2W5AA

Human nek2 kinase adp-bound
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
277
structure length
267
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSLHRDLKPANVFLDGKQNVKLGDFGLARILTSFAKTFVGTPYYMSPEQMNRMYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Insights Into the Conformational Variability and Regulation of Human Nek2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 267
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w5aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w5aA01
2WTWA 2ERZE 4PL4A 1JSTA 4AZEA 3SG8A 3EQPA 5FQDC 4RX9A 3W2QA 1XJDA 3TDWA 5FBOA 2IW6A 2ZV8A 2ZOQA 5J8IA 4IE9A 3LXKA 4AQCA 3BI6A 2NRUA 4RX7A 4WIHA 4IX3A 4MXAA 4QMQA 3ZLWA 3QLGA 4MXZA 4F1MA 3LMIA 4KRCA 2OSCA 3MW1A 4H3PA 3R83A 3LLAA 3VNTA 3QTWA 3R28A 5EDRA 3Q9ZA 4UALA 3LFQA 3ORLA 4FF8A 1UV5A 4XG3A 1P5EA 5D12A 3SW4A 2WZJA 4FOBA 1FVTA 3DKCA 1Q61A 1P14A 2RKUA 4GCJA 3QRJA 2YCSA 3F3TA 4EOSA 3QRKA 5J79A 2YLFA 3F3UA 2P33A 2HIWA 2W1CA 3OHTA 4MWHA 2W06A 4O83A 4TWCA 1OIUA 3MB7A 4YHTA 5CSXA 3BHVA 4FV8A 4YTCA 4A7CA 5IA4A 2O63A 4QT1A 2VV9A 3TJDA 3VQHA 2OWBA 3WIKA 4CXAA 3PXKA 4USDA 1BMKA 3R8LA 3ZOSA 3C7QA 4FKPA 4HOKA 3EQHA 4HGSA 5HICA 5BMSA 3GBZA 4IANA 2F7ZE 5M51A 1O6LA 5DEWA 3PG3A 4K6ZA 3ZEPA 2XK9A 3MY5A 2HZ0A 1WMKA 4FKJA 1F0QA 3ORZA 4M68A 3SC1A 3PY1A 4IH8A 3CC6A 3KCKA 3KVWA 3PRIA 2PE2A 3MYGA 5HCXA 3QTSA 3TV4A 4CYIA 4ZMFA 3F2RA 3A61A 4XRJA 2XIZA 3NUXA 2YIYA 3I79A 3R30A 2R7BA 1Q62A 4JIKA 4BI0A 1KOAA 3TZ7A 4HYHA 5IISA 2G1TA 3UVPA 4UMQA 4HVSA 2B9HA 3ZLXA 4BHZA 2KULA 2I0VA 4DEDA 5A54A 3F61A 4BKZA 3IOKA 3T9TA 3ENHA 5J1VA 4PL5A 5A4QA 4P4CA 4YMJA 3GVUA 3UO5A 2ESMA 4YGAA 5IUHA 2QR8A 4IB1A 4U97A 5GNKA 2W1FA 5B2LA 4QMLA 3KK9A 4RQVA 2VZ6A 4CKJA 4ANQA 3PE2A 3NR9A 5AP2A 3P0MA 3C4EA 2JKOA 3R8PA 1DI9A 3LZBA 3COMA 4YJRA 5F20A 1CKPA 3HRBA 4HPTE 3K54A 4UXLA 2XNPA 5E8UA 1NW1A 2P2IA 3O8UA 3LFBA 1YXTA 4MXXA 5CU2A 5C1QB 1JLUE 4IJ9A 4YURA 2BROA 4JDKA 4NKAA 2E9VA 2O3PA 3CBLA 3VC4A 4B9DA 5E7RA 4QO9A 3H9OA 3DK6A 3GC7A 5FDPA 3TWJA 4ZZMA 3VUHA 2R7IA 5JSMA 2EUFB 2J0KA 4GK3A 4N70A 3P9JA 4O7ZA 4YJVA 3UODA 3PXYA 3OBGA 5EYDA 4RJ4A 1WBOA 2CKPA 1TQMA 1UWJA 1ZOHA 2ONLC 4XOYA 2C3KA 4Y85A 4TN6A 2JDVA 5DMZA 2XIRA 2G2HA 2HCKA 1K9AA 2ZM1A 3SOCA 4RGJA 4OGRA 1OECA 1H08A 5K3YA 4I6BA 1H1QA 5DGZA 3BWFA 5JQ8A 4F9YA 3P7CA 3FZRA 3O51A 5AM7A 3D5XA 1KWPA 5K0XA 3Q4ZA 1WVYA 2QCSA 1UVRA 3D5UA 3QYZA 4RJ3A 2QHNA 2G2FA 5DN3A 5EYMA 3ZTXA 4GG5A 4XMOA 1Q8TA 4U8ZA 4A9YA 4I6HA 4LOOA 3SXRA 3TKHA 2BILB 2XCKA 3E64A 4B0GA 3PVBA 5FEQA 2QOOA 4M7IA 5CAOA 3KMUA 4RC2A 4RIOA 2IG7A 4FZ6A 2BIYA 2WU6A 1TKIA 4X3JA 2V55A 2ITNA 3D2KA 1PJKA 2HWPA 3EL8A 4BYIA 5EQEA 5IQGA 3O0GA 3Q5IA 1Q8WA 1Q3WA 2RG6A 3R6XA 4O21A 5AP5A 2WMTA 3NYOA 3ZUVA 1YWNA 2FB8A 2C69A 3U9CA 3Q96A 4O0VA 3FSFA 4XOZA 1KE5A 4KINA 3JVRA 5LVLA 3VS2A 5EH0A 3ZLYA 3CQUA 3G9NA 5JGBA 3LJ0A 4XV2A 2WTJA 3FPMA 4R77A 3H10A 1MRYA 3ORPA 4U40A 4W9WA 2GS6A 3RJCA 4B7TA 3E7VA 4D4VA 4PNKA 2BIKB 1YI4A 3TT0A 4IZ7A 3P08A 1HOWA 2Z02A 4RWKA 1OPLA 4I94A 4CKIA 2YACA 3EFKA 3WZDA 4OTPA 4EQUA 2XM8A 1ZYSA 3QTRA 2PUPA 2ZV2A 3M42A 5FXRA 3HL7A 4PUZA 4BCNA 5AV3A 1XWSA 5DVRA 3M1SA 1ZWSA 4FMQA 3QTUA 4GT3A 5K0KA 1NVRA 4KIOA 5AA8A 4BR3A 3E8EA 2NP8A 4XG2A 4WUNA 3LFEA 4RIXB 2NO3A 4QMZA 4PF4A 5CU4A 4CFUA 3HMOA 4FEUA 4YLJA 4Y72A 2GNLA 2YM7A 4DTBA 4DGNA 1Q41A 4R78A 3CPCA 3QQHA 1P4FA 3KCFA 4FC0A 5HG5A 4FA2A 4RG0A 3QRUA 4Q9ZA 4IVAA 3UG1A 4G6OA 2VO0A 3ZO3A 4AFEA 4OAUC 3R2BA 3BGPA 4PTGA 5ANGA 4DLJA 3R8VA 1UKIA 5GJDA 5A6OA 4FTAA 1Y8GA 4DH5A 4LL5A 4BIDA 4QMTA 2W17A 4NW5A 5EHLA 3NSZA 5ANJA 1H1WA 4EJNA 3L8XA 3OD6X 4JXFA 2YIRA 2BZIB 2VX3A 2QOIA 2YFXA 2P4IA 4FZ7A 3MTFA 3WF8A 3V5TA 3AMYA 3NGAA 2XJ1A 4C3RA 5FRIA 1YHSA 5HE0A 3MPMA 3E63A 3Q9WA 1PYXA 3TIYA 3ZXZA 1KV2A 4LMUA 5DI1A 4FR4A 5KE0A 4WA9A 4FK3A 3NYNA 3FLWA 5HG8A 2G9XA 1S9JA 4Y83A 4EH2A 1A48A 2IWIA 1PXMA 4L6QA 4W8DA 4CCUA 2CNQA 3KA0A 3POOA 5JFWA 4ZJIA 4QP3A 5E1SA 3UYTA 3IG7A 4CMUA 2ITXA 5BYZA 1DAYA 2Q83A 4GT4A 3UNZA 2NRYA 1W98A 4JX3A 4BDEA 3DK7A 3CXWA 4HGTA 2PZ5A 4JJRA 4GT5A 5BVKA 4PMSA 2HAKA 1DM2A 1RDQE 2R3NA 3LCDA 4A4XA 3QTZA 4O2PA 2WMSA 5HIBA 5F9EA 2OW3A 1Q5KA 5HD7A 5EM7A 4ENXA 3TM0A 2Z7SA 4FODA 2HW6A 4EOQA 3LQ3A 4P5QA 3TXOA 3IOPA 1M52A 3DY7A 1YXUA 3O17A 4ZTQA 3WBLA 3QA0A 4DH7A 5E8WA 1SVGA 2HYYA 2JDTA 2VTAA 3JY0A 3MVHA 3AXWA 3GCVA 4IX6A 3LKMA 4RC3A 4GJ3A 3TJCA 5C26A 2ACXA 3F9NA 4AA5A 5E90A 4CTCA 3PLSA 1XH5A 4HCUA 1ZY4A 4K1BA 4N4SA 3V8SA 1OBGA 1B6CB 4LGGA 3WZUA 5I3OA 3JS2A 3JVSA 4D0XA 1YWVA 4U6RA 4X21A 5KBRA 4IB5A 3H0YA 4PPBA 4X7QA 3QWKA 4OTFA 2XK8A 4YTFA 4S2ZA 3AC4A 2WMBA 4WNPA 4AFJA 4TKSA 3TDVA 1IG1A 4QYYA 1SZMA 2V5QA 2XH5A 4FYOA 1ZYJA 3MDYA 5EHOA 3RAHA 3OROA 1UNLA 4FKGA 4LV5A 2FUMA 4HNIA 3QL8A 4KIPA 3DNDA 2FYSA 3QTXA 4ANNA 3COKA 3I1AA 4M3QA 4AN3A 4ASEA 4X0MA 2CN8A 3EHAA 3ACJA 2VWBA 3DB8A 3R7VA 1HCLA 4DFZE 4NM0A 4FTJA 3KF4A 4O7RA 3DTCA 2YCQA 4IM3A 3OWPA 2QOKA 4FOCA 3UC3A 4RMZA 3W33A 3HV5A 3OXZA 4AZTA 3OY3A 3PIZA 5BUIA 2B7AA 5CT7A 4L68A 4Q5HA 4WSYA 2R0IA 3NUNA 3QCXA 4NM7A 1OKYA 4R3PA 5AV1A 2B54A 4ACCA 4FVQA 4BWPA 2VRXA 4LI5A 3K3IA 4QMNA 5HBJA 2OKRA 2RFSA 3MPAA 4GIIA 3D5WA 3C5IA 3DJ6A 2BALA 3U6HA 1J1CA 4EK4A 4FTTA 3LPBA 1V1KA 4H39A 4QP8A 5GZ9A 4FKUA 4BIBA 2I1MA 4NK9A 4ID7A 1NT2A 1IRKA 4O6LA 1PXJA 2XNGA 2VWZA 4G1WA 4IXPA 3F7ZA 4QPMA 3AC5A 2YIWA 4AG8A 3PY3A 3I5NA 4N0SA 4C4JA 5HKMA 5CXZA 5DG5A 4JBQA 4H1MA 1ZYCA 5E8YA 4JNWA 1TQIA 4JR3A 3UOKA 4AE6A 4F6WA 2WQEA 4FV9A 3VBYA 3BU5A 3JXWA 4QYEA 5AX9A 3S4QA 4DT9A 2R3KA 3GQLA 5BVEA 5J7HA 3I5ZA 4KD1A 1M14A 3ALOA 5AEPA 4NM3A 3Q32A 4XG6A 3E8NA 3BBWA 3SQQA 4MWIA 3FI2A 1CMKE 1ZARA 4AT3A 5ITAA 5CF6A 3PPJA 3Q04A 1JNKA 3TN8A 4I5CA 2JDSA 5HOAA 4DBXA 5DNRA 3FMHA 4TTHB 2W1EA 4I20A 3ZRKA 3ZO2A 2C6OA 2ZDTA 4NKSA 4C33A 4MCVA 2BUJA 1RW8A 4FTIA 3A7GA 4C4IA 1O6KA 4NZWB 2IZRA 2CHLA 2Z7LA 4G17A 5K9IA 3ZC5A 4IM0A 1J91A 2AYPA 2JD5A 1ZRZA 3CEKA 2WB8A 2CJMA 4EK5A 1JBPE 3KL8A 5AAGA 5M57A 3N9XA 3NIZA 4QMPA 4FBXA 2R3OA 5AR8A 1Y57A 4F70A 5A4EA 3DQWA 1GOLA 4L52A 4YZBA 4E20A 3FL5A 3LFCA 2QNJA 1GAGA 3DGKA 3GU5A 4YBJA 4XRLA 3FMKA 4LOPA 3NMUF 5D7AA 1MQBA 4OBPA 4BHNA 5CYIA 3VS6A 4JVGA 3ZSGA 2OH4A 4NTSA 3IDCA 1Q97A 3C1XA 4FT5A 4EH8A 3C4XA 4ITIA 3TV6A 1RQQA 3HGKA 4R3CA 4I0SA 5KNJA 5E4HA 5ANIA 2QOQA 4CZUA 4FL2A 2OJIA 4D5HA 1BI8A 4OT5A 3FHRA 4PPAA 3I6WA 2GTNA 3R7YA 2PVYA 3LCKA 3RCDA 4K18A 4MH7A 3QQUA 4NT4A 3GNIB 3BWJA 3L1SA 2W4KA 3UIUA 4AZFA 1MRUA 3UPZA 1ZAOA 4F63A 2VO6A 1ZLTA 3COHA 4MQ2A 2QURA 3RZBA 3LMGA 4IAIA 4RLLA 1PXIA 4BDIA 3BCEA 4IMYA 2H34A 4UMPA 2C0TA 3DQXA 4AZSA 3FKNA 2C0IA 1QCFA 4AUAA 4G2FA 3RINA 5CI6A 3Q6WA 4K9YA 3EN4A 3IW5A 2QLUA 5K4JA 5M09A 4C3FA 1PY5A 4J53A 3A7FA 1GY3A 4BZDA 1E9HA 4XNEA 4ERKA 4L3LA 3AQVA 3FY2A 1V0PA 4IHPA 5LCJA 4A4LA 2V0DA 2RGPA 1NY3A 4TT7A 3LMHA 4O7WA 4FNZA 3FI3A 1YDTE 4L67A 4RVKA 3CQWA 3D9VA 5KKRB 2W4JA 3Q4UA 5C8NA 4ACDA 2PZRA 1V0BA 4R3RA 2G15A 4RPVA 3F2AA 2W9ZB 3MGYA 2F4JA 3RI1A 5JK3A 2AUHA 1TQPA 2BPMA 5DR2A 3OP5A 2VU3A 3BGQA 3ORMA 4XHKB 1FVRA 4RA5A 2C6MA 5C01A 1PXNA 3U54A 4FYNA 4O1OA 3K3JA 2BZHB 2R0UA 5AADA 4U80A 3CY2A 3C5UA 4IAKA 2W96B 3SXSA 5IF1A 3KRLA 4ZOGA 2W1ZA 1WZYA 5DWRA 4EK6A 5CU3A 5HVKA 5IDPA 5CZIA 2X6DA 1XH9A 2QKRA 3MESA 4I23A 4G5PA 1FGKA 2WTCA 2PVNA 3PJ2A 5AM6A 3ZDUA 4BCIA 4DEEA 3PDTA 4ASZA 4X6RA 4I92A 3EB0A 4ONAA 4MKCA 4ZY6A 3ZHPC 5K5XA 3LQ8A 4QRCA 3V5WA 1JOWB 3IW6A 3NDMA 3TACA 3IECA 3UVRA 4DINA 3ZS5A 4WG3A 3O8PA 3PXZA 3KN5A 3MH1A 3NX8A 3JY9A 2RFDA 3OT3A 4QMWA 2QO2A 2Y6OA 3F2NA 5GIOE 1URWA 4C59A 4XG4A 2YISA 4FKIA 4BZOA 4DTKA 2LAVA 3NUAA 2C5OA 2UZLA 1OIYA 1W82A 1LEZA 3EFJA 3ODZX 3OW4A 2FO0A 4U44A 3ZM4A 5LVOA 5M06A 2HWOA 1W7HA 2QU5A 5JH6A 5E8TA 5KMMA 2OXXA 4HZRA 1H07A 4RIWA 1IASA 2FSMX 3JPVA 3UC4A 5AR4A 3RK9A 3EYHA 1G8AA 4CV8A 3U87A 4E1ZA 4E73A 2EXEA 3F5UA 2PMLX 5AP4A 2WXVA 2KTYA 2YDKA 5FDXA 2VWVA 3I4BA 4QNAA 4UMTA 1QMZA 3CKWA 4XV3A 5EYCA 1JAMA 2UZUE 4AGWA 5H9BA 5IA5A 4DE4A 4C37A 1URCA 2B1PA 4ACGA 1PMEA 4ZS0A 3AOXA 3CIKA 3UMXA 2ZM4A 2JIVA 4RA4A 5L6PA 4A9RA 1ZYDA 3DAJA 5IQHA 4K2RA 5IA0A 4E7WA 2R3LA 1OMWA 4XYFA 2UW5A 4FV7A 3ZMMA 4DEBA 1Y91A 5M07A 2PVRA 4BBFA 4YLLA 4ORKA 2XYNA 3MFRA 2X1NA 2UVXA 1FBNA 5F94A 2O5KA 3MVJA 4M0ZA 4CLIA 1IR3A 4M66A 1O6YA 2BTRA 1STCE 1YRPA 1QPJA 2VNWA 1Q4LA 3UOJA 4FL3A 4U81A 4RJ7A 2XK3A 4YC3A 2C6TA 4FTKA 4C3PA 3O2MA 3R2YA 2Y9QA 4FTMA 2PVFA 4U43A 3PA4A 3FI4A 3NUSA 3PJ8A 1NVSA 5CENA 5M4CA 1L3RE 4FEXA 3HUBA 2VTNA 4FSWA 3QTIA 3W16A 1AQ1A 2OGVA 5CAQA 2X7GA 4M8TA 4ALWA 2QOCA 2XJ0A 3DBQA 3HEGA 3KRJA 4DEIA 4EUUA 4O7TA 3VBVA 4BYJA 4E3CA 3QZGA 3EQGA 4JDHA 3FQHA 5I4NA 2WO6A 4WKQA 3QD2B 4QMUA 3R9HA 2R3MA 2Z7QA 3FMEA 4E5WA 2XNOA 2V22A 4DG3E 3AGMA 4QTDA 4E4NA 4EKKA 2C5XA 4F9AA 3V6SA 4PRJA 4FTNA 4C35A 5FP6A 2OLCA 3VS3A 3DBEA 2PVJA 3ORIA 4U7ZA 5L8JA 3FBVA 1U5QA 3D83A 4QOXA 4CQGA 2B55A 2GNJA 4AP7A 3O7LD 5CASA 2OZOA 1Q8ZA 3KGAA 2B9FA 3V04A 2B53A 5FM3A 3FYKX 3VUKA 5D9HA 4DEAA 1GIJA 4UMUA 2VGPA 1YOLA 4BGHA 2WEVA 3HECA 4FIJA 4TL0A 4ASDA 3F88A 4EKLA 4IAYA 5EM5A 2RFEA 2XEZA 4CEGA 3ERKA 5AR5A 5BX0A 3LFSA 4JQ7A 3EL7A 4A07A 4BDAA 4HJOA 4CFMA 3OWLA 2XMYA 3RNIA 4MF1A 5CAVA 4AW2A 2R3QA 2F2UA 1OB3A 4QP4A 4XJ0A 5EDPA 5FD2A 4D2RA 3SG9A 3FYJX 3POZA 4TYGA 5JFVA 5J9YA 5DH3A 5L2WA 3A7JA 2IN6A 2XEYA 5BVFA 2Y7JA 4I21A 4M69A 5GZAA 5CSPA 1KE7A 4O0TA 3HV4A 5CF4A 4XV1A 2CCHA 2JIUA 4JRVA 2Z60A 1AGWA 3AD6A 4IVDA 4EOOA 4JT3A 4DH3A 4FKQA 5BNJA 2PMNX 5HX8A 3UOHA 5I3RA 1APME 2XKDA 1XH8A 4GFMA 4I5HA 1I44A 3HYHA 5D1JA 3BELA 2OO8X 4QP1A 4RJ6A 2BRGA 5IKWA 5IH4A 5IH6A 1H1RA 5HTBA 3DKOA 4FTUA 3PVGA 4MNFA 3P7BA 4FV6A 5BQ0A 4ALVA 3RPSA 4FNYA 4J97A 3ZU7A 1ND4A 3HV3A 4NCTC 4FZAB 3WZJA 4CRSA 2VWWA 4L3PA 1PMUA 4RVLA 3DDQA 3THBA 5IDNA 4C8BA 5M4IA 3IONA 3EN7A 3HMPA 3B2TA 3CD8A 4IQ6A 5AUUA 3EQIA 4KWPA 1QPCA 2V7OA 1YHWA 3HA6A 3Q6UA 4LYNA 4UB7A 5EW3A 3VUGA 2R5TA 4EZ3A 1DAWA 1BLXA 2A2AA 4X2JA 4ZEGA 5BPYA 4AAAA 5E9EA 2OBJA 1AD5A 2J0MB 3DK3A 4IDVA 5HU3A 3GGFA 2Y4IB 5KMOA 1PKDA 4BBMA 1YVJA 4DF3A 5TO8A 1M7NA 3WF6A 1Y8YA 2QC6A 3T3VA 2C5YA 4HGEA 2FVDA 4FT9A 4WNOA 4UYNA 3DFCB 4EL9A 4Y95A 4E5BA 4XX9A 5BVNA 5IQEA 3N4UA 2VWUA 2J5FA 3D5VA 3DFAA 3FZSA 4ZTHA 3R9DA 3V3VA 3WILA 4AU8A 3T8OA 5EYKA 3ZUUA 3PPKA 1RE8A 3EQFA 5AP3A 5FEDA 4XP3A 5CT0A 3E92A 5E8VA 2OFUA 2G01A 2QO9A 3KXXA 2C0OA 3BHYA 5FTQA 2CNVA 3CQEA 3R7OA 4DFBA 5F4NA 4BCPA 4W4XA 1MP8A 2VWIA 3LM5A 1G8SA 4FIGA 4FKRA 4FKSA 1YW2A 3VBTA 2PU8A 1H4LA 4YTHA 2CKOA 4PMPA 3DXQA 3ULIA 4ACMA 4AS0A 4C4EA 3LHJA 3ACKA 3ODYX 4G6LA 3G6GA 3LAUA 4W8EA 4ZTRA 3BQCA 5FXSA 4RWLA 2QG7A 3UBDA 2WFYA 4TYJA 4OTGA 4RIWB 4BBEA 5LWNA 3ROCA 2CKQA 4C34A 1BI7A 2YJSA 3R7EA 5J95A 3EIDA 3HNGA 4CNHA 4XLIA 5CU0A 4BCOA 5GZ8A 2WTVA 3ZRMA 1FPUA 3PP0A 4B4LA 2OF2A 2DWBA 1ZYLA 4RLKA 4EOMA 2OI4X 4FTOA 3TKUA 1QPEA 3TI1A 3VS0A 3U9NA 3GQIA 2YM6A 3WF7A 3FL4A 5AR2A 2XF0A 3KXMA 5BVWA 3KRWA 3BLQA 1OUYA 2WOUA 2EU9A 3HP5A 4P5ZA 4H58A 2I0EA 4O0UA 4PMTA 4DG0E 2BZKB 3R1SA 4S30A 3EZRA 4F7SA 4O6EA 2R64A 2FSTX 4F64A 5LARA 2VTPA 4YJNA 3OUNB 3ZXTA 1BKXA 3UP2A 4IVBA 5B2MA 3T3UA 3PTGA 4E6DA 4NFMA 1SYKA 3T9IA 2XBAA 1PXOA 3ROYA 5JFXA 3VUMA 5JGDA 3PXFA 2GTMA 3BLRA 3LW0A 3GCPA 4YHFA 4HPUE 4CZYB 1YKRA 3UQFA 3FC2A 3EZVA 3BU3A 4H05A 4IX4A 2DS1A 4H3BA 3KXHA 2J0IA 2WTKB 3E88A 3EWHA 2RL5A 2VTLA 3IDPA 3NRMA 5CI7A 3ZDIA 5GJFA 3VHKA 4PDYA 3BE9A 4UBAA 1WBPA 1YOMA 3RAKA 4G6NA 1BL6A 3GP0A 3RK5A 3TV7A 4YNEA 5HNIX 1B38A 3C9WA 4L8MA 3NWWA 3FQEA 2Y6MA 4LRMA 3P78A 4PDOA 2XKEA 3KFAA 4TRLA 5EW9A 1JPAA 2X4FA 3OEFX 1VZOA 5KZIA 2PHKA 3ZFYA 2ITQA 4U42A 3CJFA 4D2VA 3AMBA 2H96A 4XEYA 4DH8A 3EFLA 4AWIA 4IIRA 2ZB1A 2JC6A 4V0GA 5ANEA 2C6IA 2JFLA 2R2PA 3GUBA 4C57A 5I9VA 4G5JA 4YSMA 2YM5A 4AOJA 3U8WA 5T68A 3COIA 2DQ7X 3FXWA 4IZAA 4DEHA 1OL5A 1ZZ2A 3BE2A 3D14A 5HBEA 3A4OX 3U4UA 3A62A 2HELA 3AT2A 5CVFA 2BFXA 3DKFA 3EFWA 1M17A 3L8VA 2HXLA 3C13A 4MXOA 3EQRA 5AR7A 2ZMCA 1MRVA 1GNGA 4I0RA 5LOHA 3OCSA 4I6QA 1PXPA 2JAVA 3RKBA 4KB8A 4W4YA 2BZJA 3HKOA 3FZTA 4CQEA 3F3VA 4O0YA 4EORA 3TCPA 3A4PA 2CNUA 2UW8A 3U4WA 4PL3A 3D94A 4QTBA 3F3WA 3GOPA 4Y5HA 4MQ1A 3DA6A 3L9PA 2YM8A 5EQPA 3RPVA 3VS7A 1PXKA 3QKKA 3QQLA 4M69B 3W2SA 2ZDUA 1Z5MA 4GU9A 2XNBA 2YITA 4EEVA 4E6CA 1SMHA 5AUYA 4LFIA 4IJPA 5CEIA 4IZ5A 5CS6A 4GMYA 4AE9A 2JDRA 2UW4A 5CEOA 1I09A 3HLLA 1GZOA 3DZQA 4DITA 4L7FA 5AV2A 5H2UA 4RFMA 2QQ7A 5LCKA 2IW8A 4EOIA 5BVDA 2AC5A 1ATPE 3W32A 2WEIA 4WRGA 4FG7A 5HESA 5IQCA 3BLHA 4DN5A 4FSRA 1OL7A 1Y6AA 4WD5A 2XIKA 3OW3A 4C2WA 3LFNA 1GIHA 3MY0A 4NW6A 4JBVA 4R1YA 4CCBA 5M44A 3OEZA 4FUXA 3PIYA 1T45A 3VWAA 3DS6A 3CE3A 3VRZA 1OITA 3FXZA 5A14A 3F7WA 3NYXA 1IAJA 3EN5A 3E5AA 2BTSA 2QO7A 3GENA 4DGOA 4FSUA 4IWDA 4GJ2A 3SX9A 2PMIA 2REIA 3AD5A 4NTTA 3ID6C 2JIIA 2VTQA 3IKAA 2UZTA 3NNWA 4O1PA 4FNWA 2UW7A 2RF9A 5EK7A 4XH6A 5ETAA 5HO6A 2C5NA 3ZO4A 1M2QA 3FZOA 2GMXA 3DKGA 5D41A 4QQTA 3QGWA 3DTWA 1PHKA 4BCFA 3BV3A 4AOIA 3FI8A 3R7IA 5CEQA 3VF8A 1OPKA 2EVAA 5GHVA 3WE4A 5LVPA 1CDKA 3MSSA 3E62A 2PMOX 4K0YA 2OFVA 3TNWA 1LR4A 2PUIA 1JVPP 3AC3A 5HLNA 3KULA 2VD5A 2RIOA 5ACKA 3TZ9A 4GVJA 3PVUA 4EUTA 4ZXTA 4YO4A 2XYUA 4EZ7A 3FEGA 4F7JA 1JKLA 3WYYA 4CFWA 5J1WA 4D4SA 2YDJA 5HCYA 1RJBA 3KF7A 3EKKA 4ZLYA 3PG1A 3PZEA 2Y0AA 3QF9A 1JQHA 2BRHA 3UNKA 2H8HA 3ANRA 1FOTA 3CR0A 5HE1A 2R3JA 3LCTA 1PYEA 2EXMA 4MXCA 2IPXA 3QXOA 2ZMDA 2Y8OA 3V5QA 4AW1A 3II5A 2E9OA 1LUFA 1WFCA 2CKEA 3CD3A 4UZHA 4C0TA 4P7EA 2JBPA 4KIQA 3NS9A 3HP2A 2ZJWA 3QD4A 2JFMA 1YQJA 3PSDA 3QHWA 3TIZA 3TUBA 4L44A 4QMXA 2XRWA 4TW9A 1EH4A 4FUYA 2ITVA 3E3BX 3HDMA 4BTMA 3PP1A 5DBXA 5JMSA 3Q60A 4O7LA 3A99A 1OGUA 3OCTA 2GQRA 5DIAA 4DA5A 3DAKA 3HMIA 4G31A 1UNHA 3L8SA 3QCYA 2EB3A 2XM9A 1NVQA 3G51A 2XJ2A 2WQNA 3I60A 3MIAA 5AIRA 3W2RA 3W2OA 4BKJA 5A4CA 4O7YA 3BBTB 3ORNA 4O7VA 3O50A 1FGIA 5L2TA 4ZP5A 4ENYA 3RAWA 2QODA 3VS4A 4CSVA 3QYWA 3A7IA 4MAOA 2FA2A 4GW8A 3MPTA 5IQDA 5A4LA 4IX5A 4EONA 5CEPA 2I7QA 4J71A 4A06A 1H01A 4IWQA 3CPBA 3OVVA 4AGCA 5BYYA 2PVKA 2X2KA 3OWJA 2GCDA 4JG7A 4D55A 4D2SA 3SA0A 3F5PA 3VJNA 3QD0A 3E7OA 4KSQA 1OI9A 4YJPA 5IEXA 2B9IA 2X2LA 3AT4A 4B6LA 4BTFA 5HD4A 5CANA 5HG9A 2W05A 5ETCA 3ETAA 5AV0A 4FEVA 1A06A 4S32A 3RTPA 2X81A 4KSPA 4MD9E 4O91A 4UN0C 1P4OA 2O2UA 4ARKA 4TWNA 4HVGA 5E8SA 4E4MA 2CCIA 3FC1X 4F0GA 2V7AA 3PSBA 4WG4A 5FEEA 3PJCA 2HY81 3G2FA 3IS5A 3G5DA 4K77A 3SV0A 2BVAA 4GVAA 4KAOA 3KXZA 3UZPA 2J9MA 4HCVA 1JKTA 2ZV7A 2ITYA 5HHWA 4O81A 4DCAA 2IO6A 3W2CA 2CGXA 3QUPA 4X3FC 5L2SA 1BUHA 4FSQA 4V0GB 5A3XA 4F6UA 1Z57A 4USFA 3TUCA 4KNBA 3LFAA 4C7TA 2GHGA 3NEWA 3QD3A 3VUIA 3HV7A 3GCQA 4G9RA 3BKBA 4YZMA 2PULA 3QKLA 4FEQA 3UOLA 4YUQA 2GDOA 3P5KA 2WU7A 3QLFA 3LM0A 5KMIA 3BYSA 1YDRE 2OIBA 4BI1A 3WARA 4I22A 3V6RA 4QMMA 1XH7A 2XNMA 4D1ZA 4ZTMA 1FMKA 2HOGA 2BHHA 3MB6A 3W1FA 4RX5A 1NXKA 3QWJA 3QKMA 4BF2A 5E92A 1ZY5A 3NCGA 3MVLA 3HAVA 1GZKA 3CY3A 4FKOA 5HIEA 1PRYA 4PP7A 1YI6A 4L53A 5L2IA 2OZAA 3FLSA 2GNGA 3EOCA 4EH7A 4GSBA 3BYUA 1CSNA 4QMVA 4C4GA 2WMAA 4JQ8A 5LVNA 3VF9A 3KN6A 3V5LA 2YIXA 3R73A 1OKZA 3QU0A 2RFNA 1XO2B 4DH1A 3D7TA 5CF5A 5EM8A 2PZYA 3R1YA 5KHWA 2BAKA 4FNXA 2CMWA 3DBDA 3OXIA 4X6QC 3IGOA 3OUKA 1YWRA 4CT2A 2UZWE 4YZ9A 1JSUA 4O7NA 5EI6A 2BAQA 5D11A 2GQGA 4YP8A 3QUEA 2WTDA 5CSHA 5FLFA 3NUPA 5C03A 5DT0A 1VJYA 2OF4A 2WMXA 4B8LA 3QRTA 3AGLA 1H0WA 4PDPA 3VVHA 4CYJA 2XBJA 3Q2MA 3RALA 5EOLA 3O71A 3FKOA 4O0SA 4ZY5A 4UWCA 3AC2A 5JT2A 3V5JA 5I9YA 1O9UA 5LWMA 5AWMA 5DR9A 2R3GA 3N51A 3PYYA 1UU3A 4R5SA 4JQEA 5BUJA 3SDJA 3HDNA 4BDGA 5DOSA 4O22A 5KMJA 3S00A 1JWHA 2OJFE 5L3AA 3RHXA 4CZTA 2ONLA 3HZTA 3OY1A 2YABA 2DUVA 1OL2A 2IZUA 4WBOA 3MFTA 4ZS4A 2A0CX 5DYJA 2WELA 1GZ8A 4ZZNA 1XH6A 2QI8A 2VUWA 1YI3A 4L00A 3KULB 5B0XA 4RFZA 4IFCA 2XK6A 3R7UA 3UO6A 4E26A 4BCQA 1VYZA 1ZOEA 2E9NA 2Z8CA 4D2TA 1XBAA 3BYVA 1X8BA 4E8AA 4GU6A 2ITPA 3G6HA 3PRFA 2X7OA 2QOLA 5AUXA 3TNPC 4KIKA 4O0RA 2XVDA 3ATTA 3A8WA 4G34A 5CU6A 2X39A 2GU8A 1UU9A 3ZBFA 5HIDA 1GIIA 1YXXA 4O2ZA 4NUSA 3HX4A 4HYIA 4ZTNA 4CLJA 4QP6A 3VW8A 2WIPA 4J95A 5EKNA 1XR1A 3VUDA 5CAUA 4FEWA 1Q8UA 5LMKC 2C4GA 4PTCA 4EOPA 3CGOA 5HE3A 4RBLA 2ZYBA 3MV5A 1WCCA 3DJ7A 3OZ6A 5HO8A 3IO7A 5H8EA 2XRUA 3MWUA 3VS5A 4EOKA 5C8KA 3CP9A 4XG8A 4O82A 2PYWA 4S34A 4UYAA 4C62A 3FQSA 3ZM9A 4EQMA 5CXHA 1R0EA 5EI8A 4D1SA 2WMVA 3UQGA 3MH2A 2WMQA 2XS0A 4QPAA 4EHVA 1WVWA 2VN9A 3FSKA 3PA5A 4EC9A 5CVHA 5M55A 4F0IA 2QLQA 5EI2A 3BZ3A 4M67A 4XG9A 3FE3A 1U46A 4R6VA 4AF3A 3OTVA 1CM8A 3B8RA 3S2PA 2Y4PA 3LOKA 5FTOA 5KZ0A 5J9LA 2A1AB 3WZKA 4PNIA 2YCRA 3RM7A 4AA0A 3F66A 1CTPE 3RP9A 2CPKE 3F6XA 4FG9A 4E6AA 4YC8A 3FV8A 3N4TA 3QXPA 4KBCA 3EQCA 4FGRA 2WNTA 3QZFA 3RHKA 2Z7RA 1U59A 4RC4A 1H8FA 3UE4A 1PW2A 4YPSA 1IA9A 3LVPA 4BY9E 4E5AX 2C3LA 4OTHA 2ETKA 3QX4A 4RSSA 3DJ5A 2YWPA 4M14A 3GU6A 3L8PA 4XV9A 4APPA 3F5XA 4ZJJA 3S1HA 4F4PA 4IWOA 4D2WA 4DHFA 2OK1A 3AMAA 1H24A 4ITHA 4MXYA 1CKJA 2YWVA 4DLIA 1H1SA 3OFMA 3TTJA 3VBWA 4NJDA 4FV4A 4UEUA 4LGHA 3GB2A 3QA8A 2Q0BA 5HTCA 2IZSA 4RVMA 4ANLA 3ZUTA 5IZFA 3ZRLA 3A8XA 3RNYA 3D15A 3BQRA 4AZVA 4IM2A 4BTKA 1ZOGA 2UZEA 2B9JA 5HLPA 2VAGA 3R1QA 5L2QA 2UW3A 2WQBA 4BZNA 2UZVA 3UJGA 4Z55A 3UP7A 3IK3A 3UG2A 4D9UA 5CX9A 3RZFA 3G9LX 4OTQA 3ZFXA 1Q99A 4FG8A 5CQWA 4DAWA 3EJ1A 3O96A 2CDZA 4L46A 3SOAA 1MUOA 5M4UA 1OVEA 2GPHA 1KOBA 3C50A 4FT3A 3VBXA 2O65A 2BKKA 1SVEA 3DT1A 2IVTA 3QC4A 5AUVA 2X6EA 3GCUA 3P1AA 3ZONA 5A4TA 4QMYA 3PJ3A 3KMMA 5EM6A 3HRCA 3FWQA 4M0YA 4RX8A 1G5SA 4YJQA 4TNBA 4DBNA 2EWAA 3GFWA 5AAEA 4EQCA 1YOJA 2UV2A 5IG1A 3VULA 4BVUA 4YLKA 4DGMA 5IEYA 2R9SA 2WMRA 5CNOA 2R3FA 3JR1A 3ORXA 4JDIA 1PMVA 3EH9A 5J5SA 3C4ZA 3OTUA 1VYWA 1H25A 4LG4A 3WOWA 4BDFA 4JDJA 4JLCA 2W1HA 5CTPA 2OZAB 3REPA 3OCBA 5HO7A 2PUUA 5ANKA 4AXAA 3F82A 1WAKA 4U45A 4FV3A 2YERA 3LXNA 3R8UA 3IW8A 4TXCA 1ZMUA 3UIMA 3V51A 2GFSA 4AGUA 4C4FA 1U4DA 2OICA 4QQCA 3H9FA 2XNEA 1R1WA 3NNVA 2B0QA 3D7TB 3HMMA 4U3YA 4EWQA 5CEKA 1DI8A 2A4LA 3QQKA 2CGUA 3QCSA 4WOVA 4DG2E 3NCZA 3UIBA 4YBKA 4FKTA 3FZ1A 2R4BA 4RVTA 4RT7A 2ERKA 2XK4A 2NPQA 5AUTA 5C27A 2I6LA 5A6NA 5A9UA 3P86A 4IB3A 2G2IA 4AN2A 4MX9A 4UXQA 4IW0A 2VTIA 3LXLA 4MD7E 4XP2A 3WE8A 1R0PA 3DOGA 2C68A 2X8EA 3ZBXA 5KO1A 3R63A 3BU6A 4Z9LA 4Z7HA 3DU8A 5DLSA 4BCMA 3FKLA 4EYJA 4Y73A 5JRQA 4JR7A 4W4VA 2P0CA 4TYHA 4LRKA 4YR8A 4CFVA 4FV5A 2I0HA 2UVZA 4D0WA 4O7SA 3SRVA 3NZ0A 3UDBA 4WSQA 3ULZA 4EBWA 3RPOA 4FIIA 5IQIA 1NA7A 1BYGA 4L3JA 2BAJA 4FKWA 3DBCA 4C38A 2ITTA 4XUFA 3UZTA 1UWHA 4RJ8A 4U9AA 3KMWA 3Q2JA 2BRMA 2QHMA 3W18A 4PWNA 4IZYA 4ITJA 1H28A 4W4WA 4LMNA 5CLPA 4GL9A 4GYIA 4OT6A 2WQOA 4KIKB 3F5GA 3KVXA 5K4IA 4M12A 4Q2AA 3R8ZA 2ZAZA 1OKVA 1ZZLA 2PZIA 3ORKA 1F5QA 2JBOA 4X3FA 5DRDA 4BCJA 4CGAA 1W84A 3UPXA 3OF0A 3ZZEA 2QD9A 3IW7A 4QTAA 3E87A 4HYSA 5D7VA 2YM4A 3OOMA 3ZZWA 3C51A 4XLVA 3VQUA 4BC6A 4ALUA 4TY1A 3AC1A 4TZRA 3O23A 4QMOA 2W5HA 4XBRA 5EOBA 3ATSA 4O84A 5BYLA 4IAFA 2J50A 1T46A 5EW8A 1OBDA 3KKVA 4GEOA 4BTJA 2H6DA 2YZAA 4MHAA 3LQ5A 1OL6A 2ZVAA 4APCA 1REKA 4YU2A 4N6ZA 4NFNA 4A9SA 5J7BA 1J7LA 1M2PA 4D1XA 4JRNA 2WAJA 3DBFA 4Y8DA 4YC6A 4FT0A 4F0FA 4YNOA 3PIXA 2PE1A 3GI3A 2UW6A 3QQGA 3BIZA 3P23A 5I9XA 4PMMA 4CG9A 4G3CA 4OTRA 4EH4A 3CTJA 4EHGA 5M56A 1E1XA 2CGVA 2PVHA 5I9WA 3M2WA 4D9TA 3QFVA 2VTOA 3MS9A 3OXTA 5A46A 5LQFA 3QC9A 3R9OA 4QYHA 2DYLA 4WUAA 2YLEA 4J8MA 4IC7A 2BRNA 2YJRA 3FLYA 4F08A 4D4YA 3IW4A 4JAJA 2FGIA 4QYGA 3MI9A 5AMNA 2XIYA 4D2PA 4ZY4A 4X2GA 1IAHA 2X8IA 4NEUA 4F9CA 3BEAA 3ALNA 2PK9A 4OR5A 2PVMA 5KBQA 3ZYAA 5KX8A 3CLYA 3QZHA 3UO4A 5AFVA 2X0GA 2ZV9A 3WI6A 3OC1A 3QQJA 4X2KA 3UZRA 3DNEA 5H8BA 2BFYA 3Q5ZA 3TZ8A 4EOLA 2ZM3A 5L8LA 5DE2A 5DFPA 1KSWA 3WZEA 5IPJA 5JFSA 1P2AA 2R3RA 3Q9YA 3MVMA 4MEDA 5F1ZA 3TTIA 3QHRA 3U6IA 4PDSA 2ETRA 3DZOA 4D28A 1W8CA 3NW6A 2VTHA 3DAEA 3OCGA 4WNMA 5JRSA 4BL1A 4HVDA 2YZLA 3UTOA 3W2PA 4EJ7A 3IGGA 3SAYA 2IJMA 3R0TA 4XCUA 3QAME 2C6LA 3ZCLA 5T3QA 4L01A 4DCEA 3ORTA 4F9BA 3FMDA 4TNDA 3QQFA 1YHVA 3DV3A 4BRXA 5IA3A 3KREA 5AX3A 5FBNC 5HGIA 2A19B 3PJ1A 5EFQA 3SW7A 1IA8A 3QUDA 5ACBC 2Z2WA 3RCJA 3RK7A 3SLSA 4F09A 3Q4TA 4EBVA 5HVYA 4MBIA 2P55A 3W10A 3NUYA 3ET7A 3PVWA 2E2BA 5CQUA 4FSYA 3H4JA 3KU2A 3W8QA 3B8QA 1OM1A 4IWPA 5H8GA 4JOAA 1A9UA 1KE6A 4X2NA 2C30A 4ZTLA 3Q3BA 4M15A 2OIDA 4JL9A 4F7NA 3E3PA 3FLQA 3PWDA 4NJ3A 1WBVA 4KS8A 4B8MA 4KKGA 3C4CA 2HENA 5LMAA 5I5ZA 3B2WA 3U55A 4FGBA 5L4QA 5LMKA 1LEWA 5DA3A 4OTIA 1JKKA 4E4LA 2F2CB 3MTLA 2YM3A 5K5NA 4R7BA 5AAFA 3QX2A 4GIHA 4EH9A 1WVXA 4G3GA 5BUEA 5HNBA 1ZMWA 5J9ZA 5DRBA 5L8KA 2IVSA 4KS7A 3OWKA 4ZAUA 4LUEA 4ANOA 3L9LA 4NSTA 5DEYA 5C4LA 4L45A 3NUUA 3QCQA 1WBSA 5AR3A 1LP4A 2VWYA 2R3PA 4MBJA 2XB7A 5M53A 4QPSA 5B2KA 2GSFA 3C0HA 4RZVA 5AV4A 3OT8A 3GCSA 4KBAA 3PY0A 5C8MA 2P3GX 3FMNA 4FIHA 4R8QA 5HEZA 3GOKA 4QD6A 4BDBA 2C3JA 2CSNA 5F95A 4N57A 3V01A 3RPYA 1VR2A 1SNXA 2FH9A 3DXNA 4TYHB 2FSLX 2VTTA 4Q9SA 4I5MA 4L7SA 2F7EE 5TOZA 2J90A 3BYMA 2UUEA 3EKNA 3EQDA 3SRVB 4I5PA 4MF0A 3K5UA 4IBMA 4CFNA 2Y4IC 5DR6A 4BCGA 5IMXA 4FSNA 4ANBA 2B4SB 2O64A 4KABA 3QGYA 1XQZA 4N6YA 5EKOA 4NIFA 3NW7A 2W1GA 5JGAA 3UGCA 3K5VA 2W1DA 4WO5A 1KV1A 3VRYA 3E93A 3RAIA 4GYGA 4ZSLA 3TG1A 4D5KA 4FV2A 4ZMEA 2PY3A 3PWYA 5IA2A 3OMVA 1SM2A 4FK6A 2QOBA 4GH2A 5KMKA 1SVHA 5LXMA 2PUNA 3PLAE 1K3AA 2VTSA 3PXQA 4X3FB 2OJ9A 2WHBA 3DXPA 3PPZA 2VTJA 1R78A 2PTKA 3MIYA 3QTQA 1OKWA 4IAAA 4K33A 3AT3A 3RBWA 2ITZA 4JG6A 4UV0A 5KMLA 5EHYA 5CWZA 4ZSEA 5LVMA 4ZLZA 2J7TA 4D4RA 1OUKA 3BPRA 3MA6A 4F1OA 4F7LA 4ERWA 5M4FA 2C6KA 5FGKA 5L6WL 2BMCA 2B52A 3VHEA 4JIAA 2UZDA 2QU6A 1Z9XA 3DLSA 3OS3A 4UX9A 4IDTA 3S95A 3LCSA 5GIPE 1KUTA 3MH0A 1GZNA 4BKYA 4I0TA 4H36A 3R9RA 5ETFA 4Z3VA 1BX6A 3BX5A 2JAMA 2GNIA 3O7LB 3ZH8A 1ZXEA 4DT8A 3AD4A 1YDSE 1YXVA 4MK0A 5IA1A 2UZOA 4K11A 1V0OA 4JG8A 2W0JA 4GFOA 2JEDA 4WNKA 3VS1A 3KRXA 3GC0A 4G3DA 3VO3A 2VX1A 3HRFA 4K8AA 3NPCA 4OTDA 4RJ5A 4Y46A 4YPDA 4O86A 4GV1A 4CD0A 2O8YA 4BWKA 2E9UA 1U5RA 4CMTA 4BDHA 4DFYA 4F6SA 5AP6A 4KUJA 3BGZA 4CKRA 2HZ4A 3V8TA 4DFLA 4AOTA 1UU8A 4U5JA 4UWYA 3O8TA 4RWIA 1JSVA 2WD1A 4TWPA 4U41A 3E8CA 4QTCA 2EB2A 3I7CA 2GQSA 3R1NA 2PPQA 1JKSA 4TWOA 5HTIA 4KRDA 5CSWA 4BI2A 3HMNA 2J5EA 4J98A 4I4EA 5TT7A 3WIGA 4ZLOA 3RVGA 5DT3A 3TZMA 2YIQA 4CRLA 3UVQA 1J1BA 3Q4CA 2WTKC 4GK2A 4PY1A 3R21A 3KXNA 2YAKA 4WBBB 4QQ5A 4CFFA 1QL6A 1WBWA 1KE8A 4RQKA 5CSVA 2QOFA 4FSZA 5T6KA 4YJTA 4AX8A 1XHAA 3FMMA 3RM6A 2WMWA 5HORA 4H3QA 1OPJA 3VUTA 1R39A 4O0WA 3I0QA 4DC2A 2SRCA 4EYMA 2GHLA 1BL7A 4NH1A 2HY0A 3DCVA 3VN9A 2W9FB 2BR1A 4F1TA 3LIJA 3A7HA 4XS2A 4QP7A 4MNEA 5CZHA 4DTAA 4KA3A 5JZNA 3D0EA 3K2LA 4QQJA 5B7VA 3BRBA 2YCFA 2GHMA 3ZO1A 3ZEWA 4HVIA 4ZSJA 4RFYA 1W0XC 4C58A 3GFEA 3CGFA 2JKMA 2XNNA 3H9RA 3NNXA 4EH5A 3QRIA 4JX7A 4RWJA 2O0UA 1R3CA 3FPQA 1UA2A 2RSVA 3HV6A 4XP0A 5HQ0A 1HCKA 5IUGA 4NCTA 3A2CA 1MQ4A 3NYVA 4FE2A 2QR7A 4UWBA 4MBLA 4I3ZA 1XBBA 1OIQA 2BDWA 2XUUA 3UIXA 4EWHA 3R04A 3LFDA 1WBTA 3TEIA 3MBLA 4C02A 4CFXA 3MY1A 4FV1A 2J0LA 3PXRA 3SVVA 3FLNC 5H3QA 4BCKA 2X8DA 4PTEA 5BVOA 2CGWA 3BHUA 3KK8A 4FTQA 4IACA 5IUIA 3OOGA 3BV2A 4R5YA 4YHJA 2VTRA 2WQMA 4J1RA 4WT6A 5HI2A 2BCJA 4OTWA 3GXLA 1XBCA 2F7XE 3LJ1A 3ZSIA 1FQ1B 4ACHA 4EHZA 3OBJA 1UNGA 2YDIA 3ENMA 1M2RA 2BHEA 4UZDA 4GUBA 2EXCX 3DLZA 1ZMVA 3ZFMA 4QP9A 3Q52A 5HLWA 5AUZA 3ZLSA 5I0BA 3R9NA 3EYGA 4R7IA 3MJ2A 3PSCA 5JZJA 2PVLA 4CTBA 3QBNA 1B39A 2J6MA 1VEBA 3NW5A 4LUDA 2XA4A 4LGDA 4A4OA 4AT4A 3FAAA 4E6QA 3KXGA 2J51A 3OG7A 1TVOA 3GU7A 3H30A 3IQ7A 3QALE 3I81A 4J99A 4RIYA 5DT4A 3SXFA 4AA4A 5ANOA 5AA9A 3CJGA 3EMGA 2JKQA 2W5BA 2UW9A 3F69A 4KKHA 1DS5A 1GJOA 5J87A 5CF8A 4FZDB 4QYFA 2CLXA 4BICA 2UVYA 2GS2A 5JEBA 3MFUA 4YZCA 4J7BA 3GC9A 3CTHA 4PV0A 4ANMA 1IEPA 4CMOA 5AP0A 2F57A 2X9EA 3R8MA 2OJJA 2X4ZA 3AC8A 3R01A 4V01A 4ZK5A 3VBQA 4G16A 4U0IA 4ZZOA 4FSTA 4U79A 4O0XA 4TYEA 3KQ7A 4DGGA 5M08A 4NIFB 2JITA 3BHHA 3GU8A 4BFMA 4FIFA 3HA8A 2PZPA 3AG9A 3FZPA 1W83A 1PKGA 4J96A 3VJOA 4BGGA 4LL0A 3Q9XA 3CSVA 3VAPA 5HCZA 3RMFA 5DPVA 3CCNA 4DFXE 2WKMA 3QZIA 3S0OA 3I6UA 3NIEA 3GC8A 3V8WA 3TNIA 5LMBA 5JN2A 4BCHA 4AN9A 4Y5QA 4YJOA 2C6EA 5AJQA 4WG5A 2XK7A 1QPDA 4ASXA 3NAXA 3PFQA 4S33A 4EK3A 3LXPA 4CT1A 2OIQA 1LPUA 5HE2A 4EC8A 1J7IA 3HAMA 4OBOA 4NM5A 3PA3A 1PXLA 2BKZA 4S31A 5IU2A 5BMMA 4JBOA 4OUCA 3CTQA 4M84A 3P7AA 4CVAA 3LE6A 4P2KA 4YO6A 1J3HA 4B99A 2BDJA 2UZBA 5KHXA 2X7FA 2WMUA 3Q53A 1J7UA 2JGZA 5JQ5A 2C3IB 3L9MA 1FMOE 1Q24A 2BRBA 3R00A 1KE9A 2WOTA 3KY2A 2C47A 4M97A 4X2FA 3ZC6A 4QNYA 1U54A 3L9NA 4LRJA 2OG8A 4TPTA 2JDOA 3DPKA 4HZSA 2JKKA 4D58A 4I6FA 5TR6A 3JUHA 2HK5A 2QVSE 3R22A 4GUEA 5IMEA 2GFCA 1H0VA 3FDNA 2XZSA 4BGQA 3SGCA 4P90A 4IEBA 5E8ZA 3H3CA 5E91A 4IAZA 3GU4A 1FVVA 4BIEA 4DYMA 2IVVA 3C4FA 3P79A 5TKDA 4I4FA 4IVCA 2VNYA 4J52A 3FLZA 1REJA 4IC8A 4R7HA 4FT7A 3ANQA 4C2VA 4MVFA 2R3IA 1OL1A 4O38A 4BDJA 4FIEA 3KC3A 2RG5A 3DDPA 3CS9A 3KRRA 2ITWA 4GFGA 4GS6A 4R1VA 4IB0A 2V62A 4TYIA 4II5A 2YN8A 4NU1A 3MJ1A 4FV0A 4DFNA 5LJJA 5GJGA 4RRVA 4KKEA 5C4KA 2HZNA 2IZTA 5AP1A 2WTIA 3V5PA 3FUPA 5HZNA 2OJGA 2QKWB 2VO7A 3E8DA 4Q5EA 2P2HA 3R71A 4BDDA 5IEVA 3NLBA 4F65A 3F3ZA 5G6VA 4YTIA 1M7QA 2GNFA 4DGLC 1G3NA 3LLTA 5HU9A 2OXDA 4EZ5A 2W4OA 1Y6BA 4MTAA 4YZNA 4G9CA 1H26A 2J4ZA 3GT8A 2W5AA 5CNNA 4MNEB 5AIKA 4ZJVA 2X9FA 4NL0A 3FXXA 5GINE 4NWMA 5D10A 4C36A 4FTRA 1ERKA 4LOQA 4FKLA 2YA9A 3BEGA 4A9TA 3SKCA 4HW7A 2UW0A 5IQFA 1S9IA 2XKFA 5CAPA 3R7GA 4BB4A 2PE0A 2YAAA 4XG7A 4PPCA 2HXQA 4LQMA 4F9WA 3U6JA 1XH4A 5FM2A 1UKHA 3G33A 5FTGA 2HW7A 4FZFB 4QMSA 3NVKI 2GS7A 2W99B 4DEGA 1E1VA 2J0JA 3G0EA 5EG3A 2QONA 2C1AA 5IQBA 3P4KA 1PF8A 2QG5A 2W1IA 3R02A 4IFGA 1FINA 4HGLA 2BDFA 2UZNA 5KCVA 2C1BA 5ETIA 3D4QA 5HX6A 5IH5A 3LFFA 4J8NA 4AACA 4FTLA 5CALA 4G3FA 4MYGA 4FSMA 4YSJA 2VO3A 1H00A 5AP7A 4G3EA 5AUWA 3NVMB 3TL8A 4BN1A 2AC3A 4A9UA 4EOJA 2PSQA 3UYSA 4E4XA 2WPAA 4PQNA 4GRBA 2VWXA 2I0YA 4V05A 4MD8E 4OLIA 5FG8A 5FUTA 4JI9A 4BDKA 2YEXA 3I7BA 1OIRA 2QOHA 2XP2A 1F3MC 5G1XA 5EDQA 3FMJA 4GK4A 2OXYA 3TNHA 3H0ZA 3IPHA 4E93A 1PMNA 3RWPA 4FTCA 3PE1A 4AW5A 4RIYB 4O96A 4PP9A 3A60A 4CV9A 2VTMA 4FKVA 5E8XA 5HVJA 4CG8A 3MN3A 5ANDA 2IW9A 3WF5A 2ETMA 3HUCA 3UMWA 3WF9A 2E9PA 3PUPA 2R3HA 4FVPA 5HBHA 3NNUA 2J2IB 5HNGA 5CEMA 5I9ZA 5CY3A 1CKIA 2XIXA 5ICPA 4BDCA 5IQAA 4ZSGA 2CN5A 2VGOA 5I9UA 5FWKK 3MFSA 3S3IA 3RWQA 2Q0NA 3D2IA 4IADA 3WYXA 2FSOX 4H1JA 2WGJA 3CKXA 4OW8A 4V04A 3ITZA 2PWLA 3EN9A 3NAYA 4I93A 4FL1A 4YJUA 4JAIA 3RPRA 2XKCA 4I41A 3C0IA 4M13A 1Q8YA 4BWXA 1L8TA 2YHVA 3U51A 3FY0A 4HVHA 3RGFA 4HNFA 1WBNA 5HG7A 4LM5A 2A27A 2XCHA 3BHTA 1H1PA 3ELJA 1SNUA 3C0GA 3DB6A 3GEQA 2HZIA 4WRSA 3W8LA 2C6DA 2C5VA 4HYUA 3TKIA 4YJSA 3VW6A 4UMRA 5KKRC 4GG7A 4JBPA 3UQCA 3SHEA 4OAVB 4EI4A 3I0OA 4EHEA 4GKHA 4ANSA 3MH3A 4U3ZA 3TUDA 2I40A 3LCOA 4GKIA 5FP5A 2ITUA 4HCTA 4OBQA 2IVUA 3HVCA 3BYOA 4LV8A 2F49A 3SD0A 4AGDA 4ZTSA 3ZSHA 5C9CA 5E1EA 4C61A 2F9GA 5KMNA 4F99A 3FMLA 1YXSA 2ITOA 4AT5A 2X2MA 3D7ZA 2H9VA 3M11A 3IDBA 4W9XA 4L42A 3G90X 4FVRA 4C4HA 5KUPA 5CVGA 3G15A 4XBUA 4UY9A 5DHJA 5FXQA 4ZIMA 3FJQE 4KBKA 4Z7GA 3EQBA 1XKKA 3KB7A 3LJ2A 4QP2A 1U54B 1UU7A 3KEXA 5TF9A 2GNHA 4FX3A 4DFUA 3VIDA 4O27B 4L43A 4L9IA 5TE0A 3C4WA 2ZB0A 3JYAA 4AZWA 4NYEA 4I1ZA 2NNWB 3TNQB 3MA3A 3N4VA 5JKGA 2W7XA 4AW0A 4EH6A 3PZHA 4Z16A 2PL0A 2LGCA 5L6OA 2JLDA 3FHIA 1K2PA 2CLQA 4WHZA 4PX6A 4YZDA 4EH3A 1H27A 4USEA 2OH0E 5EQYA 1OZ1A 3W55A 2VX0A 4I24A 4FICA 4QTEA 3G0FA 2WIHA 4RZWA 4EK8A 4FI1A 5J5TA 3EN6A 4JS8A 4RIXA 4ZSAA 3UNJA 2OU7A 1Q3DA
chains in the Genus database with same CATH superfamily
2WTWA 2ERZE 4PL4A 1JSTA 4AZEA 3SG8A 3EQPA 5FQDC 4RX9A 3W2QA 1XJDA 3TDWA 5FBOA 2IW6A 2ZV8A 4O4DA 2ZOQA 5J8IA 4IE9A 3LXKA 4AQCA 3BI6A 2NRUA 4RX7A 4WIHA 4IX3A 4MXAA 4QMQA 3ZLWA 4QDVA 3QLGA 4MXZA 4F1MA 3LMIA 4KRCA 2OSCA 3MW1A 4H3PA 3R83A 3LLAA 3VNTA 3QTWA 3R28A 5EDRA 3Q9ZA 4UALA 3LFQA 3ORLA 4FF8A 1UV5A 4XG3A 1P5EA 5D12A 3SW4A 2WZJA 4FOBA 1FVTA 3DKCA 1Q61A 1P14A 2RKUA 4GCJA 3QRJA 2YCSA 3F3TA 4EOSA 3QRKA 5J79A 2YLFA 3F3UA 2P33A 2HIWA 2W1CA 3OHTA 4MWHA 2W06A 4O83A 4TWCA 1OIUA 3MB7A 4YHTA 5CSXA 3BHVA 4FV8A 4YTCA 4A7CA 5IA4A 2O63A 4QT1A 2VV9A 3TJDA 3VQHA 2OWBA 3WIKA 4CXAA 3PXKA 4USDA 1BMKA 3R8LA 3ZOSA 3C7QA 4FKPA 4HOKA 3EQHA 4HGSA 5HICA 5BMSA 3GBZA 4IANA 2F7ZE 5M51A 1O6LA 5DEWA 3PG3A 4K6ZA 2IEWA 3ZEPA 2XK9A 3MY5A 2HZ0A 1WMKA 4FKJA 1F0QA 3ORZA 4M68A 3SC1A 3PY1A 4IH8A 3CC6A 3KCKA 3KVWA 3PRIA 2PE2A 3MYGA 5HCXA 3QTSA 3TV4A 4CYIA 4ZMFA 3F2RA 3A61A 4XRJA 2XIZA 3NUXA 2YIYA 3I79A 3R30A 2R7BA 1Q62A 4JIKA 4BI0A 1KOAA 3TZ7A 4HYHA 5IISA 2G1TA 3UVPA 4UMQA 4HVSA 2B9HA 3ZLXA 4BHZA 2KULA 2I0VA 4DEDA 5A54A 3F61A 4BKZA 3IOKA 3T9TA 3ENHA 5J1VA 4PL5A 5A4QA 4P4CA 4YMJA 3GVUA 3UO5A 2ESMA 4YGAA 5IUHA 2QR8A 4IB1A 4U97A 5GNKA 2W1FA 5B2LA 4QMLA 3KK9A 4RQVA 2VZ6A 4CKJA 4ANQA 3PE2A 3NR9A 5AP2A 3P0MA 3C4EA 2JKOA 3R8PA 1DI9A 3LZBA 3COMA 4YJRA 5F20A 1CKPA 3HRBA 4HPTE 3K54A 4UXLA 2XNPA 5E8UA 1NW1A 2P2IA 3O8UA 3LFBA 1YXTA 4MXXA 5CU2A 5C1QB 1JLUE 4IJ9A 4YURA 2BROA 4JDKA 4NKAA 4DDIA 2E9VA 2O3PA 3CBLA 3VC4A 4B9DA 5E7RA 4QO9A 3H9OA 3DK6A 3GC7A 5FDPA 3TWJA 4ZZMA 3VUHA 2R7IA 5JSMA 2EUFB 2J0KA 4GK3A 4N70A 3P9JA 4O7ZA 4YJVA 3UODA 3PXYA 3OBGA 5EYDA 4RJ4A 1WBOA 2CKPA 1TQMA 1UWJA 1ZOHA 2ONLC 4XOYA 2C3KA 4Y85A 4TN6A 2JDVA 5DMZA 2XIRA 2G2HA 2HCKA 1K9AA 2ZM1A 3SOCA 4RGJA 4OGRA 1OECA 1H08A 5K3YA 4I6BA 1H1QA 5DGZA 3BWFA 5JQ8A 4F9YA 3P7CA 3FZRA 3O51A 5AM7A 3D5XA 1KWPA 5K0XA 3Q4ZA 1WVYA 2QCSA 1UVRA 3D5UA 3QYZA 4RJ3A 2QHNA 3BL9A 2G2FA 5DN3A 5EYMA 3ZTXA 4GG5A 4XMOA 1Q8TA 4U8ZA 4A9YA 4I6HA 4LOOA 3SXRA 3TKHA 2BILB 2XCKA 3E64A 4B0GA 3PVBA 5FEQA 2QOOA 4M7IA 5CAOA 3KMUA 4RC2A 4RIOA 2IG7A 4FZ6A 2BIYA 2WU6A 1TKIA 4X3JA 2V55A 2ITNA 3D2KA 1PJKA 2HWPA 3EL8A 4BYIA 5EQEA 5IQGA 3O0GA 3Q5IA 1Q8WA 1Q3WA 2RG6A 3R6XA 4O21A 5AP5A 2WMTA 3NYOA 3ZUVA 1YWNA 2FB8A 2C69A 3U9CA 3Q96A 4O0VA 3FSFA 4XOZA 1KE5A 4KINA 3JVRA 5LVLA 3VS2A 5EH0A 3ZLYA 3CQUA 3G9NA 5JGBA 3LJ0A 4XV2A 2WTJA 3FPMA 4R77A 3H10A 1MRYA 3ORPA 4U40A 4W9WA 2GS6A 3RJCA 4BJJA 4B7TA 3E7VA 4D4VA 4PNKA 2BIKB 1YI4A 3TT0A 4IZ7A 3P08A 1HOWA 2Z02A 4RWKA 1OPLA 4I94A 4CKIA 2YACA 3EFKA 3WZDA 4OTPA 4EQUA 2XM8A 1ZYSA 3QTRA 2PUPA 2ZV2A 3M42A 5FXRA 3HL7A 4PUZA 4BCNA 5AV3A 1XWSA 5DVRA 3M1SA 1ZWSA 4FMQA 3QTUA 4GT3A 5K0KA 1NVRA 4KIOA 5AA8A 4BR3A 3E8EA 2NP8A 4XG2A 4WUNA 3LFEA 4RIXB 2NO3A 4QMZA 4PF4A 5CU4A 4CFUA 3HMOA 4FEUA 4YLJA 4Y72A 2GNLA 2YM7A 4DTBA 4DGNA 1Q41A 4R78A 3CPCA 3QQHA 1P4FA 3KCFA 4FC0A 5HG5A 4FA2A 4RG0A 3QRUA 4Q9ZA 4IVAA 3UG1A 4G6OA 2VO0A 3ZO3A 4AFEA 4OAUC 3R2BA 3BGPA 4PTGA 5ANGA 4DLJA 3R8VA 3W0NA 1UKIA 3TYKA 5GJDA 5A6OA 4FTAA 1Y8GA 4DH5A 4LL5A 4BIDA 4QMTA 2W17A 4NW5A 5EHLA 3NSZA 5ANJA 1H1WA 4EJNA 3L8XA 3OD6X 4JXFA 2YIRA 2BZIB 2VX3A 2QOIA 2YFXA 2P4IA 4FZ7A 3MTFA 3WF8A 3V5TA 3AMYA 3NGAA 2XJ1A 4C3RA 5FRIA 1YHSA 5HE0A 3MPMA 3E63A 3Q9WA 1PYXA 3TIYA 3ZXZA 1KV2A 4LMUA 5DI1A 4FR4A 5KE0A 4WA9A 4FK3A 3NYNA 3FLWA 5HG8A 2G9XA 1S9JA 4Y83A 4EH2A 1A48A 2IWIA 1PXMA 4L6QA 4W8DA 4CCUA 2CNQA 3KA0A 3POOA 5JFWA 3W0QA 4ZJIA 4QP3A 5E1SA 3UYTA 3IG7A 4CMUA 2ITXA 5BYZA 1DAYA 2Q83A 4GT4A 3UNZA 2NRYA 1W98A 4JX3A 4BDEA 3DK7A 3CXWA 4HGTA 2PZ5A 4JJRA 4GT5A 5BVKA 4PMSA 2HAKA 1DM2A 1RDQE 2R3NA 3LCDA 4A4XA 3QTZA 4O2PA 2WMSA 5HIBA 5F9EA 2OW3A 1Q5KA 5HD7A 5EM7A 4ENXA 3TM0A 2Z7SA 4FODA 2HW6A 4EOQA 3LQ3A 4P5QA 3TXOA 3IOPA 1M52A 3DY7A 1YXUA 3O17A 4ZTQA 3WBLA 3QA0A 4DH7A 4AXEA 5E8WA 1SVGA 2HYYA 2JDTA 2VTAA 3JY0A 3MVHA 3AXWA 3GCVA 4IX6A 3LKMA 4RC3A 4GJ3A 3TJCA 5C26A 2ACXA 3F9NA 4AA5A 5E90A 4CTCA 3PLSA 1XH5A 4HCUA 1ZY4A 4K1BA 4N4SA 3V8SA 1OBGA 1B6CB 4LGGA 3WZUA 5I3OA 3JS2A 3JVSA 4D0XA 1YWVA 4U6RA 4X21A 5KBRA 4IB5A 3H0YA 4PPBA 4X7QA 3QWKA 4OTFA 2XK8A 4YTFA 4S2ZA 3AC4A 2WMBA 4WNPA 4AFJA 4TKSA 3TDVA 1IG1A 4QYYA 1SZMA 2V5QA 2XH5A 4FYOA 1ZYJA 3MDYA 5EHOA 3RAHA 3OROA 1UNLA 4FKGA 4LV5A 2FUMA 4HNIA 3QL8A 4KIPA 3DNDA 2FYSA 3QTXA 4ANNA 3COKA 3I1AA 4M3QA 4AN3A 4ASEA 4X0MA 2CN8A 3EHAA 3ACJA 2VWBA 3DB8A 3R7VA 1HCLA 4DFZE 4NM0A 4FTJA 3KF4A 4O7RA 3DTCA 2YCQA 4IM3A 3OWPA 2QOKA 4FOCA 3UC3A 4RMZA 3W33A 3HV5A 3OXZA 4AZTA 3OY3A 3PIZA 5BUIA 2B7AA 5CT7A 4L68A 4Q5HA 4WSYA 2R0IA 3NUNA 3QCXA 4NM7A 1OKYA 4R3PA 5AV1A 2B54A 4ACCA 4FVQA 4BWPA 1TFFA 2VRXA 4LI5A 3K3IA 4QMNA 5HBJA 2OKRA 2RFSA 3MPAA 4GIIA 3D5WA 3C5IA 3DJ6A 2BALA 3U6HA 1J1CA 4EK4A 4FTTA 3LPBA 1V1KA 4H39A 4QP8A 5GZ9A 4FKUA 4BIBA 2I1MA 4NK9A 4ID7A 1NT2A 1IRKA 4O6LA 1PXJA 2XNGA 2VWZA 4G1WA 4IXPA 3F7ZA 4QPMA 3AC5A 2YIWA 4AG8A 3PY3A 3I5NA 4N0SA 4C4JA 5HKMA 5CXZA 5DG5A 4JBQA 4H1MA 1ZYCA 5E8YA 4JNWA 1TQIA 4JR3A 3UOKA 4AE6A 4F6WA 2WQEA 4FV9A 3VBYA 3BU5A 3JXWA 4QYEA 5AX9A 3S4QA 4DT9A 2R3KA 3GQLA 5BVEA 5J7HA 3I5ZA 4KD1A 1M14A 3ALOA 5AEPA 4NM3A 3Q32A 4XG6A 3E8NA 3BBWA 3SQQA 4MWIA 3FI2A 1CMKE 1ZARA 4AT3A 5ITAA 5CF6A 3PPJA 3Q04A 1JNKA 3TN8A 4I5CA 2JDSA 4BJJB 5HOAA 4DBXA 5DNRA 3FMHA 4TTHB 2W1EA 4I20A 3ZRKA 3ZO2A 2C6OA 2ZDTA 4NKSA 4C33A 4MCVA 1ST0A 2BUJA 1RW8A 4FTIA 3A7GA 4C4IA 1O6KA 4NZWB 2IZRA 2CHLA 2Z7LA 4G17A 5K9IA 3ZC5A 4IM0A 1J91A 2AYPA 2JD5A 1ZRZA 3CEKA 2WB8A 2CJMA 4EK5A 1JBPE 3KL8A 5AAGA 5M57A 3N9XA 3NIZA 4QMPA 4FBXA 2R3OA 5AR8A 1Y57A 4F70A 5A4EA 3DQWA 1GOLA 4L52A 4YZBA 4E20A 3FL5A 3LFCA 2QNJA 1GAGA 3DGKA 3GU5A 4YBJA 4XRLA 3FMKA 4LOPA 3NMUF 5D7AA 1MQBA 4OBPA 4BHNA 5CYIA 3VS6A 4JVGA 3ZSGA 2OH4A 4NTSA 3IDCA 1Q97A 3C1XA 4FT5A 4EH8A 3C4XA 4ITIA 3TV6A 1RQQA 3HGKA 4R3CA 4I0SA 5KNJA 5E4HA 5ANIA 2QOQA 4CZUA 4FL2A 2OJIA 4D5HA 1BI8A 4OT5A 3FHRA 4PPAA 3I6WA 2GTNA 3R7YA 2PVYA 3LCKA 3RCDA 4K18A 4MH7A 3QQUA 4NT4A 3GNIB 3BWJA 3L1SA 2W4KA 3UIUA 4AZFA 1MRUA 3UPZA 1ZAOA 4F63A 2VO6A 1ZLTA 3COHA 4MQ2A 2QURA 3RZBA 3LMGA 4IAIA 4RLLA 1PXIA 4BDIA 3BCEA 4IMYA 2H34A 4UMPA 2C0TA 3DQXA 4AZSA 3FKNA 2C0IA 1QCFA 4AUAA 4G2FA 3RINA 5CI6A 3Q6WA 4K9YA 3EN4A 3IW5A 2QLUA 5K4JA 5M09A 4C3FA 1PY5A 4J53A 3A7FA 1GY3A 4BZDA 1E9HA 4XNEA 4ERKA 4L3LA 3AQVA 3FY2A 1V0PA 4IHPA 5LCJA 4A4LA 2V0DA 2RGPA 1NY3A 4TT7A 3LMHA 4O7WA 4FNZA 3FI3A 1YDTE 4L67A 4RVKA 3CQWA 3D9VA 5KKRB 2W4JA 3Q4UA 5C8NA 4ACDA 2PZRA 1V0BA 4R3RA 2G15A 4RPVA 3F2AA 2W9ZB 3MGYA 2F4JA 3RI1A 5JK3A 2AUHA 1TQPA 2BPMA 5DR2A 3TMOA 3OP5A 2VU3A 3BGQA 3ORMA 4XHKB 1FVRA 4RA5A 2C6MA 5C01A 1PXNA 3U54A 4FYNA 4O1OA 3K3JA 2BZHB 2R0UA 5AADA 4U80A 3CY2A 3C5UA 4IAKA 2W96B 3SXSA 5IF1A 3KRLA 4ZOGA 2W1ZA 1WZYA 5DWRA 4EK6A 5CU3A 5HVKA 5IDPA 5CZIA 2X6DA 1XH9A 2QKRA 3MESA 4I23A 4G5PA 1FGKA 2WTCA 2PVNA 3PJ2A 5AM6A 3ZDUA 4BCIA 4DEEA 3PDTA 4ASZA 4X6RA 4I92A 3EB0A 4ONAA 4MKCA 4ZY6A 3ZHPC 5K5XA 3LQ8A 4QRCA 3V5WA 1JOWB 3IW6A 3NDMA 3TACA 3IECA 3UVRA 4DINA 4DHZA 3ZS5A 4WG3A 3O8PA 3PXZA 3KN5A 3MH1A 3NX8A 3JY9A 2RFDA 3OT3A 4QMWA 2QO2A 2Y6OA 3F2NA 5GIOE 1URWA 4C59A 4XG4A 2YISA 4FKIA 4BZOA 4DTKA 2LAVA 3BLAA 2C5OA 3NUAA 2UZLA 1OIYA 1W82A 1LEZA 3EFJA 3ODZX 3OW4A 2FO0A 4U44A 3ZM4A 5LVOA 5M06A 2HWOA 1W7HA 2QU5A 5JH6A 5E8TA 5KMMA 2OXXA 4HZRA 1H07A 4RIWA 1IASA 2FSMX 3JPVA 3UC4A 5AR4A 3RK9A 3EYHA 1G8AA 4CV8A 3U87A 4E1ZA 4E73A 2EXEA 3F5UA 2PMLX 5AP4A 2WXVA 2KTYA 2YDKA 5FDXA 2VWVA 3I4BA 4QNAA 4UMTA 1QMZA 3CKWA 4XV3A 5EYCA 1JAMA 2UZUE 4AGWA 5H9BA 5IA5A 4DE4A 4C37A 1URCA 2B1PA 4ACGA 1PMEA 4ZS0A 3AOXA 3CIKA 3UMXA 2ZM4A 2JIVA 4RA4A 5L6PA 4A9RA 1ZYDA 3DAJA 5IQHA 4K2RA 5IA0A 4E7WA 2R3LA 1OMWA 4XYFA 2UW5A 4FV7A 3ZMMA 4DEBA 1Y91A 5M07A 2PVRA 4BBFA 4YLLA 4ORKA 2XYNA 3MFRA 2X1NA 2UVXA 1FBNA 5F94A 2O5KA 3MVJA 4M0ZA 4CLIA 1IR3A 4M66A 1W2CA 1O6YA 2BTRA 1STCE 1YRPA 1QPJA 2VNWA 1Q4LA 3UOJA 4FL3A 4U81A 4RJ7A 2XK3A 4YC3A 2C6TA 4FTKA 4C3PA 3O2MA 3R2YA 2Y9QA 4FTMA 2PVFA 4U43A 3PA4A 3FI4A 3NUSA 3PJ8A 1NVSA 5CENA 5M4CA 1L3RE 4FEXA 3HUBA 2VTNA 4FSWA 3QTIA 3W16A 1AQ1A 2OGVA 5CAQA 2X7GA 4M8TA 4ALWA 2QOCA 2XJ0A 3DBQA 3HEGA 3KRJA 4DEIA 4EUUA 4O7TA 4AXFA 3VBVA 4BYJA 4E3CA 3QZGA 3EQGA 4JDHA 3FQHA 5I4NA 2WO6A 4WKQA 3QD2B 4QMUA 3R9HA 2R3MA 2Z7QA 3FMEA 4E5WA 2XNOA 2V22A 4DG3E 3AGMA 4QTDA 4E4NA 4EKKA 2C5XA 4F9AA 3V6SA 4PRJA 4FTNA 4C35A 5FP6A 2OLCA 3VS3A 3DBEA 2PVJA 3ORIA 4U7ZA 5L8JA 3FBVA 1U5QA 3D83A 4QOXA 4CQGA 2B55A 2GNJA 4AP7A 3O7LD 5CASA 2OZOA 1Q8ZA 3KGAA 2B9FA 3V04A 2B53A 5FM3A 3FYKX 3VUKA 5D9HA 3W0RA 4DEAA 1GIJA 4UMUA 2VGPA 1YOLA 4BGHA 2WEVA 3HECA 4FIJA 4TL0A 4ASDA 3F88A 4EKLA 4IAYA 3ML1A 5EM5A 2RFEA 2XEZA 4CEGA 3ERKA 5AR5A 5BX0A 3LFSA 4JQ7A 3EL7A 4A07A 4BDAA 4HJOA 4CFMA 3OWLA 2XMYA 3RNIA 4MF1A 5CAVA 4AW2A 2R3QA 2F2UA 1OB3A 4QP4A 4XJ0A 5EDPA 5FD2A 4D2RA 3SG9A 3FYJX 3POZA 4TYGA 5JFVA 5J9YA 5DH3A 5L2WA 3A7JA 2IN6A 2XEYA 5BVFA 2Y7JA 4I21A 4M69A 5GZAA 5CSPA 1KE7A 4O0TA 3HV4A 5CF4A 4XV1A 2CCHA 2JIUA 4JRVA 2Z60A 1AGWA 3AD6A 4IVDA 4EOOA 4JT3A 4DH3A 4FKQA 5BNJA 2PMNX 5HX8A 3AKKA 3UOHA 5I3RA 1APME 2XKDA 1XH8A 4GFMA 4I5HA 1I44A 3HYHA 5D1JA 3BELA 2OO8X 4QP1A 4RJ6A 2BRGA 5IKWA 5IH4A 5IH6A 1H1RA 5HTBA 3DKOA 4FTUA 3PVGA 4MNFA 3P7BA 4FV6A 5BQ0A 4ALVA 3RPSA 4FNYA 4J97A 3ZU7A 1ND4A 3HV3A 4NCTC 4FZAB 3WZJA 4CRSA 2VWWA 4L3PA 1PMUA 4RVLA 3DDQA 3THBA 5IDNA 4C8BA 5M4IA 3IONA 3EN7A 3HMPA 3B2TA 3CD8A 4IQ6A 5AUUA 3EQIA 4KWPA 1QPCA 2V7OA 1YHWA 3HA6A 3Q6UA 4LYNA 4UB7A 5EW3A 3VUGA 2R5TA 4EZ3A 1DAWA 1BLXA 2A2AA 4X2JA 4ZEGA 5BPYA 4AAAA 5E9EA 2OBJA 1AD5A 2J0MB 3DK3A 4IDVA 5HU3A 3GGFA 2Y4IB 5KMOA 1PKDA 4BBMA 1YVJA 4DF3A 5TO8A 1M7NA 3WF6A 1Y8YA 2QC6A 3T3VA 1TZDA 2C5YA 2FVDA 4FT9A 4HGEA 4UYNA 4WNOA 3DFCB 4EL9A 2X0QA 4Y95A 4E5BA 4XX9A 5BVNA 5IQEA 3N4UA 2VWUA 2J5FA 3D5VA 3DFAA 3FZSA 4ZTHA 3R9DA 3V3VA 3WILA 4AU8A 3T8OA 5EYKA 3ZUUA 3PPKA 1RE8A 3EQFA 5AP3A 5FEDA 4XP3A 5CT0A 3E92A 5E8VA 2OFUA 2G01A 2QO9A 3KXXA 2C0OA 3BHYA 5FTQA 2CNVA 3CQEA 3R7OA 4DFBA 5F4NA 4BCPA 4W4XA 1MP8A 2VWIA 3LM5A 1G8SA 4FIGA 4FKRA 4FKSA 1YW2A 3VBTA 2PU8A 1H4LA 4YTHA 2CKOA 4PMPA 3DXQA 3ULIA 4ACMA 4LDTA 4AS0A 4C4EA 3LHJA 3ACKA 3ODYX 4G6LA 3G6GA 3LAUA 4W8EA 4ZTRA 3BQCA 5FXSA 4RWLA 2QG7A 3UBDA 2WFYA 4TYJA 4OTGA 4RIWB 4BBEA 5LWNA 3ROCA 2CKQA 4C34A 1BI7A 2YJSA 3R7EA 5J95A 3EIDA 3HNGA 4CNHA 4XLIA 1ST4A 5CU0A 4BCOA 5GZ8A 2WTVA 3ZRMA 1FPUA 3PP0A 4B4LA 2OF2A 2DWBA 1W2DA 1ZYLA 4RLKA 4EOMA 2OI4X 4FTOA 3TKUA 1QPEA 3TI1A 3VS0A 3U9NA 1OGYA 3GQIA 2YM6A 3WF7A 3FL4A 5AR2A 2XF0A 3KXMA 5BVWA 4DHIB 3KRWA 3BLQA 1OUYA 2WOUA 2EU9A 3HP5A 4P5ZA 4H58A 2I0EA 4O0UA 4PMTA 4DG0E 2BZKB 3R1SA 4S30A 3EZRA 4F7SA 4O6EA 2R64A 2FSTX 4F64A 5LARA 2VTPA 4YJNA 3OUNB 3ZXTA 1BKXA 3UP2A 4IVBA 5B2MA 3T3UA 3PTGA 4E6DA 4NFMA 1SYKA 3T9IA 2XBAA 1PXOA 3ROYA 5JFXA 3VUMA 5JGDA 3PXFA 2GTMA 3BLRA 3LW0A 3GCPA 4YHFA 4HPUE 4CZYB 1YKRA 3UQFA 3FC2A 3EZVA 3BU3A 4H05A 4IX4A 2DS1A 4H3BA 3KXHA 2J0IA 2WTKB 3E88A 3EWHA 2RL5A 2VTLA 3IDPA 3NRMA 5CI7A 3ZDIA 5GJFA 3VHKA 4PDYA 3BE9A 4UBAA 1WBPA 1YOMA 3RAKA 4G6NA 1BL6A 3GP0A 3RK5A 3TV7A 4YNEA 3BL7A 5HNIX 1B38A 3C9WA 4L8MA 3NWWA 3FQEA 2Y6MA 4LRMA 3P78A 4PDOA 2XKEA 3KFAA 4TRLA 5EW9A 1JPAA 2X4FA 3OEFX 1VZOA 5KZIA 2PHKA 3ZFYA 2ITQA 4U42A 3CJFA 4D2VA 3AMBA 2H96A 4XEYA 4DH8A 3EFLA 4AWIA 4IIRA 2ZB1A 2JC6A 4V0GA 5ANEA 2C6IA 2JFLA 4F78A 2R2PA 3GUBA 4C57A 5I9VA 4G5JA 4YSMA 2YM5A 4AOJA 3U8WA 5T68A 3COIA 2DQ7X 3FXWA 4IZAA 4DEHA 1OL5A 1ZZ2A 3BE2A 3D14A 5HBEA 3A4OX 3U4UA 5BV3A 3A62A 2HELA 3AT2A 5CVFA 2BFXA 3DKFA 3EFWA 1M17A 3L8VA 2HXLA 3C13A 4MXOA 3EQRA 5AR7A 2ZMCA 1MRVA 1GNGA 4I0RA 5LOHA 3OCSA 4I6QA 1PXPA 2JAVA 3RKBA 1XMLA 4KB8A 4W4YA 2BZJA 3HKOA 3FZTA 4CQEA 3F3VA 4O0YA 4EORA 3TCPA 3A4PA 2CNUA 2UW8A 3U4WA 4PL3A 3D94A 4QTBA 3F3WA 3GOPA 4Y5HA 4MQ1A 3DA6A 3L9PA 2YM8A 5EQPA 3RPVA 3VS7A 1PXKA 3QKKA 3QQLA 4M69B 3W2SA 2ZDUA 1Z5MA 4GU9A 2XNBA 2YITA 4EEVA 4E6CA 1SMHA 5AUYA 4LFIA 4IJPA 5CEIA 4IZ5A 5CS6A 4GMYA 4AE9A 2JDRA 2UW4A 5CEOA 1I09A 3HLLA 1GZOA 3DZQA 4DITA 4L7FA 5AV2A 5H2UA 4RFMA 2QQ7A 5LCKA 2IW8A 4EOIA 5BVDA 2AC5A 1ATPE 3W32A 2WEIA 4WRGA 4FG7A 5HESA 5IQCA 3BLHA 4DN5A 4FSRA 1OL7A 1Y6AA 4WD5A 2XIKA 3OW3A 4C2WA 3LFNA 1GIHA 3MY0A 4NW6A 3W0OA 4JBVA 4R1YA 4CCBA 5M44A 3OEZA 4FUXA 3PIYA 1T45A 3VWAA 3DS6A 3CE3A 3VRZA 1OITA 3FXZA 5A14A 3F7WA 3NYXA 1IAJA 3EN5A 3E5AA 2BTSA 2QO7A 3GENA 4DGOA 4FSUA 4IWDA 4GJ2A 3SX9A 2PMIA 2REIA 3AD5A 4NTTA 3ID6C 2JIIA 2VTQA 3IKAA 2UZTA 3NNWA 4O1PA 4FNWA 2UW7A 2RF9A 5EK7A 4XH6A 5ETAA 5HO6A 2C5NA 3ZO4A 1M2QA 3FZOA 2GMXA 3DKGA 5D41A 4QQTA 3QGWA 3DTWA 1PHKA 4BCFA 3BV3A 4AOIA 3FI8A 3R7IA 5CEQA 3VF8A 1OPKA 2EVAA 5GHVA 3WE4A 5LVPA 1CDKA 3MSSA 3E62A 2PMOX 4K0YA 2OFVA 3TNWA 1LR4A 2PUIA 1JVPP 3AC3A 5HLNA 3KULA 2VD5A 2RIOA 5ACKA 3TZ9A 4GVJA 3PVUA 4EUTA 4ZXTA 4YO4A 2XYUA 4EZ7A 3FEGA 4F7JA 1JKLA 3WYYA 4CFWA 5J1WA 4D4SA 2YDJA 5HCYA 1RJBA 3KF7A 3EKKA 4ZLYA 3PG1A 3PZEA 2Y0AA 3QF9A 1JQHA 2BRHA 3UNKA 2H8HA 3ANRA 1FOTA 3CR0A 5HE1A 2R3JA 3LCTA 1PYEA 2EXMA 4MXCA 2IPXA 3QXOA 2ZMDA 2Y8OA 3V5QA 4AW1A 3II5A 2E9OA 1LUFA 1WFCA 2CKEA 3CD3A 4UZHA 4C0TA 4P7EA 2JBPA 4KIQA 3NS9A 3HP2A 2ZJWA 3QD4A 2JFMA 1YQJA 3PSDA 3QHWA 3TIZA 3TUBA 4L44A 4QMXA 2XRWA 4TW9A 1EH4A 4FUYA 2ITVA 3E3BX 3HDMA 4BTMA 3PP1A 5DBXA 5JMSA 3Q60A 4O7LA 3A99A 1OGUA 3OCTA 2GQRA 5DIAA 4DA5A 3DAKA 3HMIA 4G31A 1UNHA 3L8SA 3QCYA 2EB3A 2XM9A 1NVQA 3G51A 2XJ2A 2WQNA 3I60A 3MIAA 5AIRA 3W2RA 3W2OA 4BKJA 5A4CA 4O7YA 3BBTB 3ORNA 4O7VA 3O50A 1FGIA 5L2TA 4ZP5A 4ENYA 3RAWA 2QODA 3VS4A 4CSVA 3QYWA 3A7IA 4MAOA 2FA2A 4GW8A 3MPTA 1VLRA 5IQDA 5A4LA 4IX5A 4EONA 5CEPA 2I7QA 4J71A 4A06A 1H01A 4IWQA 3CPBA 3OVVA 4AGCA 5BYYA 2PVKA 2X2KA 3OWJA 2GCDA 4JG7A 4D55A 4D2SA 3SA0A 3F5PA 3VJNA 3QD0A 3E7OA 4KSQA 1OI9A 4YJPA 5IEXA 2B9IA 2X2LA 3AT4A 4B6LA 4BTFA 5HD4A 5CANA 5HG9A 2W05A 5ETCA 3ETAA 5AV0A 4FEVA 1A06A 4S32A 3RTPA 2X81A 4KSPA 4MD9E 4O91A 4UN0C 1P4OA 2O2UA 4ARKA 4TWNA 4HVGA 5E8SA