3OUKA

Crystal structure of rv3910 from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
248
structure length
248
Chain Sequence
QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
total genus 58
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oukA01
3NSZA 5F4NA 4DH8A 3GUBA 4YZBA 3QCSA 4GFMA 4HPTE 4XHKB 4P90A 1H24A 4XP2A 4D58A 4EUUA 4ACHA 4NJDA 5H8BA 4CSVA 2R7BA 4AW5A 3LHJA 4FSRA 3ZDIA 2DYLA 4O96A 1E1VA 4BDIA 3R28A 3VUMA 4OW8A 4RC3A 4W4VA 4IX6A 3SRVA 3PJ1A 4F70A 3HAVA 4MYGA 3R1YA 2XBAA 4F1OA 2ITZA 4WO5A 2R3GA 2PUUA 4S30A 3VQUA 3EFKA 4JLCA 1MQBA 5EHYA 4FKIA 4MBJA 3W2OA 3TV4A 3SVVA 3KXZA 3TIZA 1FOTA 4J53A 5DLSA 3THBA 4ACCA 4PP7A 5J8IA 3SV0A 3QUDA 4QQTA 2CNQA 2I40A 4DTBA 4BWXA 4UALA 5AR7A 4D1SA 3O7LB 5IQFA 5EHOA 1YRPA 2W0JA 1CKIA 5L8JA 4IX4A 1OUYA 1NA7A 3FZPA 2UZBA 5AUXA 1BMKA 4BDFA 2QHMA 1OITA 3EQFA 4O0YA 2B0QA 3S00A 1OKWA 3OC1A 1ZZLA 1YWNA 2YCRA 4ANLA 2ITPA 3KEXA 4RJ6A 2UW7A 2ITUA 2J7TA 4FNWA 4JRNA 1VJYA 5HIDA 3CY3A 5A14A 5CXZA 4OAVB 3PSBA 2R7IA 2BKKA 4MD8E 1IA8A 3MIAA 1MQ4A 2YIRA 3RNIA 2GPHA 3QD3A 2CLXA 4FT7A 2C6MA 2R64A 2A4LA 4YHFA 4ZJJA 5CVFA 2YERA 3VBVA 2WELA 4O0UA 1PMUA 2WHBA 4F09A 4FZ6A 4YPDA 2Z60A 1OI9A 1JSVA 4GU9A 4C2WA 1H0WA 2R2PA 4G3EA 4WIHA 3QKMA 1H25A 4KIOA 3DQWA 3V3VA 4AW2A 4RX7A 5EH0A 2OICA 4J8MA 4DTAA 3OZ6A 3UO6A 3V5LA 3JY9A 3FUPA 3V04A 1BKXA 5M51A 4W4WA 5HO6A 1DM2A 2PUNA 4DT9A 4J99A 1G8AA 3BBTB 4FYOA 4K8AA 3RBWA 3NW5A 4MD9E 1O9UA 2BUJA 4BI2A 3QYWA 4ARKA 3UIMA 3UODA 4EOKA 2PE0A 3NZ0A 3R2BA 4D2WA 3BLHA 1AQ1A 5KMJA 4BCPA 1ZOEA 2AC5A 3M11A 3II5A 3WF7A 1WBSA 2WD1A 3VNTA 5L6OA 1BI8A 3NUSA 5K5NA 4GMYA 2HYYA 4FA2A 5J1VA 1M2QA 3DTCA 3WYYA 2B54A 4J97A 3ORTA 3W2PA 2C1AA 3MB7A 4X0MA 3RI1A 3QZFA 2Q0BA 2XKFA 3DPKA 3E62A 4CMOA 1H4LA 5FBOA 4C4IA 3V6SA 1W83A 1QCFA 4G3CA 4JOAA 5EYCA 3H0ZA 1ZMWA 4BIDA 1A48A 3V01A 2GS7A 1Q24A 5IUIA 2X2KA 2BTSA 3C1XA 4GVAA 4Y8DA 5I9VA 3KCKA 5LQFA 5EYKA 3LFBA 3A7HA 4JG6A 4C4GA 2R3PA 4Z16A 5D1JA 4QTEA 3H9RA 2HW6A 2KULA 2W96B 4YJNA 2O63A 2X4ZA 4I0RA 3NCGA 1YXTA 4AA5A 4QP7A 3NIEA 3HUCA 2WMAA 1OPLA 2IVUA 2Y4IB 5CU3A 3PZEA 4FKRA 3RCDA 1PKDA 5D11A 3VUHA 3HYHA 3H9FA 4BL1A 4HVSA 5EOBA 4TYJA 1GZNA 2GQRA 2I0YA 2X7FA 3LXKA 4IX5A 3BEAA 3VW6A 5KUPA 4CT2A 3KK9A 2VTMA 5HNBA 3Q5IA 4JJRA 3ULIA 3QC9A 2BDWA 5JMSA 4FSUA 3E8EA 3LFQA 4IM0A 4QQJA 4NKSA 4Z7GA 2OJJA 4ANBA 1F0QA 4XUFA 1KOBA 1REJA 4M13A 2VTAA 3FMKA 3OVVA 3OOMA 4ANOA 4OTIA 4DBXA 2FSLX 2OG8A 5AMNA 3PVWA 4WT6A 3FZOA 5H3QA 2EB2A 2ZB1A 4D55A 2XJ2A 3OBJA 2WOUA 2SRCA 3BHYA 3VBQA 3W8LA 4F6UA 5LMAA 3KXNA 4RX5A 4O84A 4LM5A 1PXIA 2HOGA 4RWLA 5JKGA 4DEEA 1FGIA 3HL7A 4W9XA 5L2IA 3I5ZA 3LOKA 2OO8X 2F4JA 3ORIA 4YURA 4DF3A 1ZARA 3E88A 3WF9A 5ACBC 3Q2JA 4USEA 3DXNA 4BCQA 3FZSA 2C6LA 1A9UA 1U5RA 3NYOA 1T45A 2C68A 4O7RA 2WPAA 4GIHA 3IECA 5LVMA 2FB8A 2VTOA 3R7IA 3NVMB 4MTAA 2RSVA 4YJRA 3FMHA 4F64A 2PVKA 1URWA 5DBXA 3G6HA 5M08A 4IC8A 2B53A 3OBGA 3COKA 4F0GA 4OUCA 4ZAUA 3HNGA 2WMSA 3RGFA 4EC9A 4ZK5A 2WTDA 4IM3A 4MQ1A 4U44A 2FGIA 4ASDA 4CFWA 4MAOA 2JDSA 3ZYAA 3LJ0A 1LP4A 4MNEA 5AUYA 5M44A 2BRNA 1OPKA 4JQEA 4ZTLA 3EN4A 3HA6A 4RIWA 3HV6A 4QMVA 1NY3A 4LG4A 3KA0A 4EKLA 3UQGA 3FMNA 3HLLA 2OIBA 2GNLA 2BHEA 5JGAA 2ZVAA 5HLWA 2I0HA 2P2HA 1XO2B 4A06A 4L67A 5GINE 3GU7A 3CBLA 3MVHA 5DEWA 4RJ5A 1TQIA 4ZEGA 3VF9A 3R30A 4FIFA 2PVRA 2VO7A 3RPVA 4E6QA 3BHVA 3MBLA 4FV9A 1OMWA 3WZDA 5IG1A 2B9IA 4JDKA 2OZAA 3E7OA 2WIHA 4I5HA 4G3FA 3RJCA 5AP4A 3UTOA 5HG8A 4OT6A 3SHEA 4YMJA 4IE9A 4O2PA 2QHNA 4AT4A 2B9JA 5C1QB 5FTGA 3CPCA 4L52A 4I20A 5KZ0A 1JSUA 3R1NA 3ZLYA 4FKWA 4PL3A 4QMPA 2IZRA 3IONA 3FAAA 4EH7A 3F6XA 2VTRA 5J5SA 4R3RA 5BYZA 5IA4A 3PFQA 4G3DA 5ANJA 2PZRA 3SXFA 4L6QA 3AOXA 1PY5A 2WEVA 3CQEA 4GRBA 1U54B 4YC8A 3ZZWA 4DGNA 2I0EA 5CEOA 3UVQA 3FZTA 4YGAA 1U46A 4C02A 2HCKA 5TF9A 5AIKA 3QRKA 3QXPA 3MN3A 4BF2A 4QYYA 4FZAB 1R0PA 2DS1A 4ASEA 4JDHA 4BIBA 5B0XA 4IMYA 4BICA 1O6KA 3CD3A 3JR1A 4JBQA 4AAAA 2BDJA 3DDQA 3VBTA 4AOJA 5DG5A 3VS3A 2Z2WA 3GT8A 4L3LA 5FBNC 1OIUA 1GOLA 2C6TA 4D2VA 5AUUA 4TPTA 2GCDA 4FUXA 4IAIA 3SX9A 2O3PA 3QL8A 3VUDA 2EVAA 1WCCA 4R1YA 2B9HA 1UWHA 3MH3A 1MUOA 4EOJA 4DEBA 2Y7JA 5D7AA 2E9VA 4O7WA 4U6RA 5HX6A 3UQFA 5KMOA 3F3UA 3IW4A 5IMEA 1KUTA 2VGPA 3Q3BA 5M4FA 2C1BA 3JS2A 3ZFMA 3WIKA 2PZYA 4JG8A 3QTIA 1B6CB 3MFRA 3ZDUA 5IA1A 1F5QA 3DBDA 4KS7A 4APPA 3LVPA 5DYJA 3BU3A 2JEDA 5GZ8A 1OUKA 3CGOA 2R3JA 1ZAOA 3OD6X 2VV9A 4QMUA 4QRCA 2QLUA 4XV1A 4F9YA 1LR4A 3SOCA 2JIUA 4GK3A 1PYEA 2YM6A 3JXWA 3ROYA 4V0GA 3UP2A 1O6LA 2C3LA 2I1MA 4NCTA 5AM6A 4TYIA 5K0XA 2QURA 1CSNA 3QZGA 3UDBA 3JVRA 4YHJA 5JZJA 2C69A 1WBPA 3V6RA 2UZVA 3MH2A 3ANRA 4GJ3A 3RVGA 4BDKA 4BWPA 3ZS5A 3OCSA 4C36A 4I21A 4DFZE 5L2QA 5C8KA 3ZRMA 2HW7A 1M52A 5DA3A 3R7VA 3AD6A 3ZFXA 4E6CA 3LCDA 3BX5A 4L46A 3EL7A 4I23A 3MA3A 3MY5A 2QU5A 3R00A 4ZIMA 2YZLA 1SMHA 5IDNA 3DJ6A 3K3JA 4HYUA 2ETMA 2X6DA 4NTSA 5HVKA 3FLZA 5A4CA 3QTQA 2J90A 4AN9A 1OBDA 1UNLA 4FZDB 3I6WA 4ONAA 4AW1A 4A07A 4K77A 3SXRA 4Z3VA 2IG7A 4DFBA 1PXPA 3O0GA 3KGAA 3D5WA 4MBIA 4BDEA 3U4WA 5E4HA 3QRIA 5JT2A 2RKUA 2OU7A 1Q41A 2OK1A 3LW0A 4IC7A 4JR7A 4JT3A 3FQHA 5HO8A 3VC4A 3TEIA 4CG9A 2WNTA 4NEUA 4ACMA 4A7CA 2OKRA 3W32A 4CYJA 5IA2A 4J95A 3WZUA 2C6OA 4A4OA 4YPSA 5AA9A 4EH9A 3R22A 2JLDA 3VS0A 4A9RA 3SQQA 1NW1A 3D14A 3P79A 4FR4A 3VWAA 4DGLC 3KQ7A 3U8WA 3G9NA 4DGMA 2WOTA 1I09A 2BVAA 4I5MA 4H39A 3NX8A 3FYKX 4OTDA 4GH2A 4AFJA 1UNHA 3DNDA 4YJTA 4RWKA 2UVXA 4WBOA 4QMMA 4L53A 1YOLA 3Q4TA 4XRJA 5HZNA 1QPJA 1URCA 3KB7A 3ENHA 3MYGA 4I22A 1PXOA 4LRMA 5HG5A 4CFUA 3GGFA 4MWIA 4BBEA 2X2MA 3RPOA 5BUIA 3NAYA 4EZ7A 3QA8A 5M07A 3QD4A 3ERKA 2CGVA 3QALE 3A62A 2W1FA 2ONLA 3D2KA 3S4QA 3MESA 5IH5A 2YCFA 4M8TA 2WFYA 3BZ3A 4QMWA 3PE2A 3SDJA 3I81A 4KUJA 5GIPE 3UO4A 4HVGA 1OB3A 4ACDA 5L8KA 2Z8CA 2GU8A 4FTUA 3UOJA 3PXYA 5ANOA 2AYPA 2GHMA 3M1SA 4Z7HA 1JAMA 4YTFA 3HMOA 2GHGA 4XG7A 4HVHA 2QOFA 4JAJA 3WI6A 4D4YA 5IEVA 2J6MA 2CPKE 4U5JA 1QL6A 2XIZA 4OLIA 3SW7A 1ZYJA 2GS2A 4E20A 5B2LA 2ZDUA 4K9YA 2C0IA 2UZLA 4RC4A 5D12A 3D83A 1V0OA 5FTOA 3FDNA 4Q9SA 5LJJA 3GCPA 5AIRA 5FTQA 3LLTA 4L9IA 4O22A 3DZQA 4ZSGA 3MFTA 5HQ0A 4Q5EA 2JDVA 4UB7A 2XK4A 5DRDA 5ANKA 4L68A 3LFDA 3VVHA 3NLBA 4FMQA 3FSFA 1U59A 2YM7A 4RIOA 1W7HA 1PMEA 4F6SA 4V01A 5CALA 1Y8YA 4EH6A 5FDPA 2ZB0A 5HG7A 3BYUA 4DLIA 4RVTA 2WMUA 3WBLA 1BLXA 4H3QA 4UZHA 2JIIA 4JG7A 1XHAA 4LOPA 3VUTA 3BE2A 4M84A 2B4SB 5M53A 3EQPA 2W1IA 3E87A 2XZSA 4FKPA 4TT7A 4FK6A 1XH9A 5HE0A 1V0BA 5E8ZA 1PHKA 2GDOA 4JQ8A 3P9JA 3OW3A 1OZ1A 2J5EA 5LWNA 2QOCA 4XLVA 1BI7A 2XRUA 4EWHA 1LUFA 4NKAA 2WU6A 3FI3A 2E2BA 5I3RA 3TUBA 3ZXTA 5IKWA 4ERKA 2YABA 3GU8A 3HEGA 5K0KA 2JDRA 4H05A 2PE2A 4EH2A 3Q6UA 1SNUA 3AMBA 4IZAA 4B7TA 2XEZA 3GCUA 4JL9A 2J0MB 2JAMA 4U42A 5CTPA 1E9HA 3PG3A 4U0IA 5LVPA 3O71A 4TN6A 3GC9A 4I4FA 2F7XE 5C01A 2J9MA 2Z7LA 4LUEA 1YDTE 1OECA 2A2AA 3KC3A 4B4LA 3FXXA 4I0SA 4R6VA 4HGTA 3RK7A 4XBRA 3WZEA 5JFSA 3O23A 4FTMA 3HAMA 1UWJA 3HV4A 4K33A 3ZUTA 2J5FA 2UW4A 3P78A 4X6QC 1MRVA 3W2RA 4Y85A 4JR3A 5A4EA 3QA0A 2XB7A 2PZPA 3H30A 1J1CA 2YLFA 3KF4A 3L8VA 4FSTA 4U7ZA 4UZDA 3PXZA 4CCBA 3R8ZA 4QMQA 4N6YA 3ENMA 3EYGA 4FKOA 3BHHA 2ZAZA 3VUIA 4DG2E 2CLQA 1WVXA 3BU6A 3W8QA 2QKRA 5AP0A 1U4DA 3NAXA 4G1WA 4BDHA 3BPRA 2WMTA 5C26A 3OEFX 4L42A 3LFSA 4I41A 3WIGA 3CXWA 3SG8A 3O51A 2VZ6A 4YJSA 5CI6A 4EJNA 3QRUA 3FQSA 4RX8A 4LRKA 3TACA 4C4FA 4IHPA 2R3LA 4IX3A 4S33A 4GFOA 1WFCA 4AF3A 1XBAA 1LEWA 3PY1A 2LAVA 2W17A 4JQ7A 4FF8A 1ZY4A 4YTIA 4A9SA 2OLCA 2WZJA 4ITHA 4C2VA 2E9PA 5CQWA 4L7SA 5FM2A 4RFMA 4ZSJA 1JKLA 1U54A 2QO2A 2XIKA 3LQ5A 3GXLA 3E3PA 3NUPA 3TUCA 3A61A 4CXAA 2EXEA 2Y6MA 3L9LA 4PX6A 4I94A 3OEZA 1BL7A 1YVJA 2VX3A 3A7FA 4HZRA 3CJGA 3OUNB 4G17A 4IH8A 4IWOA 2R0UA 4L01A 4ZTMA 2R3QA 5K9IA 5DHJA 4YNOA 3E64A 2YM4A 4IB3A 4V05A 4I5PA 4YC6A 4YJVA 3RAKA 2R3NA 1REKA 4KAOA 2HAKA 4QTDA 4WOVA 4ZTRA 4HCUA 3VF8A 4BBMA 4HNIA 5CQUA 5DEYA 3BKBA 3NNWA 3DOGA 3P7BA 2OF4A 5IA0A 4JBVA 4OTGA 3R9NA 2GFCA 2PVHA 4FGRA 3PXQA 4BBFA 5I9ZA 3H4JA 3ZC5A 4AZTA 1IASA 1HCLA 3ZXZA 4C57A 2A27A 3TIYA 3DKOA 4IZ5A 5J95A 3ROCA 2HZ0A 4H3BA 3W55A 2BRHA 3BGZA 5AV0A 3TL8A 4E5WA 5FGKA 2QOHA 1PXKA 2R3FA 4D4RA 4EOPA 3VS2A 2ZYBA 4BTMA 4R1VA 5KCVA 4J52A 5CVGA 5B2KA 3EJ1A 3NW7A 4HOKA 4D2SA 1TQMA 4NK9A 3BYOA 4TY1A 4GUBA 3OWJA 2XNEA 1DAWA 3ZO2A 5AEPA 5ETCA 4NSTA 3WE8A 1JQHA 2GTNA 1OIRA 2Y0AA 5M57A 5HTIA 5HD4A 4AOTA 4HGLA 4U79A 3KF7A 3MVLA 4K11A 4AZEA 3DKGA 3QAME 2XF0A 3QQGA 3HMIA 1UVRA 3SRVB 2JBOA 5J87A 4GG5A 3NEWA 3RP9A 5CSVA 4FSMA 2R3MA 1U5QA 4UY9A 3HRFA 2PVYA 3OOGA 1K3AA 1GIHA 3MVJA 4O2ZA 5GJDA 4B6LA 4DH5A 1CKPA 3R7YA 1KE6A 3QYZA 5H8EA 3R8LA 2OXXA 4C33A 2BALA 4DFLA 4NU1A 5FEDA 1RW8A 2HZNA 4GW8A 4AA4A 3EQRA 3FXZA 4PDYA 4R7BA 1AD5A 4LQMA 3FI4A 2FSOX 3IO7A 1YKRA 3PVUA 4GYIA 4M69A 3PIXA 4YLLA 4I93A 4YO6A 3TTJA 3VIDA 5IF1A 3FLWA 4QP8A 4G6NA 2OJFE 2YACA 3UOKA 4FG7A 3UZRA 3D2IA 2ITTA 5B2MA 2XNNA 4J71A 3C4CA 5DOSA 1UU9A 3TT0A 4FV5A 5ETIA 3F3VA 3OROA 4AE6A 3EN6A 3GENA 4BCNA 1PF8A 2I7QA 1XBCA 4YBKA 2PU8A 4AGCA 4QYHA 3PSDA 3ALOA 2XEYA 3QTXA 3TI1A 4ZSEA 3RWQA 1W82A 2CNUA 3BQCA 2H96A 2YFXA 2YLEA 2RFEA 3GCVA 4EQMA 4LOOA 4LI5A 5HTBA 2R9SA 4RQVA 3BBWA 4IVBA 2YM8A 3DBCA 4Y5QA 2BRGA 4FV3A 3H3CA 5DNRA 4ZY4A 4AW0A 4USFA 5HIBA 3AC3A 1MRUA 3F5XA 3QHRA 4J1RA 4X3JA 4BCKA 1IEPA 2QOQA 4G31A 1P14A 3E8DA 2RF9A 4FNYA 4D5HA 5JEBA 5AAEA 5AJQA 2GS6A 5ACKA 4HNFA 4GEOA 4J8NA 4FIJA 3FLSA 4DYMA 3TM0A 3DB6A 5M55A 4AT5A 3ZUUA 2WTVA 4WNKA 1UU7A 3R8VA 4XBUA 2QOBA 3PXRA 4I1ZA 1UNGA 3UIBA 4OR5A 3F69A 3PJ2A 2EB3A 3LCSA 4U8ZA 5FLFA 4FT5A 4IZ7A 3UOHA 1Q8UA 3FV8A 4ITJA 5F9EA 3R7UA 4CEGA 3H10A 4NM0A 3HDNA 3IS5A 3PA4A 4PMTA 4IANA 3A8WA 5EM5A 3IW5A 4M12A 3KXGA 1F3MC 4IBMA 4PQNA 4Q2AA 4Y72A 1ZYCA 4MF1A 4Y5HA 5D41A 5AP1A 4RT7A 1H1PA 4FOBA 4EKKA 5CASA 4R77A 3FL4A 5EW3A 2GFSA 1ZYSA 4AT3A 4FEQA 5JN2A 5D9HA 2R3KA 3VJNA 3K3IA 2NO3A 4GSBA 2G2FA 1FVVA 5HOAA 3I7CA 2VWZA 5AV1A 3BHTA 5K3YA 2O5KA 3TNQB 4FL3A 3F2AA 4IEBA 4GVJA 3AD5A 3CLYA 3QGWA 4Z9LA 4MXOA 2BFYA 3RKBA 4O7LA 5BMSA 4NUSA 1MP8A 1VZOA 4CLIA 3KULA 5CSXA 4DHFA 4WUNA 2YIXA 1PRYA 5DN3A 3WZJA 3Q2MA 1JKTA 5DT0A 1JPAA 5AWMA 3DLZA 3OT3A 4EZ3A 3QFVA 2GQSA 2IW6A 3KN6A 2F57A 3RPRA 3NYXA 2PUIA 3IDBA 3LXNA 4FKQA 5CNNA 5EDQA 3WARA 3LMIA 4KIQA 2W1HA 2R3OA 4RZWA 4TL0A 4TWNA 5DWRA 4DEHA 5CANA 5CSPA 1YI6A 2NPQA 1YDSE 4QMOA 2QO9A 5K4IA 4CFMA 4ZLOA 5F20A 3MJ1A 2H8HA 3G0EA 4CQEA 4MXAA 1IAJA 4BDBA 2BDFA 3K2LA 3VJOA 2IVSA 4YJUA 3GEQA 5I9WA 5IQCA 4BCIA 3F3ZA 4BDAA 5BUEA 3HV5A 4CV8A 3WF6A 5AP3A 2O0UA 2ETRA 4S2ZA 1KV1A 2QD9A 2W1DA 2XIXA 4O0RA 3W33A 2WU7A 2RIOA 5E91A 1S9IA 1OL5A 3OMVA 2WIPA 3R71A 4RIXB 2W5HA 1JVPP 3A99A 3CQWA 2XIYA 2X39A 2PMLX 4EK3A 2IW8A 4U3YA 5KBQA 5HNGA 4JS8A 4RA5A 4EONA 3RK5A 3ODZX 4EH5A 3OF0A 4FSZA 4MXXA 4U45A 4ZLZA 2IWIA 2OBJA 4EYJA 3UQCA 3UJGA 5AV2A 3NUAA 4C0TA 2YDJA 5HBHA 3GQLA 5FD2A 4EOSA 4F0IA 4OT5A 4KKGA 2G9XA 3L8XA 3QTWA 4KBCA 3CS9A 2VWVA 5JH6A 4D5KA 3PWDA 3LQ3A 4AWIA 2FVDA 4FV0A 4I92A 3I1AA 4IAYA 2P55A 3P08A 1SYKA 4Q5HA 2WKMA 5AUVA 2P33A 3HP5A 3R9OA 4FZ7A 3FKNA 5M4CA 2XNGA 1P4FA 4CVAA 3TXOA 2C0OA 3EN7A 4FKTA 4CT1A 3HGKA 4HGSA 3OWPA 3SKCA 2BTRA 1H01A 5H8GA 1R0EA 4RJ3A 3ZEPA 4XX9A 4FG9A 3DKFA 2F9GA 4F1TA 3FJQE 4NT4A 2FO0A 4C58A 2PPQA 2XM8A 2IZUA 2JAVA 2O64A 5E1SA 3G9LX 2HK5A 1YOMA 3BV3A 3U6HA 4AA0A 4AN2A 2G15A 2QQ7A 4R5YA 4W4XA 4X6RA 3VW8A 3HV7A 4DH7A 4Q9ZA 5KHXA 4XOZA 2W4OA 3IW6A 5AP2A 3OP5A 4FI1A 2HZ4A 3R7GA 5LVLA 4RVLA 4OBPA 3ANQA 4BC6A 1OL7A 2OFVA 4IAZA 3G15A 2QOLA 1BX6A 3R73A 5H9BA 4UMQA 3NNVA 4EOIA 2QLQA 2HENA 4YZNA 4F4PA 2C47A 5AA8A 2X1NA 2C0TA 4RVKA 1ND4A 4KBKA 2ZMCA 5KMKA 1H08A 5BVOA 2VO3A 3PIYA 3QGYA 5I9XA 3QQUA 4HYSA 3HA8A 1K9AA 5JQ8A 4ITIA 3QBNA 4LL5A 4ALUA 3PLSA 4ORKA 5E1EA 1OM1A 3QQFA 5ANGA 4XP3A 4QPSA 3RHKA 3UPXA 3M42A 2B52A 4O38A 3ZFYA 1J7LA 4RIYB 4FTRA 4LMUA 5AV4A 4IWDA 2GSFA 4YHTA 4EHZA 5LVOA 4O1PA 4WRSA 4AZWA 3FLYA 4BR3A 5AP5A 5I5ZA 4KSQA 3VS7A 3RINA 5HBEA 4DBNA 3KRLA 4RLKA 5IU2A 2WQMA 5M56A 1PJKA 4FICA 2G2HA 4BZNA 1RQQA 5LVNA 3PP0A 3Q96A 4YZDA 3RHXA 3KRXA 2ZV2A 3RNYA 3UGCA 3QXOA 5LXMA 4L3JA 5EM6A 1Z57A 3IK3A 4R7HA 3B2TA 2Y4PA 4TZRA 4FTIA 4FTOA 4N0SA 2XCHA 4E4MA 4NM5A 1GZOA 3ORXA 4GK4A 4XV3A 4BCJA 3W2QA 4PDPA 2PE1A 4FIGA 3C4XA 2GQGA 3I5NA 2V22A 3EZVA 2B7AA 3F5PA 4NW6A 4I4EA 4EOOA 2ZV7A 2QODA 4S31A 3P23A 4D1ZA 2JC6A 3PDTA 4PWNA 2JITA 3IW7A 3S3IA 3DK3A 5IZFA 4UWCA 2VNYA 2C30A 3KL8A 3PZHA 2CCIA 4KRDA 4PNIA 2YDIA 3QTUA 4X21A 3JVSA 4DG3E 4QPMA 2OFUA 5J7HA 3DA6A 5C4KA 1GZKA 4EWQA 5LARA 4MXZA 3JPVA 2CGXA 3FLNC 3GC8A 3GBZA 4JRVA 4NCTC 3UC3A 1FVTA 4XG8A 4ZTQA 2YM5A 3UNZA 3PYYA 4NIFA 4O27B 2WTJA 2BZHB 3I79A 1Q99A 3QUEA 1UV5A 4KNBA 5CVHA 3BLRA 5BVWA 3ET7A 3NUYA 1H1RA 3ZRKA 4P5QA 1XH7A 2C6IA 4I6QA 4KKHA 4AN3A 1WZYA 4V04A 4OTFA 1XWSA 5HBJA 4XRLA 4NL0A 2VWYA 2QG7A 5HORA 2XMYA 1Q8YA 5CF5A 2J0LA 2ITXA 3WF8A 3EQDA 2W9ZB 4TYHB 3U9NA 2CMWA 3Q9ZA 3BYSA 3C4WA 1GNGA 2UVYA 3DY7A 2RL5A 1S9JA 3WE4A 2P2IA 3F2RA 4FSQA 3LCKA 5CAVA 4FE2A 2W7XA 2QR8A 4WNPA 3JYAA 4EYMA 5EW9A 2CKEA 4FT9A 2C5OA 2W1CA 3SC1A 3F2NA 3KFAA 4CYIA 4WG4A 4FKVA 4X2KA 3G2FA 5CSHA 3FY0A 4GKIA 3WOWA 3QTRA 2YM3A 2JKKA 3D7ZA 1AGWA 1P4OA 1ZZ2A 2QC6A 1MRYA 5HESA 4D2PA 2BCJA 3LFCA 4BKZA 4QP3A 3ZO3A 2JKMA 4BZOA 5E92A 3PLAE 5HD7A 3CTQA 4YO4A 4TWOA 3MFSA 5HCZA 1P5EA 4BHZA 4DFXE 3PJCA 4FV8A 1YHSA 4XYFA 5DVRA 4ZSLA 3FMJA 4CMTA 3DXPA 1J1BA 4GT3A 4AU8A 2Z7QA 3DV3A 1O6YA 5IMXA 4XOYA 3NGAA 4FK3A 4IVAA 4CRLA 4QMZA 3PUPA 4UYNA 4KABA 1ZYDA 1I44A 5IEYA 3ZONA 1ZMVA 2XNBA 5AR8A 3DCVA 3UC4A 3ATSA 5EM8A 1WBOA 1PXJA 3A4OX 3ZC6A 4FKLA 4BDCA 2ITYA 4B8LA 4K1BA 3NUXA 4K2RA 2PVNA 3PWYA 5CS6A 4RX9A 3IQ7A 2RG5A 4O7YA 5IQGA 4FKGA 4YLKA 3A60A 1JSTA 1SNXA 3RZBA 5JK3A 3RMFA 3U6JA 3FEGA 2HWPA 1XH6A 3ZMMA 2VX0A 5BNJA 4FEVA 1ZOHA 2J51A 2X81A 3Q5ZA 3SXSA 3L1SA 3VULA 4ANMA 3EFWA 3HMMA 4IDTA 3F9NA 3BV2A 4WG5A 4OBOA 4R7IA 3ZO4A 4EQUA 3FHRA 4XLIA 1SZMA 3V5QA 4AGWA 1OPJA 3EQIA 2YAKA 4PF4A 5D7VA 4MNEB 3ZTXA 4UXLA 1Y8GA 2CHLA 5BMMA 3DGKA 3QD0A 4HCVA 3F3TA 4G9CA 2Z7SA 4KRCA 5L8LA 4DEGA 5L2WA 3ORMA 3R02A 4ERWA 5KO1A 5BPYA 5I9UA 4E93A 4JI9A 3AQVA 2I0VA 1Y6BA 4EL9A 1Q62A 3TUDA 3POOA 4M69B 5E8YA 3RPSA 4EK5A 2NNWB 4AFEA 3QTZA 4FIIA 4H3PA 1G5SA 3Q6WA 4BI0A 3UBDA 3FMLA 3QD2B 4N70A 3HKOA 3PY0A 4FTTA 3OXTA 5HNIX 2VGOA 1JOWB 2H9VA 2R0IA 3COHA 3QUPA 2H6DA 4XG3A 5LCKA 3SD0A 4YTHA 4DAWA 3D9VA 2PYWA 5AV3A 3A8XA 3D5XA 5AR2A 3RZFA 3ZM9A 4X3FC 4K0YA 5DT3A 3R21A 4G16A 2BZKB 4BFMA 3S1HA 5HIEA 5D10A 3ZH8A 4WNOA 4QTCA 4ZLYA 1TVOA 1OKYA 5AP6A 4AG8A 3ZLXA 2FUMA 3SA0A 4D0WA 4CD0A 2WTKC 2WMBA 4QP4A 2VD5A 3PSCA 4CZUA 4ZSAA 4DEDA 3O8UA 3R01A 4N6ZA 2W1EA 4R5SA 4AOIA 3EIDA 4CQGA 1OL1A 1A06A 3F61A 1VEBA 4EOQA 4M67A 3RTPA 3FI8A 3UVPA 3R83A 4W8EA 4O7ZA 1NVSA 2C4GA 2HY0A 4UX9A 2X6EA 5CSWA 5HCYA 2J0KA 4PL4A 3EYHA 4CFVA 4O7VA 3EQHA 2JFLA 4L3PA 4BDDA 3W2SA 2VTLA 1H07A 2XYNA 4NFNA 4O0WA 4X2GA 4FV2A 5FEEA 3PY3A 5EHLA 1ZY5A 4G6OA 3VBWA 4O7SA 2YHVA 3PPJA 5KMIA 2WQNA 3K5UA 4IIRA 3O50A 1J7UA 4R78A 1ZMUA 4E4LA 3NCZA 5F95A 4QP2A 3C0IA 4KB8A 2PVJA 5LOHA 4C34A 4O82A 3UIXA 3HECA 1Z9XA 4ENYA 5HI2A 3FL5A 3QQLA 4OTPA 4TW9A 3N9XA 4KS8A 2G01A 5HLPA 4ANQA 4MVFA 2XKCA 4EC8A 3A2CA 3ZOSA 5AR3A 3OY3A 5HEZA 5F94A 3V5TA 5KZIA 4BWKA 3SG9A 3K54A 4FKJA 1IR3A 3BGPA 5CXHA 3KREA 1OVEA 1YW2A 4O21A 2Y4IC 3C7QA 2XNOA 5JFXA 3EB0A 4D28A 4U43A 4TNDA 3CIKA 3BEGA 3GCSA 1XH5A 3PPZA 4TNBA 3R8PA 4DCAA 3FPMA 3B2WA 4QMTA 3AMYA 3FC1X 3GB2A 4G5JA 3O96A 2ZM3A 4FSWA 4X2NA 4BIEA 3MJ2A 5EKNA 2JFMA 3T9IA 4TYGA 3VN9A 5I3OA 2VWIA 3LKMA 1K2PA 1OKZA 1YXXA 2HWOA 2X4FA 2R3RA 2PVMA 3ORNA 2BR1A 3D0EA 3P1AA 4IACA 4NM3A 4AS0A 5HVYA 4RFZA 4GJ2A 1H26A 4IB0A 4YLJA 3BWJA 4IAAA 1PKGA 4QT1A 3ZBFA 5AUWA 5A3XA 3I0QA 4IW0A 1Z5MA 2JBPA 5EDRA 2XS0A 4GS6A 4HYIA 3N4TA 2PWLA 2H34A 1YHWA 3UZTA 4HPUE 3QU0A 4YZCA 4KIKB 1YDRE 3BCEA 4CFNA 2UW6A 2WEIA 2WB8A 3EL8A 3FZ1A 4RBLA 4QMNA 2F2CB 2FSTX 2CNVA 4ZTHA 2Y6OA 2OXDA 4M97A 4CTCA 1ZXEA 3KXXA 3KXMA 2BILB 5J9YA 5HHWA 3VUGA 3HMPA 3BIZA 5CEKA 3DKCA 5HE1A 3QWKA 3AC1A 5CZHA 2E9UA 3EWHA 4C35A 4FZFB 2C3IB 4E4NA 3QTSA 3TNPC 4FV7A 5BYYA 4FTLA 1OL2A 4G6LA 3OCGA 5L6PA 5GIOE 4WHZA 4OTHA 3ZSHA 4QNYA 1UA2A 4MKCA 5IUGA 3GP0A 1YXUA 2DQ7X 3ZU7A 4QQCA 4DFUA 4L8MA 4ZTNA 3MPAA 3AC5A 4RJ4A 4JDJA 2G2IA 5E8WA 3PRFA 2HXLA 2OJIA 3R6XA 3FBVA 5FP6A 3E8NA 2QU6A 3QZHA 4GV1A 1PMNA 1TQPA 2BKZA 3D5VA 4KIPA 4ZXTA 3RM6A 1VYZA 4XV2A 4YNEA 2NRUA 3QX4A 4X2JA 4NYEA 3BYVA 4ASXA 2EWAA 3LQ8A 3PE1A 4EH4A 5GHVA 4WKQA 4P4CA 5I4NA 4LFIA 4J7BA 5M4UA 1M14A 4E4XA 4BCHA 2X7GA 5DH3A 1ZRZA 2UZWE 3OY1A 4UMUA 3KRJA 2OWBA 4MH7A 1CKJA 3Q9WA 3TV6A 4C3FA 4U80A 2C5NA 3ZLSA 3KXHA 4WSQA 2XH5A 1LEZA 3CTHA 3PG1A 2VX1A 4QPAA 3DFAA 3G0FA 1SVGA 5JGDA 4OBQA 1UU3A 2HELA 2QKWB 4Y46A 3VUKA 3LE6A 3P7CA 4U3ZA 2VTSA 4YJOA 3VBYA 4IFGA 4DCEA 4ZZOA 4A4XA 5IISA 1CMKE 5HU3A 1NVQA 3CD8A 2X9FA 5AAFA 2A0CX 2VWUA 1FMOE 3OUKA 3VRYA 5DPVA 1HCKA 4FIHA 4BTKA 4ZZMA 2CGUA 2RFSA 3REPA 1J3HA 5CWZA 4JX3A 4YUQA 2UZOA 3QCYA 4A4LA 3BELA 4IAFA 4CKIA 1FVRA 3OWLA 3OW4A 3S0OA 3AMAA 5HX8A 3ID6C 2XK6A 3QQJA 3VS6A 3KULB 3C5IA 5A4QA 2OIQA 4RWJA 2QOIA 2UZEA 3FWQA 4NIFB 3DS6A 4H1JA 5EYDA 5KNJA 3ALNA 2ITQA 3DTWA 3TV7A 3DXQA 2G1TA 3L9PA 5IQBA 5DI1A 4DITA 4EHEA 5J1WA 4OTQA 5CY3A 5J79A 4O81A 4JNWA 3C50A 3F5GA 3OXZA 5L2SA 2UW9A 4RSSA 3KKVA 3KY2A 2XK7A 4ZMEA 2W05A 4ZY5A 3RALA 3D15A 3B8RA 2BAJA 1PMVA 3CCNA 1RJBA 4RZVA 2QVSE 3QKKA 3E3BX 2PZIA 1L3RE 1CM8A 1H00A 4APCA 3O7LD 4FEUA 4ANSA 3FLQA 4L43A 4F9BA 1FMKA 2UZUE 1W84A 3LMHA 2NRYA 1V0PA 2GTMA 3AC4A 4I6HA 3G6GA 4WD5A 3IGOA 2BAQA 3UZPA 4EH3A 5JRQA 4O7NA 3KCFA 3QZIA 3FQEA 2IO6A 1Q8WA 4MBLA 2VO0A 2Q0NA 3FE3A 3PRIA 4OTWA 4S32A 3V51A 4EEVA 4QMXA 5CAOA 1STCE 3O8PA 4DEIA 3RAIA 4FV4A 1GAGA 5IEXA 3ORLA 3ACKA 5CT0A 4PMSA 5IQHA 5E8XA 1YOJA 2WMVA 3GNIB 1IG1A 5CNOA 1G8SA 4HZSA 4ALVA 3R2YA 1XH4A 3AC8A 2WTKB 1SVEA 1M17A 2GNGA 4RJ8A 4DT8A 4WBBB 4AUAA 3QX2A 4EJ7A 5B7VA 5CF8A 3WZKA 1Q61A 4CRSA 3NDMA 4ZJIA 2OW3A 3MWUA 3PP1A 4N57A 4AX8A 4PDSA 4NTTA 3EQBA 5JZNA 4MWHA 3F5UA 4PPCA 2ZDTA 3EN5A 5CEIA 4D0XA 4X3FA 1EH4A 4XG9A 5CZIA 3V5JA 1PYXA 4MF0A 2F2UA 3COIA 1XKKA 3NRMA 2EUFB 3NWWA 4AZSA 5IPJA 3SLSA 4LGDA 2ERZE 2YEXA 3C0GA 4IM2A 2FSMX 3DBEA 4F7LA 4QTAA 3RAHA 3PXKA 3V8WA 2VTQA 3EH9A 3R0TA 5E8TA 5HE3A 5GZ9A 4K6ZA 4QP1A 4NWMA 4DG0E 1FPUA 3DFCB 3VHKA 5TKDA 5G6VA 3FSKA 1E1XA 5DGZA 2YAAA 5FG8A 2PL0A 3IKAA 5CAQA 4CFFA 4ANNA 3TKUA 2EU9A 4KA3A 4RRVA 3TWJA 4C3PA 4C4HA 3JUHA 3LM5A 3OT8A 3TZ9A 5E90A 2VWXA 5JFWA 4HGEA 3U54A 4O0VA 3LPBA 4DFNA 5A4TA 4M66A 5BVNA 4B9DA 1R1WA 3SW4A 3Q9XA 3MA6A 5C9CA 3GCQA 3KVWA 1KSWA 5IH4A 1GIIA 3V5PA 5EM7A 1KWPA 2J4ZA 3E8CA 3ELJA 3BYMA 3MY0A 3W16A 3FI2A 3I0OA 4C7TA 3BRBA 2CN5A 3NPCA 2V62A 3AG9A 4M0ZA 4D2TA 2YDKA 2OXYA 2AC3A 5ICPA 5A6NA 2PVFA 4BYJA 3E92A 5DIAA 4RLLA 4BKJA 4O6EA 1R78A 4MD7E 3QLFA 4NW5A 2GHLA 5EI6A 1H1WA 4GFGA 5DMZA 2FA2A 2OH4A 4F65A 1R39A 2CDZA 2VRXA 1YI3A 5J5TA 3UPZA 2ZV8A 3KMWA 2UW5A 5L4QA 1YXVA 3CTJA 4FC0A 2BRBA 4YBJA 4GUEA 2UZTA 4YC3A 3BGQA 4RQKA 4D9TA 3TG1A 5LCJA 4EORA 3DLSA 2EXCX 3CGFA 2X8DA 3R1SA 2LGCA 3MH0A 4S34A 3I4BA 3MI9A 5CU4A 3KRRA 4FVRA 4FEWA 3PA3A 3QWJA 3P86A 4I0TA 4AZFA 4DGOA 1X8BA 3PIZA 3FKLA 3UG2A 3VQHA 2CCHA 2ZMDA 4PP9A 3SGCA 1FBNA 4YJQA 3RWPA 4WUAA 2XJ1A 3FHIA 4XP0A 4D9UA 1Q3WA 5GZAA 2WO6A 4YZMA 5KMNA 5EOLA 2VTTA 3GI3A 2GNHA 4TKSA 1SM2A 5BVEA 3U51A 5CU6A 5DR2A 5KKRB 4UN0C 5CF6A 3E63A 4F1MA 3TZ8A 4YSMA 1GZ8A 1M2RA 4FSNA 3S2PA 3TKIA 2WMXA 2HIWA 4EZ5A 1H27A 4FX3A 4QP6A 2JKOA 3NVKI 5E8VA 4B0GA 5FUTA 4FOCA 3LFEA 5I0BA 4I5CA 3O17A 1JWHA 4QO9A 5EQYA 5K4JA 5E7RA 4U40A 1IA9A 2C3JA 3ACJA 4O0TA 2YIWA 4DA5A 2DWBA 4FTQA 4U9AA 2IPXA 2XIRA 3U6IA 1OBGA 4GU6A 3UG1A 2YJSA 1YQJA 1BYGA 2OH0E 1PXMA 4K18A 4M7IA 3QHWA 5C27A 4HVIA 3VBXA 4W8DA 4O83A 3DNEA 4JXFA 2CKOA 1B38A 2YCSA 4QQ5A 4L44A 3MIYA 4IDVA 5JQ5A 1KOAA 3QQHA 4EHGA 4ZY6A 3QQKA 4RMZA 5JSMA 1XJDA 4FKUA 2V55A 5LMBA 2XYUA 1DI9A 2JGZA 4F7JA 4M15A 3RK9A 4QOXA 2YWVA 2J0JA 2PMIA 2RFDA 1HOWA 1OL6A 3NUNA 5ITAA 4ZTSA 3Q60A 4NJ3A 3NIZA 3TCPA 4E1ZA 1FQ1B 2JD5A 1JNKA 5CLPA 2VWWA 1NVRA 4DFYA 5IA3A 2RFNA 1PXLA 5IDPA 2IZTA 3TDVA 2ZJWA 4BZDA 4LYNA 4PMPA 1WBWA 2QNJA 2WGJA 1JBPE 2C5YA 4UWBA 4BN1A 2PMNX 2ACXA 3V8TA 3E7VA 4MX9A 2ITVA 4BGQA 4EUTA 2W1GA 2YJRA 2C6KA 1WVWA 1T46A 3C4ZA 2VU3A 3MTLA 2IVTA 2VO6A 2UUEA 5EI8A 4BCOA 3IW8A 2W1ZA 4HJOA 5LWMA 5C4LA 4D2RA 3KVXA 3HMNA 3MSSA 2QR7A 3HX4A 1JLUE 1H8FA 4G3GA 4XG2A 5CAUA 4CKRA 3ZSGA 2YA9A 5EKOA 5TOZA 2A1AB 4GK2A 4A9TA 4AGDA 3P0MA 3Q9YA 4G2FA 1M7NA 4MEDA 2BZIB 4TYEA 2YISA 3A7JA 2W5AA 4RGJA 1H1SA 2FH9A 3F7WA 3LXPA 4QNAA 1KE8A 3TDWA 2WQBA 2VUWA 3CQUA 1G3NA 2YIYA 3GFWA 4C8BA 2ZOQA 3VRZA 3BE9A 2QCSA 4XV9A 2XRWA 3G90X 4DLJA 2CKPA 4USDA 2WMRA 2R3IA 2O2UA 3CEKA 4FYNA 2Z02A 3GU4A 3MGYA 4YU2A 2X8EA 5HE2A 1XR1A 3OG7A 3TNHA 1WBNA 4ASZA 5GJGA 5FP5A 3TJCA 4M14A 3TZMA 2PULA 1M2PA 4OGRA 2PZ5A 3D7TB 1LPUA 2UW3A 3EOCA 5AX9A 4AE9A 1Y6AA 4WNMA 4XH6A 3LLAA 3F82A 2DUVA 4EHVA 1XH8A 2ITNA 3Q04A 5FXQA 5C8MA 2WQOA 3W2CA 4F9AA 3VS4A 5HU9A 4KINA 2F49A 4ZP5A 2P4IA 4EK8A 1FINA 4QMSA 1DI8A 1Y91A 5EQEA 4G34A 5JRSA 4HVDA 4AP7A 2BIKB 3AGLA 5AP7A 3C5UA 2IJMA 4IB1A 3ZO1A 1IRKA 4MQ2A 3DZOA 3NYVA 1ZOGA 5CU2A 2YITA 2P3GX 3BU5A 3DB8A 2QO7A 4LMNA 5GNKA 4C62A 3R1QA 3DJ7A 4UMPA 3RAWA 3F88A 2EXMA 5KBRA 5EYMA 3GC0A 2PTKA 3QLGA 1VYWA 1Q8ZA 3Q4UA 4PTEA 1B39A 5F1ZA 4PMMA 4FVQA 3ETAA 4XG6A 2BHHA 3NNXA 4JDIA 4F9CA 2XNMA 3CSVA 2W4KA 3QRTA 5FM3A 2PHKA 3KN5A 2E9OA 3ORKA 4E5BA 2Q83A 3CC6A 4I3ZA 1XBBA 4W9WA 4R3CA 4FEXA 3VS5A 4YTCA 5EDPA 4TXCA 1Q3DA 3LCOA 4IVCA 3EN9A 4FVPA 4RA4A 3AT3A 4J98A 5ETFA 4E26A 3MW1A 4OAUC 4M68A 3R9DA 5EFQA 3OTUA 3T8OA 1L8TA 2REIA 4IADA 3D94A 4RC2A 5AR5A 4CFXA 3AC2A 5DR6A 4BVUA 3BHUA 4RFYA 1YHVA 4JVGA 1ZLTA 4FL2A 3AT2A 3C4FA 4XNEA 5T68A 3D4QA 3R7OA 1OGUA 3TTIA 1VR2A 5TO8A 3UP7A 1Q8TA 5TR6A 4CKJA 5AUTA 4B8MA 2WTIA 3QC4A 3H0YA 1ZYLA 1CTPE 5DRBA 4R3PA 4HYHA 4BDJA 4YSJA 3A7IA 4YZ9A 2WMWA 3OWKA 1FGKA 1H0VA 3PPKA 4KWPA 5KMLA 3ULZA 4HCTA 4RVMA 2QOKA 3POZA 2YZAA 3MDYA 2ONLC 5FXSA 2IZSA 4H58A 2QONA 5DT4A 4CV9A 4FTJA 4RPVA 1RE8A 4ZS0A 1WBTA 3UNJA 4BTJA 2CJMA 2XBJA 2WAJA 3RM7A 2JKQA 4J96A 5CEMA 4LV8A 2BMCA 4F7NA 3CKWA 2UZDA 3OFMA 4AQCA 1W98A 3D7TA 4EOMA 5CT7A 5KMMA 3DU8A 4TYHA 3ZM4A 5AAGA 4FGBA 3ZZEA 5HICA 2ESMA 4IJPA 4BGGA 2R4BA 3IOKA 5CENA 4DC2A 2PUPA 4L00A 3LJ2A 4UYAA 3P4KA 4V0GB 5TT7A 3UOLA 1R3CA 3GU6A 5BYLA 3WYXA 4PTGA 3IPHA 3BLQA 1V1KA 3W1FA 4QYFA 4XG4A 5HLNA 4BGHA 3AT4A 1QPEA 5A6OA 4ZOGA 3WF5A 2XKDA 1IAHA 2JDTA 2QI8A 5C8NA 4TWPA 3N51A 4GG7A 3EQCA 4MHAA 3MB6A 2W5BA 2XJ0A 1KE7A 1RDQE 3GQIA 4ALWA 2VN9A 2YWPA 5A54A 2Y9QA 3KMUA 2XA4A 4Z55A 2W06A 1KV2A 3P5KA 4IJ9A 4O6LA 4E6DA 4ZMFA 3ZCLA 5KX8A 3OCTA 2J50A 4ZS4A 2OIDA 4X3FB 3FXWA 3B8QA 5EW8A 3LM0A 4KBAA 2X7OA 2XK9A 3VHEA 1PW2A 4MK0A 2OGVA 1Q5KA 2B9FA 5E8SA 2J0IA 2JDOA 3D5UA 5CI7A 3CP9A 4LGGA 2VAGA 3H9OA 3TKHA 4E5AX 4LGHA 3GOPA 4O91A 3S95A 5DR9A 5BUJA 3T3VA 4WA9A 3IOPA 2YIQA 3E93A 1JKKA 2C5XA 4FL1A 3UMXA 4F9WA 4EK6A 3FMDA 5J9ZA 4L45A 3ZSIA 3F66A 3AD4A 4F6WA 5LMKC 3U55A 5EI2A 4XCUA 5CEPA 3EFLA 3FZRA 3MVMA 3ZBXA 3ZRLA 4UV0A 3LXLA 4IQ6A 2ETKA 4XS2A 3UMWA 3C9WA 4YP8A 5CX9A 4F0FA 4BDGA 3UNKA 5JGBA 3NNUA 1GJOA 4JAIA 3CPBA 4ENXA 1UKHA 2C5VA 3EKKA 2NP8A 4JX7A 2OF2A 3L9NA 1NT2A 4ZZNA 4HW7A 2XNPA 2BAKA 4M0YA 1BL6A 3Q52A 4ACGA 4QD6A 4U97A 2ITOA 4LL0A 4P7EA 3C13A 3SOAA 3LMGA 3I7BA 4FT3A 5T6KA 3E5AA 4PRJA 1APME 4TRLA 4C38A 2XUUA 3G33A 5ANEA 4BCFA 5E8UA 5BVDA 3T3UA 3W18A 4P2KA 2GNFA 3LFNA 5CF4A 2QG5A 4ZJVA 3ZEWA 3HRBA 5J7BA 3FMEA 1OIQA 2C3KA 3DBQA 4Y83A 4UMTA 4A9YA 4RWIA 4OTRA 2PY3A 3IDCA 3GU5A 4FIEA 4BKYA 5A4LA 5AADA 2X9EA 3CE3A 3ZHPC 4X2FA 2GNJA 2OZOA 4NFMA 4FTAA 2GMXA 3UVRA 2HXQA 3FYJX 5EQPA 2CGWA 3EFJA 2Y8OA 2VNWA 3L8PA 3LCTA 4CNHA 4CZYB 3UYSA 3MTFA 3EKNA 4FTKA 3I6UA 4H36A 4UEUA 5DFPA 5GJFA 1ATPE 3ODYX 4C4JA 5H2UA 1W8CA 1W0XC 4PY1A 3R8UA 2I6LA 3R9RA 4JIKA 3DAKA 5E9EA 4UMRA 4LRJA 3UYTA 4QTBA 3KK8A 2XP2A 5IA5A 5BQ0A 2ZM1A 4L7FA 4E8AA 3OCBA 3GFEA 2RGPA 5L2TA 3N4UA 5FQDC 3G5DA 2UW0A 4R8QA 3F3WA 4CMUA 4PPBA 5BX0A 2J2IB 1GY3A 2OSCA 5HVJA 5BVFA 4UWYA 3HDMA 3UO5A 3F7ZA 4FKSA 5FEQA 3PTGA 4MCVA 3ITZA 3KMMA 3NUUA 1XQZA 4GL9A 2B1PA 3QCQA 3NS9A 5M09A 2VWBA 2WTCA 2VTJA 1BUHA 4ID7A 3MPTA 3PXFA 3PJ8A 4FTNA 4DTKA 4QYGA 2R5TA 1QPCA 3IG7A 4FV1A 4FTCA 4EBWA 5JFVA 2BPMA 3MV5A 4MXYA 4FG8A 4NZWB 5CEQA 4EQCA 4WSYA 4C37A 4F7SA 3W10A 4NH1A 4AGUA 3BI6A 1Y57A 4PNKA 5AR4A 2Z7RA 5EG3A 2VTNA 2BROA 1PXNA 4XMOA 2OJGA 2UV2A 4O0SA 2HY81 2V7AA 1J7IA 3Q4CA 3M2WA 3QCXA 1OIYA 2JIVA 3DDPA 1ERKA 3JY0A 5A46A 4LV5A 5CAPA 3DT1A 2X8IA 4JBPA 1TKIA 4UBAA 3VO3A 4IVDA 4BY9E 2B55A 5IQEA 5IH6A 3DAEA 5M4IA 4F63A 3K5VA 4FSYA 4PPAA 3NMUF 2OJ9A 3SAYA 4CLJA 5I9YA 5DE2A 5EK7A 3VAPA 4CCUA 2V0DA 2IW9A 2A19B 2C6DA 3DK6A 3PJ3A 4QMLA 1WMKA 4IFCA 5TE0A 3RPYA 1SVHA 4EOLA 3TNWA 4U81A 4BHNA 3R04A 1J91A 4H1MA 2UVZA 1WAKA 4II5A 5T3QA 2V7OA 4GKHA 4YJPA 2CKQA 2FYSA 3EQGA 1YI4A 4FT0A 3OXIA 3Q53A 1Q97A 3CJFA 2WXVA 4RIWB 1DAYA 1Q4LA 4W4YA 5HG9A 4BB4A 4BRXA 4D4VA 2QOOA 3AXWA 4LOQA 4WRGA 4O7TA 3OTVA 1WBVA 2BIYA 3HP2A 3WILA 4E7WA 3C0HA 3PVBA 1H28A 2F7ZE 5CU0A 4EBVA 4PTCA 4YR8A 2CN8A 4GCJA 1ZWSA 5IQAA 5L3AA 1KE9A 4RIXA 2ZM4A 1NXKA 4GT5A 2OI4X 3AGMA 4DGGA 4IB5A 4O0XA 4BYIA 4PL5A 2ERKA 2GNIA 4C61A 3R7EA 4D1XA 3IDPA 4NM7A 1H1QA 3ORPA 3QKLA 3O2MA 2VTIA 3KU2A 3P7AA 4KIKA 4LUDA 4FV6A 4O1OA 4QMYA 3KRWA 3ZUVA 3R8MA 1UU8A 4CG8A 4FBXA 4E6AA 3U9CA 5HKMA 1KE5A 3QF9A 2X0GA 3Q32A 2PK9A 4DN5A 3U87A 5M06A 2XCKA 5AUZA 3IGGA 3OHTA 4WG3A 5FWKK 3TNIA 3HZTA 5KHWA 2P0CA 3OS3A 4E3CA 4CGAA 3COMA 5IQIA 2W9FB 3G51A 3GOKA 3PVGA 4GIIA 4IZYA 5HGIA 3TJDA 2V5QA 1GIJA 4G5PA 5HTCA 4IXPA 2VTHA 5LMKA 2F7EE 4DINA 4E73A 4GYGA 5FRIA 5KKRC 3T9TA 4D4SA 3R63A 4TTHB 4RG0A 3MFUA 2YCQA 3I60A 4AZVA 3TZ7A 4DEAA 4F99A 3BQRA 5IUHA 1CDKA 5AFVA 3LAUA 4FNZA 4N4SA 2BZJA 4KKEA 3LZBA 3O8TA 4JIAA 1WVYA 1YWRA 2ITWA 3A4PA 3NW6A 3L8SA 2O65A 2VTPA 3HUBA 3LFFA 4FNXA 4DH1A 3MH1A 2UW8A 2XK8A 3U4UA 4DH3A 3TN8A 4EK4A 4MXCA 4PV0A 3MPMA 2WMQA 2E9NA 4I6BA 4JBOA 4PUZA 4IAKA 2IVVA 3FKOA 3FPQA 2BFXA 4M3QA 2PVLA 3C51A 4B99A 3EZRA 4QP9A 1YWVA 2C6EA 2W4JA 4FUYA 1QPDA 4EH8A 2YN8A 3FY2A 1YXSA 1DS5A 4PDOA 4QYEA 4Y95A 3ZLWA 5G1XA 3BWFA 4KD1A 3EHAA 4CTBA 2W99B 3HV3A 2PSQA 2WTWA 1JKSA 2HZIA 2XKEA 4TWCA 3CKXA 5HCXA 3DK7A 1UKIA 5L6WL 4A9UA 5K5XA 2AUHA 3DJ5A 3MS9A 3MY1A 4G9RA 4P5ZA 3HVCA 4X7QA 2BRMA 5FDXA 3Q4ZA 5HO7A 3QRJA 4I6FA 3UE4A 5A9UA 2IN6A 3CR0A 3EMGA 4AACA 5FXRA 4DE4A 4AXAA 3FMMA 4UXQA 4C59A 2RG6A 4FODA 4BI1A 3R9HA 3GVUA 5ETAA 3NR9A 5BVKA 4BCGA 4RIYA 5ANDA 3C4EA 4EI4A 2XVDA 1P2AA 5AX3A 5CYIA 5IQDA 2XK3A 2CSNA 3L9MA 4I24A 4KSPA 2X2LA 3UIUA 2XM9A 3FC2A 3ATTA 3HRCA 3V5WA 3DAJA 2UZNA 4Y73A 1QMZA 3CY2A 4C4EA 5AM7A 4F08A 5ANIA 4O86A 4CZTA 2PMOX 4IWQA 3LFAA 4XJ0A 3RCJA 2ZV9A 2KTYA 3A7GA 5C03A 3ORZA 3V8SA 3VS1A 4BTFA 3NYNA 4C3RA 4GT4A 5J9LA 4XEYA 2OZAB 3PA5A 5KE0A 2O8YA 4BCMA 3N4VA 3LIJA 4U41A 2WQEA 3DBFA 3DQXA 1M7QA 4IWPA 4MNFA 3LJ1A 2R3HA 4RJ7A 1OKVA 3GC7A
chains in the Genus database with same CATH superfamily
3NSZA 5F4NA 4DH8A 3GUBA 4YZBA 3QCSA 4GFMA 4HPTE 4XHKB 4P90A 1H24A 4XP2A 4D58A 4EUUA 4ACHA 4NJDA 5H8BA 4CSVA 2R7BA 4AW5A 3LHJA 4FSRA 3ZDIA 2DYLA 4O96A 1E1VA 4BDIA 3R28A 3VUMA 4OW8A 4RC3A 4W4VA 4IX6A 3SRVA 3PJ1A 4F70A 3HAVA 4MYGA 3R1YA 2XBAA 4F1OA 2ITZA 4WO5A 2R3GA 2PUUA 4S30A 3VQUA 3EFKA 4JLCA 1MQBA 5EHYA 4FKIA 4MBJA 3W2OA 3TV4A 3SVVA 3KXZA 3TIZA 1FOTA 4J53A 5DLSA 3THBA 4ACCA 4PP7A 5J8IA 3SV0A 3QUDA 4QQTA 2CNQA 2I40A 4DTBA 4BWXA 4UALA 5AR7A 4D1SA 3O7LB 5IQFA 5EHOA 1YRPA 2W0JA 1CKIA 5L8JA 4IX4A 1OUYA 1NA7A 3FZPA 2UZBA 5AUXA 1BMKA 4BDFA 2QHMA 1OITA 3EQFA 4O0YA 2B0QA 3S00A 1OKWA 3OC1A 1ZZLA 1YWNA 2YCRA 4ANLA 2ITPA 3KEXA 4RJ6A 2UW7A 2ITUA 2J7TA 4FNWA 4JRNA 1VJYA 5HIDA 3CY3A 5A14A 5CXZA 4OAVB 4MUQA 3PSBA 2R7IA 2BKKA 4MD8E 1IA8A 3MIAA 1MQ4A 2YIRA 3RNIA 2GPHA 3QD3A 2CLXA 4FT7A 2C6MA 2R64A 2A4LA 4YHFA 4ZJJA 5CVFA 2YERA 3VBVA 2WELA 4O0UA 1PMUA 2WHBA 4F09A 4FZ6A 4YPDA 2Z60A 1OI9A 1JSVA 4GU9A 4C2WA 4AXFA 1H0WA 2R2PA 4G3EA 4WIHA 3QKMA 1H25A 4KIOA 3DQWA 3V3VA 4AW2A 4RX7A 5EH0A 2OICA 4J8MA 4DTAA 3OZ6A 3UO6A 3V5LA 3JY9A 3FUPA 3V04A 1BKXA 5M51A 4W4WA 5HO6A 1DM2A 2PUNA 4DT9A 4J99A 1G8AA 3BBTB 4FYOA 4K8AA 3W0QA 3RBWA 3NW5A 4MD9E 1O9UA 2BUJA 4BI2A 3QYWA 4ARKA 3UIMA 3UODA 4EOKA 2PE0A 3NZ0A 3R2BA 4D2WA 3BLHA 1AQ1A 1XMMA 5KMJA 4BCPA 1ZOEA 2AC5A 3M11A 3II5A 3WF7A 1WBSA 2WD1A 3VNTA 5L6OA 1BI8A 3NUSA 5K5NA 4GMYA 2HYYA 4FA2A 5J1VA 1M2QA 3DTCA 3WYYA 2B54A 4J97A 3ORTA 3W2PA 2C1AA 3MB7A 4X0MA 3RI1A 3QZFA 2Q0BA 2XKFA 3DPKA 3E62A 4CMOA 1H4LA 5FBOA 4C4IA 3V6SA 1W83A 1QCFA 4G3CA 4JOAA 5EYCA 3H0ZA 1ZMWA 4BIDA 1A48A 3V01A 1OGYA 2GS7A 1Q24A 5IUIA 2X2KA 2BTSA 3C1XA 4GVAA 4Y8DA 5I9VA 3KCKA 5LQFA 5EYKA 3LFBA 3A7HA 4JG6A 4C4GA 2R3PA 4Z16A 5D1JA 4QTEA 3H9RA 2HW6A 2KULA 2W96B 4YJNA 2O63A 2X4ZA 4I0RA 3NCGA 1YXTA 4AA5A 4QP7A 3NIEA 3HUCA 2WMAA 1OPLA 2IVUA 2Y4IB 5CU3A 3PZEA 4FKRA 3RCDA 1PKDA 5D11A 3VUHA 3HYHA 3H9FA 4BL1A 4HVSA 5EOBA 4TYJA 1GZNA 2GQRA 2I0YA 2X7FA 3LXKA 4IX5A 3BEAA 3VW6A 5KUPA 4CT2A 3KK9A 2VTMA 5HNBA 3Q5IA 4JJRA 3ULIA 3QC9A 2BDWA 5JMSA 4FSUA 3E8EA 3LFQA 4IM0A 4QQJA 4NKSA 4Z7GA 3W0MA 2OJJA 4ANBA 1F0QA 4XUFA 1KOBA 1REJA 4M13A 2VTAA 3FMKA 3OVVA 3OOMA 4ANOA 4OTIA 4DBXA 2FSLX 2OG8A 5AMNA 3PVWA 4WT6A 3FZOA 5H3QA 2EB2A 2ZB1A 4D55A 2XJ2A 3OBJA 2WOUA 2SRCA 3BHYA 3VBQA 3W8LA 4F6UA 5LMAA 3KXNA 4RX5A 4O84A 4LM5A 1PXIA 2HOGA 4RWLA 5JKGA 4DEEA 1FGIA 3HL7A 4W9XA 5L2IA 3I5ZA 3LOKA 2OO8X 2F4JA 3ORIA 4YURA 4DF3A 1ZARA 3E88A 3WF9A 5ACBC 3Q2JA 4USEA 3DXNA 4BCQA 3FZSA 2C6LA 1A9UA 1U5RA 3NYOA 1T45A 2C68A 4O7RA 2WPAA 4GIHA 3IECA 5LVMA 2FB8A 2VTOA 3R7IA 3NVMB 4MTAA 2RSVA 4YJRA 3FMHA 4F64A 2PVKA 1URWA 5DBXA 3G6HA 5M08A 4IC8A 2B53A 3OBGA 3COKA 4F0GA 4OUCA 4ZAUA 3HNGA 2WMSA 3RGFA 4EC9A 4ZK5A 2WTDA 4IM3A 4MQ1A 4U44A 2FGIA 4ASDA 4CFWA 4MAOA 2JDSA 3ZYAA 3LJ0A 1LP4A 4MNEA 5AUYA 5M44A 2BRNA 1OPKA 4JQEA 4ZTLA 3EN4A 3HA6A 4RIWA 3HV6A 4QMVA 1NY3A 4LG4A 3KA0A 4EKLA 3UQGA 3FMNA 3HLLA 2OIBA 2GNLA 2BHEA 5JGAA 2ZVAA 5HLWA 2I0HA 2P2HA 1XO2B 4A06A 2X0QA 4L67A 5GINE 3GU7A 3CBLA 3MVHA 5DEWA 4RJ5A 1TQIA 4ZEGA 3VF9A 3R30A 4FIFA 2PVRA 2VO7A 3RPVA 4E6QA 3BHVA 3MBLA 4FV9A 1OMWA 3WZDA 5IG1A 2B9IA 4JDKA 2OZAA 3E7OA 2WIHA 4I5HA 4G3FA 3RJCA 5AP4A 3UTOA 5HG8A 4OT6A 3SHEA 4YMJA 4IE9A 4O2PA 2QHNA 4AT4A 2B9JA 5C1QB 5FTGA 3CPCA 4L52A 4I20A 5KZ0A 1JSUA 3R1NA 3ZLYA 4FKWA 4PL3A 4QMPA 2IZRA 3IONA 3FAAA 4EH7A 3F6XA 2VTRA 5J5SA 4R3RA 5BYZA 5IA4A 3PFQA 4G3DA 5ANJA 2PZRA 3SXFA 4L6QA 3AOXA 1PY5A 2WEVA 3CQEA 4GRBA 1U54B 4YC8A 3ZZWA 4DGNA 2I0EA 5CEOA 3UVQA 3FZTA 4YGAA 1U46A 4C02A 2HCKA 5TF9A 5AIKA 3QRKA 3QXPA 3MN3A 4BF2A 4QYYA 4FZAB 1R0PA 2DS1A 4ASEA 4JDHA 4BIBA 5B0XA 4IMYA 4BICA 1O6KA 3CD3A 3JR1A 4JBQA 4AAAA 2BDJA 3DDQA 3VBTA 4AOJA 5DG5A 3VS3A 2Z2WA 3GT8A 4L3LA 5FBNC 1OIUA 1GOLA 2C6TA 4D2VA 5AUUA 4TPTA 2GCDA 4FUXA 4IAIA 3SX9A 2O3PA 3QL8A 3VUDA 2EVAA 1WCCA 4R1YA 2B9HA 1UWHA 3MH3A 1MUOA 4EOJA 4DEBA 2Y7JA 5D7AA 2E9VA 4O7WA 4U6RA 5HX6A 3UDTA 3UQFA 5KMOA 3F3UA 3IW4A 5IMEA 1KUTA 2VGPA 3Q3BA 5M4FA 2C1BA 3JS2A 3ZFMA 3WIKA 2PZYA 4JG8A 3QTIA 1B6CB 3MFRA 3ZDUA 5IA1A 1F5QA 3DBDA 4KS7A 4APPA 3LVPA 5DYJA 3BU3A 2JEDA 5GZ8A 1OUKA 3CGOA 2R3JA 1ZAOA 3OD6X 2VV9A 4QMUA 4QRCA 2QLUA 4XV1A 4F9YA 1LR4A 3SOCA 2JIUA 4GK3A 1PYEA 2YM6A 3JXWA 3ROYA 4V0GA 3UP2A 1O6LA 2C3LA 2I1MA 4NCTA 5AM6A 4TYIA 5K0XA 2QURA 1CSNA 3QZGA 3UDBA 3JVRA 4YHJA 5JZJA 2C69A 3W0NA 1WBPA 3V6RA 2UZVA 3MH2A 3ANRA 4GJ3A 3RVGA 4BDKA 4BWPA 3ZS5A 3OCSA 4C36A 4I21A 4DFZE 5L2QA 5C8KA 3ZRMA 2HW7A 1M52A 5DA3A 3R7VA 3AD6A 3ZFXA 4E6CA 3LCDA 3BX5A 4L46A 3EL7A 4I23A 3MA3A 3MY5A 2QU5A 3R00A 4ZIMA 2YZLA 1SMHA 5IDNA 3DJ6A 3K3JA 4HYUA 2ETMA 4O4DA 2X6DA 4NTSA 5HVKA 3FLZA 5A4CA 3QTQA 2J90A 4AN9A 1OBDA 1UNLA 4FZDB 3I6WA 4ONAA 4AW1A 4A07A 4K77A 3SXRA 4Z3VA 2IG7A 4DFBA 1PXPA 3O0GA 3KGAA 3D5WA 4MBIA 4BDEA 3U4WA 5E4HA 3QRIA 5JT2A 4BJJA 2RKUA 4QDVA 2OU7A 1Q41A 2OK1A 3LW0A 4IC7A 4JR7A 4JT3A 3FQHA 5HO8A 3VC4A 3TEIA 4DDIA 4CG9A 2WNTA 4NEUA 4ACMA 4A7CA 2OKRA 3W32A 4CYJA 5IA2A 4J95A 3WZUA 2C6OA 4A4OA 4YPSA 5AA9A 4EH9A 3R22A 2JLDA 3VS0A 4A9RA 3SQQA 1NW1A 3D14A 3P79A 4FR4A 3VWAA 4DGLC 3KQ7A 3U8WA 3G9NA 4DGMA 2WOTA 1I09A 2BVAA 4I5MA 4H39A 3NX8A 3FYKX 4OTDA 2A98A 4GH2A 4AFJA 1UNHA 3DNDA 4YJTA 4RWKA 2UVXA 4WBOA 4QMMA 4L53A 1YOLA 3Q4TA 4XRJA 3NFFB 5HZNA 1QPJA 1URCA 3KB7A 3ENHA 3MYGA 4I22A 1PXOA 4LRMA 5HG5A 4CFUA 3GGFA 4MWIA 4BBEA 2X2MA 3RPOA 5BUIA 3NAYA 4EZ7A 3QA8A 5M07A 3QD4A 4JMQA 3ERKA 2CGVA 3QALE 3A62A 2W1FA 2ONLA 3D2KA 3S4QA 3MESA 5IH5A 2YCFA 4M8TA 2WFYA 3BZ3A 4QMWA 3PE2A 3SDJA 3I81A 4KUJA 5GIPE 3UO4A 4HVGA 1OB3A 4FRFA 4ACDA 5L8KA 2Z8CA 2GU8A 4FTUA 3UOJA 3PXYA 5ANOA 2AYPA 2GHMA 3M1SA 4Z7HA 1JAMA 4YTFA 3HMOA 2GHGA 4XG7A 4HVHA 2QOFA 4JAJA 3WI6A 4D4YA 5IEVA 2J6MA 2CPKE 4U5JA 1QL6A 2XIZA 4OLIA 3SW7A 1ZYJA 2GS2A 4E20A 5B2LA 2ZDUA 4K9YA 2C0IA 2UZLA 4RC4A 5D12A 3D83A 1V0OA 5FTOA 3FDNA 4Q9SA 5LJJA 3GCPA 5AIRA 5FTQA 3LLTA 4L9IA 4O22A 3DZQA 4ZSGA 3MFTA 5HQ0A 4Q5EA 2JDVA 4UB7A 2XK4A 5DRDA 5ANKA 4L68A 3LFDA 3VVHA 3NLBA 4FMQA 3FSFA 1U59A 2YM7A 4RIOA 1W7HA 1PMEA 4F6SA 4V01A 5CALA 1Y8YA 4EH6A 5FDPA 2ZB0A 5HG7A 3BYUA 4DLIA 4RVTA 2WMUA 3WBLA 1BLXA 4H3QA 4UZHA 2JIIA 4JG7A 1XHAA 4LOPA 3VUTA 3BE2A 4M84A 2B4SB 5M53A 3EQPA 2W1IA 3E87A 2XZSA 4FKPA 4TT7A 4FK6A 1XH9A 5HE0A 1V0BA 5E8ZA 1PHKA 2GDOA 4JQ8A 3P9JA 3OW3A 1OZ1A 2J5EA 5LWNA 2QOCA 4XLVA 1BI7A 2XRUA 4EWHA 1LUFA 4NKAA 2WU6A 3FI3A 2E2BA 5I3RA 3TUBA 3ZXTA 5IKWA 4ERKA 2YABA 3GU8A 3HEGA 5K0KA 2JDRA 4H05A 2PE2A 4EH2A 3Q6UA 1SNUA 3AMBA 4IZAA 4B7TA 2XEZA 3GCUA 4JL9A 2J0MB 2JAMA 4U42A 5CTPA 4FJVA 1E9HA 3PG3A 4U0IA 5LVPA 3O71A 4TN6A 3GC9A 4I4FA 2F7XE 5C01A 2J9MA 2Z7LA 4LUEA 1YDTE 1OECA 2A2AA 3AKLA 3KC3A 4B4LA 3FXXA 4I0SA 4R6VA 4HGTA 3RK7A 4XBRA 3WZEA 5JFSA 3O23A 4FTMA 3HAMA 1UWJA 3HV4A 4K33A 3ZUTA 2J5FA 2UW4A 3P78A 4X6QC 1MRVA 3W2RA 4Y85A 4JR3A 5A4EA 3QA0A 2XB7A 2PZPA 3H30A 1J1CA 2YLFA 3KF4A 3L8VA 4FSTA 4U7ZA 4UZDA 3PXZA 4CCBA 3R8ZA 2ZFYA 4QMQA 4N6YA 3ENMA 3EYGA 4FKOA 3BHHA 2ZAZA 3VUIA 4DG2E 2CLQA 1WVXA 3BU6A 3W8QA 2QKRA 5AP0A 1U4DA 3NAXA 4G1WA 4BDHA 3BPRA 2WMTA 5C26A 3OEFX 4L42A 3LFSA 4I41A 3WIGA 3CXWA 3SG8A 3O51A 2VZ6A 4YJSA 5CI6A 4EJNA 3QRUA 3FQSA 4RX8A 4LRKA 3TACA 3W0OA 4C4FA 4IHPA 2R3LA 4IX3A 4S33A 4GFOA 1WFCA 4AF3A 1XBAA 1LEWA 3PY1A 2LAVA 2W17A 4JQ7A 4FF8A 1ZY4A 4YTIA 4A9SA 2XAOA 2OLCA 2WZJA 4ITHA 4C2VA 2E9PA 5CQWA 4L7SA 5FM2A 4RFMA 4ZSJA 1JKLA 1U54A 2QO2A 2XIKA 3LQ5A 3GXLA 4QEBA 3E3PA 3NUPA 3TUCA 3A61A 4CXAA 2EXEA 2Y6MA 3L9LA 4PX6A 4I94A 3OEZA 1BL7A 1YVJA 2VX3A 3A7FA 4HZRA 3CJGA 3OUNB 4G17A 4IH8A 4IWOA 2R0UA 4L01A 4ZTMA 2R3QA 5K9IA 5DHJA 4YNOA 3E64A 2YM4A 4IB3A 4V05A 4I5PA 4YC6A 4YJVA 3RAKA 2R3NA 1REKA 4KAOA 2HAKA 4QTDA 4WOVA 4ZTRA 4HCUA 3VF8A 4BBMA 4HNIA 5CQUA 5DEYA 3BKBA 3NNWA 3DOGA 3P7BA 2OF4A 5IA0A 4JBVA 4OTGA 3R9NA 2GFCA 2PVHA 4FGRA 3PXQA 4BBFA 5I9ZA 3H4JA 3ZC5A 4AZTA 1IASA 1HCLA 3ZXZA 4C57A 2IF8A 2A27A 3TIYA 3DKOA 4IZ5A 5J95A 3PFYA 3ROCA 2HZ0A 4H3BA 3W55A 2BRHA 3BGZA 5AV0A 3TL8A 4E5WA 5FGKA 2QOHA 1PXKA 2R3FA 4D4RA 4EOPA 3VS2A 2ZYBA 4BTMA 4R1VA 5KCVA 4J52A 5CVGA 5B2KA 3EJ1A 3NW7A 4HOKA 4D2SA 1TQMA 4NK9A 3BYOA 4TY1A 4GUBA 3OWJA 2XNEA 1DAWA 3ZO2A 5AEPA 5ETCA 4NSTA 3WE8A 1JQHA 2GTNA 1OIRA 2Y0AA 5M57A 5HTIA 5HD4A 4AOTA 4HGLA 4U79A 3KF7A 3MVLA 4K11A 4AZEA 3DKGA 3QAME 2XF0A 3QQGA 3HMIA 1UVRA 3SRVB 2JBOA 5J87A 4GG5A 3NEWA 3RP9A 5CSVA 4FSMA 2R3MA 1U5QA 4UY9A 3HRFA 2PVYA 3OOGA 1K3AA 1GIHA 3MVJA 4O2ZA 5GJDA 4B6LA 4DH5A 1CKPA 3R7YA 1KE6A 3QYZA 5H8EA 3R8LA 2OXXA 4C33A 2BALA 4DFLA 4DHZA 4NU1A 5FEDA 1RW8A 2HZNA 4GW8A 4AA4A 3EQRA 3FXZA 4PDYA 4R7BA 1AD5A 4LQMA 3FI4A 2FSOX 3IO7A 1YKRA 3PVUA 4GYIA 4M69A 3PIXA 4YLLA 4I93A 4YO6A 3TTJA 3VIDA 5IF1A 3FLWA 4QP8A 4G6NA 2OJFE 2YACA 3UOKA 4FG7A 3UZRA 3D2IA 2ITTA 5B2MA 2XNNA 4J71A 3C4CA 5DOSA 1UU9A 3TT0A 4FV5A 5ETIA 3F3VA 3OROA 4AE6A 3EN6A 3GENA 4BCNA 1PF8A 2I7QA 1XBCA 4YBKA 2PU8A 4AGCA 4QYHA 3PSDA 3ALOA 2XEYA 3QTXA 3TI1A 4ZSEA 3RWQA 1W82A 2CNUA 3BQCA 2H96A 2YFXA 2YLEA 2RFEA 3GCVA 4EQMA 4LOOA 4LI5A 5HTBA 2R9SA 4RQVA 3BBWA 4IVBA 2YM8A 3DBCA 4Y5QA 2BRGA 4FV3A 3H3CA 5DNRA 4ZY4A 4AW0A 4USFA 5HIBA 3AC3A 1MRUA 3F5XA 3QHRA 4J1RA 4X3JA 4BCKA 1IEPA 2QOQA 4G31A 1P14A 3E8DA 2RF9A 4FNYA 4D5HA 5JEBA 5AAEA 5AJQA 2GS6A 5ACKA 4HNFA 4GEOA 4J8NA 5BV3A 4FIJA 3FLSA 4DYMA 3TM0A 3DB6A 5M55A 4AT5A 3ZUUA 2WTVA 4WNKA 1UU7A 3R8VA 4XBUA 2QOBA 3PXRA 4I1ZA 1UNGA 3UIBA 4OR5A 3F69A 3PJ2A 2EB3A 3LCSA 4U8ZA 5FLFA 4FT5A 4IZ7A 3UOHA 1Q8UA 3FV8A 4ITJA 5F9EA 3R7UA 4CEGA 3H10A 4NM0A 3HDNA 3IS5A 3PA4A 4PMTA 4IANA 3A8WA 5EM5A 3IW5A 4M12A 3KXGA 1F3MC 4IBMA 4PQNA 4Q2AA 4Y72A 1ZYCA 4MF1A 4Y5HA 5D41A 5AP1A 4RT7A 1H1PA 4FOBA 4EKKA 5CASA 4R77A 3FL4A 5EW3A 2GFSA 1ZYSA 4AT3A 4FEQA 5JN2A 5D9HA 2R3KA 3VJNA 3K3IA 2NO3A 4GSBA 2NYAA 2G2FA 1FVVA 5HOAA 3I7CA 2VWZA 5AV1A 3BHTA 5K3YA 2O5KA 3TNQB 4FL3A 3F2AA 4IEBA 4GVJA 3AD5A 3CLYA 3QGWA 4Z9LA 2AEGA 4MXOA 2BFYA 2XARA 3RKBA 4O7LA 3TYKA 5BMSA 4NUSA 1MP8A 1VZOA 4CLIA 3KULA 5CSXA 4DHFA 4WUNA 2YIXA 1PRYA 5DN3A 3WZJA 3Q2MA 1JKTA 5DT0A 1JPAA 5AWMA 3DLZA 3OT3A 4EZ3A 3QFVA 2GQSA 2IW6A 3KN6A 2F57A 3RPRA 3NYXA 2PUIA 3IDBA 3LXNA 4FKQA 5CNNA 5EDQA 3WARA 3LMIA 4KIQA 2W1HA 2R3OA 4RZWA 4TL0A 4TWNA 5DWRA 4DEHA 5CANA 5CSPA 1YI6A 2NPQA 1YDSE 4QMOA 2QO9A 5K4IA 4CFMA 4ZLOA 5F20A 3MJ1A 2H8HA 3G0EA 4CQEA 4MXAA 1IAJA 4BDBA 2BDFA 3K2LA 3VJOA 2IVSA 4YJUA 3GEQA 5I9WA 5IQCA 4BCIA 3F3ZA 4BDAA 5BUEA 3HV5A 4CV8A 3WF6A 3BL7A 5AP3A 2O0UA 2ETRA 4S2ZA 1KV1A 2QD9A 2W1DA 2XIXA 4O0RA 3W33A 2WU7A 2RIOA 5E91A 1S9IA 1OL5A 3OMVA 2WIPA 3R71A 4RIXB 2W5HA 1JVPP 3A99A 3CQWA 2XIYA 2X39A 2PMLX 4EK3A 2IW8A 4U3YA 5KBQA 5HNGA 4JS8A 4RA5A 4EONA 4DHJA 3RK5A 3ODZX 4EH5A 3OF0A 4FSZA 4MXXA 4U45A 4ZLZA 2IWIA 2OBJA 4EYJA 3UQCA 1TZDA 5AV2A 3UJGA 1XMLA 3NUAA 4C0TA 2YDJA 5HBHA 3GQLA 5FD2A 4EOSA 4F0IA 4OT5A 4KKGA 2G9XA 3L8XA 3QTWA 4KBCA 3CS9A 2VWVA 5JH6A 4D5KA 3PWDA 3LQ3A 4AWIA 2FVDA 4FV0A 4I92A 3I1AA 4IAYA 2P55A 3P08A 1SYKA 4Q5HA 2WKMA 5AUVA 2P33A 3HP5A 3R9OA 4FZ7A 3FKNA 5M4CA 2XNGA 1P4FA 4CVAA 3TXOA 2C0OA 3EN7A 4FKTA 4CT1A 3HGKA 4HGSA 3OWPA 3SKCA 2BTRA 1H01A 5H8GA 1R0EA 4RJ3A 3ZEPA 4XX9A 4FG9A 3DKFA 2F9GA 4F1TA 3FJQE 4NT4A 2FO0A 4C58A 2PPQA 2XM8A 2IZUA 2JAVA 2O64A 5E1SA 3G9LX 2HK5A 1YOMA 3BV3A 3U6HA 4AA0A 4AN2A 2G15A 2QQ7A 4R5YA 4W4XA 4X6RA 3VW8A 3HV7A 4DH7A 4Q9ZA 5KHXA 4XOZA 2W4OA 3IW6A 5AP2A 3OP5A 4FI1A 2HZ4A 3R7GA 5LVLA 4RVLA 4OBPA 3ANQA 4BC6A 1OL7A 2OFVA 4IAZA 3G15A 2QOLA 1BX6A 3R73A 5H9BA 4UMQA 3NNVA 4EOIA 2QLQA 2HENA 4YZNA 4F4PA 2C47A 5AA8A 2X1NA 2C0TA 4RVKA 1ND4A 4KBKA 2ZMCA 5KMKA 1H08A 5BVOA 2VO3A 3PIYA 3QGYA 5I9XA 3QQUA 4HYSA 3HA8A 1K9AA 5JQ8A 4ITIA 3QBNA 4LL5A 4ALUA 3PLSA 3ML1A 5E1EA 4ORKA 1OM1A 3QQFA 5ANGA 4XP3A 4QPSA 3RHKA 3UPXA 3M42A 2B52A 4O38A 3ZFYA 1J7LA 4RIYB 4FTRA 4LMUA 5AV4A 4IWDA 2GSFA 4YHTA 4EHZA 5LVOA 4O1PA 4WRSA 4AZWA 3FLYA 4BR3A 5AP5A 5I5ZA 4KSQA 3VS7A 3RINA 5HBEA 4DBNA 3KRLA 4RLKA 5IU2A 2WQMA 5M56A 1PJKA 4FICA 2G2HA 4BZNA 1RQQA 5LVNA 3PP0A 3Q96A 4YZDA 3RHXA 3KRXA 2ZV2A 3RNYA 3UGCA 3QXOA 5LXMA 4L3JA 5EM6A 1Z57A 3IK3A 4R7HA 3B2TA 4F78A 2Y4PA 4TZRA 4FTIA 4FTOA 4N0SA 2XCHA 4E4MA 4NM5A 1GZOA 3ORXA 4GK4A 4XV3A 4BCJA 3W2QA 4PDPA 2PE1A 1G8JA 4FIGA 3C4XA 2GQGA 3I5NA 2V22A 3EZVA 2B7AA 3F5PA 4NW6A 4I4EA 4EOOA 2ZV7A 2QODA 4S31A 3P23A 4D1ZA 2XALA 2JC6A 3PDTA 4PWNA 2JITA 3IW7A 3S3IA 3DK3A 5IZFA 4UWCA 2VNYA 2C30A 3KL8A 3PZHA 2CCIA 4KRDA 4PNIA 2YDIA 3QTUA 4X21A 3JVSA 4DG3E 4QPMA 2OFUA 5J7HA 3DA6A 5C4KA 1GZKA 4EWQA 5LARA 4MXZA 3JPVA 2CGXA 3FLNC 3GC8A 3GBZA 4JRVA 4NCTC 3UC3A 1FVTA 4XG8A 4ZTQA 2YM5A 3UNZA 3PYYA 4NIFA 4O27B 2WTJA 2BZHB 3I79A 1Q99A 3QUEA 1UV5A 4KNBA 5CVHA 3BLRA 5BVWA 3ET7A 3NUYA 1H1RA 3ZRKA 4P5QA 1XH7A 2C6IA 4I6QA 4KKHA 4AN3A 1WZYA 4V04A 4OTFA 1XWSA 5HBJA 4XRLA 4NL0A 2VWYA 2QG7A 5HORA 2XMYA 1Q8YA 5CF5A 2J0LA 2ITXA 3WF8A 3EQDA 2W9ZB 4TYHB 3U9NA 2CMWA 3Q9ZA 3BYSA 3C4WA 1GNGA 2UVYA 3DY7A 2RL5A 1S9JA 3WE4A 2P2IA 3F2RA 4FSQA 3LCKA 5CAVA 4FE2A 2W7XA 2QR8A 4WNPA 3JYAA 4EYMA 5EW9A 2CKEA 4FT9A 2C5OA 2W1CA 3SC1A 3F2NA 3KFAA 4CYIA 4WG4A 4FKVA 4X2KA 3G2FA 5CSHA 3FY0A 4GKIA 3WOWA 3QTRA 2YM3A 2JKKA 3D7ZA 1AGWA 1P4OA 1ZZ2A 2QC6A 1MRYA 5HESA 4D2PA 2BCJA 3LFCA 4BKZA 4QP3A 3ZO3A 2JKMA 4BZOA 5E92A 3PLAE 5HD7A 3CTQA 4YO4A 4TWOA 3MFSA 5HCZA 1P5EA 4BHZA 4DFXE 3PJCA 4FV8A 1YHSA 4XYFA 5DVRA 4ZSLA 3FMJA 4CMTA 3DXPA 1J1BA 4GT3A 4AU8A 2Z7QA 3DV3A 1O6YA 5IMXA 4XOYA 3NGAA 4FK3A 4IVAA 4CRLA 4QMZA 3PUPA 4UYNA 4KABA 1ZYDA 1I44A 5IEYA 3ZONA 1ZMVA 2XNBA 5AR8A 3DCVA 3UC4A 3ATSA 5EM8A 1WBOA 1PXJA 3A4OX 3ZC6A 4FKLA 4BDCA 2ITYA 4B8LA 4K1BA 3NUXA 4K2RA 2PVNA 3PWYA 5CS6A 4RX9A 3IQ7A 2RG5A 4O7YA 5IQGA 4FKGA 4YLKA 3A60A 1JSTA 1SNXA 3RZBA 5JK3A 3RMFA 3U6JA 3FEGA 2HWPA 1XH6A 3ZMMA 2VX0A 5BNJA 4FEVA 1ZOHA 2J51A 2X81A 3UDZA 3Q5ZA 3SXSA 3L1SA 3VULA 4ANMA 3EFWA 3HMMA 4IDTA 3F9NA 3BV2A 4WG5A 4OBOA 4R7IA 3ZO4A 4EQUA 3FHRA 4XLIA 1SZMA 3V5QA 4AGWA 1OPJA 3EQIA 2YAKA 4PF4A 5D7VA