2W5AA

Human nek2 kinase adp-bound
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
267
Chain Sequence
b'SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSLHRDLKPANVFLDGKQNVKLGDFGLARILTSFAKTFVGTPYYMSPEQMNRMYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 267
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5aA01
1OKVA 5D10A 4BDGA 3FE3A 4UMUA 4QYFA 1XBAA 4CG8A 3JVSA 3E8DA 4ALWA 1EH4A 5KE0A 3TKUA 4P90A 2BROA 2W4KA 2R3JA 3UNJA 1M14A 4PL5A 3ORLA 3W2RA 1DM2A 4TKSA 3DFCB 2DS1A 4G3FA 5BUIA 2XKDA 3ZZWA 2PUPA 4FEVA 2B53A 1B6CB 3RHXA 2R7IA 2KULA 3MJ1A 1JKTA 3D0EA 4LL5A 4FZFB 3ZO2A 3NVKI 4GJ2A 3PRIA 3C4CA 4IDTA 3SC1A 1ZOEA 2GQGA 2W17A 3RPOA 2JAVA 3PA4A 3R01A 4YJTA 3UOLA 2NRUA 2OJFE 4EYJA 3MTLA 4FV4A 3DLZA 5IQHA 3KULA 4FV1A 3QCQA 2B54A 3CKXA 3QD2B 3ENHA 2WMTA 2VV9A 2O65A 3SXRA 2PMNX 3O8PA 5J9YA 5JQ8A 2WTJA 4O0SA 2OG8A 4R7BA 4RQKA 2IZRA 3ZH8A 5AP3A 4U40A 4O81A 2GDOA 3R7IA 5CSVA 5HVYA 1QPJA 5FDPA 3R9HA 2GPHA 4RC2A 5M57A 1XR1A 4FT3A 3BI6A 2XK8A 3VS1A 4CV8A 4FSZA 3HV7A 2BVAA 4DEDA 2PE2A 4U3YA 4IM3A 2AUHA 3FSFA 4IAKA 1LEWA 4M15A 5KKRC 2UW4A 4BKYA 4EUUA 3U54A 3OFMA 1IG1A 3PLSA 4IEBA 4MD9E 3TZ8A 3EQRA 3EL7A 1JPAA 3RTPA 4FL3A 2ZV9A 4IADA 3KMWA 4UWBA 4JIAA 4MXYA 3TNQB 4F7SA 4RC4A 3RAHA 5IQDA 1APME 2VX0A 3QWKA 2R3FA 3QTWA 2WIPA 3TM0A 3P08A 3MVHA 2RSVA 4B4LA 1YHWA 5ANJA 1F0QA 5CNNA 2XBAA 4YJSA 1VJYA 4FBXA 3V5TA 3QC4A 3KMUA 1RQQA 4RC3A 3ANQA 1VZOA 3P0MA 3IONA 4OTWA 4U44A 4YSMA 4FZAB 2XM9A 4QYYA 2R3MA 2V7AA 3MY1A 4FTTA 3R8ZA 3UIBA 4EOQA 1DI8A 5E7RA 5LWNA 3NAXA 4HGSA 1H28A 4FK6A 4OTRA 2O63A 3ORIA 4XV1A 4YJQA 3S1HA 2PHKA 4YO4A 2XBJA 3O71A 4X3JA 3GFWA 1LUFA 3LQ5A 3OUNB 3KA0A 3AC1A 4G6NA 3TJCA 3VIDA 4PDYA 3DAKA 3VRZA 3FPMA 4XV2A 5IDNA 3EOCA 1JQHA 3OCGA 3A2CA 4PMTA 3TXOA 4QTEA 4U80A 2IZSA 2I0YA 5M06A 2X2KA 1A9UA 4H3BA 3FQSA 4J95A 1KUTA 5LVOA 3HRCA 4F70A 2JEDA 3LLAA 2ZVAA 5DVRA 5E8VA 1KE8A 1ZMWA 4A9UA 4F65A 5JN2A 3CP9A 2WTWA 3BLQA 3QWJA 3EL8A 4NFMA 5AR4A 3ORPA 3BHYA 4FTOA 5AUWA 2IWIA 2XEZA 3D5VA 3UOKA 2AC3A 1FOTA 1E1VA 4I6QA 4QYGA 4FA2A 4BI2A 4BDCA 3F9NA 1Q62A 2C4GA 3OP5A 4YJUA 5TR6A 3DXQA 4YC8A 4ONAA 3KCKA 3RPYA 3ZUVA 2B4SB 5CF4A 3PG3A 5H2UA 2WMSA 5HG7A 3SQQA 3TZ9A 4YHJA 1OKWA 4LRJA 3DT1A 4D58A 2P3GX 4BBFA 2H34A 2XYUA 3ZO3A 4D2RA 4DH5A 1URCA 1YXVA 3CS9A 4RRVA 4JQEA 4C4IA 3ACKA 4QPMA 1FGKA 2W1DA 3HGKA 4O84A 2RG5A 4O0YA 3TJDA 5HG5A 2WOTA 3HMOA 1ZYJA 3E8CA 3VUMA 4AOTA 2OI4X 4QP7A 3OBJA 3ORMA 5GJGA 4B8MA 2E9PA 5B2LA 2VWXA 1ZMVA 5HBHA 3WARA 4WNPA 4RIYB 1YOJA 5I3OA 4H3PA 2C6DA 4ZTNA 5HU3A 5LOHA 5M4CA 2IG7A 3PIZA 1WAKA 5AR8A 1ERKA 5CEPA 3NRMA 1Q3DA 3HUCA 4RPVA 3V8WA 2YA9A 1H24A 2PZ5A 2VAGA 3A60A 3RPSA 3QQKA 4RJ6A 4CCBA 4QQJA 3MESA 4UZDA 4NU1A 4C62A 2ZOQA 1WVXA 5H8EA 5JZNA 1V0PA 2EVAA 2XCHA 3H30A 4QNYA 4E26A 5A54A 1OPLA 2OZAA 3R7YA 5CXZA 4XBUA 1OIQA 1MUOA 2PSQA 3OXTA 5ITAA 2OLCA 4RFZA 4R5SA 4ANOA 4AF3A 2R9SA 5FP6A 3ZCLA 3OXZA 5CT7A 1GJOA 2VU3A 1YWNA 3DKFA 4Q5EA 2HXLA 3TL8A 1YQJA 5E8UA 5F9EA 3RGFA 1U54B 2Y7JA 4JG8A 4I93A 5HE1A 5BYZA 3TNPC 4DH8A 1WBNA 2HZ4A 3DA6A 3FZOA 1UU3A 1Q97A 3COHA 1Z57A 3QX2A 2ZM1A 5BUEA 2BFXA 3CY3A 3FKOA 3MSSA 2XIKA 5FWKK 4F99A 4NIFA 2JKQA 3G15A 3HECA 4WNOA 2FO0A 4ZZNA 2WXVA 2X9EA 4M13A 4DEIA 4GK4A 4YSJA 4AE6A 4FKTA 4YU2A 1H1SA 4PMSA 3OCTA 2WEIA 3FHIA 4JDIA 4FSMA 5A4QA 2C3JA 4AU8A 3DV3A 1ZY4A 4MVFA 4CLIA 2W05A 5BVEA 4DFXE 3QGYA 3EQFA 2W9FB 3KFAA 3GU8A 4ZSJA 4BCIA 3Q60A 2XK9A 3QRUA 4DH3A 3IW6A 4QOXA 2ERZE 5HIDA 5K5XA 3NUSA 4FIIA 2QOCA 4TPTA 3BWJA 4K8AA 3KEXA 3I5ZA 5CEQA 4CKJA 5KZIA 4O7LA 4YO6A 3SGCA 3FZ1A 1GIJA 3IECA 3HYHA 4EK4A 1OUYA 1XBCA 3EFKA 2C5YA 4H1MA 5E8YA 2CKPA 5HG8A 4OT6A 4USDA 4UX9A 3QALE 3LCDA 4L9IA 5KKRB 4PDSA 1JSUA 3P1AA 4HYUA 5G1XA 4D4SA 5AEPA 3D4QA 4I1ZA 2YCRA 3BCEA 3FZSA 3NYNA 3V5JA 5ETIA 2F7ZE 5BVFA 5BYLA 3GNIB 5AWMA 5KMKA 1Y6BA 2VTTA 2QHMA 3THBA 2ITOA 2VRXA 1P4OA 3NGAA 3MH1A 3QL8A 4BCHA 4I6BA 4PMMA 3R8PA 4MEDA 4FV3A 3TDWA 4PTGA 4FTJA 4NKSA 5AP4A 4FE2A 4ACHA 3TUCA 5GZ8A 3BELA 3KRJA 1Q8YA 4BCMA 1O6LA 4A4LA 1IA9A 2WQEA 1H25A 3F2AA 4AT4A 4A07A 4I6FA 4JBVA 4L68A 4BGQA 4EBWA 3C9WA 2GNHA 3B2TA 4M69A 1I09A 3PYYA 1VYWA 5CVFA 3OTUA 4QMZA 3HDMA 3O2MA 2OF4A 2Z7QA 5AAFA 1JAMA 3GXLA 4BDFA 3GQLA 4L52A 5IKWA 4PDOA 2B52A 3UYTA 4G6LA 1GZKA 2HZNA 3MA3A 1YW2A 3KKVA 4C02A 4CYIA 2ITUA 4FI1A 3ORZA 4GH2A 1T45A 4DG3E 3LXNA 4U42A 4ZS0A 5DMZA 2YZAA 2PVMA 2I1MA 3IS5A 2BCJA 4J1RA 4CFWA 3CBLA 2GNJA 2QOKA 3WIGA 3SW7A 3I0OA 3VS4A 4BCFA 4FTNA 2ZB0A 4ALUA 4JRNA 4J99A 5IA3A 5AV0A 4L42A 4AFEA 3WZUA 3UC3A 3LFBA 1YI3A 3VULA 4C4GA 3MPMA 4J52A 2B0QA 4FR4A 4Q2AA 4HW7A 4JG7A 3PA5A 2CGXA 2IW8A 4NW6A 3OWKA 3UO6A 3ZHPC 5EQYA 4EH8A 3ZLSA 5EM7A 1KWPA 1QPEA 1YXTA 3G6GA 1AQ1A 5CNOA 3CQEA 1F3MC 4YNOA 4BTFA 4C34A 3LXPA 4QQTA 5AV3A 3QUDA 3CY2A 3Q4TA 5FM3A 3OOGA 4F4PA 5L4QA 2BAQA 1KSWA 2QKRA 4XH6A 4DTBA 4TT7A 2FSLX 3KC3A 3ZMMA 3KREA 3FL4A 3KY2A 5LMKC 2OXDA 5E1SA 3K5UA 3KF4A 1H0WA 4QP3A 3ZFXA 3LJ1A 3GCUA 4FVQA 4D1ZA 4D5KA 2EB3A 2JKOA 5DGZA 3UTOA 3O50A 3VC4A 3PVUA 2WAJA 3C51A 4JBOA 2F2UA 4G16A 1UV5A 4L3PA 5ETAA 5BVKA 1BL6A 3FLZA 3DQXA 1OKZA 3I79A 4HCVA 5CWZA 5A14A 3QAME 4L8MA 3A4PA 5AFVA 1FVVA 3ZO4A 3ATSA 3II5A 3FMJA 3UO5A 5AV1A 2GHGA 3GC8A 3C13A 4ITIA 4AAAA 5B2MA 3VS5A 3LHJA 4KBKA 4ZY5A 4Q9SA 3GOPA 4UYAA 4G9RA 1ZWSA 4ZJVA 4IACA 5AUTA 2O2UA 4A7CA 4BIDA 4JL9A 3A7IA 1Y8YA 4F09A 4HZSA 3ZM9A 3O7LB 2OH0E 3RPVA 4D1XA 3NW6A 4IAAA 1Q24A 1VEBA 4C8BA 2WMXA 2C69A 3BKBA 3R63A 4K0YA 5HOAA 5K4IA 4X3FB 4MBLA 1OGUA 3M2WA 4MXAA 2YIWA 4IANA 2HZIA 1ZOHA 2PVKA 5A4EA 3VUTA 4II5A 4CRSA 2GHMA 5ANKA 3U6IA 3M42A 3JR1A 4JQ8A 3NZ0A 5J95A 3UJGA 5J7HA 4PV0A 4KINA 5CVHA 5J79A 4I23A 3H10A 2J0IA 4FSTA 3R8UA 3QX4A 4D2SA 1FMOE 1Z9XA 3W2OA 4U45A 4QMLA 1H1RA 3UZRA 5ANEA 4DF3A 4UB7A 3H4JA 3P4KA 2B9JA 4ANBA 4I5HA 5EI2A 3AT2A 2B9HA 3RHKA 4CCUA 2H9VA 3V6RA 4L43A 1UKIA 4E5WA 3GC7A 5HIEA 4LGHA 4I5PA 4MXOA 4AA4A 1STCE 1XJDA 4IB5A 4RVMA 2R3OA 3O23A 4FTKA 4LUDA 2NNWB 2BTRA 4E4LA 4FTMA 4C2VA 2V22A 3W1FA 3QTSA 3FMMA 3GC9A 3MA6A 4DFNA 4GS6A 5I9XA 3DAJA 2WTCA 2PPQA 4MBJA 5A9UA 2YITA 3VVHA 5HX6A 4BZNA 3REPA 4D2VA 4DGLC 4AWIA 4JR7A 2GS7A 1YHSA 5AM6A 3MJ2A 4NTTA 3QKKA 4XRLA 3RP9A 1S9IA 4F0GA 3ZRLA 4QQ5A 3SOAA 2YM7A 4RIWA 4F9BA 3ETAA 1GY3A 4DE4A 4WRSA 3VUGA 5L3AA 1FVRA 5TOZA 5JFWA 4GUBA 2YEXA 3G9LX 3ROCA 4FNYA 3FC2A 3UODA 3UVPA 4XLIA 1BLXA 1CSNA 1Q5KA 3UE4A 3WF8A 4V01A 1Y91A 2ZB1A 4TXCA 3EN6A 4R7IA 4GL9A 3W10A 2H96A 4X2FA 4ERKA 3E62A 1BKXA 4EEVA 3E87A 3TNIA 1Z5MA 2YJSA 5BX0A 3HLLA 2JC6A 2ZV7A 1JKSA 5CVGA 5BVOA 1UKHA 4XX9A 4Y72A 4FZDB 2X7GA 2YABA 4YTIA 2Y6OA 4QYEA 3IGOA 3IOKA 1UWHA 2BIKB 2YCQA 3FQHA 4GVJA 4QMSA 3P78A 3OS3A 3P79A 4GT3A 4E6AA 2VTLA 4O7NA 3LCSA 4I92A 5J87A 4RIXB 3UQGA 3LMGA 3OC1A 4MD7E 2PVJA 3ZM4A 5GINE 4EZ7A 5KMOA 4V05A 5HX8A 5KO1A 2UV2A 4IZ5A 2NRYA 2VTHA 1ZY5A 2QU5A 5HHWA 4MCVA 4F0IA 4CKIA 3R73A 4TYIA 4R3RA 3VBYA 3WZKA 3L8SA 4IB0A 5HZNA 4D1SA 1U4DA 4LRKA 3QCXA 2ITPA 4MNEA 4JDKA 5AIKA 5AUZA 3BYMA 2DUVA 4D2PA 3DK3A 4UY9A 2XNPA 2O8YA 4GU6A 4OLIA 3BX5A 4ITJA 3RK7A 3U4UA 3F3WA 2BZIB 2PMIA 5LMKA 2WTKB 4F6SA 3HP2A 2JFMA 1O6YA 4AE9A 1B39A 2C1AA 2R3GA 4J96A 3IW7A 3NNVA 4MXZA 4F6UA 3SOCA 2FVDA 2J9MA 3SKCA 5HU9A 5IH6A 3BQRA 3NDMA 5AP0A 5EDQA 1E1XA 2VO6A 2CNVA 3C50A 2XKCA 3R8VA 3VBTA 2BTSA 3VAPA 4WOVA 3ULZA 2VWYA 5DPVA 3HMIA 4FKGA 1RE8A 3DBFA 4QMVA 5FEQA 2Z8CA 3GVUA 5E8TA 1Q99A 4IM2A 4JR3A 4IX5A 4G3EA 1URWA 5DT4A 5A4CA 1Q8TA 1U59A 2HW7A 3CC6A 4P4CA 1WZYA 4EONA 3PVWA 3MI9A 4NSTA 1OZ1A 4YHFA 4O7SA 4Y85A 3D7TB 4CZYB 2GFSA 1JBPE 1OVEA 4RX7A 1PXMA 3RAKA 3BWFA 4EWQA 4PPBA 4XG3A 2C68A 4R1YA 4RLLA 5H9BA 2W1ZA 5IQEA 4BBMA 4ZY4A 3IQ7A 3EQGA 2VTJA 5FTQA 2PMLX 3TNWA 3DDQA 4G5JA 2VX3A 5GNKA 1A48A 4G6OA 4C4FA 4AA5A 3KN5A 1B38A 3PVBA 1ZLTA 3GCSA 4RWKA 4DFLA 2J7TA 3D2KA 3R0TA 4O6EA 2J0KA 4I6HA 4X2JA 3D7ZA 3NLBA 3ENMA 3P7AA 3KVWA 3KMMA 1QL6A 3PSCA 1JSTA 2I0EA 3FZPA 2JITA 2XYNA 2W1CA 4GYIA 2WO6A 4WT6A 3Q4CA 4P2KA 4Y46A 3ZLYA 3UO4A 1KE5A 4KD1A 4XG7A 3JVRA 3ZEWA 3LFQA 3B8QA 2PVLA 4O0WA 3BRBA 1AGWA 2P0CA 4IZAA 3SRVA 4ANQA 4O86A 2VNWA 2CKQA 4FTRA 5BNJA 3UPZA 1OPJA 3OD6X 3RM6A 3QGWA 5H8BA 4BWPA 1ZYDA 4EQCA 3HMNA 5AUYA 3HMMA 4XCUA 4R3CA 4KWPA 3EJ1A 2J51A 4R8QA 3R1YA 3SXFA 4RGJA 3Q6WA 2C3KA 3HP5A 3CGOA 2J2IB 5CAUA 2CHLA 2W1IA 3MVLA 3Q6UA 4BCPA 4EH6A 1MQBA 3POOA 4KIPA 4OTIA 4BDHA 4W8EA 4RVTA 3OMVA 3PPZA 4CFNA 4CVAA 4O7YA 4QMMA 3TV6A 4FG7A 4RVKA 3UG1A 3ZONA 2OU7A 4ZTSA 3Q96A 4YBKA 4YJVA 4NEUA 4F7LA 4ZK5A 3DJ5A 2IW9A 3LM0A 2OJJA 3W2CA 3DK7A 4C3PA 4FKUA 5HO6A 4D28A 3VS6A 1U5RA 4BGHA 2Z60A 4HYHA 2G9XA 3AGMA 1BL7A 3W2QA 3NSZA 1CMKE 3I4BA 3RNIA 4I0TA 3FKLA 3OTVA 2NPQA 4GUEA 3KVXA 4W9XA 3OG7A 3QZGA 5I0BA 3QYZA 4KKGA 1PW2A 3WE8A 3PJ1A 4HVHA 4OW8A 3RZBA 3ZBXA 5I3RA 4BGGA 1PXPA 2XIZA 4PP9A 4XV3A 2XZSA 4BYIA 3PIXA 4USFA 5JFXA 4NM5A 2HXQA 1OIUA 5JH6A 4GEOA 4BIEA 1QMZA 3AC3A 3BE9A 3QQHA 3EWHA 5CAVA 5HLWA 3R28A 2YIQA 4U9AA 3O7LD 3F3VA 3OY1A 2ACXA 4M67A 1LR4A 2XK6A 4AACA 4D9TA 4JS8A 5DEYA 2ZAZA 3MGYA 1NY3A 2X4ZA 5CASA 3QRIA 1WFCA 2BAKA 4GYGA 4YZDA 3RZFA 4M97A 4O6LA 3R02A 3BGZA 4L53A 2LGCA 4F9CA 4FOBA 3WI6A 5IA4A 4O38A 1OL7A 1NW1A 5HESA 3JS2A 4ITHA 2CSNA 3NR9A 3UBDA 3DDPA 2YCSA 2JDTA 5C01A 2C47A 4OBOA 2CJMA 4P5QA 3F6XA 3EHAA 3R1NA 3PUPA 4XG4A 5FP5A 4AOJA 5L2TA 3AG9A 2ETRA 5A6OA 2PE1A 4EOMA 3UIUA 4FT5A 4UYNA 3HDNA 3E7VA 4RIOA 4IB3A 3HA8A 4XG6A 4TYGA 3V8TA 3R7UA 4EOIA 4FGRA 1GZOA 5FTGA 3DB8A 5EK7A 3MDYA 5AP5A 5AX9A 4RA5A 3GFEA 2BR1A 2YCFA 4X21A 4FV8A 1UU7A 3NNXA 3AMAA 4FSUA 4ZOGA 3DXNA 4F08A 1OL5A 2QOLA 3Q2JA 3F61A 3AD6A 2QONA 1R0PA 3GU6A 3VO3A 4FNWA 3KF7A 3R1QA 2WMBA 3QXPA 4RVLA 3M11A 3ODZX 3BPRA 2GNFA 5HCXA 4QMYA 3QQGA 3EYHA 4XHKB 5DFPA 2VN9A 3KULB 5C1QB 2E9NA 5JEBA 3F7WA 2QNJA 3CIKA 5J9ZA 4C33A 3UVRA 4S33A 1RW8A 3IOPA 4W4WA 3TIYA 2B9FA 3CD3A 5FDXA 3WF9A 3OBGA 1WVYA 4TNDA 5A3XA 2QG7A 1YI4A 2VO0A 5EM8A 4QTBA 2YFXA 1H26A 3UIXA 4CMTA 1M2PA 2FSTX 4U0IA 3OT3A 3FZTA 3WIKA 3GC0A 1HOWA 4H3QA 3MPAA 3QUEA 1XBBA 1IRKA 1SVHA 4QTDA 5DH3A 4F1MA 5M55A 3O96A 3QA8A 1JKLA 3I1AA 3BHHA 2J0LA 1U46A 2GMXA 5AADA 1UNHA 2CMWA 1OB3A 3FI4A 4ALVA 3LQ8A 2IZUA 4IVDA 1L3RE 1NA7A 2PWLA 3HV4A 3IW4A 3E88A 4BR3A 3KGAA 4W4YA 3L9NA 3OUKA 5EM5A 4HGTA 5FD2A 3ZDUA 4A9RA 5HLNA 3HVCA 4M3QA 4JVGA 4E6DA 3F5GA 3EB0A 5C27A 2WEVA 4GFGA 5KMJA 3HAMA 4TN6A 5M07A 3C0HA 3FMKA 2WQNA 3QTUA 5EDRA 4U43A 2V55A 2W5HA 2IO6A 4GT5A 2XNEA 4E6CA 3FBVA 4BVUA 3FY0A 4I4EA 4BC6A 2J0MB 3E63A 4TWNA 1JSVA 3P9JA 4G17A 1Q4LA 4G2FA 2WMUA 4JT3A 4CTCA 2XIXA 2YJRA 4GG7A 1XQZA 3EMGA 3GP0A 4EH7A 3TUBA 2QODA 4WG5A 4FZ6A 5ANIA 2YIYA 5FRIA 2HY0A 4AN9A 3FJQE 4LOPA 4FF8A 4PNKA 4XOYA 4XUFA 2W4JA 3PRFA 3PJ2A 2ERKA 2IZTA 5E4HA 3V6SA 5KBQA 4ZLZA 4GFOA 3O17A 3MIYA 4OTFA 3T9TA 3VJOA 1TQIA 2IW6A 2XB7A 4BDIA 4C36A 3NNWA 5IMEA 5JGBA 3V01A 4E20A 2IVUA 4FNXA 4V0GA 2Y6MA 3AMYA 3PPJA 4PPCA 2FYSA 4IC8A 3MW1A 2XCKA 4ANSA 5M08A 1SNUA 3POZA 1OIYA 4LQMA 2XRUA 2VWWA 4EOKA 3W16A 1M7NA 3EQHA 3G6HA 3PE2A 3EZVA 3PVGA 1ZMUA 4ANNA 4ACGA 3VS7A 2W4OA 2IVVA 1YXUA 3NW7A 3LPBA 2W9ZB 2OK1A 3R2YA 5L6WL 5EQEA 2WELA 3TACA 3AQVA 1FGIA 4GIIA 2OZOA 3F7ZA 3ALOA 3COIA 2E9VA 4YZNA 3B2WA 2A4LA 2R4BA 1YDTE 1PRYA 3PY0A 1Q8UA 4O0RA 5T68A 3IKAA 3EN7A 4NYEA 2Y0AA 3PTGA 3UIMA 3E3PA 1ZOGA 4FEUA 1TKIA 3WZEA 3NUAA 4IWPA 4FTCA 3CR0A 4LYNA 2GQSA 1LEZA 3PZEA 2P4IA 3R22A 4K33A 4X0MA 1KOBA 2CGUA 4ZSLA 4AW1A 1CKJA 3SVVA 1GOLA 1AD5A 4WNMA 4PWNA 2WTIA 5BMSA 1W0XC 2JFLA 4BHNA 5KMIA 2I0VA 4M8TA 3LKMA 2OZAB 4E1ZA 2BHEA 4ZY6A 4IFGA 4QP6A 2BHHA 5EM6A 4MXCA 5J8IA 4GKIA 1YWRA 4IX6A 2B9IA 3IDPA 5L2WA 4YNEA 4QMTA 2YZLA 2HWPA 4D4YA 5E8ZA 5D7VA 5ETCA 4O82A 3CXWA 4KIKA 3RALA 4APCA 2CNUA 4WNKA 3NIZA 1GNGA 3S0OA 2JLDA 4BN1A 4DGOA 3OCBA 4WG3A 4IBMA 3BLHA 3BYSA 4XP3A 3CSVA 5M56A 5E9EA 3I6WA 5HEZA 5IMXA 4AQCA 4CZUA 1OL1A 4JJRA 4NIFB 2QURA 1IASA 3AC4A 3IDBA 1H00A 2PUUA 5DR2A 4FT0A 3QZFA 4UV0A 5GJDA 3WBLA 1NT2A 4ZAUA 3NYXA 2UW3A 4ASEA 4EHZA 3CTQA 3N4TA 4RX8A 3QZIA 5DT3A 4F0FA 4LM5A 3OF0A 5GIPE 1YHVA 3VW6A 4AN3A 1ZYCA 3G0FA 5AV4A 5K4JA 3ZC5A 3PXRA 2VNYA 2ZM4A 1UVRA 3U8WA 4G3CA 3N4UA 5CSHA 3F3ZA 4M0ZA 1X8BA 3VHEA 3DB6A 3HNGA 3OEFX 2DQ7X 2R3HA 3FLWA 4O96A 4Y73A 4EK3A 4YR8A 2PMOX 3ZOSA 4EORA 5KBRA 5IQGA 5JFSA 3CTHA 1H8FA 2WKMA 3ZXTA 5EW8A 5J1WA 3CPCA 3GB2A 4E5AX 3SA0A 4JAJA 3DXPA 3BQCA 2UZNA 4B8LA 3IW5A 5EW9A 3QUPA 4O7VA 4BI0A 1PXIA 3FDNA 3GU7A 3LW0A 2VTNA 4O0TA 1MP8A 1JNKA 3RAWA 4XS2A 1ND4A 4DFUA 1MRYA 4ZXTA 1FINA 4ENYA 1R0EA 4H39A 5DRDA 3R7GA 3QXOA 2BAJA 3QTZA 2QI8A 2J5FA 3LFSA 3ALNA 1T46A 2QU6A 4LGDA 3V3VA 3MS9A 3G51A 3KCFA 4K77A 4G9CA 4AGUA 1YXXA 2C6MA 4FV2A 4W4VA 4O2PA 3ZZEA 3C5IA 4TWPA 3PFQA 5TO8A 1MQ4A 3MPTA 4M69B 1PXLA 3ORXA 5KMNA 5M4FA 3ZSIA 4RLKA 4DA5A 2YM5A 3BE2A 5LARA 3TNHA 2B55A 4IVAA 2OIBA 3T3UA 5AX3A 4L3JA 5B0XA 3C5UA 2QO2A 3TIZA 5H3QA 4C4JA 5EQPA 4OAVB 4CG9A 3H3CA 4JIKA 2YDKA 3IO7A 4EHVA 2ESMA 4DFYA 3PLAE 2CKEA 4FIJA 4XG2A 4N6YA 5DA3A 3TKIA 5E1EA 4U8ZA 4A06A 5IUGA 3SXSA 2OICA 3FLNC 2NO3A 4EWHA 4NJ3A 1PXOA 4XG9A 2RKUA 5HTBA 4PPAA 3PIYA 4FUYA 4BRXA 2EXCX 5I9VA 2EU9A 4JDJA 5DOSA 3MB7A 3NYOA 4JDHA 4L7FA 3S00A 3L9LA 4D4RA 3QQJA 1YRPA 2ZDUA 4RZWA 4DYMA 4S34A 2VWZA 2XM8A 4FEXA 4NWMA 3VNTA 2J90A 5LMAA 4O27B 5E8XA 3JYAA 5CT0A 5CF8A 1YXSA 3O0GA 5A4LA 2HOGA 3O8UA 3NX8A 4FKWA 3R7OA 2ZDTA 3C0GA 3DKGA 2CLXA 3PE1A 4IFCA 2EUFB 3AC2A 3LXLA 1NVQA 4MWHA 2ZM3A 4FTLA 3MFSA 2Y4IC 2J0JA 4TTHB 4YC3A 5BVNA 2BDJA 3SLSA 4YHTA 4ZJJA 4YP8A 4RWJA 3QFVA 2C6TA 2R64A 3PY3A 2R3QA 4KSPA 3ZBFA 3ZLXA 5HORA 3M1SA 3R2BA 4K2RA 1NXKA 3HRBA 4N6ZA 4L45A 4R6VA 3ZEPA 4IMYA 3EFJA 5EKNA 3NS9A 3OXIA 3KXMA 3ZU7A 4EOSA 5I9ZA 4M7IA 3ZYAA 3OROA 4IVCA 1J7LA 1Q3WA 1H0VA 4ZTRA 2A1AB 3F2NA 5CAQA 3OT8A 5EW3A 2C1BA 4BFMA 4YZMA 2FA2A 3FQEA 4EBVA 4EJNA 4QP2A 4IH8A 2CNQA 3D83A 2Z7SA 4H58A 5KX8A 1V0BA 3GOKA 5DWRA 4FG8A 2W7XA 5M44A 2WMVA 3Q9ZA 4F6WA 4O22A 2Q0NA 4UMPA 5AJQA 3SV0A 5J1VA 2RF9A 4C35A 3V51A 2KTYA 4BKZA 4IE9A 2R3IA 3PY1A 4I20A 3OWLA 2J5EA 4U81A 5JRQA 3QKMA 3PJCA 4XLVA 4APPA 3ZLWA 1WBOA 3Q4UA 2JBOA 3FHRA 4YTFA 2G2FA 3U6HA 3AOXA 4FVPA 4UN0C 3C1XA 4L6QA 2ITZA 4ZEGA 3AC8A 3WILA 5FUTA 1O6KA 4RFMA 3FLSA 4IW0A 5HD4A 3ERKA 1JLUE 2UVZA 4E4NA 4U6RA 2X1NA 3EH9A 3NUNA 4H36A 5AR2A 3VBXA 2JKMA 2QLQA 1G3NA 2HCKA 2QO9A 3D5WA 3LCOA 1YDSE 4JX3A 4LMNA 4TNBA 1PXKA 2CN8A 2QO7A 5DE2A 5EHOA 5LXMA 3R30A 2IVSA 4CGAA 2ITXA 3C7QA 1E9HA 3LOKA 5F95A 1M2QA 3C4WA 1M7QA 4DH7A 3AD5A 1OMWA 4UMRA 4AN2A 5D7AA 3WZDA 4FV9A 5HCZA 3R9DA 2GSFA 3UDBA 4C58A 5AR5A 4DN5A 2XP2A 1OITA 4LI5A 3VN9A 4M66A 3OWJA 3QQUA 4O91A 4X6QC 3RPRA 1NVRA 4FOCA 2HENA 3TWJA 4XP2A 1P2AA 1Q41A 4ASDA 1UWJA 3BHTA 4JBPA 5IU2A 5DR9A 2Y8OA 1V1KA 1ZYLA 3NUXA 4ERWA 3TUDA 3Q5IA 5BVWA 4LFIA 4DEEA 5L8KA 5DR6A 5HE3A 1J7IA 5IA2A 2HZ0A 1IA8A 1PYXA 3QHWA 4RQVA 1CDKA 2OWBA 3DKCA 5IQBA 3QCSA 3LCKA 4OTQA 5DYJA 4YLLA 5I9UA 4JBQA 3KXNA 4E3CA 3U6JA 2YHVA 3LE6A 2WU7A 2X8DA 3F82A 3LFDA 3Q2MA 2I7QA 5DBXA 2DYLA 4RIWB 4YTHA 4BDEA 3QHRA 5EYDA 2PVNA 4MX9A 5L2QA 1J1BA 3H9OA 4WD5A 3ZDIA 4M68A 2QD9A 4QMXA 4MXXA 2UW5A 5CSXA 1PF8A 3V5WA 4KBCA 3MFRA 4I24A 4KRDA 4U97A 5IA0A 3CQWA 4UMQA 2WTVA 5DLSA 4IZYA 4DEGA 2R5TA 4FC0A 2WMQA 4IAIA 2QLUA 2REIA 3OW4A 3P86A 4IAFA 3SD0A 4XV9A 3DU8A 5HGIA 2JAMA 5DIAA 4R1VA 2VO3A 3A7FA 5CAPA 2EXMA 2XK7A 3LFNA 3CEKA 4XNEA 4CYJA 3D14A 3ZC6A 2WNTA 2XNBA 3EQDA 4GK2A 4IDVA 2A0CX 1WBVA 2O5KA 3LM5A 3IK3A 2WMRA 4XG8A 4AZFA 4OTDA 2OXXA 3FAAA 2QVSE 2XRWA 4HVSA 3FYKX 4C57A 1OL2A 3ZSHA 4RX9A 4ASZA 4FV7A 2JIUA 3D5XA 2J6MA 4FUXA 2RFEA 5HTIA 2X0GA 5ETFA 2W5BA 3CGFA 4RG0A 3R83A 2OJIA 5KNJA 4ZZOA 5KUPA 1F5QA 3KXZA 3Q52A 2PY3A 4RSSA 4IJPA 4FL1A 4QYHA 5DRBA 4EUTA 4MYGA 4I3ZA 3N9XA 2OIQA 4MNEB 5EHLA 2F9GA 3UNKA 1HCLA 4QMUA 5CZIA 1H08A 3R9RA 2BALA 4ARKA 1K2PA 3L1SA 3QD0A 4AZEA 4S30A 2XK3A 5BVDA 4AW2A 2Z02A 3CE3A 4FK3A 4TZRA 3W2SA 4WBBB 3V8SA 4ASXA 5EI8A 1UNLA 5TF9A 4Y5QA 3D2IA 4LOQA 4HZRA 5CZHA 4DINA 2BRMA 2BRHA 3Q04A 5A4TA 3PXQA 2UZDA 4UALA 3QRJA 3ZSGA 4GIHA 4F64A 1GAGA 5T3QA 4QP4A 4U41A 3VUIA 4TYHA 5A6NA 2W99B 3W2PA 4DHFA 3C4ZA 1K3AA 4FKQA 4EJ7A 2OJ9A 4W4XA 4FKLA 3QD3A 4QMNA 3D15A 4L44A 4QT1A 2F49A 3ZRMA 4YURA 2CCIA 3TKHA 3HUBA 4CKRA 4G31A 2QCSA 5GHVA 3SAYA 4FV6A 2BRGA 4TL0A 3KRRA 3NUUA 2C6KA 3O51A 4WIHA 5BPYA 4H05A 4MKCA 5HNBA 2Z2WA 4D4VA 4MF1A 3QLFA 4IAYA 3KRLA 4GCJA 4PQNA 4UBAA 4XOZA 4ACCA 3GCQA 4BICA 3FC1X 3KRXA 4C3FA 4IAZA 3GU4A 4KIOA 4YGAA 4AOIA 2PYWA 3U9CA 2CCHA 3R9OA 4W9WA 4WSYA 2ZYBA 2P2IA 4JOAA 5EH0A 1FVTA 2OH4A 4AZSA 1UA2A 2GFCA 2PUNA 4UZHA 4KNBA 3R8LA 2XIRA 5JRSA 2EB2A 3D5UA 4FG9A 5FTOA 4R3PA 4ZTLA 5HLPA 2UW6A 3W33A 5AP6A 1DAYA 2UVYA 3Q3BA 3FMDA 3KXXA 4KS8A 4MTAA 1YKRA 4RZVA 5T6KA 3SRVB 2O3PA 3ZTXA 4BDDA 3E93A 5HE2A 3VS2A 4BDJA 2QOOA 4YMJA 2YN8A 1REJA 3DGKA 3QKLA 4BWKA 1WMKA 2HW6A 2JGZA 1J3HA 3VWAA 2G15A 5DG5A 4BTJA 4QP9A 3HA6A 4PNIA 4B7TA 1YI6A 3MFTA 4ZLYA 3U55A 4KABA 1Y6AA 2J4ZA 2WTDA 5FXSA 2XNMA 4QP8A 2XVDA 3G90X 4HNFA 5EI6A 3RCDA 4CFMA 2X7FA 2QOFA 4C2WA 4FKOA 3FWQA 3VHKA 5CENA 3TG1A 3NYVA 4CEGA 4HVIA 1PMNA 2OJGA 5IF1A 4QMPA 1M52A 3BGPA 1R1WA 5AUVA 5IUIA 2H8HA 4DAWA 3VS0A 5CTPA 5HVJA 4BDKA 2BZJA 3H0YA 1SM2A 3R9NA 3GT8A 2OF2A 2OSCA 2VWIA 2VTMA 2WQOA 3SW4A 1ATPE 2VTIA 4OTPA 3UPXA 3QQLA 4IWQA 3DJ6A 3WYXA 3T8OA 3I7CA 3ORKA 4EHGA 4DTAA 3RWQA 4BKJA 4RJ3A 3F88A 5FLFA 3VJNA 3QA0A 3BYOA 5E91A 3PJ8A 2YLFA 3ITZA 4PTCA 5L8LA 1PXJA 2GTNA 4FV0A 5EDPA 3F5PA 4HYIA 3FZRA 1OL6A 3ZFMA 4QO9A 2VGPA 4PRJA 3BYUA 4LOOA 3Q9WA 3DFAA 2QR7A 2C0TA 2PE0A 3HL7A 3DZQA 5K0KA 3MWUA 5LVPA 1CKIA 1WBPA 4K11A 3UOJA 1NVSA 1SYKA 2YIRA 4IQ6A 4IWOA 4RJ5A 4TW9A 2XUUA 3RM7A 2W0JA 3GENA 3ATTA 3FXWA 1R78A 5CU4A 2ITQA 4J7BA 1KV2A 2VTOA 4UEUA 4YBJA 4JX7A 4IM0A 3MH3A 4A4OA 3KU2A 4RMZA 5CEIA 1YDRE 4FEWA 3MTFA 1G8AA 2GHLA 4F9WA 4L00A 4AP7A 2X8IA 2RGPA 3A8XA 4IIRA 4OUCA 4WSQA 4C7TA 3P7CA 5CEMA 3DTWA 4FIGA 4Z7GA 4DGGA 4EZ5A 4D9UA 1S9JA 2BKKA 1JWHA 2QOIA 3CD8A 3D94A 4LV8A 4FX3A 4O0XA 4Y95A 4G5PA 2YDIA 1R3CA 3VBWA 5C26A 3H9RA 1IR3A 3PXYA 4MBIA 1YVJA 3TZMA 2FSMX 2W1FA 2BFYA 3UMXA 1L8TA 4A4XA 2F2CB 3OWPA 1H1PA 1FBNA 4FEQA 5HBJA 1W82A 4JRVA 4PMPA 3BBWA 3A8WA 4X2GA 3GBZA 2C0IA 4GRBA 2P2HA 3GUBA 4E7WA 4QMQA 5L2IA 4L01A 3MN3A 3EZRA 4XRJA 1YWVA 5CI6A 3EIDA 4FTQA 3DCVA 4O0UA 4C37A 2W1HA 1KE9A 4WHZA 3PP1A 2CKOA 4OTHA 1KE7A 3IDCA 2RFDA 1BMKA 1P14A 5BYYA 3D9VA 2PVRA 3WF7A 4I0RA 3ID6C 3IG7A 4FKSA 4WO5A 3BZ3A 1OECA 2V5QA 3MY5A 4P7EA 4EI4A 2QHNA 1H1QA 1FQ1B 2IN6A 3DTCA 4X6RA 2XJ1A 5AAEA 2GTMA 5ACKA 4FKRA 1PKGA 4I5CA 4JAIA 4XEYA 4FSNA 2QG5A 4J98A 5HG9A 4HNIA 4CXAA 2WD1A 3NEWA 4BTMA 3RK9A 3ZO1A 3LFCA 1KOAA 4ZSGA 3C4FA 4I94A 4HCTA 2HELA 3NNUA 4IWDA 1ZZ2A 3DY7A 4MQ2A 5AUUA 3KN6A 4UXLA 5CANA 4DGMA 1IAHA 2FSOX 1PXNA 3MY0A 3QRKA 2PZRA 1IAJA 2O64A 4FTUA 5H8GA 3LAUA 3BLRA 3FKNA 2WZJA 3QQFA 3BV3A 4N4SA 5B2KA 2RL5A 4OBPA 3PJ3A 3ELJA 2QOHA 3LIJA 2A2AA 4F1OA 5I4NA 4MQ1A 4IVBA 4BCGA 5CU6A 4PY1A 4YZBA 3BU3A 2G2HA 3NUPA 1BUHA 3DQWA 1YOLA 2W06A 4BZDA 4FT9A 4EHEA 5ICPA 4U7ZA 3T9IA 1OKYA 3UZTA 4MAOA 2PUIA 1RJBA 2HAKA 4CQEA 2PULA 4L46A 4LGGA 5IA5A 4O7TA 4RA4A 2G2IA 2UZUE 4AW0A 5JK3A 4F7NA 1OBDA 3L8XA 4O21A 3RVGA 3UP2A 2FH9A 2F7XE 2PK9A 2Y4PA 3CPBA 4OAUC 2W5AA 5EOLA 3FXXA 3Q53A 3EQCA 4CFUA 3KQ7A 2ZV2A 4CZTA 4D5HA 5HI2A 3RMFA 3SDJA 4D0WA 2DWBA 3E5AA 4EOPA 2XJ2A 2BZHB 4K1BA 3OCSA 4BCJA 4K18A 4C59A 3C4EA 3ET7A 4U5JA 3EKKA 5CSWA 5FXRA 1PYEA 3EYGA 1DS5A 3OOMA 5EG3A 4DLJA 1OUKA 2GS2A 3CKWA 4FIFA 3A7HA 4FSYA 3KK8A 5ANGA 2F4JA 4UMTA 3ACJA 5ANDA 4FT7A 4NW5A 1TQMA 5FEEA 3R6XA 4I5MA 2VO7A 3JXWA 5EYCA 2PL0A 3P7BA 4JNWA 4QMWA 5HO7A 3QRTA 4R7HA 4MH7A 2XK4A 4YJRA 4CFXA 3GGFA 3BEAA 4XYFA 2VGOA 4YJNA 5L2SA 4QNAA 4BB4A 2ZV8A 4V0GB 4YPSA 5C8NA 4BDAA 2WMAA 4G34A 4C4HA 4DT8A 4A9YA 4CT2A 4JQ7A 3SHEA 5IH5A 5JKGA 3EN4A 4E4MA 3FV8A 4IC7A 3RINA 4BCQA 5AP1A 4NT4A 5DT0A 4FSQA 3PXZA 5M4IA 1JVPP 3Q5ZA 2HIWA 2YWVA 2UW8A 2WOUA 3E8EA 5BQ0A 2UUEA 1PMVA 4YLJA 4TRLA 3PDTA 3HZTA 2ZJWA 1XH5A 4RIYA 3V5LA 4PP7A 4KKHA 5GIOE 3A99A 1MRUA 3VQHA 4NKAA 4EC8A 2RFSA 4QD6A 2VZ6A 2HK5A 3K5VA 4DT9A 3N4VA 4AZWA 3VF9A 5CI7A 4KAOA 3WE4A 4F7JA 2YAAA 2OGVA 2FUMA 3OW3A 4DG2E 5I5ZA 2W1EA 1U5QA 3MFUA 4FL2A 5KHWA 1M2RA 3NCZA 2OBJA 3FMNA 4YC6A 4FTAA 1OM1A 4YJPA 4I0SA 2UZWE 5EKOA 4UWCA 4MHAA 1BI7A 4Y83A 2WQBA 3NPCA 2Q0BA 4BTKA 1UNGA 5K5NA 1W7HA 3R04A 2OFUA 5E92A 1ZAOA 1TQPA 1REKA 2OKRA 5FGKA 2HY81 5HKMA 4OBQA 5L6PA 3NWWA 5EYKA 3U51A 3UOHA 3WZJA 2UW7A 4M12A 3UMWA 1DAWA 2QQ7A 4BZOA 5CS6A 5TKDA 4CFFA 4EH2A 4FIEA 4E5BA 1XH8A 3N51A 2UZVA 1U54A 2B7AA 3E64A 4L7SA 4W8DA 5CEKA 5F20A 2JDSA 4P5ZA 4CLJA 3F2RA 3TZ7A 4AFJA 4Q5HA 1RDQE 4FSRA 4FICA 3LFEA 3HV3A 3I6UA 3F66A 5HVKA 2IJMA 2VTPA 3E3BX 3LCTA 3I81A 4X3FC 4TWCA 2PZYA 1KE6A 4KIKB 4EOLA 1XHAA 3FYJX 2E9OA 3Q9YA 5K3YA 5CALA 4RBLA 5GJFA 2HYYA 4JG6A 1BYGA 1W8CA 4BCKA 2GS6A 3AT4A 4BHZA 4EYMA 4WUAA 3CTJA 1SMHA 4CFVA 3G0EA 5EFQA 3G2FA 4EZ3A 2ONLC 5CU3A 3EQPA 3Q32A 4GSBA 3FI8A 3COKA 3L8PA 1WCCA 4MF0A 2A27A 3Q9XA 2GNGA 2JIIA 5J5SA 4U3ZA 4J53A 5J5TA 3K3JA 2BDFA 3LXKA 1VYZA 5HO8A 1QPCA 3A7GA 1J7UA 2VTSA 4GMYA 4C3RA 2VTRA 4FGBA 2OIDA 2ITYA 3WOWA 3UNZA 4ZTQA 5C8KA 2W96B 5J9LA 4HPUE 2P55A 4RT7A 4DCEA 4ENXA 1HCKA 4J71A 5IPJA 3MH0A 1H4LA 1XH9A 4TYJA 4BDBA 2CN5A 3PPKA 4ZIMA 5JGDA 1XH7A 4QQCA 2EWAA 1ZYSA 5AIRA 4GU9A 3NCGA 5CU2A 1BX6A 1GZNA 2C6OA 1LP4A 3LLTA 5M51A 3GI3A 4OTGA 5KMLA 1GIIA 2OO8X 4EK8A 3BU6A 4EC9A 3GEQA 4YLKA 2V62A 5HD7A 2VX1A 3UYSA 4QTAA 3CLYA 5L8JA 4KB8A 2R3RA 3OHTA 1I44A 4UWYA 4CD0A 2LAVA 2YM3A 3OVVA 2XNOA 4I21A 4RWLA 3W32A 5CLPA 4KKEA 4B99A 3FLYA 4YZCA 3RWPA 3L8VA 4I22A 4R5YA 4J97A 5FBOA 3VQUA 2IPXA 2GQRA 5ANOA 4S31A 4FYOA 5D11A 4CMOA 4CQGA 4EQUA 3LVPA 3ZUUA 2YM4A 3PG1A 2CPKE 4BCNA 1CKPA 2ZMCA 4N0SA 3VBQA 1FPUA 4EQMA 2JDRA 5DEWA 5AA9A 2Z7RA 3K3IA 3PA3A 3F3UA 4CSVA 1K9AA 1PMUA 4RWIA 2CLQA 2XS0A 3EQBA 4J8NA 5LMBA 2WGJA 5IEVA 2E9UA 4DLIA 3DS6A 2PVYA 2CDZA 3EN9A 3HRFA 5AR7A 4ZTMA 5BMMA 2OXYA 4AGWA 2C5VA 1Y57A 2NP8A 5DI1A 4FODA 3BYVA 3UP7A 2XJ0A 5CF6A 4I4FA 5IEXA 4E4XA 3HV6A 5F94A 1GZ8A 4NK9A 5DNRA 4K6ZA 3VUHA 4F1TA 5CEOA 2R3KA 5TT7A 3ZUTA 5F1ZA 4O7WA 3FLQA 4DCAA 4JXFA 3F5UA 4DEBA 1QPDA 3EFLA 4IXPA 3LMIA 2ITTA 3QTIA 2YLEA 3B8RA 4F63A 2Y9QA 3P5KA 3EN5A 5FBNC 2PVHA 3HEGA 2XH5A 2WB8A 2C6IA 3ZS5A 4Y8DA 3PXKA 5AUXA 5CYIA 1PMEA 2H6DA 3DKOA 3BHUA 3R8MA 2C5XA 3L9PA 3QBNA 2XNNA 5K9IA 4U79A 1DI9A 2R3NA 2AYPA 4KRCA 4WKQA 5LJJA 3OZ6A 4GW8A 2WTKC 2X39A 4KS7A 3TN8A 3PZHA 3U4WA 3TV4A 3DBCA 2IVTA 3QC9A 4XP0A 5D1JA 4CMUA 2UZTA 3QZHA 2R2PA 3FSKA 4RX5A 3ANRA 5F4NA 3IGGA 3BGQA 4PDPA 4HGEA 1IEPA 4HYSA 4A9SA 1FMKA 5IZFA 3I7BA 3DBQA 3QTQA 4K9YA 3AMBA 4DITA 2XKEA 2UZBA 2Z7LA 2WQMA 1OPKA 5I9YA 5D12A 3DBEA 3C4XA 4GG5A 4CV9A 2I40A 3WF6A 4HJOA 4ORKA 2JDVA 2UW0A 2VWVA 3S95A 2XA4A 3MBLA 4FKVA 5CQWA 3NW5A 3BEGA 5M09A 4LL0A 3HKOA 3SG9A 4E73A 1PY5A 4AW5A 3PSBA 2UW9A 3BBTB 2I0HA 5KMMA 2YAKA 3F69A 2R7BA 4AZTA 3I0QA 1P5EA 2BZKB 4AGCA 3LZBA 5JFVA 4X3FA 4DEAA 4ZSEA 3IPHA 2VD5A 4JI9A 2UZEA 4MK0A 3R21A 1WBSA 3W18A 3BV2A 3QTXA 3F5XA 4NZWB 3FMEA 3GCPA 3QLGA 3V5PA 4E93A 3HAVA 5C9CA 3WYYA 3DBDA 4RJ4A 5A46A 1H01A 3VW8A 2ONLA 3DOGA 2Q83A 4ZS4A 2E2BA 5JSMA 5AMNA 3TTIA 3GU5A 5KCVA 5IG1A 1M17A 4O7ZA 3DAEA 4EOJA 5LCJA 3ZRKA 4IJ9A 2R0UA 4DTKA 4ZMFA 5EYMA 3RKBA 3UVQA 5IDPA 4R77A 4ZP5A 3AT3A 4I41A 4NM3A 3BIZA 5JMSA 1BI8A 4GFMA 2BKZA 2YWPA 1UU9A 3FY2A 3MH2A 4CT1A 4S32A 4X7QA 3AGLA 3TI1A 1PKDA 1Q8WA 1R39A 4PTEA 4PX6A 3TV7A 4YUQA 2O0UA 1UU8A 5CAOA 3AXWA 4XMOA 2UZLA 2C5NA 4IX4A 2ITNA 3R7EA 3KK9A 3ORNA 4CTBA 3QYWA 3JPVA 5AAGA 4HGLA 4ANMA 4YPDA 4FYNA 3VS3A 2XIYA 3A7JA 4PUZA 4BBEA 4ZLOA 2PZPA 4KBAA 3I60A 4FKJA 5GZ9A 1XWSA 2X9FA 2VTAA 3NIEA 4L3LA 1Q8ZA 2BPMA 4KSQA 5IQIA 2X2LA 3MIAA 3LFFA 4LRMA 3IW8A 2WIHA 3MYGA 4GT4A 3FUPA 4XJ0A 2PU8A 4X2NA 4EH3A 2CGVA 5FEDA 5CX9A 5FQDC 1XO2B 3DLSA 4EH9A 5AM7A 5FM2A 2YERA 3MVMA 3QU0A 1XH4A 3TT0A 2PVFA 4NM0A 3ZFYA 3ZXZA 4QRCA 4BF2A 5IQFA 4GV1A 4WA9A 5EOBA 4F9YA 2B1PA 2X2MA 4N70A 3COMA 2XMYA 3ORTA 4BY9E 3S4QA 4DH1A 4EKLA 5DN3A 2JDOA 2I6LA 4X2KA 4HPTE 4MWIA 2HWOA 4MD8E 5HIBA 5IUHA 2VUWA 5JT2A 4USEA 2PZIA 5HICA 5JZJA 2BMCA 3ROYA 3C0IA 5DHJA 4EOOA 5HQ0A 2YDJA 5AR3A 2JD5A 3R1SA 4AUAA 4IX3A 4YTCA 2RG6A 2BILB 2C3LA 2ETKA 1JKKA 5IA1A 1CTPE 3KRWA 1ZZLA 4RIXA 4EL9A 2WFYA 3A4OX 4NH1A 4O0VA 2GCDA 4FVRA 3RBWA 4EK5A 3PXFA 3QCYA 3RAIA 2FGIA 4YZ9A 4NFNA 2VTQA 4B6LA 4C61A 4Z3VA 2BDWA 1H1WA 2QKWB 1PJKA 4FNZA 3F3TA 3G33A 4NM7A 4O1PA 3VF8A 3OEZA 4LMUA 3A62A 1J1CA 3KXHA 3LJ0A 5GZAA 2JKKA 3H0ZA 5G6VA 5B7VA 5C4LA 4NCTC 4AS0A 1O9UA 1QCFA 2GNLA 4EH4A 3JY0A 2X6EA 2JBPA 3FI2A 5FXQA 4GKHA 3BHVA 4ACMA 1XH6A 2C30A 2RFNA 4IZ7A 4DFZE 3ULIA 5HE0A 2G1TA 1W84A 2X4FA 4G3DA 3RNYA 2XEYA 3HX4A 4E8AA 5BUJA 3JY9A 3DK6A 4BCOA 3FI3A 4AZVA 2CGWA 5IEYA 4PL3A 4ZMEA 3W8QA 2OFVA 4ZJIA 2ITVA 4FSWA 1WBTA 4DFBA 3W55A 2VWUA 5E8WA 5LVMA 3NMUF 2C5OA 2R0IA 3FPQA 2R3PA 2W1GA 3RI1A 2YM6A 4FTIA 2R3LA 4WRGA 3RJCA 5AP2A 5J7BA 3AC5A 5EHYA 2UZOA 3CCNA 2X8EA 1ZARA 4HCUA 2C3IB 4S2ZA 5LCKA 4BWXA 4QP1A 3S3IA 3FEGA 4GJ3A 2Y4IB 4AG8A 2EXEA 3Q4ZA 3I5NA 4DG0E 4EK6A 3UG2A 4BYJA 5ACBC 4HVDA 3FL5A 3E92A 4D2TA 4QPSA 5CSPA 5C4KA 3QD4A 5FG8A 4WUNA 5E90A 5AV2A 4CNHA 4D2WA 3R71A 4Y5HA 2UVXA 2XKFA 2SRCA 2C6LA 3D7TA 4YJOA 4AGDA 4R78A 2QOQA 3DPKA 3LJ2A 3K2LA 3E8NA 3RK5A 5TE0A 2C6EA 5C8MA 2YIXA 4TYHB 4OGRA 4AA0A 4EH5A 4XBRA 1WVWA 4NUSA 2WMWA 4Z16A 3V04A 3LMHA 1A06A 4ID7A 4M84A 4PL4A 4TYEA 3JUHA 3L9MA 2GU8A 4D55A 3UQCA 3KXGA 4ZTHA 3G5DA 5HTCA 3SG8A 4UXQA 4IHPA 4ZZMA 5CU0A 2JIVA 5KHXA 2F7EE 3HV5A 3H9FA 4NJDA 5IH4A 1CM8A 5CF5A 5I9WA 5C03A 2WU6A 2WPAA 3CJGA 4D0XA 1JOWB 4G3GA 3ODYX 4N57A 3VUDA 3UC4A 1XKKA 4FIHA 4FMQA 5IQCA 2A19B 2G01A 1LPUA 4GK3A 3TEIA 4WG4A 1SNXA 4RFYA 4FZ7A 1OI9A 5LQFA 5K0XA 2ITWA 1SVEA 1TVOA 4HVGA 1W83A 3A61A 5HCYA 5CQUA 3WF5A 4E6QA 3V5QA 5E8SA 3KB7A 1OIRA 2FB8A 2X6DA 1OBGA 1MRVA 4GVAA 1Y8GA 3DZOA 4DBNA 4BL1A 4MNFA 3FXZA 4H1JA 3TTJA 3CJFA 4DGNA 3DNEA 2BIYA 4C4EA 2BRBA 3VRYA 3AD4A 4FKIA 1W98A 2QC6A 2ZMDA 4WBOA 5HBEA 4AT3A 1PHKA 3E7OA 2RIOA 4KA3A 3HMPA 5HNGA 4CRLA 2C0OA 4LUEA 4BI1A 4FKPA 1WBWA 3UZPA 2BUJA 4Z7HA 5AA8A 2X81A 3VUKA 4M14A 4DBXA 3S2PA 4RJ8A 1KV1A 2GNIA 5CXHA 4ACDA 1YOMA 3W8LA 3R00A 4O2ZA 1G8SA 3CQUA 4J8MA 3K54A 4Z9LA 3LQ3A 4KUJA 3TDVA 2AC5A 2XNGA 4QPAA 3SX9A 4FV5A 1SVGA 3NVMB 4M0YA 3RCJA 1Q61A 2YACA 5AP7A 3PWDA 4DC2A 3LFAA 4KIQA 4QMOA 3OY3A 3QF9A 3PSDA 5CY3A 4NTSA 4ANLA 3FMHA 4DEHA 4F9AA 3NAYA 1VR2A 4HOKA 3PP0A 5HNIX 4O83A 2VWBA 2F57A 4OR5A 5D41A 4LV5A 4C38A 3EKNA 1GIHA 3MVJA 4QTCA 5D9HA 3GCVA 4EKKA 1P4FA 3UQFA 4C0TA 2V7OA 3O8TA 3MB6A 2P33A 3PWYA 1G5SA 4B0GA 4Q9ZA 4JLCA 1ZXEA 5IISA 1V0OA 3DJ7A 4B9DA 1H07A 3FMLA 5KZ0A 5JQ5A 5LWMA 1J91A 2X7OA 2YM8A 3EFWA 4PF4A 3BU5A 2ETMA 1ZRZA 3P23A 4G1WA 4TWOA 4LG4A 4ZSAA 4TY1A 4AT5A 2QOBA 3GQIA 2BRNA 4OT5A 4O1OA 5M4UA 3EQIA 3G9NA 3DNDA 5LVNA 5IQAA 2YISA 3MV5A 4AXAA 3U87A 2J50A 4A9TA 4RJ7A 4BIBA 4Z55A 3UGCA 5JGAA 4NL0A 2OW3A 3NUYA 2V0DA 3R7VA 5M53A 5LVLA 3QTRA 3U9NA 1SZMA 2QR8A 3TCPA 4O7RA 4L67A 1H27A 3KL8A 4AX8A 2PTKA 4IB1A 3T3VA 5L6OA 4NCTA 3VBVA 2WHBA 4V04A 2XF0A
chains in the Genus database with same CATH superfamily
1OKVA 5D10A 4BDGA 3FE3A 4UMUA 4DHIB 4QYFA 1XBAA 4CG8A 3JVSA 3E8DA 4ALWA 1EH4A 5KE0A 3TKUA 4P90A 2BROA 2W4KA 2R3JA 3UNJA 1M14A 4PL5A 3ORLA 3W2RA 1DM2A 4LDTA 4TKSA 3DFCB 2DS1A 4G3FA 5BUIA 2XKDA 3ZZWA 2PUPA 4FEVA 2B53A 1B6CB 3RHXA 2R7IA 2KULA 3MJ1A 1JKTA 3D0EA 4LL5A 4FZFB 3ZO2A 3NVKI 4GJ2A 3PRIA 3C4CA 4IDTA 3SC1A 1ZOEA 2GQGA 2W17A 3RPOA 2JAVA 3PA4A 3R01A 4YJTA 3UOLA 2NRUA 2OJFE 4EYJA 3MTLA 4FV4A 3DLZA 5IQHA 3KULA 4FV1A 3QCQA 2B54A 3CKXA 3QD2B 3ENHA 2WMTA 2VV9A 2O65A 3SXRA 2PMNX 3O8PA 5J9YA 5JQ8A 2WTJA 4O0SA 2OG8A 4R7BA 4RQKA 2IZRA 3ZH8A 5AP3A 4U40A 4O81A 2GDOA 3R7IA 5CSVA 5HVYA 1QPJA 5FDPA 3R9HA 2GPHA 4RC2A 5M57A 1XR1A 4FT3A 3BI6A 2XK8A 3VS1A 4CV8A 4FSZA 3HV7A 2BVAA 4DEDA 2PE2A 4U3YA 4IM3A 2AUHA 3FSFA 4IAKA 1LEWA 4M15A 5KKRC 2UW4A 4BKYA 4EUUA 3U54A 3OFMA 1IG1A 3PLSA 4IEBA 4MD9E 3TZ8A 3EQRA 3EL7A 1JPAA 3RTPA 4FL3A 2ZV9A 4IADA 3KMWA 4UWBA 4JIAA 4MXYA 3TNQB 2IF8A 4F7SA 4RC4A 3RAHA 3BLAA 5IQDA 1APME 2VX0A 3QWKA 2R3FA 3QTWA 2WIPA 3TM0A 3P08A 3MVHA 2RSVA 4B4LA 1YHWA 5ANJA 1F0QA 5CNNA 2XBAA 4YJSA 1VJYA 4FBXA 3V5TA 3QC4A 3KMUA 1RQQA 4RC3A 3ANQA 1VZOA 3P0MA 3IONA 4OTWA 4U44A 4YSMA 4FZAB 2XM9A 4QYYA 2R3MA 2V7AA 3MY1A 4FTTA 3R8ZA 3UIBA 4EOQA 1DI8A 5E7RA 5LWNA 3NAXA 4HGSA 1H28A 4FK6A 4OTRA 2O63A 3ORIA 4XV1A 4YJQA 3S1HA 2PHKA 2XAOA 3W0RA 4YO4A 2XBJA 3O71A 4X3JA 3GFWA 1LUFA 3LQ5A 3OUNB 3KA0A 3AC1A 4G6NA 3TJCA 3VIDA 4PDYA 3DAKA 3VRZA 3FPMA 4XV2A 5IDNA 3EOCA 1JQHA 3OCGA 3A2CA 4PMTA 3TXOA 4QTEA 4U80A 2IZSA 2I0YA 5M06A 2X2KA 1A9UA 4H3BA 3FQSA 4J95A 1KUTA 5LVOA 3HRCA 4F70A 2JEDA 3LLAA 2ZVAA 5DVRA 5E8VA 1KE8A 1ZMWA 4A9UA 4F65A 5JN2A 3CP9A 2WTWA 3BLQA 3QWJA 3EL8A 4NFMA 5AR4A 3ORPA 3BHYA 4FTOA 5AUWA 2IWIA 2XEZA 3D5VA 3UOKA 2AC3A 1FOTA 1E1VA 4I6QA 4QYGA 4FA2A 4BI2A 4BDCA 3F9NA 1Q62A 2C4GA 3OP5A 4YJUA 5TR6A 3DXQA 4YC8A 4ONAA 4FJVA 3KCKA 3RPYA 3ZUVA 2B4SB 5CF4A 3PG3A 5H2UA 2WMSA 5HG7A 3SQQA 3TZ9A 4YHJA 1OKWA 4LRJA 3DT1A 4D58A 2P3GX 4BBFA 2H34A 2XYUA 3ZO3A 4D2RA 4DH5A 1URCA 1YXVA 3CS9A 4RRVA 4JQEA 4C4IA 1ST0A 3ACKA 4QPMA 1FGKA 2W1DA 3HGKA 3BL7A 4O84A 2RG5A 4O0YA 3TJDA 5HG5A 2WOTA 3HMOA 1ZYJA 3E8CA 3VUMA 4AOTA 2OI4X 4QP7A 3OBJA 3ORMA 5GJGA 4B8MA 2E9PA 5B2LA 2VWXA 1ZMVA 5HBHA 3WARA 4WNPA 4RIYB 1YOJA 5I3OA 4H3PA 2C6DA 4ZTNA 5HU3A 5LOHA 5M4CA 2IG7A 3PIZA 1WAKA 5AR8A 1ERKA 5CEPA 3NRMA 1Q3DA 3HUCA 4RPVA 3V8WA 2YA9A 1H24A 2PZ5A 2VAGA 3A60A 3RPSA 3QQKA 4RJ6A 4CCBA 4QQJA 3MESA 4UZDA 4NU1A 4C62A 2ZOQA 1WVXA 5H8EA 5JZNA 1V0PA 2EVAA 2XCHA 3H30A 4QNYA 4E26A 5A54A 1OPLA 2OZAA 3R7YA 5CXZA 4XBUA 1OIQA 1MUOA 2PSQA 3OXTA 5ITAA 2OLCA 4RFZA 4R5SA 4ANOA 4AF3A 1W2DA 2R9SA 5FP6A 3OXZA 3ZCLA 5CT7A 1GJOA 2VU3A 1YWNA 3DKFA 4Q5EA 2HXLA 3TL8A 1YQJA 5E8UA 5F9EA 3RGFA 1U54B 2Y7JA 4JG8A 4I93A 5HE1A 5BYZA 3TNPC 4DH8A 1WBNA 2HZ4A 3DA6A 3FZOA 1UU3A 1Q97A 3COHA 1Z57A 4AXDA 4O4BB 3QX2A 2ZM1A 5BUEA 2BFXA 3CY3A 3FKOA 3MSSA 2XIKA 5FWKK 4F99A 4NIFA 2JKQA 3G15A 3HECA 4WNOA 2FO0A 4ZZNA 2WXVA 2X9EA 4M13A 4DEIA 4GK4A 4YSJA 4AE6A 4FKTA 4YU2A 1H1SA 4PMSA 3OCTA 2WEIA 3FHIA 4JDIA 4FSMA 5A4QA 2C3JA 4I6LA 4AU8A 3DV3A 1ZY4A 4MVFA 4CLIA 1W2CA 2W05A 5BVEA 4DFXE 3QGYA 3EQFA 3KIOC 2W9FB 3KFAA 3GU8A 4ZSJA 4BCIA 3Q60A 2XK9A 3QRUA 4DH3A 3IW6A 4QOXA 2ERZE 5HIDA 5K5XA 3NUSA 4FIIA 2QOCA 4TPTA 3BWJA 4K8AA 3KEXA 3I5ZA 5CEQA 4CKJA 5KZIA 4O7LA 4YO6A 3SGCA 3FZ1A 1GIJA 3IECA 3HYHA 4EK4A 1OUYA 1XBCA 3EFKA 2C5YA 4H1MA 5E8YA 2CKPA 4AXCA 5HG8A 4OT6A 4USDA 4UX9A 3QALE 3LCDA 4L9IA 5KKRB 4PDSA 1JSUA 3P1AA 4HYUA 4O4FA 5G1XA 2XARA 4D4SA 5AEPA 3D4QA 4I1ZA 3W0PA 2YCRA 3BCEA 3FZSA 3NYNA 3V5JA 5ETIA 2F7ZE 2A98A 5BVFA 3GNIB 5AWMA 5KMKA 5BYLA 1Y6BA 2VTTA 2QHMA 3THBA 2ITOA 2VRXA 1P4OA 3NGAA 3MH1A 3QL8A 4BCHA 4I6BA 4PMMA 3R8PA 4MEDA 4FV3A 3TDWA 4PTGA 4FTJA 4NKSA 5AP4A 4FE2A 4ACHA 3TUCA 5GZ8A 3BELA 3KRJA 1Q8YA 4BCMA 1O6LA 4A4LA 1IA9A 2WQEA 1H25A 3F2AA 4AT4A 4A07A 4I6FA 4JBVA 4L68A 4BGQA 4EBWA 3C9WA 2GNHA 3B2TA 4M69A 1I09A 3PYYA 1VYWA 5CVFA 3OTUA 4QMZA 3HDMA 3O2MA 2OF4A 2Z7QA 5AAFA 1JAMA 3GXLA 4BDFA 3GQLA 4L52A 5IKWA 4PDOA 2B52A 3UYTA 4G6LA 3BL9A 1GZKA 2HZNA 3MA3A 2X0QA 1YW2A 3KKVA 4C02A 4CYIA 2ITUA 4FI1A 3ORZA 4GH2A 1T45A 4DG3E 3LXNA 4U42A 4ZS0A 5DMZA 2YZAA 2PVMA 2I1MA 3IS5A 2BCJA 4J1RA 4CFWA 3CBLA 2GNJA 2QOKA 3WIGA 3SW7A 3I0OA 3VS4A 4BCFA 4FTNA 2ZB0A 4ALUA 4JRNA 3AKJA 4J99A 5IA3A 5AV0A 4L42A 4AFEA 3WZUA 3UC3A 3LFBA 1YI3A 3VULA 4C4GA 3MPMA 4J52A 2B0QA 4FR4A 4Q2AA 4HW7A 4JG7A 3PA5A 2CGXA 2IW8A 4NW6A 3OWKA 3UO6A 3ZHPC 5EQYA 4EH8A 3ZLSA 5EM7A 1KWPA 1QPEA 1YXTA 3G6GA 1AQ1A 5CNOA 3CQEA 1F3MC 4YNOA 4BTFA 4C34A 3W0MA 3LXPA 4QQTA 5AV3A 3QUDA 3CY2A 3Q4TA 5FM3A 3OOGA 4F4PA 5L4QA 2BAQA 1KSWA 2QKRA 4XH6A 4DTBA 4TT7A 2FSLX 3KC3A 3ZMMA 3KREA 3FL4A 3KY2A 5LMKC 2OXDA 5E1SA 3K5UA 3KF4A 1H0WA 4QP3A 3ZFXA 3LJ1A 3GCUA 4FVQA 4D1ZA 4D5KA 2EB3A 2JKOA 5DGZA 3UTOA 3O50A 3VC4A 3PVUA 2WAJA 3C51A 4JBOA 2F2UA 4G16A 1UV5A 4L3PA 5ETAA 5BVKA 1BL6A 3FLZA 3DQXA 1OKZA 3I79A 4HCVA 5CWZA 5A14A 3QAME 4L8MA 3A4PA 5AFVA 1FVVA 3ZO4A 3ATSA 3II5A 3FMJA 3UO5A 5AV1A 2GHGA 3GC8A 3C13A 4ITIA 4AAAA 5B2MA 3VS5A 3LHJA 4KBKA 4ZY5A 4Q9SA 3GOPA 4UYAA 4G9RA 1ZWSA 4ZJVA 4IACA 5AUTA 2O2UA 4A7CA 4BIDA 4JL9A 3A7IA 1Y8YA 4F09A 4HZSA 3ZM9A 3O7LB 2OH0E 3RPVA 4D1XA 3NW6A 4DHZA 4IAAA 1Q24A 1VEBA 4C8BA 2WMXA 2C69A 3BKBA 3R63A 4K0YA 5HOAA 5K4IA 4X3FB 4MBLA 1OGUA 3M2WA 4MXAA 2YIWA 4IANA 2HZIA 1ZOHA 2PVKA 5A4EA 3VUTA 4II5A 4CRSA 2GHMA 5ANKA 3U6IA 3M42A 3JR1A 4JQ8A 3NZ0A 5J95A 3UJGA 5J7HA 4PV0A 4KINA 5CVHA 5J79A 4I23A 3H10A 2J0IA 4FSTA 3R8UA 3QX4A 4D2SA 1FMOE 1Z9XA 3W2OA 4U45A 4QMLA 1H1RA 3UZRA 5ANEA 4DF3A 4UB7A 3H4JA 3P4KA 2B9JA 4ANBA 4I5HA 5EI2A 3AT2A 2B9HA 3RHKA 4CCUA 2H9VA 3V6RA 4L43A 1UKIA 4E5WA 3GC7A 5HIEA 4LGHA 4I5PA 4MXOA 4AA4A 1STCE 1XJDA 4IB5A 4RVMA 2R3OA 3O23A 4FTKA 4LUDA 2NNWB 2BTRA 4E4LA 4FTMA 4C2VA 2V22A 3W1FA 3QTSA 3FMMA 3GC9A 3MA6A 4DFNA 4GS6A 5I9XA 3DAJA 2WTCA 2PPQA 4MBJA 5A9UA 2YITA 3VVHA 5HX6A 4BZNA 3REPA 4D2VA 4DGLC 4AWIA 4JR7A 2GS7A 1YHSA 5AM6A 3MJ2A 4NTTA 3QKKA 4XRLA 3RP9A 1S9IA 4F0GA 3ZRLA 4QQ5A 3SOAA 2YM7A 4RIWA 4F9BA 3ETAA 1GY3A 4DE4A 4WRSA 3VUGA 5L3AA 1FVRA 5TOZA 5JFWA 4GUBA 2YEXA 3G9LX 3ROCA 4FNYA 3FC2A 3UODA 3UVPA 4XLIA 1BLXA 1CSNA 1Q5KA 3UE4A 3WF8A 4V01A 1Y91A 2ZB1A 4TXCA 3EN6A 4R7IA 4GL9A 3W10A 2H96A 4X2FA 4ERKA 3E62A 1BKXA 4EEVA 4BJJB 3E87A 3TNIA 1Z5MA 2YJSA 5BX0A 1ST4A 3HLLA 2JC6A 2ZV7A 1JKSA 5CVGA 5BVOA 1UKHA 4XX9A 4Y72A 4FZDB 3NFFB 2X7GA 2YABA 4YTIA 2Y6OA 4QYEA 3IGOA 3IOKA 1UWHA 2BIKB 2YCQA 3FQHA 4GVJA 4QMSA 3P78A 3OS3A 3P79A 4GT3A 4E6AA 2VTLA 4O7NA 3LCSA 4I92A 5J87A 4RIXB 3UQGA 3LMGA 3OC1A 4MD7E 2PVJA 3ZM4A 5GINE 4EZ7A 5KMOA 4V05A 5HX8A 5KO1A 2UV2A 4IZ5A 2NRYA 2VTHA 1ZY5A 2QU5A 5HHWA 4MCVA 4F0IA 4CKIA 3R73A 4TYIA 4R3RA 3VBYA 3WZKA 3L8SA 4IB0A 5HZNA 4D1SA 1U4DA 4LRKA 3QCXA 2ITPA 4MNEA 4JDKA 5AIKA 3PFYA 5AUZA 3BYMA 2DUVA 4D2PA 3DK3A 4UY9A 2XNPA 2O8YA 4GU6A 4OLIA 3BX5A 4ITJA 3RK7A 3U4UA 2IEWA 3F3WA 2BZIB 2PMIA 5LMKA 2WTKB 3NFGB 4F6SA 3HP2A 2JFMA 1O6YA 4AE9A 1B39A 2C1AA 2R3GA 4J96A 3IW7A 3NNVA 4MXZA 4F6UA 3SOCA 2FVDA 2J9MA 3SKCA 5HU9A 5IH6A 3BQRA 3NDMA 5AP0A 5EDQA 1E1XA 2VO6A 2CNVA 3C50A 2XKCA 3R8VA 3VBTA 2BTSA 3VAPA 4WOVA 3ULZA 2VWYA 5DPVA 3HMIA 4FKGA 1RE8A 3DBFA 4QMVA 5FEQA 3W0NA 2Z8CA 3GVUA 5E8TA 1Q99A 4IM2A 4JR3A 4IX5A 4G3EA 1URWA 5DT4A 5A4CA 1Q8TA 1U59A 2HW7A 3CC6A 4P4CA 1WZYA 4EONA 3PVWA 3MI9A 4NSTA 1OZ1A 4YHFA 4O7SA 4Y85A 3D7TB 4CZYB 2GFSA 1JBPE 1OVEA 4RX7A 1PXMA 3RAKA 3BWFA 4EWQA 4PPBA 4XG3A 2C68A 4R1YA 4RLLA 5H9BA 2W1ZA 4LV7A 4BBMA 4ZY4A 5IQEA 3IQ7A 3EQGA 2VTJA 5FTQA 2PMLX 3TNWA 3DDQA 4G5JA 2VX3A 5GNKA 1A48A 4G6OA 4C4FA 4AA5A 3KN5A 1B38A 3PVBA 1ZLTA 3GCSA 4RWKA 4DFLA 2J7TA 3D2KA 3R0TA 4O6EA 2J0KA 4I6HA 4X2JA 3D7ZA 3NLBA 3ENMA 3P7AA 3KVWA 3KMMA 1QL6A 3PSCA 1JSTA 2I0EA 3FZPA 2JITA 2XYNA 2W1CA 4GYIA 2WO6A 4WT6A 3Q4CA 4P2KA 4Y46A 3ZLYA 3UO4A 1KE5A 4KD1A 4XG7A 3JVRA 3ZEWA 3LFQA 3B8QA 2PVLA 4O0WA 3BRBA 1AGWA 2P0CA 4IZAA 3SRVA 4ANQA 4O86A 2VNWA 2CKQA 4FTRA 5BNJA 3UPZA 1OPJA 3OD6X 3RM6A 3QGWA 5H8BA 4BWPA 1ZYDA 4EQCA 3HMNA 5AUYA 3HMMA 4XCUA 4R3CA 4KWPA 3EJ1A 2J51A 4R8QA 3R1YA 3SXFA 4RGJA 3Q6WA 2C3KA 2X0PA 3HP5A 3CGOA 2J2IB 5CAUA 2CHLA 2W1IA 3MVLA 3Q6UA 4BCPA 4EH6A 1MQBA 3POOA 4KIPA 4OTIA 4BDHA 4W8EA 4RVTA 3OMVA 3PPZA 4CFNA 4CVAA 4O7YA 4QMMA 3TV6A 4FG7A 4RVKA 3UG1A 3ZONA 2OU7A 4ZTSA 3Q96A 4YBKA 4YJVA 2XAMA 4NEUA 4F7LA 4ZK5A 3DJ5A 2IW9A 3LM0A 2OJJA 3W2CA 3DK7A 4C3PA 4FKUA 5HO6A 4D28A 3VS6A 1U5RA 4BGHA 2Z60A 4HYHA 2G9XA 3AGMA 1BL7A 3W2QA 3NSZA 1CMKE 3I4BA 3RNIA 4I0TA 3FKLA 3OTVA 2NPQA 4GUEA 3KVXA 4W9XA 3OG7A 3QZGA 5I0BA 3QYZA 4KKGA 1PW2A 3WE8A 3PJ1A 4HVHA 4OW8A 3RZBA 3ZBXA 5I3RA 4BGGA 1PXPA 2XIZA 4PP9A 4XV3A 2XZSA 4BYIA 3PIXA 4USFA 5JFXA 4NM5A 2HXQA 1OIUA 5JH6A 4GEOA 4BIEA 1QMZA 3AC3A 3BE9A 3QQHA 3EWHA 5CAVA 5HLWA 3R28A 2YIQA 4U9AA 3O7LD 3F3VA 3OY1A 2ACXA 4M67A 1LR4A 2XK6A 4AACA 4D9TA 4JS8A 5DEYA 2ZAZA 3MGYA 1NY3A 2X4ZA 5CASA 3QRIA 1WFCA 2BAKA 4GYGA 4YZDA 3RZFA 4M97A 4O6LA 3R02A 3BGZA 4L53A 2LGCA 4F9CA 4FOBA 3WI6A 5IA4A 4O38A 1OL7A 1NW1A 5HESA 3JS2A 4ITHA 2CSNA 3NR9A 3UBDA 3DDPA 2YCSA 2JDTA 5C01A 2C47A 4OBOA 2CJMA 4P5QA 3F6XA 3EHAA 3R1NA 3PUPA 4XG4A 5FP5A 4AOJA 5L2TA 3AG9A 2ETRA 5A6OA 2PE1A 4EOMA 3UIUA 4FT5A 4UYNA 3HDNA 3E7VA 4RIOA 4IB3A 3HA8A 4XG6A 4TYGA 3V8TA 3R7UA 4EOIA 4FGRA 1GZOA 5FTGA 4DDIA 3DB8A 5EK7A 3MDYA 5AP5A 5AX9A 4RA5A 3GFEA 2BR1A 2YCFA 4X21A 4FV8A 1UU7A 3NNXA 3AMAA 4FSUA 4ZOGA 3DXNA 4F08A 1OL5A 2QOLA 3Q2JA 3F61A 3AD6A 1XMLA 2QONA 1R0PA 3GU6A 3VO3A 4FNWA 3KF7A 3R1QA 2WMBA 3QXPA 4RVLA 3M11A 3ODZX 3BPRA 2GNFA 5HCXA 4QMYA 3QQGA 3EYHA 4XHKB 5DFPA 2VN9A 3KULB 5C1QB 2E9NA 5JEBA 3F7WA 2QNJA 3CIKA 5J9ZA 4C33A 3UVRA 4S33A 1RW8A 3IOPA 4W4WA 3TIYA 2B9FA 3CD3A 5FDXA 3WF9A 3OBGA 1WVYA 4TNDA 5A3XA 2QG7A 1YI4A 2VO0A 5EM8A 4QTBA 2YFXA 1H26A 3UIXA 4CMTA 1M2PA 2FSTX 4U0IA 3OT3A 3FZTA 3WIKA 3GC0A 1HOWA 4H3QA 3MPAA 3QUEA 1XBBA 1IRKA 1SVHA 4QTDA 5DH3A 4F1MA 5M55A 3O96A 3QA8A 1JKLA 3I1AA 3BHHA 2J0LA 1U46A 2GMXA 5AADA 1UNHA 2CMWA 1OB3A 3FI4A 4ALVA 3LQ8A 2IZUA 4IVDA 1L3RE 1NA7A 2PWLA 3HV4A 3IW4A 3E88A 4BR3A 3KGAA 4W4YA 3L9NA 3OUKA 5EM5A 4HGTA 5FD2A 3ZDUA 4A9RA 5HLNA 3HVCA 4M3QA 4JVGA 4E6DA 3F5GA 3EB0A 5C27A 2WEVA 4GFGA 5KMJA 3HAMA 4TN6A 5M07A 3C0HA 3FMKA 2WQNA 3QTUA 5EDRA 4U43A 2V55A 2W5HA 2IO6A 4GT5A 2XNEA 4E6CA 3FBVA 4BVUA 3FY0A 4I4EA 4BC6A 2J0MB 3E63A 4TWNA 1JSVA 3P9JA 4G17A 1Q4LA 4G2FA 2WMUA 4JT3A 4CTCA 2XIXA 2YJRA 4GG7A 1XQZA 3EMGA 3GP0A 4EH7A 3TUBA 2QODA 4WG5A 4FZ6A 5ANIA 2YIYA 5FRIA 2HY0A 4AN9A 3FJQE 4LOPA 4FF8A 4PNKA 4XOYA 4XUFA 2W4JA 3PRFA 3PJ2A 2ERKA 2IZTA 5E4HA 3V6SA 5KBQA 4ZLZA 4GFOA 3O17A 3MIYA 4OTFA 3T9TA 3VJOA 1TQIA 2IW6A 2XB7A 4BDIA 4C36A 3NNWA 5IMEA 5JGBA 3V01A 4E20A 2IVUA 4FNXA 4V0GA 4AAYA 2Y6MA 3AMYA 3PPJA 4PPCA 2FYSA 4IC8A 3MW1A 2XCKA 4ANSA 5M08A 1SNUA 3POZA 1OIYA 4LQMA 2XRUA 2VWWA 5BV3A 4EOKA 3W16A 1M7NA 3EQHA 3G6HA 3PE2A 3EZVA 3PVGA 1ZMUA 4ANNA 4ACGA 3VS7A 2W4OA 2IVVA 1YXUA 3NW7A 3LPBA 2W9ZB 2OK1A 3R2YA 5L6WL 2AQXA 2WELA 3TACA 5EQEA 3AQVA 1FGIA 4GIIA 2OZOA 3F7ZA 3ALOA 3COIA 2E9VA 4YZNA 3B2WA 2A4LA 2R4BA 1YDTE 1PRYA 3PY0A 1Q8UA 4O0RA 5T68A 3IKAA 3EN7A 4NYEA 2Y0AA 3PTGA 3UIMA 3E3PA 1ZOGA 4FEUA 1TKIA 3WZEA 3NUAA 4IWPA 4FTCA 3CR0A 4LYNA 2GQSA 3O5AA 1LEZA 3PZEA 2P4IA 3R22A 4K33A 4X0MA 3W0QA 1KOBA 2CGUA 4ZSLA 4AW1A 1CKJA 3SVVA 1GOLA 1AD5A 4WNMA 4PWNA 2WTIA 5BMSA 1W0XC 2JFLA 3ML1A 4BHNA 5KMIA 2I0VA 4M8TA 3LKMA 2OZAB 4E1ZA 2BHEA 4ZY6A 4IFGA 4QP6A 2BHHA 5EM6A 4MXCA 5J8IA 4GKIA 1YWRA 4IX6A 2B9IA 3IDPA 5L2WA 4YNEA 4QMTA 2YZLA 3TYKA 2HWPA 4D4YA 5E8ZA 5D7VA 5ETCA 4O82A 3CXWA 4KIKA 3RALA 4APCA 2CNUA 4WNKA 3NIZA 1GNGA 3S0OA 2JLDA 4BN1A 4DGOA 3OCBA 4WG3A 4IBMA 3BLHA 3BYSA 4XP3A 3CSVA 5M56A 5E9EA 3I6WA 5HEZA 5IMXA 4AQCA 4CZUA 1OL1A 4JJRA 4NIFB 2QURA 1IASA 3AC4A 3IDBA 1H00A 2PUUA 5DR2A 4FT0A 3QZFA 4UV0A 5GJDA 3WBLA 1NT2A 4ZAUA 3NYXA 2UW3A 4ASEA 4EHZA 3CTQA 3N4TA 4RX8A 3QZIA 5DT3A 4F0FA 4LM5A 3OF0A 5GIPE 1YHVA 3VW6A 4AN3A 1ZYCA 3G0FA 5AV4A 5K4JA 3ZC5A 3PXRA 2VNYA 2ZM4A 1UVRA 3U8WA 4G3CA 3N4UA 5CSHA 3F3ZA 4M0ZA 1X8BA 3VHEA 3DB6A 3HNGA 3OEFX 2DQ7X 2R3HA 3FLWA 4O96A 4Y73A 4EK3A 4YR8A 2PMOX 3ZOSA 4EORA 5KBRA 5IQGA 5JFSA 3CTHA 1H8FA 2WKMA 3ZXTA 5EW8A 5J1WA 3AKLA 3CPCA 3GB2A 4E5AX 3SA0A 4JAJA 3DXPA 3BQCA 2UZNA 4B8LA 3IW5A 4MUQA 5EW9A 3QUPA 4O7VA 4BI0A 1PXIA 3FDNA 3GU7A 3LW0A 2VTNA 4O0TA 1MP8A 1JNKA 3RAWA 4XS2A 1ND4A 4DFUA 1MRYA 4ZXTA 1FINA 4ENYA 1R0EA 4H39A 5DRDA 3R7GA 3QXOA 2BAJA 3QTZA 2QI8A 2J5FA 1OGYA 3LFSA 3ALNA 1T46A 2QU6A 4LGDA 3V3VA 3MS9A 3G51A 3KCFA 4K77A 4G9CA 4AGUA 1YXXA 2C6MA 4FV2A 4W4VA 4O2PA 3ZZEA 3C5IA 4TWPA 3PFQA 5TO8A 1MQ4A 3MPTA 4M69B 1PXLA 3ORXA 5KMNA 5M4FA 3ZSIA 4RLKA 4DA5A 2YM5A 3BE2A 3UDTA 5LARA 3TNHA 2B55A 4IVAA 2OIBA 3T3UA 5AX3A 4L3JA 5B0XA 3C5UA 2QO2A 3TIZA 5H3QA 4C4JA 5EQPA 4OAVB 4CG9A 3H3CA 4JIKA 2YDKA 3IO7A 4EHVA 2ESMA 4DFYA 3PLAE 2CKEA 4FIJA 4XG2A 4N6YA 5DA3A 3TKIA 5E1EA 4U8ZA 4A06A 5IUGA 3SXSA 2OICA 3FLNC 2NO3A 4EWHA 4NJ3A 1PXOA 4XG9A 2RKUA 5HTBA 4PPAA 3PIYA 4FUYA 4BRXA 2EXCX 5I9VA 2EU9A 4JDJA 5DOSA 3MB7A 3NYOA 4JDHA 4L7FA 3S00A 3L9LA 4D4RA 3QQJA 1YRPA 2ZDUA 4RZWA 4DYMA 4S34A 2VWZA 2XM8A 4FEXA 4NWMA 3VNTA 2J90A 5LMAA 4O27B 5E8XA 3JYAA 5CT0A 5CF8A 1YXSA 3O0GA 5A4LA 2HOGA 3O8UA 3NX8A 4FKWA 3R7OA 2ZDTA 3C0GA 3DKGA 2CLXA 3PE1A 4IFCA 2EUFB 3AC2A 3LXLA 1NVQA 4MWHA 2ZM3A 4FTLA 3MFSA 2Y4IC 2J0JA 4TTHB 4YC3A 5BVNA 2BDJA 3SLSA 4YHTA 4ZJJA 4YP8A 4RWJA 3QFVA 2C6TA 2R64A 3PY3A 2R3QA 4KSPA 3ZBFA 3ZLXA 5HORA 3M1SA 3R2BA 4K2RA 1NXKA 3HRBA 4N6ZA 4L45A 4R6VA 3ZEPA 4IMYA 3EFJA 5EKNA 3NS9A 3OXIA 3KXMA 3ZU7A 4EOSA 5I9ZA 4M7IA 3ZYAA 3OROA 4IVCA 1J7LA 1Q3WA 1H0VA 4ZTRA 2A1AB 3F2NA 5CAQA 3OT8A 5EW3A 2C1BA 4BFMA 4YZMA 2FA2A 3FQEA 4EBVA 4EJNA 4QP2A 4IH8A 2CNQA 3D83A 2Z7SA 4H58A 5KX8A 1V0BA 3GOKA 5DWRA 4FG8A 2W7XA 5M44A 2WMVA 3Q9ZA 4F6WA 4O22A 2Q0NA 4UMPA 5AJQA 3W0OA 3SV0A