CD0A 4G3DA 1YI4A 4O0YA 5JEBA 4Y5QA 2WTIA 4ZS4A 2G15A 3FY0A 3GU8A 3OCTA 4A06A 2C5XA 4EEVA 4O86A 3FKOA 1PXLA 1VZOA 3JYAA 3MH2A 4L52A 5A4LA 2B53A 3WOWA 5G6VA 1O9UA 2I0HA 3GU7A 5AUXA 3C4ZA 4FSWA 4D9TA 4G34A 4G17A 3EFWA 4M8TA 2Q0NA 2UVXA 4D1SA 4CZYB 2PZPA 4ZXTA 2YM8A 4HZRA 3COKA 3TIYA 3DDPA 1MQBA 4NEUA 3O96A 3QQLA 4DGMA 2GNFA 3FZ1A 4FKTA 3NUNA 4OTFA 2C30A 2CKOA 2PPQA 3MFTA 4AN9A 4KKGA 4CFVA 4DGNA 3PA5A 5ITAA 3RNYA 4JIKA 4ZAUA 2HZ0A 4FSQA 4G3EA 4NTSA 4ZY6A 2G2FA 2BRGA 3SD0A 2UZVA 3A60A 3HYHA 3DKCA 2ZV9A 5HGIA 3E8DA 4MNFA 4UMRA 2JLDA 1U59A 1P4FA 3TKHA 2BILB 3RALA 1WCCA 1YWRA 5D12A 3KU2A 2QR7A 4ASXA 4BN1A 4P90A 5HE1A 4IVAA 2GS6A 2P4IA 4M14A 3P23A 4GG7A 3R8VA 3Q04A 4RJ6A 4FSMA 3R1SA 4XV2A 4X0MA 4BBMA 3LCDA 5EHOA 4XV9A 4PTCA 3DKOA 3FMLA 4FSNA 5BNJA 2GCDA 3BQRA 4JG8A 4NSTA 4I6BA 4RIOA 3LIJA 4WNMA 5AIKA 5E8VA 3D5XA 2OBJA 4M97A 5E8XA 4AZEA 1LPUA 4HYIA 4RQVA 3SXFA 4L43A 5C26A 2O8YA 2IZSA 3VBVA 5HICA 5CU6A 2QURA 2V55A 3LFCA 2C0OA 4G3CA 4FOBA 5C01A 3UNJA 2YLFA 5CALA 4WD5A 2C1BA 3LCSA 3QD4A 5DGZA 4YC6A 5AAGA 5FTGA 4CT2A 2R0UA 3TACA 5EQEA 4S33A 4B99A 2H96A 2YCFA 4MF0A 1CKJA 3OY1A 3RAWA 4U9AA 4YZBA 1UWJA 2RSVA 2CDZA 4M0ZA 5DVRA 4AACA 1J7LA 2W1ZA 2VTPA 1H1PA 2BZJA 3JS2A 4GYIA 4QQ5A 1Z9XA 4LUDA 3KXNA 5DPVA 3OT3A 4OTGA 2PZRA 3UPZA 4LV8A 3R7IA 3PDTA 1OIRA 3FMMA 2W1DA 3IPHA 4DEGA 3QCXA 2AC5A 4OTHA 2GQGA 4OW8A 4DEHA 2UZTA 5LQFA 2QG7A 1M2PA 2CKPA 4D2SA 3E3PA 3P78A 3R1NA 4DTAA 2FYSA 2Z02A 5DHJA 3MI9A 3DXQA 3ZMMA 4HVHA 5JRSA 2O3PA 5FEDA 4A7CA 3NNXA 4FTLA 3MH1A 4RJ3A 4ZTLA 3EFLA 4UMPA 4XRLA 4GKHA 1V0BA 4EBVA 3E62A 5E8YA 4C0TA 3BQCA 3KMUA 4NM5A 2J0JA 5EI6A 3UQFA 4AWIA 2GS2A 4YGAA 3QC9A 5IG1A 3UIBA 3MIYA 2JBPA 3ORLA 5B7VA 5CAUA 2PUUA 4P4CA 3TXOA 3DK3A 4MQ1A 1SMHA 3FLWA 3MY0A 4PMTA 1VR2A 4W9XA 5CNOA 4G9CA 5IUIA 3TNHA 2GHLA 4DINA 3MIAA 3V51A 3MH3A 4APCA 3FKNA 3QD0A 4ZLYA 3FI8A 2PVMA 4PRJA 3CD3A 3CTHA 1DAWA 4J7BA 3PJ3A 2BFYA 4KRDA 5DRBA 3W33A 3PE1A 4EJNA 2HW6A 2OZAA 3D15A 5BVDA 4U3ZA 3ELJA 5GJGA 3NLBA 4DC2A 3PY3A 4K0YA 1NVQA 4YHJA 3IGGA 3QF9A 5A46A 1V0OA 3OY3A 4BR3A 3KK9A 3PXQA 1SYKA 3A7GA 4MXOA 3W8LA 4BCPA 4E6QA 4N4SA 2XBJA 4FMQA 5GZ9A 4DFUA 4EK4A 5GINE 3RZFA 2YAKA 4GK4A 5E91A 1SM2A 4OBPA 4U8ZA 3QRTA 4AA0A 1IG1A 4IB0A 5KMIA 3PWYA 5AP6A 4C2VA 5HU9A 1EH4A 4AXAA 2WXVA 4DE4A 3S3IA 4BCIA 3QD3A 3JVRA 4FTUA 4CFWA 2WMUA 3NR9A 5AAEA 3DBCA 4GK3A 1GZOA 2PVHA 2OJJA 2ZDTA 4PUZA 4DH1A 3ODZX 2XIZA 4FTQA 3MESA 3VW8A 2C5VA 4RIYA 1Q3WA 3K54A 3Q53A 4O7ZA 4JRNA 3HNGA 3KL8A 3MB6A 3QTIA 1JBPE 2QU5A 4RLLA 3SW4A 3LMHA 4TN6A 3UIMA 2I6LA 3ZCLA 4FKVA 5ANDA 4TYJA 2G2HA 4ITJA 2VZ6A 2WD1A 3I6UA 4XHKB 5K0KA 3VAPA 4ASZA 3ERKA 4MYGA 4XOZA 4F08A 1KV2A 1FBNA 3PP0A 3RNIA 1UNGA 2C6OA 2Z2WA 5C8MA 3IECA 3OBGA 4WT6A 4ERKA 4YJUA 5HTIA 3QWJA 2UVYA 5HBHA 3H10A 4GSBA 5C4LA 3PVBA 3DGKA 3GFEA 3D5UA 3OUKA 3ZUTA 4BWKA 5CF6A 1OBGA 2QOLA 4AZVA 4C37A 3AQVA 1WBTA 4FL1A 4G9RA 4HGLA 4X7QA 2VO0A 3DB8A 1Q8WA 3V5PA 4AZWA 1RJBA 4K6ZA 2XF0A 3FL5A 4JAJA 4U44A 4YC8A 5L2QA 2H34A 5IQAA 3OG7A 5IA0A 3BBTB 4DEIA 4N70A 4Y85A 2J0MB 3H0ZA 4ASDA 1PXNA 3O8UA 3F6XA 4V0GB 4YJOA 4DFXE 1O6YA 4L68A 3MGYA 5HI2A 5L2TA 3PSCA 4RPVA 4YZCA 3VIDA 4J52A 4GU9A 3ZS5A 4XP0A 4AN3A 4OUCA 4RZVA 2WIPA 5AMNA 3MFUA 3VRYA 2LGCA 3ZUVA 4R5SA 2OI4X 2WAJA 4ZSAA 2X2KA 3GGFA 4F7LA 2QD9A 4KIPA 4EL9A 5LMKC 3ZRKA 3GOPA 1QPCA 4NK9A 4Q9SA 5CEIA 3B2WA 2QHMA 3IW6A 3F7ZA 4O0UA 4RBLA 2B9FA 4F9WA 3F2NA 3KULA 2B7AA 3GP0A 4CCUA 3WZKA 3CC6A 3UE4A 2Y9QA 3OW4A 2QNJA 4GG5A 4OAVB 3UQCA 1UKIA 2Y4IB 2R3PA 5KHXA 3MWUA 2XNBA 5CASA 3AC8A 3UZPA 2BDFA 1R78A 2Y0AA 5HCXA 3WYXA 3KC3A 4M66A 3QTUA 2B9HA 2YHVA 4KINA 3VF9A 2ZJWA 4IZAA 3L8PA 1YI3A 3ZO4A 2P55A 3FKLA 4BWXA 2QR8A 3UG1A 4FV5A 2PWLA 5J5SA 3AC1A 4ZJVA 1A9UA 4FSUA 4R3CA 2CN8A 4LQMA 4R8QA 3MBLA 3JUHA 4FKOA 2OLCA 4TKSA 4IHPA 2ZMDA 3FL4A 1T45A 3MYGA 3ALOA 4TYHB 4OTPA 2OZOA 3DNDA 4CMOA 3W16A 1PMEA 3D83A 3QA8A 2ZMCA 3I79A 2UZBA 4DHFA 3TKIA 1YOMA 2C69A 3AMYA 4M84A 1BLXA 1XH4A 2R4BA 2R5TA 2RFDA
chains in the Genus database with same CATH superfamily
3OCSA 3MY1A 3QTSA 4UV0A 4FUYA 1K9AA 4GJ3A 4RA5A 5E8TA 4FEUA 2B54A 5KMLA 3RPSA 4I41A 3HV6A 5F1ZA 2LAVA 3ZU7A 3FZTA 3GB2A 1TVOA 1WAKA 4EH3A 1OKVA 2IN6A 2IVTA 2BDJA 4KNBA 1Q8ZA 4IQ6A 4RZWA 4IZ5A 4ANMA 4F1MA 4PV0A 5EG3A 4ZSEA 5FP5A 2QLQA 5H8EA 3EMGA 5HZNA 1J7IA 2PZYA 4HCVA 3VUIA 4I23A 3OD6X 1OL2A 1J1BA 4I6HA 3C5UA 1CMKE 2EXCX 2OIDA 2SRCA 4PL4A 4WNKA 2NYAA 5C4KA 2OIBA 2PMIA 3NAYA 1NY3A 3F5GA 3QAME 4QP6A 3ZFMA 4F1TA 4JMQA 2CCIA 4ZY4A 4CEGA 5AM7A 4DCEA 1JLUE 3KVXA 2CGVA 3W18A 3H30A 4XG6A 2PZIA 1T46A 2E9NA 3DT1A 3EN5A 5H9BA 4FICA 4F0IA 3QQFA 5I9XA 2J6MA 4DFYA 3HRCA 5IUHA 4CFMA 4ACCA 3EH9A 2GNHA 1U4DA 3F66A 2XEZA 2YACA 3KFAA 1G8SA 4FIGA 2F2UA 2BZIB 3KK8A 3AD6A 5DN3A 2ZOQA 2X4ZA 4H58A 4FKGA 3F82A 3KY2A 1PMNA 4USEA 4O2PA 4PDOA 4XBRA 5EM7A 2ZM3A 5KE0A 4Z7GA 3QZHA 2IVSA 5DMZA 5HNBA 5JKGA 5DA3A 1PMVA 3W2CA 4F99A 3GC9A 2NNWB 5LVNA 5CYIA 5CT7A 4YNOA 4X2JA 1Q5KA 3ORNA 4BYJA 2XB7A 1GIJA 4FG9A 5HG5A 3SC1A 1XHAA 4FEWA 1IEPA 1WBPA 3LAUA 4FKRA 4X3JA 5H8GA 5DG5A 2BHHA 2GFCA 4M0YA 3NFFB 1YDSE 5AP5A 3THBA 5IQFA 3EN9A 3SG8A 4KIOA 4JLCA 4ZSGA 1HOWA 4TTHB 5I3OA 3SOAA 4MD7E 4U43A 3FMNA 4S30A 2BPMA 3C13A 3RK9A 5CVHA 1Q3DA 5EH0A 5FLFA 3QD2B 2Y4IC 5CSXA 3O8PA 2W4JA 3OS3A 1RE8A 3Q4CA 4IAFA 3DCVA 2C3KA 3W0OA 4QMXA 4EOPA 2VTIA 4TWOA 1GZKA 3DLZA 4QTEA 3COMA 3NYNA 2OXDA 3O23A 1UVRA 1XH6A 3QALE 4LI5A 4DLJA 3RPVA 3LHJA 2OSCA 3TZ9A 2A0CX 1PXJA 5CNNA 4DTKA 3QKMA 5JN2A 3ATSA 2R3KA 4KUJA 5AX9A 1GIIA 4K18A 1H0VA 4C4HA 1FOTA 3C0IA 5EM5A 4NIFA 2G01A 4RJ5A 4EYJA 4W4XA 3HRFA 3VULA 4G31A 2OF2A 2XKCA 3DTWA 4H1MA 3KCFA 2HWPA 5DR2A 4QT1A 1CDKA 3NYOA 2VWYA 3T3UA 4BDKA 3HMPA 1ZOGA 2X0OA 5EDPA 3V04A 4O0SA 4CRSA 3QZIA 4MAOA 1OECA 3PE2A 5GHVA 3UNZA 4IWQA 4QPSA 1XH9A 5F20A 4E5WA 5CAQA 1QMZA 4NL0A 3VUGA 3L9MA 2DQ7X 3BHTA 5IUGA 3VS3A 2BKKA 3C0HA 2HXLA 2XNEA 4ZJJA 3ET7A 2BRHA 5HNGA 3KN5A 3ZBXA 4XOYA 3B2TA 3R9OA 1Y6AA 1H00A 3JXWA 1QPDA 3O71A 2BCJA 4J98A 3L9PA 4TYEA 5E8WA 3VF8A 4DFZE 4O7RA 4C7TA 4YLKA 3DV3A 3DU8A 3HV4A 4RG0A 1Q8YA 3CGFA 3BL9A 1A06A 4Z7HA 2FH9A 3GNIB 3ZYAA 4K1BA 3C7QA 4IX4A 2QLUA 2QO7A 1LR4A 2XIXA 4MKCA 5BVKA 4KB8A 3ORKA 3C50A 4J96A 3A61A 1F5QA 3H9FA 3H4JA 4FUXA 3UJGA 1H26A 2E9VA 3DNEA 3VRZA 1WZYA 4WOVA 1KOAA 3MPTA 3LW0A 4L45A 2UVZA 2ZV2A 3EWHA 1OI9A 2HCKA 1BI7A 5H2UA 4HGTA 4WHZA 2W1GA 4EYMA 4Q9ZA 2EWAA 1VYZA 3CTQA 1R1WA 4KIQA 4F70A 5EI8A 5CAOA 5LVMA 5HVYA 3WZUA 3GU5A 3VBXA 2YIRA 3P9JA 3AC4A 1GJOA 2HELA 2HENA 1VEBA 3K3JA 4XV1A 3U9CA 2HZNA 5D1JA 3W0NA 4HZSA 3MFRA 3MA3A 4UYNA 4UN0C 3DXPA 4I20A 3G90X 3EZRA 5FQDC 4EH9A 5GIOE 3LJ1A 1OVEA 5DT0A 4HCTA 5DR6A 1W98A 4BZDA 3QHRA 5AEPA 4GV1A 4HVIA 5EDRA 1JAMA 3HECA 4JR3A 4Y73A 1OKWA 4DH7A 1H1WA 4TYIA 3TJCA 5CEMA 4GEOA 4MH7A 2UZDA 2UW5A 3QZGA 4IAIA 3DJ5A 2WQMA 5DLSA 2QO2A 4E73A 2YEXA 1PYXA 4O1OA 5CWZA 3RINA 4ACMA 2ZDUA 3F3WA 4YR8A 3S95A 2XZSA 2UV2A 4S32A 3FMDA 3VVHA 3W32A 5I3RA 2F7EE 3GFWA 5EFQA 4M15A 4M68A 4FEXA 2UW0A 5AV2A 4EC8A 3DKFA 1OKYA 2VNWA 5GNKA 3PWDA 1YRPA 3PXRA 1URWA 3SGCA 4UB7A 4R3RA 3BHUA 4AXCA 2VO7A 2HOGA 4UZHA 2OO8X 5HG8A 4EQMA 2VTRA 1F3MC 2JEDA 4I92A 4D0WA 1AQ1A 4ENXA 2WMWA 4FZFB 3ULIA 5EOBA 5AWMA 3O7LB 4MNEA 3PZEA 4EHZA 4BDJA 1G5SA 3FMHA 4M13A 5HHWA 3TZ7A 4GS6A 3KXHA 5FM3A 4IDVA 3QWKA 2XNGA 2IZTA 4DFLA 3CKXA 3VUDA 4HVDA 3TTIA 4O7NA 4O4BB 3LKMA 4RJ7A 4I6LA 4DGGA 3DBQA 5C1QB 1M52A 2JC6A 4EK5A 4XH6A 5EHLA 1S9JA 5AUYA 5CU3A 4DBXA 4QTDA 4TRLA 2VNYA 3W2QA 4BDFA 2PMNX 5J8IA 3G15A 5HO8A 4D0XA 4F6UA 4YLJA 4EI4A 4PPAA 2XKEA 2W0JA 3CQUA 4ZP5A 4I94A 4KWPA 1H27A 3NW5A 2Y8OA 2R7IA 5DFPA 5AR7A 4FIHA 4IACA 4RGJA 4DAWA 1W84A 3HV5A 3RHXA 3NUAA 5M08A 2VWBA 3A8WA 4DT9A 1E9HA 4S2ZA 4RMZA 4QMMA 3FDNA 1ZY5A 3E63A 3C51A 1ZRZA 4FV8A 2J5FA 5E1EA 3POOA 4ZSJA 5JT2A 1U54A 2X0QA 2BMCA 4OGRA 4LYNA 4QTBA 1UWHA 3JY0A 4AW1A 4LV7A 1W8CA 4HGSA 5AA9A 2W1CA 3BV3A 3GQIA 3AXWA 3PSDA 3VUTA 4GCJA 3W1FA 1OMWA 3G9LX 2JAMA 2W06A 4I6FA 2QOHA 3LFFA 2ETKA 3TNIA 4BFMA 4JIAA 3SKCA 4F09A 2R2PA 3K2LA 4AA4A 2OFVA 3OCBA 4O7LA 1WFCA 4YURA 3D5VA 3M1SA 4FT3A 4QP1A 3N4VA 3TDWA 1JSTA 3F7WA 3ZONA 3PY1A 4GMYA 4FNWA 2XCKA 3V8TA 4CYJA 3OWPA 3HAVA 1KV1A 4I24A 2XALA 3P1AA 4II5A 3P7AA 4RQKA 2RFSA 4PNIA 3UODA 3ZLSA 3PP1A 3R30A 4FTTA 2CNVA 5BVNA 1Z57A 2X8DA 4WRSA 1PJKA 4AAAA 3PLAE 3BU6A 1P2AA 2XK4A 4CNHA 4R78A 3TEIA 3MB7A 4XP3A 3NS9A 3NYXA 4FG7A 2Y4PA 3QCYA 4FKLA 4A9SA 4AQCA 5KO1A 1P14A 3GT8A 2GSFA 2W1FA 3I5NA 4PDPA 3RWPA 3IONA 2E9PA 3P79A 3FC1X 4YJPA 3F3ZA 2DYLA 4BB4A 2J5EA 4GFGA 4DA5A 4GFMA 3GCSA 2I0VA 5E9EA 2HIWA 2R3GA 3SRVB 3O5AA 2YM4A 4FL3A 5D9HA 4BIBA 5BPYA 1OL1A 5DE2A 3P0MA 5M55A 1XR1A 2XEYA 2CPKE 4QPMA 3D0EA 4W8DA 3W10A 4BGQA 3LFSA 4A4OA 4CKRA 2DWBA 2Z7LA 5TR6A 2JD5A 3BL7A 4FKPA 4FTAA 1PY5A 4I22A 4IZ7A 3QTXA 4L53A 1BMKA 4V04A 2YM5A 4WUNA 3I0OA 4ZZMA 4CG8A 3IO7A 4IAAA 3BYOA 2IVVA 5DEYA 3W0SA 3EOCA 3NRMA 1W0XC 4AF3A 4CLJA 4PL3A 3KMMA 4RJ4A 3AMAA 4MUQA 3SG9A 2DUVA 3UP7A 3AGMA 5HQ0A 5CI6A 4FV7A 4F9CA 5ETFA 4YTHA 5JSMA 1WVXA 3MJ2A 4JQ8A 3NMUF 3DFAA 4MXZA 5HIDA 4O82A 2ZM1A 3UMWA 2R3JA 2BTSA 4F9AA 3C0GA 2ITXA 4KS8A 1FQ1B 4NU1A 4F0GA 3E8CA 4FIFA 1OUKA 3A4PA 4FYOA 5IMEA 3I81A 3DAKA 4C8BA 5L6PA 2J0KA 3U51A 3FLZA 1MQ4A 4CSVA 1KOBA 1LP4A 2XIYA 2UZUE 3NEWA 4RVLA 4D58A 2PZ5A 5CY3A 4PDYA 2YM6A 4AOJA 4G5PA 4I5MA 4E5BA 3A62A 1W2DA 4FZ7A 4FKUA 5IA3A 4HYHA 3RPRA 1ZYSA 4J8NA 3TV4A 3F5PA 4EK3A 2QOKA 4DG0E 4E3CA 4IFGA 4WIHA 3V5QA 2Z60A 4FSRA 2W17A 4NT4A 1W82A 4Y72A 4BCQA 1OBDA 4QMZA 1IA9A 2YWPA 4JRVA 5E7RA 3UOJA 2J4ZA 3GCQA 4BI0A 5K4JA 4AGUA 3VUMA 4BVUA 1I44A 4LL0A 5F4NA 3VS5A 1RQQA 5HO6A 5EKNA 4I6QA 4BCFA 2BAJA 3PIYA 4G6NA 4MQ2A 2ESMA 3RK5A 2JDRA 4FNYA 4KBCA 4FBXA 1ZMWA 2R3RA 4MVFA 3WYYA 5HTCA 1R3CA 2YJRA 4FF8A 1KWPA 2OKRA 4HNIA 4HYSA 2ZB1A 2OXYA 3FJQE 3F3UA 1KE8A 3QC4A 5J9LA 5I9UA 5JFWA 2VTOA 4BCKA 2C6IA 3WILA 2CCHA 3HUBA 4BCNA 2GTMA 3R21A 2X7FA 2G9XA 2W9ZB 4GK2A 5BYLA 3MW1A 3ZRLA 4AP7A 4PP9A 3OFMA 2WTKC 2OICA 4JDIA 4AZTA 3C4CA 4F64A 1MRUA 4NZWB 3Q52A 3D2KA 4QPAA 4QMTA 4FT5A 3FMJA 5CQUA 4BWPA 5CXZA 4I0SA 2UW3A 5CS6A 4QRCA 4CTCA 3A7IA 3PA4A 3TDVA 3RMFA 5DT3A 1SVGA 3DAJA 2O2UA 4FSTA 4JX7A 5LMAA 2QODA 4BCMA 4UX9A 3MVLA 4FT0A 5FTOA 2BVAA 1Q41A 5HVJA 4LRKA 4QYFA 3ROYA 3V8WA 4KA3A 3FXXA 3UPXA 2IWIA 2R3FA 1IA8A 2HXQA 3LXNA 4D2VA 4EOQA 2W7XA 3LQ8A 3ORMA 4FK3A 5AR2A 2YABA 1CKPA 1YXXA 4DEBA 5CAPA 2OXXA 2XS0A 1H0WA 4C2WA 2YCSA 4XS2A 4E1ZA 4EH8A 1GIHA 4O7WA 4GL9A 4I5CA 1FMKA 2C3JA 2R3NA 2R3QA 3QX2A 3LJ2A 3LXLA 4OTDA 2BALA 3DQWA 3OOMA 4NCTA 3WF9A 4E4MA 5L2IA 1JSUA 3R7GA 2QCSA 2JGZA 3KB7A 3KCKA 4YPDA 4LOOA 5D10A 4X3FC 4GIIA 4WNOA 5DRDA 4CV8A 2GS7A 2R9SA 3HZTA 5IH4A 4KD1A 2FA2A 4WG5A 4XG7A 2X4FA 3VBQA 3R63A 3LFNA 1Q62A 4A4LA 4U40A 2VTSA 2YZAA 4FTMA 4C59A 4E7WA 5FXRA 3LCOA 3A2CA 4IB5A 2ZYBA 2OJFE 3FQEA 4NM3A 3N51A 3ZDUA 1ZYDA 4FGBA 4F9YA 3BHHA 4O0XA 4RA4A 3SQQA 4ASEA 4FKJA 2RFNA 1JSVA 3NYVA 5FP6A 4ARKA 4Z3VA 4AQKA 3DJ7A 2BRNA 1WVYA 5LXMA 3R7VA 1H08A 3KXXA 3EHAA 2B52A 2BAQA 3OXTA 3V5TA 4C36A 3RCDA 4E6CA 5LCJA 3FWQA 1H25A 4QP8A 1JQHA 3R83A 1YHSA 1OIUA 1CSNA 3CY2A 4B7TA 2QOFA 4BRXA 3DK6A 4KIKB 5A14A 5JFXA 1PYEA 4O0VA 3FXZA 3QRKA 4FIIA 4QP4A 5BX0A 1H1QA 1JNKA 1ZYCA 4AGDA 4FRFA 3UOKA 3T3VA 1PKDA 3NAXA 4E8AA 5IKWA 3LVPA 4D4RA 3WBLA 3U6IA 4FT9A 3V8SA 2UUEA 3F3TA 3HA6A 5KZIA 4J8MA 3C4WA 3E3BX 2RIOA 4UMQA 4CXAA 3DKGA 1MRVA 3WE4A 4GUBA 2VO3A 5FBOA 2WEVA 3O51A 2F49A 3Q60A 4D1XA 3ODYX 3PJCA 5HE2A 2FSMX 1XBCA 2PVYA 3C4XA 3V5LA 3Q4TA 3ZH8A 4YMJA 4YP8A 3NGAA 2FGIA 2QI8A 5TT7A 1OIYA 3BV2A 4HVGA 5KBRA 3EQIA 5EM8A 2XK9A 3F69A 2GTNA 4CLIA 4LGHA 4M67A 3W2PA 4NKSA 1TQIA 3PXYA 3I0QA 4JG6A 2AQXA 3Q5ZA 4L44A 4D2RA 3UOHA 5EW3A 3R8ZA 4DEDA 4NJ3A 2A27A 3GXLA 4OBQA 3AT2A 1QPJA 2YZLA 1I09A 1LEWA 2AC3A 3IGOA 2PYWA 1QCFA 3BGZA 4YZ9A 2IG7A 3DBEA 2JDOA 5F9EA 3LQ5A 2R3LA 1B38A 3PPJA 4AX8A 4EH4A 4WG4A 2XNNA 5IEYA 2J2IB 3VW6A 3QFVA 2WQNA 2JAVA 4WG3A 4FTCA 3SLSA 3GBZA 3LLAA 3DBDA 5A3XA 4RFZA 5GZ8A 2IJMA 4O96A 1E1XA 3GU4A 3TM0A 4OLIA 4B6LA 4DDGA 4GT5A 1Q97A 1FPUA 1Q4LA 3CEKA 2QOBA 3P7CA 3KRWA 2X2MA 5F95A 4AU8A 4JJRA 4F63A 4C3RA 4X6QC 2QOCA 1U5QA 1BUHA 3COHA 4NFNA 3Q2JA 2PVNA 3Q9YA 3ZXTA 4QQJA 5HCZA 3MJ1A 2WNTA 4J99A 5FWKK 2A1AB 3ZSIA 4QNYA 1W7HA 3KXZA 5TF9A 2WTKB 3MA6A 4FX3A 2YAAA 5ANOA 2Z8CA 5HE0A 5HX6A 2RGPA 3R71A 3PZHA 3H3CA 3F2AA 4EQCA 5ANKA 4IWPA 2XK6A 3TTJA 4FKIA 4IJPA 3WI6A 2UW4A 5H3QA 4QTAA 2X8EA 4UXLA 3KVWA 4PTEA 2HWOA 5E92A 4RIXB 2WQBA 3FXWA 3DQXA 2VGOA 2XJ2A 2ITQA 4QP9A 3O0GA 5GZAA 2OJ9A 3LOKA 3LFAA 2AYPA 2XCHA 3R8LA 3PPZA 5HBEA 3QKLA 2R3OA 3C1XA 5E1SA 2IW9A 3EQHA 4CRLA 3G5DA 2CGXA 2F9GA 3FMKA 1Y8YA 4CZUA 2XM9A 3KXGA 4GT3A 1Z5MA 5ACKA 4BDGA 3D2IA 3FMEA 2WQEA 3LLTA 3LZBA 3ZLWA 2VTAA 4CFNA 4L42A 5DH3A 4I3ZA 3DY7A 4NJDA 4O81A 3GCVA 5HIEA 3EQBA 3BU3A 5FM2A 4D2WA 4EUTA 4BTKA 3BYVA 5FXQA 2G2IA 2BAKA 3CXWA 4R1YA 2ITNA 5LWMA 4XG3A 3W2OA 4CVAA 4UWCA 1H28A 4WKQA 3EFJA 3LMIA 4RWLA 2Z7RA 4RIWA 4DHJA 1PMUA 2JKMA 3AD4A 5AR5A 5JFSA 1NA7A 2VN9A 4IWOA 3DJ6A 4DITA 4LGDA 3P5JC 3Q5IA 3ZZEA 4FZ6A 4JL9A 4Z16A 4XP2A 2OJIA 5AADA 4JT3A 3ZO2A 3FZSA 4QMLA 2VWUA 3N4TA 2W1IA 2DS1A 5C8NA 4QYGA 5ETCA 4K11A 4RIWB 5K5NA 4O7TA 4R77A 1ZARA 2VO6A 3PA3A 1W83A 4WO5A 3N9XA 3TNPC 5AR8A 4R7IA 3ZDIA 4XG4A 3QQJA 2ERZE 4U81A 4BDDA 4DEAA 2ITPA 5HLPA 2JKOA 2O0UA 2R3IA 1UU8A 4EWQA 2NRUA 1XO2B 2YJSA 3SV0A 3NDMA 4QEBA 4ZZNA 2B9JA 3EQGA 2P33A 2EVAA 3ORZA 5M57A 2IPXA 4YBJA 4IFCA 5TKDA 3RWQA 3OWLA 1YWNA 1JWHA 3RI1A 4JS8A 4BC6A 1K3AA 3RHKA 3MY5A 2H8HA 3KXMA 4XG9A 3AMBA 1PXOA 4DEEA 4CMUA 5IA1A 1L3RE 1UU9A 4HGEA 4JR7A 2A2AA 4NFMA 5K5XA 4YBKA 3LFBA 4IWDA 1S9IA 1E1VA 3R9RA 5J79A 1PXIA 2WOUA 4D1ZA 5T68A 2HK5A 1WMKA 1Q8UA 4J95A 3EYHA 3QL8A 2XARA 1PW2A 4J97A 3E5AA 3PJ1A 3UDTA 5M4IA 2C4GA 2PE2A 4EKKA 2OF4A 3RKBA 2EUFB 5AUUA 1ZLTA 4GYGA 3BIZA 4Y5HA 3ENHA 4DGOA 3CR0A 3ID6C 4AXFA 1PRYA 3QYWA 4Z55A 5M07A 1WBSA 4O4EA 3ZEWA 4P5QA 3VS0A 3EQFA 3G6GA 5AA8A 3BU5A 2VTMA 2OFUA 3QUPA 3EQRA 5HG7A 2VX1A 4C34A 4BBEA 2ACXA 5CLPA 3H0YA 4ZY5A 3UO6A 1VJYA 3EFKA 5IQDA 3CCNA 2VWZA 1B39A 2PVLA 3G51A 3RCJA 2JFMA 1REJA 4QMSA 4ENYA 2F4JA 3HGKA 5BYYA 3BHVA 3UG2A 4YTCA 3EKKA 2W5BA 4GH2A 1KE5A 3UOLA 1Y57A 5CF4A 3BX5A 4G2FA 4ALVA 2HZIA 4KSQA 4M7IA 4O38A 3VC4A 2YDIA 1B6CB 4X2NA 4EH7A 3QGYA 3S4QA 5J95A 3FE3A 5J7BA 5JGAA 3TG1A 4P2KA 4RIYB 1BI8A 4E26A 2XNOA 4QMWA 4U0IA 2YA9A 2UW8A 5HO7A 3MVJA 4PTGA 4E93A 2C6KA 3G0EA 3UZRA 3HX4A 1UNHA 4QP3A 3PJ8A 3R8UA 4MCVA 3Q32A 2EU9A 5I9ZA 4MHAA 4ZIMA 4EOSA 3SX9A 3FBVA 5KKRC 4ITHA 3IQ7A 3PJ2A 3VS4A 2B1PA 5C03A 3KGAA 4EHGA 1Y8GA 3NIEA 5IQHA 3D7TA 2BROA 5CT0A 1BL7A 4D5KA 5EW9A 4J1RA 1VYWA 3FLNC 4O27B 3UIUA 3R9HA 3Q3BA 4BCOA 4DFBA 5D7AA 2VWWA 3AC5A 3NNUA 3UTOA 2O63A 3FI3A 4O0RA 2W05A 5IQBA 4YC3A 3LQ3A 3U6JA 2OWBA 3LXPA 4Y8DA 5ANEA 3MSSA 4A9YA 5CEPA 3TJDA 3NPCA 2OJGA 4S31A 4YLLA 3LFDA 3UVRA 2V5QA 4EOJA 4F9BA 4ANOA 3DAEA 4X2GA 3UBDA 4AS0A 4F65A 5LVLA 4YO4A 1L8TA 4PF4A 3QQKA 3GCPA 3I5ZA 3GENA 3CS9A 4F78A 2P3GX 3UDSA 4EHEA 4RC4A 5CU4A 4XRJA 4EH5A 4E6AA 4MX9A 2X39A 4MD9E 4JOAA 3TZ8A 2V7OA 3GEQA 4EC9A 4BYIA 1MP8A 2J90A 5ETAA 4C4FA 1OPJA 4AE9A 3WF5A 3BLHA 4KKHA 4M69A 2WMAA 4E20A 3U9NA 4EZ3A 1SVHA 5KMNA 4O84A 5IA2A 4ANNA 5DOSA 3O8TA 3EZVA 2HY0A 3F5XA 2W4KA 3LFQA 5I0BA 5JK3A 4XLIA 4GKIA 4GVAA 3R2BA 4ZTNA 4IX3A 1Y91A 3OWJA 3G9NA 1XJDA 5E90A 3IOKA 4AGWA 4YJNA 4ONAA 4BJJA 3HEGA 2JDTA 3EN6A 5HG9A 3GQLA 4A9UA 3NCZA 4Y95A 3C5IA 5AP4A 1JPAA 3R7UA 1YOJA 2GNGA 3ZZWA 4ANLA 1GZNA 4TYGA 1YI6A 5G1XA 4WSYA 4AOTA 5DIAA 4GJ2A 5M4FA 4FZAB 1FVRA 4PMMA 1X8BA 2FSTX 4EKLA 2WTDA 2R0IA 3REPA 1U46A 4JXFA 5C8KA 2RKUA 3LCKA 5IH5A 3HMMA 5BQ0A 4HVSA 3CSVA 1SVEA 1CTPE 2I0EA 2XK8A 5CVFA 3U4UA 3WF8A 4JI9A 4ZZOA 2YLEA 5FDPA 3AT3A 3KULB 2JBOA 2WQOA 4IH8A 1W2FA 3ANRA 3BKBA 4JAIA 3DB6A 4QMOA 3TV6A 5DYJA 5C9CA 3MTFA 5KX8A 1ZXEA 3E92A 3GI3A 4RWIA 5CTPA 3WZDA 4QYYA 3ANQA 5IDPA 1Q61A 2NRYA 2W9FB 1ZWSA 4YHFA 4Y46A 4EORA 4NUSA 4FE2A 3OUNB 3C4EA 3LPBA 2BIYA 3DZQA 4NM7A 1P4OA 5FGKA 3S00A 4WUAA 2CMWA 3L9LA 3PYYA 4ZTQA 4RLKA 3TUDA 1DM2A 2WOTA 4ZLOA 5JH6A 4BHNA 1XH8A 5EI2A 2W1EA 3L9NA 3HVCA 3KN6A 5AP2A 4RC2A 4ZTHA 4ALWA 5KMJA 4DHZA 3W0QA 4CKIA 3DTCA 4O2ZA 3G0FA 5HU3A 4UWBA 4YZMA 2IW6A 4M3QA 4U41A 5AV0A 4RRVA 4F1OA 3BYMA 2CNUA 5M06A 4KABA 3HMOA 5DI1A 3SRVA 2XBAA 4HYUA 4NKAA 4C57A 5BUEA 5IDNA 3BLRA 2CHLA 3QXPA 4FV0A 2I1MA 4MEDA 3FQSA 3KRLA 5AP1A 1H07A 4BKJA 4A9RA 3L1SA 4DFNA 2WZJA 5KCVA 4QQCA 4L7FA 4LV5A 3AC2A 1NW1A 3ORTA 4RC3A 4BDEA 2IZUA 5A4CA 4PL5A 2ETRA 4HOKA 3R01A 2F7ZE 3IS5A 4FV3A 5HLNA 3FI2A 3R2YA 4AN2A 2OIQA 3AT4A 3QYZA 4I5HA 4C4JA 5CSPA 3Q6WA 2WMVA 2WKMA 3PXFA 4U45A 5EQPA 3TN8A 4NYEA 4RX5A 4MD8E 3FZPA 4NTTA 3WARA 1BKXA 3TL8A 4DH3A 3NVMB 5I5ZA 2CKEA 2HW7A 3FHIA 4DCAA 1XMMA 2PE0A 3WZJA 4AW0A 2J0LA 2VTQA 5CU0A 4L8MA 4F6WA 3RAHA 4FNXA 2VTHA 4RVMA 5AUWA 5M56A 4JQEA 4MXXA 4FT7A 3WIKA 5A6NA 2BHEA 3POZA 4AUAA 3R02A 2XVDA 5HD7A 4C62A 5AV4A 2WTWA 4ZLZA 3W0PA 2NP8A 5BVEA 3SXRA 2C6DA 4GVJA 5CVGA 5CXHA 4YTFA 2W4OA 3K5VA 5TO8A 4IB3A 3LXKA 2W5HA 3FYKX 3ORIA 4FV2A 3EKNA 5EOLA 5KNJA 2PVKA 4I1ZA 4TT7A 2BKZA 2C5NA 5BUIA 4O7SA 2PU8A 3R04A 3NCGA 3PSBA 4TY1A 4LOPA 4AAYA 3ALNA 3ZC5A 4H36A 1XWSA 3KRRA 4WA9A 3W0RA 5IF1A 4RT7A 2CGWA 3CKWA 4FK6A 2WB8A 4RSSA 3VJOA 4CT1A 4ERWA 4FV1A 4EH2A 2EXEA 3OC1A 4FV4A 4L3PA 1ZAOA 4FV6A 4G5JA 4ALUA 5J1WA 2PHKA 4FA2A 3A7FA 4E5AX 1PF8A 4D4SA 3BE9A 3PUPA 1SZMA 3R28A 1A48A 2PUIA 4JDKA 4XV3A 2YDJA 3E8NA 4HNFA 3R8PA 4RWJA 3QTRA 4YNEA 5L6OA 5L8JA 4FOCA 3QHWA 1WBOA 4TYHA 4A07A 3PXZA 3NNVA 3NUSA 3FLQA 4HPTE 2PVJA 3IDPA 5K3YA 3QTQA 5IQEA 3UYSA 1QPEA 3WF6A 3VN9A 4BDBA 5CU2A 3TNWA 3SHEA 5M44A 4G16A 4EJ7A 2ITOA 4X2KA 2JITA 4B9DA 5CF5A 4XG2A 3KF4A 4FJVA 2O64A 2V22A 2BR1A 4IX6A 4LUEA 4DTBA 1OB3A 3HL7A 5KHWA 3E88A 4IC7A 3C4FA 1ZOHA 4LOQA 5E8SA 3HKOA 4MBLA 3T9TA 3HMIA 3FEGA 4IAKA 4RIXA 4HW7A 2UZLA 4CQGA 3E7OA 3OTVA 4D2TA 4IVCA 2YWVA 2ZVAA 4IEBA 4G1WA 3SW7A 1GY3A 3EJ1A 2GHGA 3ZBFA 2CLXA 4UBAA 4EOMA 4R6VA 2X9EA 4DYMA