3OUKA

Crystal structure of rv3910 from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
248
structure length
248
Chain Sequence
QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 58
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oukA01
1BLXA 5AP1A 3AMAA 3MVMA 3CD8A 4R1YA 2GNGA 4LM5A 5CSVA 3W8QA 3QQHA 1AQ1A 2UW4A 3FY2A 3JUHA 3RM6A 4ZTMA 5I9XA 4EWQA 4D1ZA 2XK8A 4FEVA 5LARA 5JQ8A 1OGUA 5CTPA 3O7LB 3KK8A 1SMHA 3MFSA 3HP5A 5L2WA 2LGCA 4TY1A 5EK7A 2CGXA 4IAKA 5AV1A 2RF9A 3A4OX 3UZPA 3R9HA 3UYSA 3H30A 4WIHA 4P7EA 3PVGA 2RGPA 3TCPA 4LGHA 3ERKA 3IKAA 3UVPA 2JIIA 4QO9A 1SVHA 4QMWA 4U40A 3WBLA 5GZ8A 5KHWA 1R0PA 4RIWA 3BCEA 3GC0A 5TE0A 4LOOA 4GU6A 4XNEA 4DEBA 1H25A 2JKOA 3GC7A 4HOKA 4ORKA 4BKYA 3WZDA 4BF2A 5IMXA 1ZXEA 5AUTA 2YHVA 2VTIA 4I94A 3G90X 4XLIA 4QMUA 2J50A 3QGWA 3UBDA 1R1WA 2VD5A 2W1HA 2PMOX 3QHRA 3R9OA 4JDHA 4FSUA 3AGLA 3RHKA 5KUPA 1PJKA 2CNUA 4WBBB 1KOBA 3EN4A 5E8TA 2ZV8A 2P2HA 3KMUA 3O8UA 3FSFA 4G6NA 4IDTA 5E91A 4DEGA 1NW1A 1XR1A 3OT8A 2R3HA 4S34A 2VTOA 4U45A 5EHOA 4DFZE 5F1ZA 2PWLA 2YIXA 1JKKA 4EK4A 4MNEA 2VTSA 5HG8A 4K0YA 4V04A 3VBYA 3ZFYA 4AGDA 3GQLA 4L3JA 2W4KA 4USDA 3S95A 4EHVA 3LFCA 3QXPA 1LP4A 4JDKA 5JGAA 2XK7A 3IDCA 4BYJA 3KXZA 3RNYA 3FJQE 3DJ7A 4H1MA 4Y5HA 2BZKB 4HVIA 3LZBA 4TT7A 4C3RA 3OW4A 1H1PA 4Y73A 5H8BA 4BDBA 2BAQA 4HVHA 5LVOA 1OMWA 4WNOA 5C8NA 1G8AA 2J0MB 5KMIA 4IZYA 2BZIB 1O6KA 2QI8A 5CVHA 4X2FA 2G2IA 2I0HA 4FUYA 3CTJA 4LGGA 4JBOA 4DGLC 1FBNA 4X2KA 4QMQA 4GUEA 3QL8A 5CENA 3FI4A 3Q9YA 3PA4A 3HAVA 3LM0A 4ZSLA 2W5BA 3ACKA 3SXFA 1ATPE 4DINA 5E8VA 1NXKA 4XG2A 1WVXA 3A8XA 4FTKA 3R7IA 3UNZA 3TXOA 3Q5ZA 5BUJA 5E8YA 4GH2A 4AE9A 3ORTA 1REKA 5HX8A 4DG0E 3BLRA 2OKRA 2JBOA 2XKDA 3V5LA 2ITWA 4ALWA 4CSVA 2GQRA 1IG1A 2PK9A 3LFQA 1FOTA 4Q2AA 4ANOA 4TXCA 2WB8A 3GU5A 4FV7A 2HOGA 4FVQA 2Z7QA 3TM0A 3I5NA 1W98A 3PXRA 1BL7A 5HLNA 4YJRA 2Q83A 3FEGA 3SKCA 2JGZA 4JDIA 2EB3A 5AWMA 1UWJA 5TOZA 3BLQA 3E7VA 2UZNA 1Q8WA 3SG8A 2OBJA 3MH2A 2XZSA 5GJGA 3VUKA 3QUPA 2CGWA 2C0OA 3A7HA 3N51A 4MWHA 5KBQA 5A4QA 4DH7A 1XJDA 3IDBA 4ALUA 2W1IA 5CZIA 1R0EA 1KE6A 2R3QA 3LAUA 5B0XA 4AN9A 1S9IA 1WCCA 4EHEA 1M2PA 3QZIA 4K1BA 3FQHA 5AIRA 2AC3A 4HPUE 3BE2A 1ZYSA 2CN8A 4G2FA 5DNRA 4CTCA 5IDPA 4RIYA 1Z57A 4DEEA 2XM9A 3DKFA 4YPDA 4EEVA 5HU9A 1UV5A 2JKQA 5JFVA 3V51A 4MKCA 5FTOA 4J95A 1P4FA 4F9AA 2CN5A 4DGNA 4D55A 3BYVA 3E88A 1OITA 4XEYA 1QPJA 2XNGA 4LUDA 2PMNX 4HVSA 4HNIA 5BVDA 5I9ZA 4JBVA 5HIEA 1U54B 4EKKA 5HE0A 3ID6C 5DLSA 3NNVA 4JT3A 5HORA 4OGRA 2VTQA 3SD0A 1OI9A 3CQEA 3SC1A 4ERKA 2C1BA 2C3IB 2XRWA 2BIKB 4ZTLA 3GCSA 4X3FC 4GRBA 4IVDA 3DQWA 4DT8A 2WTDA 3A62A 4IANA 2PZRA 2X9EA 2PZIA 1FMKA 3QALE 3ENHA 4ZY6A 4M15A 1OPLA 2XNMA 3KY2A 2RFDA 5HD4A 5LMKC 4BCGA 5GIPE 4EK8A 2Y8OA 3FKNA 3PWDA 4BDDA 3LKMA 4E73A 3QA0A 3Q32A 3OHTA 4FV6A 1PXKA 5HGIA 3OOMA 4JAJA 1XBBA 3DBCA 2WO6A 3EJ1A 4RVKA 2YM8A 4D9TA 3HAMA 3EFJA 4YPSA 4EZ3A 3E8EA 5G1XA 2XNPA 4QOXA 2O64A 4XBUA 5F94A 3ZCLA 3TV7A 4DH3A 4N0SA 3UPXA 3C4WA 2EXMA 1KE8A 4F70A 2E9PA 3VBVA 4AZTA 2O2UA 2ITPA 4OT5A 1YRPA 5E8UA 3UOKA 4FKQA 3THBA 2XIYA 3PXZA 4NL0A 4FKUA 4QP9A 4TTHB 5DT4A 5L6PA 1YI6A 3RWPA 1M14A 3ORLA 3AD6A 4FIFA 4R3PA 4BBMA 2C6DA 4RC3A 3CBLA 4A9RA 1LPUA 3QXOA 4OTPA 5TT7A 2UZBA 4C38A 2JC6A 2OIQA 2RL5A 2UVYA 2IZUA 3G9LX 4TKSA 3A2CA 4IZAA 4D58A 2UZVA 4F65A 2R3NA 2OFVA 3BIZA 5FRIA 1JOWB 2SRCA 3IW5A 1JAMA 3BPRA 5FUTA 3OFMA 4IADA 1CMKE 3LXPA 3EHAA 4U44A 2YM5A 3P23A 3EZRA 4G6OA 4IX5A 5AUVA 4PNIA 3D7TA 3ULIA 1XH4A 3LMIA 4GVAA 4BZOA 2BALA 4Q5EA 4C0TA 5FDPA 4JBQA 4JOAA 3RPVA 4BGQA 1OBGA 4O0VA 2CKOA 4XOYA 4DBXA 1RE8A 2G01A 4U3ZA 2XKFA 4GFMA 4Y72A 5DT0A 4R78A 4AWIA 2UZDA 5EG3A 2CGUA 4YC3A 2FVDA 4LOQA 1Q24A 4YC8A 2X1NA 5JFSA 1JBPE 1VZOA 3DCVA 2PUNA 4FZ6A 3LMHA 4CLJA 2WTKB 4QP4A 3BYSA 3RCJA 1RDQE 2GQGA 2PVHA 4FTAA 4D0XA 5AFVA 4KABA 2OO8X 4QPMA 4RVLA 3HMMA 3TNQB 3MJ2A 3K5UA 4FTLA 5AM7A 1I44A 2W0JA 4BKJA 4EI4A 5J7HA 4U43A 5A6NA 5ANDA 5IA1A 3UC3A 3MPAA 2QHNA 1PKGA 1UNHA 2VO0A 4FMQA 4H36A 2PVNA 4OBPA 3MYGA 4TYHB 2JIUA 3COIA 3ITZA 4AA0A 5KX8A 1CKPA 3ZLYA 3R63A 5HLWA 3I6UA 2UVZA 4M3QA 3IW8A 5D9HA 4DITA 5DR9A 4O82A 3WARA 4H1JA 5K0KA 3HMOA 3MPMA 5EW9A 3R21A 4EL9A 2GHMA 5HQ0A 4YZNA 4XBRA 1A06A 4IVBA 4CZUA 2BZJA 2Z8CA 3U6JA 4BCOA 4HVDA 2PMLX 3D15A 4S31A 3PY1A 4ANLA 5L3AA 3E3PA 4EQUA 3MA3A 5EW8A 2BROA 4XP0A 3S2PA 2WMVA 3KRXA 4RPVA 4HYSA 3TUDA 3FKLA 1O6LA 5AP2A 3RJCA 4EH2A 3EQHA 4FV1A 5LCJA 2YITA 4IFCA 4IBMA 3F3UA 4KINA 4FIJA 2V0DA 3K5VA 1A9UA 4RIWB 2F7ZE 5GJFA 2PVJA 4DH8A 4KKGA 5IF1A 3NYVA 4BCFA 3DKCA 3GNIB 2Z7RA 3E64A 4ZJIA 4C36A 2B0QA 4AGUA 4O0SA 4G9RA 4GUBA 2UZOA 4D2SA 2CKQA 4HYHA 4YZ9A 4YZBA 3DLZA 5IA3A 2A0CX 4ZSJA 3DGKA 4CFVA 3SW4A 3HV4A 2C5OA 1NT2A 4C57A 2I6LA 4EOSA 4F0GA 2UW3A 4MXOA 4OTFA 3RK7A 1H8FA 2X2MA 4E4LA 3CKWA 4DTKA 4DEAA 2V7AA 5C1QB 3QYZA 1H1QA 2EXCX 3AXWA 5L2IA 1ZYDA 3GU8A 3S4QA 4IZ5A 4YLLA 1KE7A 3T9TA 4ANSA 5ETAA 4AN3A 2XJ1A 4MNEB 3IDPA 3OUNB 3ALOA 3DY7A 2VZ6A 3CKXA 4IJPA 3NX8A 4JS8A 4DEIA 3R7OA 2VN9A 3P0MA 3JXWA 3O23A 1XH9A 2B55A 2WMTA 3BGZA 3M2WA 4EH5A 1JSTA 4EC8A 2WIHA 3KRWA 2IZSA 1MQ4A 3FI3A 5HNGA 2PZ5A 4S33A 1YWRA 3PDTA 1ZAOA 1PRYA 5LCKA 4U7ZA 4F63A 5B2KA 3EN7A 3ZM4A 3NLBA 3HECA 4HGEA 3KF4A 5CU4A 4OTWA 1JWHA 5CZHA 3KRLA 4MYGA 3BEGA 3W55A 2C6OA 3O8TA 2XEYA 4FKIA 4ENYA 2UZWE 4IWDA 4A9UA 4EUTA 4ARKA 4CQEA 4YUQA 3QRUA 1PHKA 2RFEA 5AUUA 4E5WA 1IR3A 2J5EA 4BI1A 2P3GX 4H3QA 4XV3A 1H24A 1MP8A 1OBDA 3QZHA 2AUHA 1YHWA 1YXXA 3PZEA 4J98A 4LI5A 5CF4A 4IX3A 4EH4A 4FL1A 3ZLSA 3ZUTA 4HGLA 4AFJA 4BFMA 2R3KA 2R3OA 4XV2A 2WQMA 5CXHA 5I3OA 4JAIA 2JAVA 3TNPC 3WF5A 4F0FA 5BNJA 2P0CA 1W7HA 3GENA 4GK2A 4YLKA 4OTQA 1LR4A 2GPHA 1OUKA 3COMA 4PQNA 2OH4A 3HZTA 2IG7A 3CLYA 3RM7A 2CPKE 2RG6A 2IW8A 1KV1A 5IQDA 1YWNA 3PWYA 3MB6A 5IQGA 4ID7A 4YJVA 5HCXA 2ERKA 3PYYA 4KNBA 3VW6A 5L8KA 2BAKA 4UBAA 5DBXA 4O86A 4MK0A 4APPA 1IASA 3VHEA 1JKSA 2CGVA 1H1WA 3NNXA 3L9PA 3DFAA 4OW8A 4ACGA 3DDPA 4OTHA 5FXQA 2IVTA 4O6EA 4UMTA 3UG2A 4EOQA 4EOJA 5AADA 5CAOA 2H6DA 4K18A 1OPKA 4RIYB 5CX9A 3FI8A 3FY0A 2C5VA 4O7WA 4CYIA 2I7QA 4BY9E 4FIGA 2C3LA 4DYMA 5K4JA 3MFRA 2C47A 3WF9A 2UV2A 3H3CA 2H8HA 5L6WL 4C61A 3CY3A 4C2WA 2W9FB 5CQWA 4NTSA 5ETCA 4GCJA 1M52A 2WMBA 5I4NA 3BKBA 4FTQA 1XWSA 5AX9A 5BYLA 3DAKA 2ZM3A 5HE1A 3ROYA 4RJ3A 2XB7A 3Q4CA 5E7RA 2WMQA 5EYKA 5CYIA 4Q5HA 3RWQA 5IISA 1WBOA 2HWOA 2XK4A 3QD3A 2FSMX 2OSCA 2X4FA 5CU0A 3NWWA 5D1JA 3LM5A 4QPAA 3T3VA 2J2IB 3U9CA 3VBQA 2X7FA 2YAAA 3HUBA 3ZO1A 4AP7A 3DPKA 2QVSE 3LQ5A 1STCE 2VU3A 4L6QA 2VO3A 1R78A 3V01A 4AACA 3HV6A 4DGMA 5A4LA 1Q8UA 4NU1A 2ITQA 5M51A 3A4PA 3GCVA 2GSFA 3G5DA 2CKEA 2XKEA 3EH9A 4JNWA 4YR8A 3NYOA 5JEBA 4FIEA 5LVLA 3QFVA 4TRLA 3IW4A 4NW5A 4FKPA 3TV6A 4RG0A 5CSHA 1Q8ZA 4EH6A 1EH4A 2PVFA 2XKCA 2VGPA 2KULA 3TZ7A 4RQVA 4ZAUA 2ETKA 3FSKA 2GU8A 3H0ZA 2WEVA 4ZSGA 2OFUA 3QD4A 4EYMA 3D5XA 4U8ZA 5HKMA 1V1KA 3D83A 3MGYA 3U8WA 2QO7A 3R73A 3PZHA 2FYSA 4RC4A 4C58A 5BVNA 3T8OA 4C35A 4D28A 2UVXA 4M7IA 2WTWA 1JQHA 4YO6A 2REIA 2XMYA 1GZ8A 1IEPA 3CS9A 4L7SA 2IJMA 5I3RA 4YJOA 3RNIA 5KMMA 1SVGA 4CG9A 4BI0A 4L67A 4KIKA 2YM7A 2XVDA 2Y9QA 5LVMA 3QTUA 4C4GA 2QC6A 3R7VA 3CR0A 3HEGA 3G0FA 3O7LD 3A61A 4DFXE 4BCMA 3V8WA 5DH3A 3RALA 3F69A 2GCDA 2YIQA 1CDKA 4BCPA 4RVMA 4R5SA 3BHHA 1XHAA 3L8PA 2R3PA 1Y57A 3ENMA 4CZYB 4EONA 2E9VA 2RFNA 5IQIA 3AC4A 1JLUE 1Q61A 4MX9A 3RGFA 3PE1A 4OTIA 2FSOX 4PNKA 2WTKC 3ZXZA 2ITOA 4ZP5A 4I6QA 1V0OA 2E2BA 4LMUA 5EFQA 1U54A 4QYYA 2RIOA 1WBTA 4FKGA 3MN3A 3VF8A 4CFWA 5HD7A 5ANGA 1PXLA 2ZM1A 2NP8A 2ZAZA 4UYAA 1W0XC 3R8UA 2Y7JA 5ETFA 4EYJA 5HTCA 3HMPA 3LCSA 3OXZA 3ZRMA 5AR3A 3GC9A 3SQQA 4A06A 3Q6UA 5FTGA 2W96B 4BTJA 1DAWA 3LFNA 2ONLA 2GTMA 3LMGA 3VUIA 3F9NA 2PE1A 4LRMA 4CFNA 1K2PA 4L68A 3E3BX 3ZRLA 4LQMA 3NUNA 4IM2A 3LFFA 5CSXA 4CYJA 3VS4A 3M1SA 2B9IA 3E93A 1VYWA 4BDCA 3ZOSA 5HNIX 4DFUA 3E92A 2ZDUA 4AT4A 4MHAA 2YIYA 1YI4A 4I93A 2YWVA 3QRTA 3R1NA 3GQIA 2VX0A 3SXRA 3EYGA 3QKMA 3QD2B 5LOHA 4H05A 3JVSA 3PA3A 2X6EA 4XP2A 5DR6A 3IGGA 2GS2A 4MQ2A 3U6HA 1DAYA 2HW6A 2XJ2A 3C1XA 4MXZA 4IMYA 4UZDA 4A07A 1RJBA 3II5A 3BBWA 4HGSA 5CU3A 3BLHA 4QMXA 1FQ1B 4RBLA 1W82A 2QOOA 2ZV2A 4IM0A 4AT5A 1PMNA 4JX7A 3KK9A 1ZMWA 4KIOA 3ORXA 3CSVA 3WE4A 4QYHA 1Q62A 4CFUA 1H00A 3QUEA 2CNQA 4RZVA 3OCGA 4EOIA 3MY5A 3TKIA 3VQHA 4C02A 5A4EA 1SVEA 4NM5A 2XUUA 3ZO3A 4FZ7A 4Y8DA 3R7YA 5EYMA 1OIRA 3TWJA 3QWKA 3MPTA 4GYIA 1CTPE 2PZYA 4L52A 4Y5QA 4Z3VA 3MI9A 1Z9XA 4MBIA 1V0BA 1GIHA 3PXFA 4ZJJA 4B8MA 1E1VA 2OZOA 4L3PA 5EHYA 4EUUA 1NVQA 2J7TA 4KSPA 3RHXA 5IMEA 3EQRA 3GU7A 2XYNA 4NUSA 4NYEA 5E92A 4R77A 2R7IA 3EQFA 4O0YA 4UV0A 4AG8A 2QLUA 3HRCA 3PUPA 3LVPA 3HA6A 2YZLA 4EH7A 3FLNC 5CNNA 3VS1A 2XCKA 4IDVA 5A6OA 3TACA 2OJJA 2W7XA 2YLEA 4IAIA 3LXNA 5JQ5A 4PF4A 4V01A 3GVUA 4CV8A 2UW8A 4XYFA 4RIXA 3HKOA 3OUKA 4J99A 3UMXA 1NVRA 2X2KA 4LYNA 4QYGA 5DGZA 4IWOA 3QWJA 3PJ1A 4BZDA 3W16A 4GT5A 2VNWA 4D9UA 3WF6A 1E1XA 2IW6A 4M68A 3QGYA 5F4NA 4ACDA 3BHUA 3PY0A 5HTBA 4ZS4A 3UPZA 5HTIA 5EH0A 1URWA 4UB7A 3IW7A 2V55A 4K11A 4ONAA 2HIWA 3LXKA 4F99A 5HE2A 3S0OA 4HW7A 3ZYAA 3TJCA 3QRKA 4CZTA 1H01A 1ZOHA 3QX2A 5HBHA 2BZHB 5AM6A 2VRXA 4PMSA 3CGOA 3HRBA 1ZZLA 1YXSA 4FG8A 1OKYA 1QPCA 4I5CA 3TNHA 2O0UA 3W1FA 1I09A 3VUMA 4F4PA 4PL5A 3ZHPC 1Q8TA 3ODYX 5AP3A 4BRXA 3UIXA 2QG5A 4J52A 2X39A 3C4ZA 3ZEPA 2Z2WA 3PLSA 4G5PA 3W18A 5HZNA 5FG8A 3QX4A 5CSWA 2IVVA 4X7QA 3D0EA 2QG7A 4J53A 4YSMA 3I7CA 4YO4A 3DNEA 3ORZA 3RPRA 2UW0A 3UIBA 1FMOE 4EOLA 3QZFA 4MD9E 1Q5KA 4I6HA 5HG9A 3AD4A 4QQJA 3WI6A 2QOFA 4FV8A 2HZIA 4DTAA 4DG3E 4U5JA 3ZLWA 4U9AA 2B9HA 3QQUA 4JQ8A 3LPBA 4I5HA 3R9NA 4NCTA 4YTIA 4YMJA 3O17A 4AZVA 3FMLA 3L8VA 4B8LA 4LV8A 2P55A 3PIZA 1OM1A 3VAPA 3DLSA 3UQCA 3EIDA 3MS9A 3REPA 4IC8A 4A4LA 5BX0A 1YOLA 3FMJA 4NM3A 1OL2A 5DPVA 5J9ZA 2W1DA 3SOAA 5CEOA 1H08A 3KKVA 3QRJA 4FSWA 3FE3A 4O7YA 3Q04A 4FIHA 3JY9A 1J1BA 2EU9A 2J4ZA 4DHFA 3D5UA 5CVFA 4OBOA 5HU3A 3OMVA 3VS7A 2C0TA 4X2GA 4W4XA 5HEZA 4KRDA 3QHWA 4M69B 4J8NA 3D2IA 3P08A 4WSYA 3D94A 4UEUA 4G9CA 3B8QA 4OTDA 3FXXA 5K9IA 4FG9A 4P5ZA 5IEYA 2J0LA 5EQYA 3A99A 4FSQA 3PA5A 2WFYA 4XUFA 5HX6A 2ETMA 4WNKA 2YABA 4RJ5A 1QCFA 3MB7A 4O7NA 4QQCA 2OIDA 4IM3A 5CEQA 1BYGA 2GHLA 3DV3A 3HV7A 3R2BA 1ZWSA 3P5KA 5J95A 2XF0A 3HMIA 4IHPA 4XV9A 3UQFA 2NNWB 1TQMA 2ESMA 4FIIA 2FO0A 4CGAA 3R22A 2BVAA 4E8AA 2XIZA 2C0IA 4K9YA 1KV2A 1OKVA 1PY5A 4QYFA 4YTCA 4I24A 3GBZA 4J96A 5A54A 5M53A 3KEXA 1ZRZA 4E6CA 4KB8A 3ZBXA 4ASDA 3KMMA 3CQUA 1WBPA 5HOAA 5CY3A 4RSSA 1NVSA 3KFAA 3UMWA 4PV0A 4DAWA 4R1VA 4OAVB 4BR3A 5IEVA 3H9OA 3UO6A 1GOLA 2QOHA 5E8WA 3VRZA 4DGGA 3A8WA 2Q0BA 4LV5A 4JI9A 5DEYA 4AZSA 3P9JA 3MTLA 3F5PA 2BDJA 3MA6A 3OW3A 4R7HA 5LMAA 5H8GA 2W9ZB 4FE2A 3TDVA 2HZNA 2J6MA 4WHZA 2CHLA 3A7JA 2WGJA 2R0UA 5AUZA 4ZLOA 4ZOGA 5TF9A 5CAVA 4FV5A 4BWXA 3TKHA 3DS6A 4AS0A 2BTRA 2FA2A 3BX5A 5C03A 4P5QA 2PL0A 4KIKB 4ZK5A 3QTQA 4JG7A 3VVHA 5H8EA 4O38A 4MQ1A 4CEGA 3DJ6A 3GUBA 5ACBC 1DI8A 3MH0A 1Q97A 1YI3A 3VUDA 3C13A 2Z60A 4M84A 5CF5A 3ZMMA 4CD0A 5FEDA 4EHZA 1L3RE 3CTQA 4TYGA 4FT0A 4FV0A 5KNJA 3OWKA 4FKJA 2F7XE 2WQNA 2Y4IB 3D7ZA 2VTAA 4QMLA 3UJGA 4TYIA 3EKKA 2VWYA 3PTGA 5AR8A 1OB3A 2XS0A 3AD5A 4BI2A 5CU2A 3RK9A 4TL0A 2QD9A 4IE9A 5KE0A 5KMNA 3LW0A 4A9SA 2UW7A 3Q4TA 4I0SA 2PTKA 3UE4A 1Q8YA 4FF8A 4QP6A 2W1CA 2WKMA 3B2WA 4YTFA 4G16A 3ANQA 1GZOA 1GAGA 3EKNA 4BDFA 4F1TA 4KS7A 2XNNA 3NYXA 3KULA 3NIZA 3D4QA 5JRQA 1F3MC 3WIKA 4OTGA 1PXNA 3DXPA 1OL7A 4HNFA 3R02A 3TI1A 5HVYA 4A4OA 3KCFA 5AV4A 3QTIA 4PL3A 3C0GA 4NKSA 1B6CB 3OG7A 3FL4A 4FA2A 2CDZA 4WSQA 3MWUA 2HXQA 1ZYCA 4EOMA 3UYTA 1TKIA 5IQBA 1BX6A 1G5SA 4M0YA 3PIXA 2IVSA 4KSQA 4QP2A 3OOGA 4K2RA 5AV0A 5J9YA 4I20A 2PUIA 3V3VA 2C3KA 5FXRA 3C7QA 1H1SA 2V5QA 3K54A 3SGCA 4MAOA 3HGKA 4CQGA 2A27A 2WMWA 4RT7A 2JKMA 3GOKA 2OJGA 3OWJA 3H0YA 4L01A 3EYHA 3P79A 1OUYA 3RZFA 2R5TA 2R7BA 3D5VA 5IA0A 3F2RA 4Q9ZA 4FVRA 3BQRA 5D7AA 4KKHA 4AAAA 3Q2MA 4GS6A 4QPSA 3LHJA 4H3PA 5CNOA 3MVJA 4JG8A 5C8MA 4O21A 4HCTA 2YWPA 3F5UA 4I21A 4GEOA 5JZNA 3TJDA 5L2SA 4UMQA 2GNLA 5EM8A 3RVGA 1M2RA 1XH8A 3ORNA 2WD1A 4WRGA 3WILA 4AF3A 1YXTA 5CF8A 4I4EA 4BGHA 3QC4A 4KIQA 3DKGA 4BHNA 2UZEA 3LCKA 3GU4A 4GYGA 3NZ0A 2Y4PA 3A7IA 3FZPA 4HZSA 4D4SA 4BCQA 4OAUC 1J7LA 1UU9A 1OIQA 4EH8A 5IH5A 3H4JA 2XK3A 4PY1A 4YJQA 4RZWA 4F7JA 4QNYA 3HRFA 2IZRA 2JKKA 3ZU7A 4NIFA 2JD5A 4AOIA 4UXQA 4A9YA 1OIUA 2VTMA 4CCBA 2VWUA 3MFTA 4O27B 3IOKA 4WT6A 2ZOQA 2Y0AA 3S00A 4E93A 2OLCA 3QQKA 3TNWA 5IQEA 4PDOA 4U97A 4EJ7A 4AW2A 4F09A 4D4YA 2J0KA 4FTRA 1MRVA 4RIXB 4NTTA 1PYXA 4IXPA 4QMTA 3DBFA 3P7BA 4E1ZA 4O7TA 2WQOA 1QL6A 4MBJA 4DEDA 4E6DA 4U3YA 3Q4UA 5TKDA 5GJDA 2ZV7A 5EI2A 2PVMA 4W4WA 2ZDTA 5AP5A 4DCAA 3DK7A 4E7WA 2CLQA 3E63A 4YZCA 4G3CA 2C5NA 3QQLA 5BMMA 2BTSA 5M08A 3OXIA 2YM4A 4FV3A 2OJ9A 1XO2B 4C62A 2QOLA 2OZAB 1RQQA 2O8YA 1U59A 3NAYA 3FHIA 4AZFA 2OICA 4R3CA 4XG6A 4PDPA 4WG3A 4BDIA 1AD5A 4RFYA 4BHZA 2IN6A 4OLIA 2X8EA 4D4RA 5HO7A 5K0XA 4DEHA 4I1ZA 2IO6A 5AIKA 3TV4A 3VC4A 3MY1A 2WTCA 1XH5A 4JRNA 1P14A 5D41A 3QTXA 2O63A 4N70A 3RPOA 1JPAA 2I0EA 3MTFA 1VEBA 2IPXA 3AT3A 3EWHA 4ZJVA 3K2LA 2JDVA 2R3MA 5KMJA 1PXIA 1Y6AA 2OJFE 5JKGA 5DIAA 2R3IA 2HELA 4F7SA 4IVCA 4RGJA 3A7GA 4EJNA 1B38A 1PF8A 5BVWA 3NUAA 3DNDA 3F3TA 4LGDA 3ZFMA 5JK3A 4L7FA 5DEWA 3ZO2A 4F64A 4YJNA 4PTEA 2YJSA 4I0TA 2O65A 4C37A 2FSTX 1BI8A 4IAYA 2BRBA 2JIVA 4NH1A 1TVOA 1WVYA 4F7LA 4C59A 2CCHA 3ZRKA 5EKNA 3VN9A 3C51A 3FQSA 1K9AA 2I0VA 3DZOA 4TZRA 4TYEA 4X21A 3RMFA 2X81A 1JKTA 3IPHA 4CFMA 3WF7A 2XNEA 4AGWA 5ANJA 4O2PA 3EN6A 4GJ3A 5C27A 3EMGA 3AC8A 2OG8A 2BPMA 3EQIA 1OL6A 4J1RA 4MEDA 3KQ7A 5AP0A 4NT4A 4FEXA 4B4LA 4M12A 4RFZA 2W05A 3QA8A 2PE2A 4TYJA 4LG4A 1VYZA 4XH6A 5FEEA 3O8PA 4G17A 3OVVA 4U41A 4JLCA 5CEIA 4YNOA 4EK5A 4QMYA 3NMUF 2XIRA 4FKLA 4WNMA 4GKIA 3WF8A 2VTRA 2A2AA 4D2RA 3GP0A 2P4IA 1BUHA 4PUZA 2CJMA 2WZJA 4K8AA 5CEPA 3H10A 3M11A 3FDNA 5FBOA 5CI7A 5KMKA 4FSYA 3V5PA 2QCSA 1R39A 2Z02A 1Z5MA 2GNJA 4FV2A 2OIBA 3R1QA 2OWBA 4KBAA 2KTYA 3VULA 3UNJA 5KCVA 2H34A 4FTNA 2CSNA 3VS0A 2P33A 4PP7A 2XCHA 4USEA 4M14A 4IIRA 3GOPA 4FT7A 4H39A 1Q3DA 3TT0A 4F1MA 4L3LA 5HIDA 4FL2A 3OT3A 2QO2A 5L2QA 2ZYBA 2VX1A 4YLJA 4BWPA 3U55A 4FX3A 2LAVA 1KOAA 3E5AA 4UY9A 3R8VA 5M44A 1MRYA 2BMCA 2GS7A 2VV9A 4OUCA 1O9UA 4JQEA 4AT3A 2ITNA 5BVEA 3RAIA 3ACJA 3ZXTA 2PU8A 3W33A 1J7IA 3VS6A 3SLSA 1ZYLA 3CP9A 5AV3A 4E6AA 2X7OA 4XX9A 2H9VA 3SG9A 2NO3A 3ET7A 3U4UA 4ZMEA 3ZTXA 2V62A 3E62A 5C9CA 2PHKA 3FWQA 4RX5A 1IAHA 3NNWA 4LL0A 3F7ZA 3DTWA 2V22A 3HV5A 3KVWA 3HX4A 2DS1A 5ANEA 4UN0C 2Y4IC 4CFXA 5IPJA 4JG6A 2QLQA 5AUXA 4HGTA 5T3QA 3HDMA 4L45A 3T9IA 2YFXA 3PG1A 5H9BA 2QKRA 4ZY5A 5B7VA 3DK3A 5AP7A 4U79A 5E8XA 5CS6A 3NAXA 4ANMA 5TO8A 4KAOA 2J90A 2C4GA 2QU6A 3COKA 3IONA 3F2AA 4O7ZA 2F2UA 4AZWA 4ZTSA 4QMMA 1OKWA 2HXLA 2X9FA 3E7OA 2ONLC 2YERA 3SXSA 3FYJX 3SV0A 3FZRA 4EQMA 5BYYA 3MJ1A 4PL4A 4PTGA 1G8SA 5IEXA 3ZBFA 4KWPA 4FT5A 3LLTA 4IB5A 5FBNC 3IW6A 2XK9A 3HYHA 3Q3BA 4RA5A 4M69A 1YHSA 2B1PA 5HBJA 5HO6A 1Y91A 3UQGA 4EZ7A 2YIWA 5HG7A 3RKBA 3DJ5A 4BIEA 2YLFA 3MVHA 3Q9ZA 5J87A 2C69A 3SHEA 1H0VA 5AJQA 3SOCA 2XK6A 5CXZA 2B53A 4XLVA 1IA8A 4FNYA 4EK6A 1X8BA 4WRSA 3FMEA 3AC3A 3HVCA 2RSVA 3I1AA 3QUDA 4MF0A 3KULB 4V0GB 5CI6A 4EK3A 2R0IA 3VRYA 2VWBA 3R01A 2FB8A 3OBJA 3Q96A 2R4BA 3EQGA 3QLGA 4NFMA 4RWIA 4O0XA 4FK3A 4R7BA 5EDRA 4N4SA 4ITHA 3R1SA 1M17A 2F57A 3FYKX 3EQCA 5L2TA 3G33A 4KRCA 3VUHA 2UZLA 1M7QA 3NVMB 3BHVA 1YVJA 4CT1A 2X0GA 3LFAA 4IQ6A 1GJOA 1Q99A 3FZTA 4YP8A 2WHBA 4GG5A 5E90A 3O2MA 2O5KA 5EYCA 4TPTA 4R5YA 4C3FA 4LOPA 5DVRA 1PW2A 3QAME 2ITVA 5M56A 3HMNA 2VGOA 5AUYA 3BYMA 1CM8A 2XBAA 4RLLA 4USFA 3W2QA 2GHGA 4IJ9A 2HZ4A 3LLAA 4XG7A 3WE8A 2EWAA 4FT3A 4IC7A 4A7CA 2QNJA 4IW0A 1UVRA 4BYIA 4BN1A 4F9WA 4RMZA 2B4SB 3TN8A 3OC1A 2BRMA 3KB7A 2X8IA 4PPAA 5EOBA 2WNTA 2WTJA 3GFWA 4APCA 3Q6WA 4RX7A 4GT3A 3PE2A 1GY3A 3LJ0A 4KS8A 3ZFXA 5IH6A 5CAPA 1OKZA 4L42A 4FUXA 4BC6A 5CALA 3UO5A 3MIAA 3F61A 3MH1A 4HYUA 5M4FA 4G34A 4EH9A 2XH5A 3R8LA 2W1FA 2PZPA 2WU6A 4HYIA 3H9FA 3ZO4A 4ALVA 4U6RA 2PVKA 2UW6A 4ACHA 2BR1A 4I23A 4NK9A 3G2FA 5CEKA 4NIFB 3UVQA 3ATSA 4HCVA 2AC5A 5CVGA 4O0UA 3KRRA 5E9EA 4XG8A 3W2PA 3RAHA 5EDPA 1UA2A 3OY3A 3DAJA 4KUJA 2OXDA 2F4JA 2QOIA 5HE3A 3NW6A 4OBQA 4CG8A 3VBWA 3VO3A 2C6EA 3N4VA 3TL8A 4XRLA 1VJYA 3OF0A 3PLAE 3KC3A 3CJFA 2QQ7A 5ICPA 4GV1A 4YJPA 4GK4A 4ZZOA 2JFMA 4RLKA 4NZWB 3V6RA 5HCZA 2YM6A 4HVGA 4MCVA 1XQZA 5K5NA 3R30A 3FZOA 3ANRA 4RWJA 1BL6A 3QC9A 3RCDA 3RPSA 4CMOA 5FD2A 2ZB0A 1YWVA 3E8NA 3O50A 2Z7SA 2UW5A 4C4FA 2CNVA 2YA9A 3F82A 5I5ZA 2F7EE 5FQDC 3I4BA 2BFYA 3W32A 1MQBA 1ZMUA 4QYEA 4BCIA 4OTRA 2J0IA 5JT2A 4OR5A 3CD3A 5JGBA 3A60A 3JY0A 3O71A 4A4XA 5GNKA 4D4VA 5JSMA 2VWVA 3EFWA 3R28A 3NW7A 5HLPA 3GCUA 5BVFA 4O1PA 4XCUA 2R64A 2EVAA 4ACMA 3BYOA 1QPEA 1SM2A 1FGKA 3C4EA 3DB8A 4PDSA 3LFSA 3G51A 4XHKB 3V5JA 5BQ0A 2WEIA 4LRKA 2VX3A 4BBEA 4D0WA 5C8KA 3BV2A 3LCOA 4QMOA 3NS9A 3ZUVA 4Z7GA 1J91A 4R3RA 5AR7A 1RW8A 3VS2A 1U4DA 1URCA 1BMKA 4XJ0A 4BB4A 4E26A 5DI1A 3DFCB 4PMTA 5G6VA 3V8TA 2J51A 2F49A 3VIDA 1XBCA 1YDRE 3CGFA 3BRBA 3FPMA 1Q4LA 5HG5A 2DQ7X 2QOQA 3LJ2A 5K3YA 5CANA 3RPYA 1FINA 3ZC5A 3KRJA 4R6VA 4F9YA 4O7VA 3FMKA 2ITXA 5ANKA 3CE3A 3W2CA 3V5QA 3DTCA 3NUYA 4DGOA 1OPJA 5HBEA 4GVJA 3BYUA 4N6ZA 4YSJA 3OCTA 4TW9A 3OEZA 1E9HA 2PUPA 1ZY4A 4ZTRA 2GNHA 2R3LA 4P90A 4ZLYA 3Q53A 4WBOA 3QKLA 4TWOA 4FV9A 3FMHA 4XG4A 3PVUA 2DYLA 4PPCA 5EOLA 1P5EA 3ATTA 4CV9A 2RFSA 1SZMA 4FNWA 1APME 3ZSIA 2ZVAA 5T68A 4AUAA 5CASA 3TDWA 2PUUA 4O7RA 1R3CA 3RINA 4JR3A 4EOOA 3POOA 2PVRA 3LIJA 4HZRA 1H4LA 4X3JA 4RIOA 2W4JA 5ANOA 4CTBA 4EKLA 3FMDA 4W4YA 5EM6A 1WZYA 2X2LA 4FKVA 2OZAA 1KE5A 2G9XA 3GU6A 5AAFA 4E5BA 4U0IA 4K6ZA 3FKOA 5J8IA 4GIHA 2G2HA 4ANQA 4MBLA 3FUPA 1W83A 3NUSA 3ZH8A 3GCPA 4BWKA 1QMZA 5IQAA 4MXYA 1FVVA 2Y6MA 5GZ9A 3DBEA 3ULZA 2GNIA 5HI2A 2R3RA 3EB0A 2GFSA 3FZ1A 4Y95A 2OJIA 4FNXA 3I79A 4O0RA 4YU2A 2X6DA 4M97A 4QTDA 5JFWA 4BDEA 4WA9A 4DFLA 5JZJA 3R00A 4JRVA 3U9NA 1ND4A 5F9EA 2W06A 2B54A 4BDKA 4MF1A 3KCKA 3KF7A 3LCDA 2PE0A 3OEFX 4ZS0A 4BGGA 2QOBA 3DXQA 3DA6A 4F08A 4MXCA 2RG5A 4KBCA 4C7TA 4EBWA 3KVXA 1ZOEA 4BTKA 1JSUA 2VO6A 3IQ7A 4GK3A 3P86A 4TNBA 4YC6A 2UW9A 1PXMA 4BTFA 2HYYA 5I0BA 3H9RA 3FHRA 4M8TA 4YJTA 2C6KA 2YCRA 3CC6A 1S9JA 5CF6A 4BICA 4CVAA 3IK3A 5JMSA 2F2CB 4D2VA 4EHGA 5T6KA 4BIDA 3RTPA 5HICA 3BHYA 3UP7A 3EQPA 4O83A 4DLIA 2W1ZA 3VJOA 5M4IA 3MIYA 4QTBA 4FYNA 4G5JA 3UG1A 5DOSA 2BAJA 4C4IA 4E4NA 3MDYA 2J0JA 1LEWA 5E1SA 3RAKA 3OROA 4E3CA 4NWMA 2WU7A 4CMTA 3RP9A 4KIPA 2JDTA 4Z7HA 3NCGA 3DBQA 3ZSHA 3U87A 2E9UA 3QQGA 3W8LA 1ZYJA 3B2TA 3Q4ZA 2XNOA 4FKTA 5BUEA 4I4FA 3PJ2A 5CWZA 3UGCA 4ZZNA 3HLLA 4JQ7A 2BHHA 2W5HA 5CAUA 4AA5A 3MW1A 3LJ1A 3VNTA 4HPTE 3FLSA 1W84A 1SYKA 4XG9A 4TN6A 4YNEA 3L8SA 3RAWA 1UKIA 3KU2A 5JRSA 1UU3A 3BEAA 2E9OA 3GGFA 4RJ7A 3OTUA 3V5WA 4BBFA 2C6LA 1WAKA 2GS6A 4I0RA 3C9WA 1GNGA 3OZ6A 2W5AA 4YGAA 2WQEA 3V5TA 4EOPA 4D1XA 3TZMA 3NR9A 4YHFA 1FVRA 1OECA 1GIIA 3NEWA 2OXYA 5J79A 4NKAA 4O7SA 2QOKA 3I7BA 4UMPA 4G6LA 3FLWA 1KE9A 3VBXA 5D11A 4IFGA 4GSBA 1WBNA 4DA5A 4H58A 4I41A 3KXNA 4FK6A 3TZ8A 5KZIA 3ZZWA 2QO9A 2ITTA 3TTIA 3QCQA 5DN3A 3AGMA 1M7NA 4AN2A 2W1GA 1Y8GA 4NJDA 2HENA 1F0QA 2XP2A 3F3WA 5LWNA 1PXOA 3GXLA 4M0ZA 4ENXA 2NPQA 2YDKA 4FKOA 4RWKA 5JN2A 2GMXA 4FI1A 3AC5A 1Q41A 2WTVA 4BKZA 5DMZA 1PKDA 4PMPA 5KKRB 5KO1A 5J5TA 1PXPA 3PXQA 5HIBA 2HK5A 5IA2A 4O6LA 3VJNA 2GTNA 4YHTA 3IG7A 4J8MA 3R8PA 2QURA 2C5YA 4FTTA 1PXJA 2E9NA 3F3ZA 4U42A 5AA9A 4FG7A 4E5AX 3SA0A 4MH7A 5BVOA 4MXAA 5HO8A 5L4QA 3CIKA 5DT3A 2VTJA 4G3DA 3K3IA 3ODZX 5FM3A 4AQCA 5C4LA 5JGDA 2EUFB 4G3EA 5ITAA 4L44A 1YDSE 4JDJA 1U5RA 3OTVA 2OF4A 3NUUA 3NUXA 4DCEA 4PP9A 3L9MA 3QF9A 3ZDIA 4FODA 3VUTA 3TTJA 4RQKA 2YIRA 1JVPP 4LMNA 3AT2A 5IUGA 5K4IA 4O81A 2OW3A 4JBPA 4CFFA 1ZARA 4GW8A 3U6IA 2O3PA 2J5FA 3MY0A 2PVLA 1B39A 4YZDA 3GT8A 4K33A 4BDAA 3QZGA 4QMZA 2OU7A 5AP6A 1OL1A 1YW2A 5A14A 1U46A 4ZLZA 3S3IA 3C4CA 4J7BA 2OI4X 3KXGA 3UOJA 4FOCA 4FTIA 3FXZA 3ORPA 4V0GA 3LFDA 3QQFA 4MD7E 4Q9SA 4YBKA 4NM7A 3OD6X 5L6OA 3UOHA 4JXFA 4J71A 2CLXA 4AOTA 4ASZA 3PSDA 5CSPA 5M4UA 4UZHA 3PIYA 4Y83A 2CCIA 4F9CA 1T45A 3Q9XA 5B2LA 1ZZ2A 5D10A 2HAKA 3G6HA 2IVUA 1GZKA 3EFLA 3C5IA 4UX9A 2ITYA 2H96A 2R3FA 5AP4A 3UVRA 4BCNA 4MWIA 4XOZA 2VWXA 3WZKA 3BU6A 5DRDA 4Z16A 3O51A 3R71A 4FTJA 4N57A 3MESA 5CT7A 3PJCA 1PMUA 4FKSA 4ZY4A 4F6SA 1LUFA 5D12A 3K3JA 4C8BA 5TR6A 4II5A 5LWMA 1LEZA 3BV3A 4W4VA 4O22A 4RX9A 5E8SA 4W8EA 1JSVA 2XBJA 4GIIA 5EYDA 5L8JA 2HWPA 4EZ5A 3OCBA 2W17A 1H07A 2HW7A 4FTOA 3EN5A 4FZDB 5FP5A 3UC4A 4FT9A 4GFOA 3AQVA 5KMOA 5JH6A 4EC9A 2OXXA 4MD8E 5DHJA 1T46A 3FMMA 3FMNA 4FSZA 3BGQA 5AMNA 2WPAA 2A19B 4LFIA 3PPKA 5KZ0A 4KBKA 4QRCA 5LXMA 3N4TA 5HVJA 5EKOA 4IWPA 4UXLA 3NRMA 5I9VA 5BVKA 4W9WA 3IO7A 3O0GA 2BDFA 2XRUA 3G6GA 4AX8A 4F7NA 5CT0A 3Q52A 3WOWA 5EQEA 2I40A 2NRYA 5LQFA 4X0MA 3NYNA 4XS2A 3BU5A 3PVWA 3SAYA 5IUIA 3I60A 3P78A 3NIEA 3FPQA 1YDTE 2BUJA 3F3VA 3G15A 4O7LA 5DYJA 3IECA 3VW8A 1YXUA 5A3XA 2VWWA 3C0IA 3W10A 3WZJA 5BMSA 3TG1A 2UZUE 3FLZA 4G1WA 4IWQA 2X7GA 4JVGA 5DA3A 4ZTQA 4NEUA 3TZ9A 4CRSA 2PSQA 4AA4A 5AX3A 3PG3A 4DFBA 3QTWA 4I5MA 1ZLTA 3DT1A 4O0TA 4L9IA 5FLFA 3BGPA 5AV2A 3UO4A 4I6BA 5FGKA 3WZEA 3NW5A 3QTSA 2JLDA 3D5WA 2WTIA 2ZV9A 3VHKA 3PP0A 4D2WA 3JS2A 4BDGA 4F6WA 3QU0A 3E87A 3EZVA 5EM5A 5FM2A 2YJRA 5A46A 5LMBA 5E8ZA 3EQDA 2YEXA 3FZSA 2C6TA 3ALNA 4ZTNA 4ZXTA 5IU2A 3PVBA 4V05A 4YJSA 3PPZA 5M07A 3TIYA 3WYYA 4DF3A 3QLFA 4O91A 3EQBA 4IAAA 5I9UA 1W8CA 2XM8A 2WXVA 3HNGA 2BRNA 3C50A 4FTCA 5DFPA 4DH5A 3DB6A 3PXYA 3DKOA 4C3PA 4CRLA 4O96A 1GZNA 4XRJA 3T3UA 2YAKA 3VS3A 4AFEA 5M57A 4QQ5A 4TNDA 5I9YA 2C68A 3S1HA 2WQBA 4X3FA 1TQPA 4BCJA 1UU7A 4D2PA 4UMUA 4RVTA 1CSNA 3CEKA 5CLPA 4ZIMA 3RBWA 2VNYA 3R7EA 2Z7LA 5I9WA 5C4KA 2BIYA 2PY3A 1H27A 3DAEA 5LMKA 4FTMA 2WMUA 2BHEA 4XP3A 4FZFB 2VAGA 3ZONA 4FVPA 4E20A 2WOUA 4ZSEA 2YDIA 4ACCA 4TWPA 3PFQA 3FC1X 1Q3WA 5KMLA 2PULA 4QP8A 3SRVA 4IACA 4QP1A 4GT4A 3HA8A 4C4EA 3B8RA 1P4OA 1SNXA 5ACKA 2R9SA 4D2TA 2GDOA 3KREA 4QMPA 3VQUA 2YACA 5LJJA 3UDBA 5EM7A 2ETRA 5IZFA 4FSTA 2PYWA 5IH4A 4IB1A 4GG7A 4S32A 4U81A 4YBJA 4AU8A 3GB2A 4NFNA 2BKKA 5M55A 4ZZMA 4A9TA 2QR7A 3Q2JA 3AC2A 4O84A 2FH9A 4HJOA 3VUGA 2I0YA 4O1OA 4BVUA 4FSMA 4CCUA 4DC2A 2YCSA 2AYPA 2W1EA 1YQJA 3ELJA 4ITIA 2NRUA 3WZUA 2YN8A 2C1AA 4C4JA 4FBXA 3PJ3A 3MSSA 3FI2A 3QD0A 3TKUA 2C3JA 4I3ZA 2G1TA 4YURA 3UIUA 4BIBA 1GIJA 3NVKI 3BQCA 1P2AA 5A4TA 1DI9A 3LE6A 2P2IA 4MXXA 4CNHA 3ROCA 4DE4A 1UNLA 3P7AA 3R1YA 4AW5A 4CXAA 5FP6A 1H1RA 3MVLA 3FLQA 3FC2A 3TIZA 3U51A 4FKRA 5KKRC 4YJUA 5DR2A 1PMVA 3MBLA 4I6FA 4WOVA 3ZEWA 1FPUA 4QTCA 4JJRA 3F2NA 4C2VA 3BI6A 4DN5A 2BILB 4I22A 4X2NA 1ZMVA 2GQSA 2ZMCA 4FV4A 3AC1A 4BL1A 2QHMA 3LOKA 5FDXA 4QMNA 1KSWA 2ZJWA 5IA4A 4QTAA 5ETIA 2VTHA 4IAFA 3NDMA 4B9DA 3OWPA 2XNBA 2JDRA 3QYWA 4E4MA 5AAGA 3IS5A 3AG9A 3MV5A 5EI8A 4L53A 3R7UA 4K77A 3HP2A 5IG1A 3TEIA 2CMWA 5A4CA 2WMRA 3QRIA 5AAEA 2YCFA 1WBVA 4IX6A 4EWHA 1UU8A 4PWNA 3CQWA 4P2KA 4E6QA 4FSNA 3C5UA 5EHLA 3V8SA 4CKIA 3EL8A 2JFLA 3BE9A 4I92A 4GMYA 5AUWA 4LUEA 3BWJA 3VS5A 4TWCA 3F7WA 3Q60A 3R0TA 4YZMA 3CY2A 5HESA 1KUTA 4NSTA 3NNUA 4RJ6A 3DU8A 4MNFA 1XBAA 4NM0A 3KA0A 5EDQA 2HCKA 4QP3A 4QNAA 4DT9A 5J1VA 3DBDA 2XYUA 1FGIA 1VR2A 3AMYA 2FUMA 3L9NA 4RJ4A 5ANIA 2B7AA 4TWNA 3W2OA 3ORMA 3PRIA 4BTMA 1HCLA 5LVPA 1YOMA 2WAJA 3BHTA 1DS5A 3GCQA 3ETAA 2ZB1A 2VTLA 4IAZA 3FL5A 5KBRA 2B9JA 3QBNA 3P4KA 5AR5A 3HDNA 4FOBA 5DE2A 4XV1A 2BRGA 2FSLX 4FC0A 3DQXA 5K5XA 3D14A 5BYZA 3ZM9A 2A4LA 2B9FA 3NUPA 4WG5A 2XJ0A 4CKRA 4FEWA 4M13A 2UZTA 4AZEA 3C4XA 4C4HA 4S30A 2DUVA 1NY3A 4KD1A 4EORA 3UP2A 2VWIA 4CLIA 1V0PA 4RRVA 3DXNA 3HL7A 1Y6BA 4NW6A 2QODA 3COHA 4ANNA 2J9MA 5KHXA 2X8DA 4G3FA 4AE6A 3BU3A 3MH3A 4FGRA 2C6IA 4AW1A 1OIYA 2UUEA 3C4FA 3AOXA 3CPBA 5EI6A 1REJA 2JITA 3OWLA 3R04A 5F20A 3GEQA 3G9NA 4XG3A 5IA5A 5B2MA 4PPBA 3SW7A 3UZTA 4L00A 4FR4A 5AR4A 3O96A 4FSRA 3Q5IA 3C0HA 4PMMA 4HCUA 3M42A 4UWYA 4D5HA 4IEBA 2JEDA 3SX9A 4L46A 5E1EA 5AEPA 4ANBA 3NCZA 5C26A 1BKXA 5IQFA 2ITUA 2F9GA 1KWPA 1WMKA 3CTHA 5C01A 4OT6A 4PDYA 5HNBA 4C33A 3TUBA 3JR1A 4UYNA 3FBVA 3FV8A 4GJ2A 4Z9LA 3R9RA 2G2FA 4WG4A 2YM3A 2RKUA 3KN6A 4FYOA 3VF9A 2G15A 5JFXA 4U80A 3ZC6A 2WMXA 4EH3A 5A9UA 2R3JA 4RFMA 5J1WA 4JR7A 4PX6A 5CQUA 3IGOA 2HY81 4RC2A 2QOCA 3R6XA 1IRKA 5DWRA 5J5SA 3LQ3A 4PRJA 3RK5A 5GZAA 1XKKA 4O2ZA 5J9LA 2CKPA 1J3HA 1JKLA 3AT4A 4L43A 1F5QA 5CU6A 2OF2A 3FLYA 4IVAA 4ZTHA 2IWIA 4J97A 4R8QA 3LFEA 3PJ8A 3BZ3A 5M06A 4GFGA 4G31A 4GU9A 4F0IA 3AMBA 3U4WA 1FVTA 4R7IA 4QMVA 4JIKA 1H0WA 4ITJA 5FWKK 4AGCA 1UWHA 5IQHA 2JAMA 3BWFA 1YOJA 1WBSA 4FNZA 4G3GA 5HHWA 1J7UA 3L9LA 4LRJA 3EFKA 4FEUA 3OS3A 3OY1A 4RA4A 3DZQA 4DBNA 3I5ZA 5M09A 5HCYA 4WNPA 4FICA 4E4XA 4AW0A 1AGWA 4JL9A 5GINE 4DFNA 4F6UA 3QTRA 3LCTA 3PPJA 4RWLA 5AR2A 3Q9WA 4GKHA 2IW9A 2FGIA 3F5XA 3G0EA 5H3QA 3N9XA 4WKQA 5LVNA 2Q0NA 3DOGA 4AXAA 4X6QC 3KXHA 4FTUA 5F95A 5H2UA 4D5KA 2VTTA 4DTBA 2WELA 4X2JA 4ERWA 3ZS5A 2HY0A 5IKWA 3KMWA 2WMSA 5AA8A 4F1OA 2A1AB 2X4ZA 5D7VA 2W99B 3D7TB 3L8XA 4B6LA 5E4HA 5BUIA 4KKEA 3RI1A 3ZZEA 5HVKA 2BKZA 3F5GA 4FGBA 4P4CA 3D9VA 4DG2E 2XIXA 3OP5A 3L1SA 3F66A 3HUCA 3IOPA 1L8TA 1MUOA 4BZNA 3ORKA 4O0WA 3F6XA 3NSZA 4ASEA 3CCNA 3DDQA 4CMUA 1TQIA 3D2KA 3ZUUA 3KGAA 4RJ8A 4YHJA 3ZDUA 2Y6OA 4NJ3A 1QPDA 5FXSA 3NGAA 5GHVA 2WOTA 4N6YA 4NCTC 4H3BA 2OH0E 2R3GA 3R7GA 4PTCA 1IAJA 4ZMFA 4BCKA 4EOKA 3SVVA 1ERKA 4JX3A 3I81A 1WBWA 3PSCA 2YZAA 2VTNA 3R9DA 1J1CA 1SNUA 4MTAA 4KA3A 1IA9A 4BCHA 1OVEA 2C6MA 1YKRA 2ITZA 1YHVA 3UIMA 3CJGA 3V6SA 3I0OA 4DFYA 2QR8A 1WFCA 4B0GA 2ZMDA 3PY3A 5M4CA 3PSBA 4I5PA 2HZ0A 3E8CA 5FTQA 3KXXA 3R8MA 3VWAA 1NA7A 1MRUA 3MFUA 4FEQA 5CAQA 4W9XA 3ZSGA 3PP1A 2BCJA 4X3FB 3QCXA 3SDJA 4CT2A 4GL9A 2EB2A 4CKJA 2JDOA 3GC8A 4FL3A 3UOLA 4WO5A 3FXWA 1XH6A 2GFCA 2B52A 3KN5A 2XIKA 2VWZA 1K3AA 5GIOE 1DM2A 4QQTA 4D1SA 3HV3A 2PMIA 2C5XA 1OL5A 4W8DA 3RZBA 5EW3A 1XH7A 1H26A 2DWBA 2YISA 4QD6A 3SRVB 4DH1A 3R2YA 3PXKA 2JDSA 2QONA 4X6RA 3I6WA 4F9BA 2C30A 3LFBA 3PRFA 4EQCA 1O6YA 1HOWA 1UNGA 3OCSA 4UWBA 1CKJA 5BPYA 4DLJA 2YCQA 3ZLXA 3GFEA 2EXEA 4YTHA 4B7TA 4QTEA 3WIGA 4QP7A 3A7FA 4Y85A 3DK6A 4ZSAA 2W4OA 3QQJA 3U54A 3FQEA 3W2SA 3LXLA 3EN9A 3QCYA 4IB0A 1U5QA 2QU5A 3KXMA 4IB3A 4WD5A 3R8ZA 1PMEA 2PVYA 2WIPA 4IZ7A 1PYEA 5J7BA 3WYXA 2R2PA 5L8LA 4M67A 2PPQA 3CXWA 3EOCA 4FKWA 1BI7A 4UWCA 2BRHA 2QKWB 1HCKA 5EQPA 5DRBA 5IDNA 5IUHA 1UKHA 3KL8A 3UODA 2GNFA 4ASXA 1ZOGA 5IQCA 2BDWA 4ZEGA 3QKKA 2V7OA 4S2ZA 3POZA 5FEQA 3JVRA 3GI3A 2OGVA 3OBGA 1G3NA 4WUAA 3FAAA 2VTPA 4LL5A 1A48A 3TNIA 4IH8A 3QCSA 3JPVA 5CEMA 3BBTB 4QMSA 3R83A 2ACXA 4QT1A 4RX8A 4EBVA 2XEZA 4C34A 3VBTA 4BDJA 3UZRA 2VUWA 3QTZA 5DG5A 4UMRA 4Y46A 4XMOA 3E8DA 4IX4A 4B99A 2I1MA 2ERZE 1Y8YA 2IZTA 4JIAA 4M66A 1YXVA 2ZM4A 3ORIA 3BELA 3UTOA 4BDHA 1H28A 1OZ1A 3P1AA 1WVWA 3LQ8A 4MVFA 2JBPA 1M2QA 3NPCA 4UALA 2XA4A 1CKIA 3EL7A 2WMAA 3P7CA 3OXTA 4FZAB 2VO7A 1ZY5A 4Z55A 4TYHA 3V04A 3N4UA 3TUCA 1JNKA 2YDJA 2OK1A 3F88A 3UNKA 2BFXA 3W2RA 3JYAA 4L8MA 3CPCA 3I0QA 4AOJA 4WUNA
chains in the Genus database with same CATH superfamily
1BLXA 5AP1A 3AMAA 3MVMA 3CD8A 4R1YA 2GNGA 4LM5A 5CSVA 3W8QA 3QQHA 1AQ1A 2UW4A 3FY2A 3JUHA 3RM6A 4ZTMA 5I9XA 4EWQA 4D1ZA 2XK8A 4FEVA 5LARA 5JQ8A 1OGUA 5CTPA 3O7LB 3KK8A 1SMHA 3MFSA 3HP5A 5L2WA 2LGCA 4TY1A 5EK7A 2CGXA 4IAKA 5AV1A 2RF9A 3A4OX 3UZPA 3R9HA 3UYSA 3H30A 4WIHA 4P7EA 3PVGA 2RGPA 3TCPA 4LGHA 3ERKA 3IKAA 3UVPA 2JIIA 4QO9A 1SVHA 4QMWA 4U40A 3WBLA 5GZ8A 5KHWA 1R0PA 4RIWA 3BCEA 3GC0A 5TE0A 4LOOA 4GU6A 4XNEA 4DEBA 3W0PA 1H25A 2JKOA 3GC7A 4HOKA 4ORKA 4BKYA 3WZDA 4BF2A 5IMXA 1ZXEA 5AUTA 2YHVA 2VTIA 4I94A 3G90X 4XLIA 4QMUA 2J50A 3QGWA 3UBDA 1R1WA 2VD5A 2W1HA 2PMOX 3QHRA 3R9OA 4JDHA 4FSUA 3AGLA 3RHKA 5KUPA 1PJKA 2CNUA 4WBBB 4LV7A 1KOBA 3EN4A 5E8TA 2ZV8A 2P2HA 3KMUA 3O8UA 3FSFA 4G6NA 4IDTA 5E91A 4DEGA 1NW1A 1XR1A 3OT8A 2R3HA 4S34A 2VTOA 4U45A 5EHOA 4DFZE 5F1ZA 2PWLA 2YIXA 1JKKA 4EK4A 4MNEA 2VTSA 5HG8A 4K0YA 4V04A 3VBYA 3ZFYA 4AGDA 3GQLA 4L3JA 2W4KA 4USDA 3S95A 4EHVA 3LFCA 3QXPA 1LP4A 4JDKA 5JGAA 2XK7A 3IDCA 4BYJA 3KXZA 3RNYA 3FJQE 3DJ7A 4H1MA 4Y5HA 2BZKB 4HVIA 3LZBA 4TT7A 4C3RA 3OW4A 1H1PA 4Y73A 5H8BA 4BDBA 2BAQA 4HVHA 5LVOA 1OMWA 4WNOA 5C8NA 1G8AA 2J0MB 5KMIA 4IZYA 2BZIB 1O6KA 2QI8A 5CVHA 4X2FA 2G2IA 2I0HA 4FUYA 3CTJA 4LGGA 4JBOA 4DGLC 1FBNA 4X2KA 4QMQA 4GUEA 3QL8A 5CENA 3FI4A 3Q9YA 3PA4A 3HAVA 3LM0A 4ZSLA 2W5BA 3ACKA 3SXFA 1ATPE 4DINA 2XAMA 5E8VA 1NXKA 4XG2A 1WVXA 3A8XA 4FTKA 3R7IA 3UNZA 3TXOA 3Q5ZA 5BUJA 5E8YA 4GH2A 1W2FA 4AE9A 3ORTA 1REKA 5HX8A 4DG0E 3BLRA 2OKRA 2JBOA 2XKDA 3V5LA 2ITWA 4ALWA 4CSVA 2GQRA 1IG1A 2PK9A 3LFQA 1FOTA 4Q2AA 4ANOA 4TXCA 2WB8A 3GU5A 4FV7A 2HOGA 4FVQA 2Z7QA 3TM0A 3I5NA 2ZFYA 1W98A 3PXRA 1BL7A 5HLNA 4YJRA 2Q83A 3FEGA 3SKCA 2JGZA 4JDIA 2EB3A 5AWMA 1UWJA 5TOZA 3BLQA 3E7VA 2UZNA 1Q8WA 3SG8A 2OBJA 3MH2A 2XZSA 5GJGA 3VUKA 3QUPA 2CGWA 2C0OA 3A7HA 3N51A 4MWHA 5KBQA 5A4QA 4DH7A 1XJDA 3IDBA 4ALUA 2W1IA 5CZIA 1R0EA 1KE6A 2R3QA 3LAUA 5B0XA 4AN9A 1S9IA 1WCCA 4EHEA 1M2PA 3QZIA 4K1BA 3FQHA 5AIRA 2AC3A 4HPUE 3BE2A 1ZYSA 2CN8A 4G2FA 5DNRA 4CTCA 5IDPA 4RIYA 1Z57A 4DEEA 2XM9A 3DKFA 4YPDA 4EEVA 5HU9A 1UV5A 2JKQA 5JFVA 3V51A 4MKCA 5FTOA 4J95A 1P4FA 4F9AA 2CN5A 4DGNA 4D55A 3BYVA 3E88A 1OITA 4XEYA 1QPJA 2XNGA 4LUDA 2PMNX 4HVSA 4HNIA 5BVDA 5I9ZA 4JBVA 5HIEA 1U54B 4EKKA 5HE0A 3ID6C 5DLSA 3NNVA 4JT3A 5HORA 4OGRA 2VTQA 3SD0A 1OI9A 3CQEA 3SC1A 4ERKA 2C1BA 2C3IB 2XRWA 2BIKB 4ZTLA 3GCSA 4X3FC 4GRBA 4IVDA 3DQWA 4DT8A 2WTDA 3A62A 4IANA 2PZRA 2X9EA 2PZIA 1FMKA 3QALE 3ENHA 1W2DA 4ZY6A 4M15A 1OPLA 2XNMA 3KY2A 2RFDA 5HD4A 5LMKC 4BCGA 5GIPE 4EK8A 3PUFC 2Y8OA 3FKNA 3PWDA 4BDDA 3LKMA 4E73A 3QA0A 3Q32A 3OHTA 4FV6A 1PXKA 4O4FA 4FJVA 5HGIA 3OOMA 4JAJA 1XBBA 3DBCA 2WO6A 3EJ1A 4RVKA 2YM8A 4D9TA 3HAMA 3EFJA 4YPSA 4EZ3A 3E8EA 5G1XA 2XNPA 4QOXA 2O64A 4XBUA 5F94A 3ZCLA 3TV7A 4DH3A 4N0SA 3UPXA 3C4WA 2EXMA 1KE8A 4AXEA 4F70A 2E9PA 3VBVA 4AZTA 2O2UA 2ITPA 4OT5A 1YRPA 5E8UA 3UOKA 4FKQA 3THBA 2XIYA 3PXZA 3BL9A 4NL0A 4FKUA 4QP9A 4TTHB 5DT4A 5L6PA 1YI6A 3RWPA 1M14A 3ORLA 3AD6A 4FIFA 4R3PA 4BBMA 2C6DA 4RC3A 3CBLA 4A9RA 1LPUA 3QXOA 3TMOA 4OTPA 4AXFA 5TT7A 2UZBA 4C38A 2JC6A 2OIQA 2RL5A 2UVYA 2IZUA 3G9LX 3BL7A 4TKSA 3A2CA 4IZAA 4D58A 2UZVA 4F65A 2R3NA 2OFVA 3BIZA 5FRIA 1JOWB 2SRCA 3IW5A 1JAMA 3BPRA 5FUTA 3OFMA 4IADA 1CMKE 3LXPA 3EHAA 4U44A 2YM5A 3P23A 3EZRA 4G6OA 4IX5A 5AUVA 4PNIA 3D7TA 3ULIA 1XH4A 3LMIA 4GVAA 4BZOA 2BALA 4Q5EA 4C0TA 5FDPA 4JBQA 4JOAA 3RPVA 4BGQA 1OBGA 4O0VA 2CKOA 4XOYA 4DBXA 1RE8A 2G01A 4U3ZA 2XKFA 4GFMA 4Y72A 5DT0A 4R78A 4AWIA 2UZDA 5EG3A 2CGUA 4YC3A 2FVDA 4LOQA 1Q24A 4YC8A 2X1NA 5JFSA 1JBPE 1VZOA 3DCVA 2PUNA 4FZ6A 3LMHA 4CLJA 3ML1A 2WTKB 4QP4A 3BYSA 3RCJA 1RDQE 2GQGA 2PVHA 4FTAA 4D0XA 5AFVA 4KABA 2OO8X 4QPMA 4RVLA 3HMMA 3TNQB 3MJ2A 3K5UA 4FTLA 5AM7A 1I44A 2W0JA 4BKJA 4EI4A 5J7HA 4U43A 5A6NA 5ANDA 5IA1A 3UC3A 3MPAA 2QHNA 1PKGA 1UNHA 2VO0A 4FMQA 4H36A 2PVNA 4OBPA 3MYGA 4TYHB 2JIUA 3COIA 3ITZA 4AA0A 5KX8A 1CKPA 3ZLYA 3R63A 5HLWA 3I6UA 2UVZA 4M3QA 3IW8A 5D9HA 4DITA 5DR9A 2XANA 3WARA 4H1JA 4O82A 5K0KA 3HMOA 3MPMA 5EW9A 3R21A 4EL9A 2GHMA 5HQ0A 4YZNA 4XBRA 1A06A 4IVBA 4CZUA 2BZJA 2Z8CA 3U6JA 4BCOA 4HVDA 2PMLX 3D15A 4S31A 3PY1A 4ANLA 5L3AA 3E3PA 4EQUA 3MA3A 5EW8A 2BROA 4XP0A 3S2PA 2WMVA 3KRXA 4RPVA 4HYSA 3TUDA 3FKLA 1O6LA 5AP2A 3RJCA 4EH2A 3EQHA 4FV1A 5LCJA 2YITA 4IFCA 4IBMA 3F3UA 4KINA 4FIJA 2V0DA 3K5VA 1A9UA 4RIWB 2F7ZE 5GJFA 2PVJA 4DH8A 4KKGA 5IF1A 3NYVA 4BCFA 3DKCA 3GNIB 2Z7RA 3E64A 4ZJIA 4C36A 2B0QA 4AGUA 4O0SA 4G9RA 4GUBA 2UZOA 4D2SA 2CKQA 4HYHA 4YZ9A 4YZBA 3DLZA 5IA3A 2A0CX 4ZSJA 3DGKA 4CFVA 3SW4A 3HV4A 2C5OA 1NT2A 4C57A 2I6LA 4EOSA 4F0GA 2UW3A 4MXOA 4OTFA 3RK7A 1H8FA 2X2MA 4E4LA 3CKWA 4DTKA 4DEAA 2V7AA 5C1QB 3QYZA 1H1QA 2EXCX 3AXWA 5L2IA 1ZYDA 3GU8A 3S4QA 4IZ5A 4YLLA 1KE7A 3T9TA 4ANSA 5ETAA 4AN3A 2XJ1A 4MNEB 3IDPA 3OUNB 3ALOA 3DY7A 2VZ6A 3CKXA 4IJPA 3NX8A 4JS8A 4DEIA 3R7OA 2VN9A 3P0MA 3JXWA 3O23A 1XH9A 2B55A 2WMTA 3BGZA 3M2WA 4EH5A 1JSTA 4EC8A 2WIHA 3KRWA 2IZSA 1MQ4A 3FI3A 5HNGA 2PZ5A 4S33A 1YWRA 3PDTA 1ZAOA 1PRYA 5LCKA 4U7ZA 4F63A 5B2KA 3EN7A 3ZM4A 3NLBA 3HECA 4HGEA 3KF4A 5CU4A 4OTWA 1JWHA 5CZHA 3KRLA 4MYGA 3BEGA 3W55A 2C6OA 3O8TA 2XEYA 4FKIA 4ENYA 2UZWE 4IWDA 4A9UA 4EUTA 4ARKA 4CQEA 4YUQA 3QRUA 1PHKA 2RFEA 5AUUA 4E5WA 1IR3A 2J5EA 4BI1A 2P3GX 4H3QA 4XV3A 1H24A 1MP8A 1OBDA 3QZHA 2AUHA 1YHWA 1YXXA 3PZEA 4J98A 4LI5A 5CF4A 4IX3A 4QDVA 4EH4A 4FL1A 3ZLSA 3ZUTA 4HGLA 4AFJA 4BFMA 2R3KA 2R3OA 4XV2A 2WQMA 5CXHA 5I3OA 4JAIA 2JAVA 3TNPC 3WF5A 4F0FA 5BNJA 2XARA 2P0CA 1W7HA 3GENA 4GK2A 4YLKA 4OTQA 1LR4A 2GPHA 1OUKA 3COMA 4PQNA 2OH4A 3HZTA 2IG7A 3CLYA 3RM7A 2CPKE 2RG6A 4BJJA 2IW8A 1KV1A 5IQDA 1YWNA 3PWYA 3MB6A 5IQGA 4ID7A 4YJVA 5HCXA 2ERKA 3PYYA 4KNBA 3VW6A 5L8KA 2BAKA 4UBAA 5DBXA 4O86A 4MK0A 4APPA 1IASA 3VHEA 1JKSA 2CGVA 1H1WA 3NNXA 3L9PA 3DFAA 4OW8A 4ACGA 3DDPA 4OTHA 5FXQA 2IVTA 4O6EA 4UMTA 3UG2A 4EOQA 4EOJA 5AADA 5CAOA 2H6DA 4K18A 1OPKA 4RIYB 5CX9A 3FI8A 3FY0A 2C5VA 4O7WA 4CYIA 2I7QA 4BY9E 4FIGA 2C3LA 4DYMA 5K4JA 3MFRA 2C47A 3WF9A 2UV2A 3H3CA 2H8HA 5L6WL 4C61A 3CY3A 4C2WA 2W9FB 5CQWA 4NTSA 5ETCA 4GCJA 1M52A 2WMBA 5I4NA 3BKBA 4FTQA 1XWSA 5AX9A 5BYLA 3DAKA 2ZM3A 5HE1A 4QEBA 3ROYA 4RJ3A 2XB7A 4AAYA 3Q4CA 5E7RA 2WMQA 5EYKA 5BV3A 5CYIA 4Q5HA 3RWQA 5IISA 1WBOA 2HWOA 2XK4A 3QD3A 2FSMX 2OSCA 2X4FA 5CU0A 3NWWA 5D1JA 3LM5A 4QPAA 3T3VA 2J2IB 3U9CA 3VBQA 2X7FA 2YAAA 3HUBA 3ZO1A 4AP7A 2NYAA 3DPKA 2QVSE 3LQ5A 1STCE 2VU3A 4L6QA 2VO3A 1R78A 3V01A 4AACA 3HV6A 4DGMA 5A4LA 1Q8UA 4NU1A 2ITQA 5M51A 3A4PA 3GCVA 2GSFA 3G5DA 2CKEA 2XKEA 3EH9A 4JNWA 4YR8A 3NYOA 5JEBA 4FIEA 5LVLA 3QFVA 4TRLA 3IW4A 4NW5A 4FKPA 3TV6A 4RG0A 5CSHA 1Q8ZA 4EH6A 1EH4A 2PVFA 2XKCA 2VGPA 2KULA 3TZ7A 4RQVA 4ZAUA 2ETKA 3FSKA 2GU8A 3H0ZA 2WEVA 3W0NA 4ZSGA 2OFUA 3QD4A 4EYMA 3D5XA 4U8ZA 5HKMA 1V1KA 3D83A 3MGYA 3U8WA 2QO7A 3R73A 3PZHA 2FYSA 4RC4A 4C58A 5BVNA 4AXCA 3T8OA 4C35A 4D28A 2UVXA 4M7IA 2WTWA 1JQHA 4YO6A 2REIA 2XMYA 1GZ8A 1IEPA 3CS9A 4L7SA 2IJMA 5I3RA 4YJOA 3RNIA 5KMMA 1SVGA 4CG9A 4BI0A 4L67A 4KIKA 2YM7A 2XVDA 2Y9QA 5LVMA 3QTUA 4C4GA 2QC6A 3R7VA 3CR0A 3HEGA 3G0FA 3O7LD 3A61A 4DFXE 4BCMA 3V8WA 5DH3A 3RALA 3F69A 2GCDA 2YIQA 1CDKA 4BCPA 4RVMA 4R5SA 3BHHA 1XHAA 3L8PA 2R3PA 1Y57A 3ENMA 4CZYB 4EONA 2E9VA 2RFNA 5IQIA 3AC4A 1JLUE 1Q61A 4MX9A 3RGFA 3W0RA 3PE1A 4OTIA 2FSOX 4PNKA 2WTKC 3ZXZA 2ITOA 4ZP5A 4I6QA 1V0OA 2E2BA 4LMUA 5EFQA 1U54A 4QYYA 2RIOA 1WBTA 4FKGA 3MN3A 3VF8A 4CFWA 5HD7A 5ANGA 1PXLA 2ZM1A 2NP8A 2ZAZA 4UYAA 1W0XC 3R8UA 2Y7JA 5ETFA 4EYJA 5HTCA 3HMPA 3LCSA 3OXZA 3ZRMA 3VONA 5AR3A 3GC9A 3SQQA 4A06A 3Q6UA 5FTGA 2W96B 4BTJA 1DAWA 3LFNA 2ONLA 2GTMA 3LMGA 3VUIA 3F9NA 2PE1A 4LRMA 4CFNA 1K2PA 4L68A 3E3BX 3ZRLA 4LQMA 3NUNA 4IM2A 3LFFA 5CSXA 4CYJA 3VS4A 3M1SA 2B9IA 3E93A 1VYWA 4BDCA 3ZOSA 5HNIX 4DFUA 3E92A 2ZDUA 4AT4A 4MHAA 2YIYA 1YI4A 4I93A 2YWVA 3QRTA 3R1NA 3GQIA 2VX0A 3SXRA 3EYGA 3QKMA 3QD2B 5LOHA 4H05A 3JVSA 3PA3A 2X6EA 4XP2A 5DR6A 3IGGA 2GS2A 4MQ2A 3U6HA 1DAYA 2HW6A 2XJ2A 3C1XA 4MXZA 4IMYA 4UZDA 4A07A 1RJBA 3II5A 3BBWA 4HGSA 5CU3A 3BLHA 4QMXA 1FQ1B 4RBLA 1W82A 2QOOA 2ZV2A 4IM0A 4AT5A 1PMNA 4JX7A 3KK9A 1ZMWA 4KIOA 3ORXA 3CSVA 3WE4A 4QYHA 1Q62A 4CFUA 1H00A 3QUEA 2CNQA 4RZVA 3OCGA 4EOIA 3MY5A 3TKIA 3VQHA 4C02A 5A4EA 1SVEA 4NM5A 2XUUA 3ZO3A 4FZ7A 4Y8DA 3R7YA 5EYMA 1OIRA 3TWJA 3QWKA 3MPTA 4GYIA 1CTPE 2PZYA 4L52A 4Y5QA 4Z3VA 3MI9A 1Z9XA 4MBIA 1V0BA 1GIHA 3PXFA 4ZJJA 4B8MA 1E1VA 2OZOA 4L3PA 5EHYA 4EUUA 1NVQA 2J7TA 4KSPA 3RHXA 5IMEA 3EQRA 3GU7A 2XYNA 4NUSA 1G8JA 5E92A 4NYEA 2R7IA 4R77A 3EQFA 4O0YA 4UV0A 4AG8A 2QLUA 3HRCA 3PUPA 3LVPA 3HA6A 2YZLA 4EH7A 3FLNC 5CNNA 3VS1A 2XCKA 4IDVA 5A6OA 3TACA 2OJJA 2W7XA 2YLEA 4IAIA 3LXNA 5JQ5A 2IF8A 4PF4A 4V01A 3GVUA 4CV8A 2UW8A 4XYFA 4RIXA 3HKOA 3OUKA 4J99A 3UMXA 1NVRA 2X2KA 4LYNA 4QYGA 5DGZA 4IWOA 3QWJA 3PJ1A 4BZDA 3W16A 4GT5A 2VNWA 4D9UA 3WF6A 1E1XA 2IW6A 4M68A 3QGYA 5F4NA 4ACDA 3BHUA 3PY0A 5HTBA 4ZS4A 3UPZA 5HTIA 5EH0A 1URWA 4UB7A 3IW7A 2V55A 4K11A 4ONAA 2HIWA 3LXKA 4F99A 5HE2A 3S0OA 4HW7A 3ZYAA 3TJCA 3QRKA 4CZTA 1H01A 1ZOHA 3QX2A 5HBHA 2BZHB 5AM6A 2VRXA 4PMSA 3CGOA 3HRBA 1ZZLA 1YXSA 4FG8A 1OKYA 1QPCA 4I5CA 3TNHA 2O0UA 3W1FA 1I09A 3VUMA 4F4PA 4PL5A 3ZHPC 1Q8TA 3ODYX 5AP3A 4BRXA 3UIXA 2QG5A 4J52A 2X39A 3C4ZA 3ZEPA 2Z2WA 3PLSA 4G5PA 3W18A 5HZNA 5FG8A 3QX4A 5CSWA 2IVVA 4X7QA 3D0EA 4F78A 2QG7A 4J53A 4YSMA 3I7CA 4YO4A 3DNEA 3ORZA 3RPRA 2UW0A 3UIBA 1FMOE 4EOLA 3QZFA 4MD9E 1Q5KA 4I6HA 5HG9A 3AD4A 4QQJA 3WI6A 2QOFA 4FV8A 2HZIA 4DTAA 4DG3E 4U5JA 3ZLWA 4U9AA 2B9HA 3QQUA 4JQ8A 3LPBA 4I5HA 3R9NA 2XAOA 4NCTA 4YTIA 4YMJA 3O17A 4AZVA 3FMLA 3L8VA 4B8LA 4LV8A 2P55A 3PIZA 1OM1A 3VAPA 3DLSA 3UQCA 3EIDA 3MS9A 3REPA 4IC8A 4BJJB 4A4LA 5BX0A 1YOLA 3FMJA 4NM3A 1OL2A 5DPVA 5J9ZA 2W1DA 3SOAA 5CEOA 1H08A 3KKVA 3QRJA 4FSWA 3FE3A 4O7YA 3Q04A 4FIHA 3JY9A 1J1BA 2EU9A 2J4ZA 4DHFA 3D5UA 5CVFA 4OBOA 5HU3A 3OMVA 3VS7A 2C0TA 4X2GA 4W4XA 5HEZA 4KRDA 3QHWA 3O5AA 4M69B 4J8NA 3D2IA 3P08A 4WSYA 3D94A 4UEUA 4G9CA 3B8QA 4OTDA 3FXXA 5K9IA 4FG9A 4P5ZA 5IEYA 2J0LA 5EQYA 3A99A 4FSQA 3PA5A 2WFYA 4XUFA 5HX6A 2ETMA 4WNKA 2YABA 4RJ5A 1QCFA 3MB7A 4O7NA 4QQCA 2OIDA 4IM3A 5CEQA 1BYGA 2GHLA 3DV3A 3HV7A 3R2BA 1ZWSA 3P5KA 5J95A 2XF0A 3HMIA 4IHPA 4XV9A 3UQFA 2NNWB 1TQMA 2ESMA 4FIIA 2FO0A 4CGAA 4DHZA 3R22A 2BVAA 4E8AA 3UDZA 2XIZA 2C0IA 4K9YA 1KV2A 1OKVA 1PY5A 4QYFA 4YTCA 4I24A 3GBZA 4J96A 5A54A 5M53A 3KEXA 1ZRZA 4E6CA 4KB8A 3ZBXA 4ASDA 3KMMA 3CQUA 1WBPA 5HOAA 5CY3A 4RSSA 1NVSA 3KFAA 3UMWA 4PV0A 4DAWA 4R1VA 4OAVB 4BR3A 5IEVA 3H9OA 3UO6A 1GOLA 2QOHA 5E8WA 3VRZA 4DGGA 3A8WA 2Q0BA 4LV5A 4JI9A 5DEYA 4AZSA 3P9JA 3MTLA 3F5PA 2BDJA 3MA6A 3OW3A 4R7HA 5LMAA 5H8GA 2W9ZB 4FE2A 3TDVA 2HZNA 2J6MA 4WHZA 2CHLA 3A7JA 2WGJA 2R0UA 5AUZA 4ZLOA 4ZOGA 5TF9A 5CAVA 4FV5A 4BWXA 3TKHA 3DS6A 4AS0A 2BTRA 2FA2A 3BX5A 5C03A 4P5QA 2PL0A 4KIKB 4ZK5A 3QTQA 4JG7A 3VVHA 5H8EA 4O38A 4MQ1A 4CEGA 3DJ6A 3GUBA 5ACBC 1DI8A 3MH0A 1Q97A 1YI3A 3VUDA 3C13A 2Z60A 4M84A 5CF5A 3ZMMA 4CD0A 5FEDA 4EHZA 1L3RE 3CTQA 4TYGA 4FT0A 4FV0A 5KNJA 3OWKA 4FKJA 2F7XE 2WQNA 2Y4IB 3D7ZA 2VTAA 4QMLA 3UJGA 4TYIA 3EKKA 4O4EA 2VWYA 3PTGA 5AR8A 1OB3A 2XS0A 3AD5A 4BI2A 5CU2A 3RK9A 4TL0A 2QD9A 4IE9A 5KE0A 5KMNA 3LW0A 4A9SA 2UW7A 3Q4TA 4I0SA 2PTKA 3UE4A 1Q8YA 4FF8A 4QP6A 2W1CA 2WKMA 3B2WA 4YTFA 4G16A 3ANQA 1GZOA 1GAGA 3EKNA 4BDFA 4F1TA 4KS7A 2XNNA 3NYXA 3KULA 3NIZA 3D4QA 5JRQA 1F3MC 3WIKA 4OTGA 1PXNA 3DXPA 1OL7A 4HNFA 3R02A 3TI1A 5HVYA 4A4OA 3KCFA 4O4CA 5AV4A 3QTIA 4PL3A 3C0GA 4NKSA 1B6CB 3OG7A 3FL4A 4FA2A 2CDZA 4WSQA 3MWUA 2HXQA 1ZYCA 4EOMA 3UYTA 1TKIA 5IQBA 1BX6A 1G5SA 4M0YA 3PIXA 2IVSA 4KSQA 4QP2A 3OOGA 4K2RA 5AV0A 5J9YA 4I20A 2PUIA 3V3VA 2C3KA 5FXRA 3C7QA 1H1SA 2V5QA 3K54A 3SGCA 4MAOA 3HGKA 4CQGA 2A27A 2WMWA 4RT7A 4I6LA 2JKMA 3GOKA 2OJGA 3OWJA 3H0YA 4L01A 3EYHA 3P79A 1OUYA 3RZFA 2R5TA 2R7BA 3D5VA 5IA0A 3F2RA 4Q9ZA 4AQKA 4FVRA 3BQRA 5D7AA 4KKHA 4AAAA 3Q2MA 4GS6A 4QPSA 3LHJA 4H3PA 5CNOA 3MVJA 4JG8A 5C8MA 4O21A 4HCTA 2YWPA 3F5UA 4I21A 4GEOA 5JZNA 3TJDA 5L2SA 4UMQA 2GNLA 5EM8A 3RVGA 1M2RA 1XH8A 3ORNA 2WD1A 4WRGA 3WILA 4AF3A 1YXTA 5CF8A 4I4EA 4BGHA 3QC4A 4KIQA 3DKGA 4BHNA 2UZEA 3LCKA 3GU4A 4GYGA 3NZ0A 2Y4PA 3A7IA 3FZPA 4HZSA 4D4SA 4BCQA 4OAUC 1J7LA 1UU9A 1OIQA 4EH8A 5IH5A 3H4JA 2XK3A 4PY1A 4YJQA 4RZWA 4F7JA 4QNYA 3HRFA 2IZRA 2JKKA 3ZU7A 4NIFA 2JD5A 4AOIA 4UXQA 4A9YA 1OIUA 2VTMA 4CCBA 2VWUA 3MFTA 4O27B 3IOKA 4WT6A 2ZOQA 2Y0AA 3S00A 4E93A 2OLCA 3QQKA 3TNWA 5IQEA 4PDOA 4U97A 4EJ7A 4AW2A 4F09A 4D4YA 2J0KA 4FTRA 1MRVA 3NFFB 4RIXB 4NTTA 1PYXA 4IXPA 4QMTA 3DBFA 3P7BA 4E1ZA 4O7TA 2WQOA 1QL6A 4MBJA 4DEDA 4E6DA 4U3YA 3Q4UA 5TKDA 5GJDA 2ZV7A 5EI2A 2PVMA 4W4WA 2ZDTA 5AP5A 4DCAA 3DK7A 4E7WA 2CLQA 3E63A 4YZCA 4G3CA 2C5NA 3QQLA 5BMMA 2BTSA 5M08A 3OXIA 2YM4A 4FV3A 2OJ9A 1XO2B 4C62A 2QOLA 2OZAB 1RQQA 2O8YA 1U59A 3NAYA 3FHIA 4AZFA 2OICA 4R3CA 4XG6A 4PDPA 4WG3A 4BDIA 1AD5A 4RFYA 4BHZA 2IN6A 4OLIA 2X8EA 4D4RA 5HO7A 5K0XA 4DEHA 4I1ZA 2IO6A 5AIKA 3TV4A 3VC4A 3MY1A 2WTCA 1XH5A 4JRNA 1P14A 5D41A 3QTXA 3UDTA 2O63A 4N70A 3RPOA 1JPAA 2I0EA 3MTFA 1VEBA 2IPXA 3AT3A 3EWHA 4ZJVA 3K2LA 2JDVA 2R3MA 5KMJA 1PXIA 1Y6AA 2OJFE 5JKGA 5DIAA 2R3IA 2HELA 4F7SA 4IVCA 4RGJA 3A7GA 4EJNA 1B38A 1PF8A 5BVWA 3NUAA 3DNDA 3F3TA 4LGDA 3ZFMA 5JK3A 4L7FA 5DEWA 3ZO2A 4F64A 4YJNA 4PTEA 2YJSA 4I0TA 2O65A 4C37A 2FSTX 1BI8A 4IAYA 2BRBA 4DHJA 2JIVA 4NH1A 1TVOA 1WVYA 4F7LA 4C59A 2CCHA 3ZRKA 5EKNA 3VN9A 3C51A 3FQSA 1K9AA 2I0VA 3DZOA 4TZRA 4TYEA 4X21A 3RMFA 2X81A 1JKTA 3IPHA 4CFMA 3WF7A 2XNEA 4AGWA 5ANJA 4O2PA 3EN6A 4GJ3A 5C27A 3EMGA 3AC8A 2OG8A 2BPMA 3EQIA 1OL6A 4J1RA 4MEDA 3KQ7A 5AP0A 4NT4A 4FEXA 4B4LA 4M12A 4RFZA 2W05A 3QA8A 2PE2A 4TYJA 4LG4A 1VYZA 4XH6A 5FEEA 3O8PA 4G17A 3OVVA 4U41A 4JLCA 5CEIA 4YNOA 4EK5A 4QMYA 3NMUF 2XIRA 4FKLA 4WNMA 4GKIA 3WF8A 2VTRA 2A2AA 4D2RA 3GP0A 2P4IA 1BUHA 4PUZA 2CJMA 2WZJA 4K8AA 5CEPA 3H10A 3M11A 3FDNA 5FBOA 5CI7A 5KMKA 4FSYA 3V5PA 2QCSA 1R39A 2Z02A 1Z5MA 2GNJA