3OUKA

Crystal structure of rv3910 from mycobacterium tuberculosis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
248
structure length
248
Chain Sequence
b'QLVPGARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVLQETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTSPSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPATMPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEPADIDRDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
publication title A phosphorylated pseudokinase complex controls cell wall synthesis in mycobacteria
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 58
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2010-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oukA01
4FV9A 4ENXA 5J1VA 4KA3A 1KWPA 3EOCA 4IMYA 1LPUA 2X39A 3JPVA 4K1BA 3VQHA 4O7WA 2NO3A 2PY3A 3OCBA 4EZ5A 3OTUA 5IH4A 5HLWA 4MAOA 3ZUTA 5A4TA 2QR7A 4QP3A 3PIZA 4ZJJA 4HCVA 5I0BA 2P33A 4D55A 2J0LA 3NEWA 5BVNA 5CZHA 1U5QA 5I9UA 4PMMA 2BHHA 3LFQA 3KGAA 4W4XA 5D10A 3WIGA 4FV5A 1NXKA 3DJ7A 5E8VA 4ACCA 3N9XA 1W84A 3NGAA 4UYAA 2QOBA 2XK9A 4CKIA 4HGLA 3U6JA 1CTPE 4FNXA 3MFRA 3NLBA 1AGWA 4JIKA 2Y9QA 3PTGA 4IWDA 2Z7QA 4DGNA 2JFLA 3BU3A 4WNPA 4EUUA 5I9ZA 2I0VA 3ORKA 4A4LA 1NVQA 4MH7A 2YJRA 4CFMA 4EC8A 1U46A 5I9XA 4H58A 4X2GA 2C5XA 3OUNB 3QQKA 2WQNA 1IASA 3FHRA 3NIZA 4C61A 2QOCA 2W1CA 3LFAA 2ZV9A 4EH7A 1YOMA 3AGLA 5FD2A 3SW4A 5E8SA 3NNUA 4MHAA 2WTJA 3OP5A 3P86A 2XEZA 3FI4A 4J96A 2HXQA 3VUKA 4GKIA 5KO1A 5HOAA 5LJJA 4PMPA 2YCSA 2QKRA 4OUCA 2X2MA 3KXXA 5CU2A 3NWWA 5AWMA 3MJ2A 1KV1A 4BBEA 3KREA 5JRQA 4H1MA 4IFCA 4BDEA 4YUQA 4DFBA 4JVGA 4YJSA 3D15A 4ANOA 4B4LA 3FXZA 3R8LA 5H9BA 5L8JA 2ZV8A 4BDAA 4O1OA 4KSQA 4F1TA 5F95A 4AS0A 4KUJA 2PMOX 2OI4X 5KE0A 3THBA 4IM0A 3KVWA 4FL2A 4YPDA 5IA3A 5J9ZA 3LCOA 2VWUA 4AAAA 4QPAA 2IJMA 4WT6A 4I6QA 4O91A 4F70A 4QP2A 1NVRA 1YW2A 3QFVA 4FT5A 4FZ7A 4GL9A 4GUEA 4A9YA 3AT4A 5IPJA 1F0QA 4FOBA 4FIJA 4GEOA 3QC4A 2G2HA 3HV6A 4MBJA 5CYIA 5HD7A 2R3JA 5CSPA 3P9JA 3OCSA 5AUYA 4BIDA 2PZPA 2YN8A 3FY2A 2HZNA 2QD9A 2XZSA 1YDSE 3MSSA 3DDQA 4KRDA 2PK9A 4K2RA 4QP7A 5FDPA 4M67A 4E4MA 2HENA 4O2PA 3MVLA 3BYOA 4ALVA 4LRJA 4FKJA 1U5RA 2E9VA 3GFWA 3IW4A 3O8TA 3U4UA 4QPMA 4RG0A 2R3NA 4KIKB 3GVUA 2JDOA 1UVRA 3FKOA 3DAJA 1ERKA 4M14A 2YAAA 4YLKA 5KBRA 4ASEA 4D4VA 3PWYA 5JGAA 3VNTA 4FIHA 3A99A 4BCKA 2CKOA 3LLAA 3LCSA 4ZEGA 1L8TA 2DUVA 1LUFA 2WTWA 4YR8A 1H1PA 4YGAA 4CMTA 3PA5A 3O2MA 4ITHA 2XKCA 3EWHA 4NCTC 5ANKA 4FSRA 3SC1A 2UW6A 3DKOA 3FLNC 3JY0A 2IVTA 2XK6A 3LFDA 3QUPA 4FSYA 4LUDA 4NEUA 3O8UA 3G2FA 5HO7A 3HP2A 2BTSA 2C3LA 3VHKA 2WELA 5HCYA 4BDJA 5EKNA 4JNWA 5FRIA 4AN2A 5BMSA 3R21A 3LFNA 3L8PA 3C0IA 4FUYA 2C6EA 4NFNA 1FVVA 3TDWA 2XM9A 3D9VA 1UA2A 3EKNA 3ZO3A 3BGPA 3GT8A 1BKXA 4FV8A 3TUBA 3DNDA 3AQVA 1HCLA 2Z8CA 3GC8A 4FV6A 4XV9A 5AR5A 2YM6A 4GKHA 1GNGA 3CTHA 3FLZA 4CV8A 4B7TA 4OTGA 5KHXA 5CEIA 4JG8A 4I0SA 3F5XA 4O7NA 2PU8A 4DTKA 2WQEA 3S0OA 2W5BA 3K5VA 4XV3A 3HRBA 4O1PA 3QRJA 4RLKA 2C47A 4A06A 2Z60A 3ORZA 3UZPA 4DITA 3QUDA 5ETAA 2ONLA 4AACA 3LQ8A 4IACA 4U0IA 1UU3A 2P3GX 3QZIA 4FOCA 4G9CA 4P7EA 4TYGA 3CQEA 2X0GA 4BCIA 1WBPA 4C7TA 5E8UA 4DF3A 4NKSA 2O64A 4IAZA 2XKDA 4D0XA 3FMDA 4AP7A 1A48A 3F69A 3UVRA 5CEQA 3MB6A 3H0ZA 1V0OA 4FL3A 4PTGA 3W2QA 2PVKA 5AV1A 3UOLA 3UPXA 4ANQA 1H4LA 2YITA 3DZQA 2HZIA 2JAMA 3R9DA 2UUEA 2WTIA 3SHEA 4QYYA 2R5TA 1UU7A 1W0XC 3GEQA 2BZHB 4BTJA 4PV0A 4BBMA 3LAUA 4J8NA 4LM5A 4G3CA 3ROYA 5I5ZA 1GJOA 4L6QA 5CU0A 4RJ5A 3ZXTA 3RWPA 2CGUA 2GFCA 3DS6A 4HGTA 3UOHA 3E64A 3SDJA 4XG7A 2BVAA 4YJOA 4AT3A 3EZVA 4CEGA 2ITOA 4FEVA 3IK3A 3D2IA 1WVWA 4R7HA 3O96A 3LCKA 4IB3A 4FKPA 3PVWA 4RX7A 5GIPE 3NUNA 4G2FA 2PUNA 4FVRA 3TTIA 5E4HA 4RQVA 2QQ7A 2YM3A 3CJGA 4L7SA 3BYVA 3PJ3A 4M0ZA 5CQUA 4OTWA 3VRZA 1BYGA 2GTMA 4MF0A 1H0WA 4YTHA 4TN6A 3LM5A 2XRUA 1TKIA 3ZMMA 2XBAA 4FODA 4JIAA 3JS2A 2JEDA 5B2KA 4ACGA 4F4PA 1Z57A 4CVAA 2W99B 4HNIA 3NNVA 4AN9A 4QPSA 4CLJA 4BDKA 3HA6A 1GOLA 4WSQA 3ZONA 4EHGA 3FLYA 5E92A 4MKCA 2G2FA 4GVJA 1NT2A 4EH2A 1I09A 4AZEA 1PMEA 5KMNA 4FL1A 5KX8A 1JSTA 1UNHA 3PRIA 3U8WA 4FTMA 4U43A 1OECA 5BNJA 1REJA 3QCXA 4ZXTA 3DTWA 4QQTA 1SYKA 4O7VA 2ITWA 5E90A 1YKRA 1RDQE 3E8CA 3FKLA 4HZRA 4BDBA 4Y73A 2IVUA 2IZUA 2UZOA 3SG9A 2ZM1A 4MWHA 3QTUA 4RIYA 2Y4IC 3OWKA 5LCKA 4QP1A 5HORA 4I5HA 4GT4A 4FKVA 3DLZA 3HDMA 3OWPA 5HX6A 4BZDA 3PY3A 5BVOA 1RE8A 2OZAB 3K2LA 3GCUA 1Q62A 4LRMA 1Y8GA 4M0YA 4C02A 5BPYA 1YI4A 5AP1A 1QPEA 2WB8A 2JBOA 1Q3DA 3SXFA 4O96A 3VF9A 3OT8A 4X0MA 4YZ9A 5AM7A 4GYIA 4BGHA 1M52A 1LEWA 3S2PA 4FKTA 1M2RA 1ZY5A 2X2KA 4RVMA 3QD3A 2O65A 4M8TA 1OB3A 2VUWA 1K3AA 4IZ5A 2GNGA 5GHVA 3TV4A 1V0PA 2WMVA 4UMRA 1IRKA 3GXLA 5DI1A 5AUXA 1NW1A 4CKJA 5GZAA 4EKLA 4FK3A 3OHTA 3KY2A 4Y8DA 3PXRA 3OCGA 2R3IA 4QP8A 2BPMA 3OFMA 2F57A 3MBLA 4JRVA 1UU8A 2F2CB 4I5MA 5EI8A 5FEEA 3VHEA 5C9CA 4CQEA 4RBLA 3KK8A 4O0VA 3G90X 3F7WA 4ZZMA 5DR9A 3AD6A 2FSOX 2WMWA 4O7ZA 2W06A 1EH4A 3BGQA 3MB7A 4EH6A 2WMAA 1VYZA 5IQCA 4GIIA 3M42A 1YVJA 3FLQA 3PE1A 4O7RA 3IQ7A 3GGFA 3P5KA 2WMRA 5TOZA 2PVYA 3KULB 3N4UA 1GZNA 3Q53A 4O0WA 3FLWA 4EQCA 2Y4PA 3BQCA 4F1OA 5HESA 2B7AA 1BL6A 2E9UA 3MWUA 3FEGA 4FTLA 5GJDA 1AD5A 2ERKA 2PE2A 2PYWA 3NYNA 5D41A 1F5QA 1WBNA 3GQIA 4TYEA 4W8DA 2H34A 3O8PA 4DGOA 3DBEA 4FTAA 4D1XA 5M53A 5HG8A 3RPVA 4FYOA 3U54A 3EQBA 3CGFA 2VTSA 3RVGA 1SNXA 3I4BA 5FTGA 5DYJA 5C01A 3DXPA 2YHVA 4M13A 3U9NA 5ICPA 4JBOA 2PTKA 4YZBA 4ZTSA 3FAAA 2CMWA 3GU8A 4DINA 2JIVA 4ZTHA 4WNMA 4IZAA 5EFQA 3F6XA 2QOOA 3E8NA 3G9NA 3OXIA 4EHVA 5HLPA 4USEA 3I5NA 4BCHA 2PZ5A 2JITA 3V6RA 1JKKA 1YI6A 4X6QC 4EH8A 4D9TA 1BX6A 3MA6A 5ACBC 1FVTA 4IAAA 5CZIA 4PPCA 3VUDA 3HAMA 3NSZA 3BU6A 2QO7A 3TNPC 5IA0A 4HCTA 2Y8OA 3QD2B 2WTDA 4TPTA 2YZLA 4CFFA 1YXSA 1URCA 2H9VA 3FL5A 4FKRA 5DHJA 3LXPA 3UIMA 4ZLYA 5GZ8A 5DR6A 2UW0A 5EW9A 2G1TA 4P4CA 2QG7A 1QPJA 1CKPA 4ANNA 3K3IA 3EQRA 3KRWA 2CKEA 4YJPA 5DPVA 4Q9ZA 1YXVA 4EYJA 3DBFA 4HVGA 3ZRLA 3QLGA 5CF5A 2WQBA 4TWOA 2ERZE 4U6RA 2X9EA 2PZIA 3QQJA 4CTBA 4QMWA 4X3JA 2Y4IB 2HWPA 3MY1A 4TTHB 3HZTA 3VBTA 3HNGA 3UO6A 3W32A 4ALUA 4K18A 5D7AA 5JH6A 4DFUA 1Y57A 4R77A 3UIXA 4S31A 4IM3A 4OTRA 1B6CB 4K0YA 4RIWB 3ORNA 5CI7A 4ZTNA 1Z5MA 4JX7A 4YO4A 4BFMA 4TYIA 4IWOA 2OH4A 3HGKA 4C38A 4NSTA 4IX5A 3NS9A 4AN3A 2VGPA 3CTJA 3ZM9A 2G15A 3IW6A 3QTXA 3ANQA 2O63A 1TVOA 3FL4A 5EQPA 3QX2A 3EQDA 3ETAA 2YISA 3CKWA 2VTTA 5IUHA 4AA4A 2GSFA 5AA8A 3W2RA 4M15A 3VBVA 4OTIA 5J95A 4EI4A 2R3LA 4UXQA 4AW5A 1NY3A 2X81A 3DTCA 5FDXA 3KK9A 3G51A 5L2WA 3S95A 4UZDA 5KMMA 2PUIA 2A1AB 4LOPA 4GK2A 3EQPA 3DBCA 2HELA 3BLHA 3HX4A 3MS9A 3NZ0A 2ETMA 4GG7A 4AOJA 5IQFA 4AXAA 1J7UA 2OGVA 3C4CA 2VTQA 3V5JA 3LQ3A 1OL5A 4O0TA 3ORLA 4EH4A 4EHEA 1KOAA 3HKOA 5CT7A 4EBVA 4PDPA 2FB8A 3QBNA 3TUCA 2EB2A 4D0WA 2A19B 2RG5A 4R7BA 4I23A 3BI6A 4U41A 4D4SA 4EK6A 4QTEA 3TV7A 2XMYA 1OBDA 1OGUA 3D94A 3RK9A 3DXQA 2YIXA 4MXZA 3CSVA 4PF4A 4XEYA 4WOVA 1QPCA 4YMJA 2XEYA 2HZ4A 4J8MA 5AV2A 3UNZA 2OFVA 1DM2A 2JKKA 4QMTA 2GNFA 1Q8TA 5FXSA 2J4ZA 3TZMA 4IVAA 1XH7A 1UNGA 4X21A 2PVJA 4IE9A 2GTNA 3TJDA 4RZWA 5DRBA 3Q52A 2W4JA 5HNGA 4IWPA 4RFZA 4LL5A 5T68A 1H27A 4ZIMA 3EN6A 4IW0A 4O22A 3COKA 5HQ0A 3ATTA 4FEXA 3OOMA 3KA0A 4PY1A 1GIHA 4BF2A 5HTIA 1TQPA 5EOBA 4OGRA 1YWVA 1JQHA 4IM2A 1G3NA 4I4FA 1UKHA 3C50A 3TNQB 4TNDA 4IVBA 5EDRA 3PXQA 5EH0A 3E7OA 4NUSA 4Q5EA 2IN6A 3PA3A 4J99A 4CYJA 1XR1A 4EOLA 4D2TA 3C0GA 1NA7A 2YAKA 4BRXA 1QCFA 1DAYA 4JDHA 4WNOA 4EK4A 4FKUA 3ZH8A 2ITTA 2QU5A 1ND4A 4NM3A 3ERKA 4XP2A 5E8TA 1UWHA 3HLLA 4L3LA 4EJ7A 3ZBFA 4AA0A 4CT2A 2RFEA 3JVSA 4F09A 4I41A 3D2KA 4AF3A 4AG8A 2FA2A 1WCCA 3G6GA 3MVJA 2GPHA 3U9CA 2G01A 5KMLA 1PKGA 3H9RA 3BX5A 2ITVA 1W7HA 4RJ4A 4ZMEA 2C4GA 4JQ8A 3RPYA 1H1SA 3AD5A 2X9FA 3I7CA 4I24A 4TRLA 3JXWA 4W4VA 1SNUA 3HV7A 5AR2A 3R1NA 3ENHA 4MBIA 4XS2A 2OXYA 3R83A 4EH3A 5HG5A 2CKQA 2F4JA 3HP5A 4BVUA 2BALA 3WZKA 2JFMA 4F63A 2JKQA 4RT7A 5DRDA 5FEDA 4H3PA 3PLAE 2BAKA 4TT7A 2CLQA 4FT0A 3TNIA 3P08A 4DC2A 4G6OA 1J1CA 5ANOA 3VF8A 3GI3A 1ZXEA 2OJIA 4X3FC 3H9FA 5KZ0A 3RHKA 3TNHA 4MWIA 1ZYLA 2UZBA 5J87A 3IS5A 4G1WA 5DVRA 4QMOA 4E6AA 5HVKA 4OTFA 1S9JA 3E8EA 4V01A 3EYHA 4E4XA 3CTQA 2VX1A 1STCE 3RAIA 2HZ0A 3O51A 3SD0A 3KMWA 4DLIA 1OIUA 4K6ZA 3HAVA 3ZSHA 4E7WA 3GCVA 5H8EA 3R04A 2CNQA 5ITAA 3OXZA 5IA5A 1CDKA 3DAKA 2OG8A 3OWJA 2ITXA 3FC2A 4LFIA 1FPUA 5BQ0A 3DCVA 5AIRA 2YJSA 3AMBA 3ODYX 3ACJA 1QPDA 4DGGA 4YNOA 4QYEA 1ZOHA 5J5TA 4OW8A 3WI6A 4XH6A 1O6LA 4O0SA 2EXEA 3KF7A 3KRJA 2X8EA 4CMOA 3FYKX 3VUMA 5CEKA 3DT1A 2VWYA 3FHIA 4G6NA 5I9WA 3GU4A 3FMKA 3LFBA 4BKJA 3QYWA 1OI9A 1WAKA 2ZJWA 4Z55A 4DLJA 5JSMA 1G8AA 1VJYA 1ZY4A 4PL4A 3QTQA 2W17A 1K9AA 2GNIA 1ZRZA 2HOGA 2ITQA 2XNNA 3W2CA 3R8VA 3P78A 2I1MA 4XYFA 5A14A 1ZMVA 3RGFA 4LI5A 2BRHA 5KBQA 4JAIA 2VTMA 2X7OA 2YCQA 2OF2A 3FZPA 4V0GB 3TXOA 4RJ7A 4RJ3A 5J7HA 4KBKA 2QCSA 4YTIA 3V5LA 4JI9A 4U44A 2UW7A 2JIUA 3S3IA 3FJQE 1OZ1A 5M4UA 2X4FA 4FI1A 4E4LA 4XG8A 1J7LA 4BZNA 1XH4A 5EOLA 3QTZA 3VUIA 4ACMA 4MXYA 4YJRA 4JG6A 4AE9A 3VBYA 2GNHA 4KIOA 3LJ1A 4I1ZA 4QYGA 4AZFA 4JL9A 2XIYA 5BUEA 5C8KA 5JFXA 3FMMA 4K11A 4XCUA 2OJFE 3P4KA 4D5HA 4G3FA 3MVMA 3I7BA 3UODA 3CPCA 1Q24A 4XG4A 3NX8A 4O0RA 3FSFA 5AP6A 4DH5A 4YSJA 3VAPA 3PXFA 5CAQA 5AX3A 1XO2B 3F7ZA 4N6ZA 3R7VA 5EDQA 5HZNA 4BTMA 2YM5A 3ZFYA 1FGIA 3BEAA 2J7TA 3U4WA 3POZA 3II5A 4XBRA 4YBJA 4WG3A 5DWRA 3QUEA 3ZYAA 2XNPA 2VTNA 4AQCA 3L8SA 4Y83A 2GHLA 3TDVA 3R2YA 2WU6A 2OJ9A 3A8WA 5B2MA 4D4YA 1KOBA 3QKMA 4N4SA 3T8OA 2BROA 4CG8A 4FTIA 4FV0A 3WE8A 4KBCA 4LOOA 3CGOA 4K8AA 2IZRA 4BCOA 4LMNA 5LVPA 2BDJA 3TUDA 3ID6C 3ELJA 2RG6A 2XJ0A 3EIDA 3LM0A 1U54A 3F61A 3F88A 3EN4A 3L9NA 4JRNA 2B52A 2W1ZA 4KWPA 5B7VA 3AC8A 2ZOQA 2R7IA 2X7GA 4HNFA 5AUWA 2LGCA 3RALA 5I3RA 4D58A 2AC3A 4Q5HA 5IUGA 1HOWA 4IAYA 3KU2A 3PJ8A 1FQ1B 3P79A 1YWNA 3K5UA 1OM1A 4MD8E 3HRFA 1YDTE 5BUJA 5I9VA 5J9YA 1W8CA 2OO8X 3EL7A 3SAYA 4IEBA 5LOHA 1A9UA 2JC6A 4C8BA 2YDKA 3WIKA 4BWPA 4KNBA 2IWIA 3BBTB 3EQGA 4RFYA 3ZEWA 4DH3A 3P23A 2BRBA 2AYPA 2HXLA 5ETIA 4E73A 4L00A 2X6EA 4QMUA 3RPOA 3OT3A 3N4VA 5IQHA 4AZTA 1H01A 5BVKA 3H9OA 2ITUA 3NW5A 3MIYA 5IQAA 3A62A 3TZ8A 2PSQA 3NUPA 3G0EA 3ZTXA 4BHZA 4F0FA 1JSVA 3EQHA 3MESA 1H28A 2JD5A 3QRUA 3WF9A 4I0RA 4JXFA 5CASA 3I81A 3OD6X 4DA5A 1H0VA 3LPBA 4IC8A 4YHFA 2XIXA 1MUOA 3UYTA 3R63A 4YURA 3Q5IA 3VIDA 2CPKE 2ZDUA 1R0EA 3ZC5A 4OAVB 2I0YA 3DQXA 3NRMA 5E7RA 3QA8A 2QU6A 4NZWB 4C4EA 3P7AA 2UZUE 3BYUA 2C1AA 2YIQA 3PZEA 2CLXA 4II5A 5L8KA 4NIFA 3TKHA 1IAHA 4S33A 3ZC6A 4GW8A 5IG1A 2C30A 4N0SA 4ZSGA 1PXLA 4ZLZA 4FZDB 1YRPA 2BFYA 3IDPA 3HV4A 2YEXA 3KRRA 4JOAA 2XP2A 4O21A 4RJ6A 3GU7A 4UALA 3EN7A 3VC4A 4FKLA 4J53A 3QWKA 4L68A 4L52A 4RVKA 3UP7A 3E3PA 5E1EA 2V55A 4D9UA 4EOOA 4NM7A 2QNJA 1PXIA 2WKMA 2WMXA 5AV4A 4WKQA 2J0JA 3H30A 5JQ8A 1H26A 5A4QA 1G8SA 4X2FA 3UG1A 5IA2A 1Q61A 3FZRA 3T3UA 4FKWA 3TIZA 1Q8UA 4EBWA 4C57A 2PPQA 1H08A 2YCFA 4FT9A 1WBVA 1M2PA 4PMTA 3R7OA 4YJUA 4CZTA 4DEEA 4F1MA 2WU7A 5FEQA 3QX4A 5AV0A 1ZARA 3F82A 3PSCA 4GH2A 5AP2A 5G1XA 5G6VA 1OUKA 2CN5A 3F5UA 5M09A 4PDOA 1YHSA 5KMJA 5H8GA 3UQFA 5DFPA 5AEPA 5CSVA 5CEMA 4PDSA 5K0KA 4IADA 3UC4A 1LR4A 1OPLA 4KKHA 3ZHPC 1FBNA 1OIRA 1E9HA 2C0IA 4RA4A 2PMIA 4HVDA 4BWXA 4UV0A 3I0QA 4EH9A 4HYSA 3D4QA 3FI3A 2QOFA 4BTFA 2FVDA 2NRUA 1ZYDA 3MGYA 4PPBA 3O7LB 5ANIA 3DJ5A 3FMJA 3VBWA 4BL1A 3JR1A 2Z02A 1Q4LA 1GZOA 4I22A 4Q9SA 3UPZA 3LLTA 3EH9A 3KC3A 4FNWA 3F2NA 2VU3A 4U3YA 5DA3A 5FLFA 4BC6A 5M56A 4I5PA 1MP8A 1Q8YA 3ATSA 4Z7GA 2W1HA 5DMZA 3QL8A 4FV3A 3MPAA 5CVHA 2Y6MA 4I5CA 1YXUA 3HRCA 4BCPA 2OU7A 4OLIA 2ONLC 4EORA 2JLDA 3A7GA 3G33A 1VZOA 2PULA 2IZSA 4NM0A 4H39A 2C6OA 4JLCA 4O6EA 3LXLA 3CKXA 1QL6A 2C6DA 4Z9LA 4DFYA 3EJ1A 5HVJA 3QZFA 3C13A 2VTLA 4JQ7A 3RAWA 4CRLA 2CGWA 4U5JA 5CSWA 4CG9A 1GZKA 2ZV7A 4U9AA 1J3HA 4FKQA 3TNWA 3W1FA 5L2IA 4NWMA 3E5AA 3PIXA 5FG8A 3LVPA 3RKBA 1UKIA 3WF6A 4IB5A 1OKYA 4I0TA 5IEXA 1LEZA 4BDDA 4LL0A 4AFEA 4BN1A 4J1RA 5CWZA 2QVSE 2CNVA 3NUXA 4F9WA 3RM7A 4KABA 5CU4A 3VS3A 2X8IA 4MXCA 2YA9A 3EFLA 3R7GA 3EB0A 1A06A 5FBNC 3Q32A 2WMQA 5DG5A 3FDNA 5AV3A 3LXKA 4BZOA 2WMUA 3PSBA 4Y95A 4EOQA 3D14A 5JT2A 3CR0A 4TZRA 5AAEA 2J90A 3ALNA 3KQ7A 5E9EA 4HOKA 4TNBA 3G6HA 4TY1A 3OROA 4UMQA 3ITZA 4JBPA 4QP6A 3VULA 4BCJA 4D28A 3PWDA 4IX6A 1H8FA 5DR2A 2W1IA 3ACKA 4WHZA 4B8LA 4OTQA 5A3XA 4CKRA 3R28A 3AXWA 1Z9XA 3D83A 3PJCA 3V5PA 4RZVA 3WOWA 3PXKA 5EM6A 3D5XA 2BFXA 2IG7A 1PXPA 4FVQA 2J50A 3UVQA 4M66A 5T6KA 3FSKA 3QQFA 3LFEA 4AWIA 5AMNA 2OF4A 5A9UA 4UWBA 4KD1A 4MEDA 5M55A 1YOLA 3TKIA 3KXHA 3R8PA 3DFCB 5GJGA 1MQBA 4L3PA 4NKAA 4ENYA 3E62A 5KKRC 4UBAA 3DKCA 2ETKA 5BX0A 2BTRA 2C0OA 2J5FA 5JZNA 4L45A 5EHLA 4YTCA 4IHPA 4RC2A 4AW0A 4UMPA 2F2UA 3NCZA 4R3PA 4EH5A 5AUTA 3HECA 3GFEA 2ZMDA 4WRSA 4DEBA 2QOIA 4QTDA 2WNTA 3KFAA 1R78A 3QU0A 5DT0A 3DY7A 4ZMFA 1W98A 4UX9A 2C69A 2R3RA 4GFGA 4FYNA 2R3FA 4FV1A 3HMNA 4W8EA 4CXAA 2HYYA 3ZLXA 2E9PA 3MI9A 3PVBA 4IB0A 4PQNA 4IVCA 5E91A 1YDRE 4GIHA 3QYZA 3IG7A 3MH0A 4XMOA 3QZGA 4D5KA 5LVLA 4BWKA 4ZOGA 5E8XA 1MRVA 4NYEA 3F2AA 1PYXA 3COMA 4E5BA 2GS6A 5KMKA 3WBLA 3Q4UA 5E8WA 4FV4A 3RINA 4GYGA 4IAKA 1XH8A 3PLSA 3C4FA 4FZFB 2A2AA 4ZJIA 4X2NA 3ZUVA 3FBVA 3U6IA 4IX3A 3SVVA 4GS6A 3B2WA 3HVCA 3E8DA 4RSSA 2O8YA 3PUPA 3EFKA 5IKWA 2WZJA 3I1AA 4FG8A 3MY5A 4LMUA 2X2LA 3WYXA 4JR3A 5CEPA 3E87A 3NYXA 1CKIA 4DYMA 5JGDA 3RMFA 4M12A 2JKMA 4GU9A 4PTEA 1JAMA 2IPXA 5BVEA 1UV5A 2E2BA 5AR8A 3QWJA 4TL0A 5L6PA 3CLYA 4U97A 1DI8A 2O0UA 4DEAA 4XG3A 3SXSA 3D0EA 3DV3A 2GU8A 5M06A 2R7BA 1PMVA 3O50A 4OBPA 5J9LA 2XNMA 4NK9A 3OEFX 5D9HA 3RZFA 1G5SA 4R1YA 5L6WL 4ZAUA 3TG1A 4A9RA 3DKGA 1PY5A 1O6YA 3H4JA 4UY9A 5CF8A 2UZWE 3MYGA 4FIIA 1ZAOA 2I0EA 3W10A 3F5PA 4GT3A 3OXTA 1UU9A 4HCUA 4EKKA 4Z16A 3NAXA 3E88A 3W8QA 4P2KA 3V8SA 1FGKA 1PXOA 3UE4A 3VW6A 5T3QA 1JKTA 4IBMA 5I9YA 4BDHA 5I4NA 1ZWSA 3B8RA 1GAGA 4QMYA 4GT5A 5HCXA 2VWVA 3CE3A 4A9TA 2C68A 5HX8A 3UC3A 2I6LA 2C6LA 4ANBA 1M7NA 3BLQA 5AR4A 3SX9A 5EK7A 3UDBA 1H1WA 1T45A 3L9PA 4RC3A 3IW5A 4C4GA 3UP2A 3EQIA 4AGWA 3PRFA 3BELA 5TE0A 5IDNA 3ULZA 4LV5A 3IPHA 3VS0A 4DH7A 4R7IA 3NCGA 4H3BA 5C4KA 4U45A 4RIWA 3Q4ZA 4J98A 3R1SA 5CF4A 4MNFA 4MD9E 5DBXA 4C62A 2KTYA 4RIYB 2FO0A 2VTAA 1Q8ZA 5KKRB 2BKZA 3P7CA 3OY3A 4KBAA 3H10A 4RFMA 1SVEA 1KUTA 3DK3A 4YC3A 1ZMUA 5A4CA 5M07A 4FR4A 4EZ3A 4XG9A 2J0KA 4P5QA 4FTUA 4FV2A 5FGKA 1M17A 4UWCA 1E1XA 3BEGA 3DK6A 4R5YA 3WZJA 3F3TA 1HCKA 2WOUA 3KL8A 5DH3A 2C3JA 3RAHA 3SGCA 4C36A 4MNEA 3LXNA 3UNJA 5KMIA 4N57A 4FG7A 5DEWA 4CTCA 4DG2E 5E8ZA 1Q5KA 3BHYA 4RPVA 4ZSEA 3PZHA 3BHTA 2BCJA 3Q9YA 4I6HA 5EQEA 4FG9A 1UNLA 2WQMA 3V51A 5HGIA 3R1YA 1OVEA 2XUUA 5TT7A 1BI8A 2R3MA 4DHFA 1OBGA 2AC5A 4XLVA 4FTOA 4R78A 3B8QA 1YQJA 3GNIB 2WXVA 3H0YA 1WZYA 2R4BA 3OBJA 4JAJA 2F9GA 3C4XA 4U7ZA 4BIEA 4AOTA 4G3EA 4TYJA 4QO9A 3VN9A 3UIUA 2RF9A 4M69A 1WBTA 3MN3A 4IIRA 2ITZA 3QTSA 4PRJA 4AGCA 4HVIA 3OC1A 4F7JA 2W1FA 3W2PA 3LCDA 3VJOA 4GV1A 2CHLA 2A27A 2ESMA 4G9RA 4O2ZA 2QKWB 3QRTA 4RIXA 4UZHA 4FNYA 4QMQA 3BYSA 3FKNA 5M4FA 4OAUC 3VO3A 4B0GA 4DFZE 3LQ5A 3ULIA 3PXZA 2WMTA 5FXRA 1YHWA 5KCVA 5D11A 4O7SA 4BCNA 4I6FA 5HIBA 5L4QA 1KSWA 4XLIA 5HD4A 1PHKA 3DU8A 3RCDA 5EHOA 1OKWA 2PVMA 3FQEA 4XNEA 2GS7A 2IVSA 3GOPA 2PE1A 2WD1A 1PXNA 2C6KA 2JDSA 3PP1A 3DXNA 2RFNA 4U40A 4YJVA 3V8WA 4BCGA 3U6HA 3UQCA 3ORXA 3LFSA 5BMMA 3V5WA 4IX4A 4CCUA 4FTCA 4YC6A 3CQWA 3SLSA 3R71A 3IONA 3MTLA 1H1QA 4AT4A 3R30A 4XJ0A 4E93A 5TR6A 4IB1A 5LXMA 5C4LA 3D7TA 3W16A 3M1SA 2BRGA 4J71A 3MH3A 3PSDA 5AR3A 1PF8A 4YHJA 3CBLA 4IDVA 4UMTA 3DK7A 3TIYA 3LCTA 1GZ8A 3R2BA 4NTTA 4QNYA 3L8XA 4WBBB 4JBQA 2PZYA 1I44A 1ZOEA 2OICA 3QTWA 4FIFA 2HWOA 2NRYA 3K3JA 2EVAA 4O0YA 4YZCA 4FICA 5GZ9A 3OMVA 5HG7A 5I3OA 4HYHA 3CY3A 4DCAA 4ZS4A 4ONAA 3C4WA 5EM7A 4MF1A 2XK4A 4USDA 5AAGA 4XG2A 2VTIA 4TXCA 5KMOA 3QD0A 4MCVA 4YBKA 3FMNA 2GHMA 5CXZA 2YACA 2R0IA 3ZUUA 4XUFA 4JJRA 3QQLA 3PFQA 2V7AA 1FINA 2XNGA 4AX8A 2B1PA 4GVAA 4C2VA 4BDCA 5IEYA 2UZVA 1CM8A 4DTAA 4LOQA 5LQFA 4KIQA 3R1QA 4IWQA 2VTRA 2WIPA 1J7IA 2OH0E 3DB8A 4KKGA 2X7FA 2UVXA 4GMYA 1JBPE 3BU5A 4I94A 4DAWA 5JEBA 3SW7A 1Q41A 4JDKA 2F7XE 2EXMA 5HO6A 3DBDA 4AGDA 3A4OX 3HV5A 3QKKA 3BGZA 3TN8A 4MYGA 3PG1A 2BMCA 2VO7A 4QQJA 3HV3A 4EL9A 4UN0C 4O86A 2R3PA 4BYJA 2PUUA 3NR9A 5IF1A 2P4IA 2VN9A 4CFVA 3QQUA 3IW7A 3F9NA 3QA0A 4MK0A 3VUTA 3MTFA 5IUIA 1XHAA 4XV2A 4BGGA 3LOKA 2XA4A 1WMKA 3BHUA 3NIEA 2YZAA 4IC7A 4YJQA 4EJNA 3QF9A 3UOJA 2YERA 1GY3A 4EWHA 5F4NA 5HBJA 2ZM3A 1BL7A 3KXZA 1OIYA 1BI7A 3LIJA 4OTDA 2GFSA 2PVFA 2PL0A 4GJ2A 3CJFA 4KKEA 2YLEA 3BE9A 3FY0A 4ALWA 3Q2MA 4DCEA 4DFNA 4EC9A 2Y6OA 3KXMA 2QR8A 4LGHA 3ANRA 2UW8A 3ZBXA 3IGGA 3M11A 1U59A 2BAJA 4OTHA 5BVDA 2W5HA 3MPMA 3FLSA 4V04A 5HE2A 2H8HA 1PXJA 2W0JA 4FZ6A 5LMBA 3NMUF 1O6KA 2G9XA 2H96A 5J1WA 3PPJA 1ZYCA 3AMYA 5CX9A 3RJCA 4L46A 1JKSA 3C5UA 3VJNA 3HYHA 3FXXA 3FPMA 4O0UA 2VO3A 4EOKA 4PNIA 2B0QA 5A4LA 5A6NA 3U55A 2CCIA 2JBPA 4EEVA 3ZSIA 4EOIA 1B39A 3I5ZA 4CRSA 1M7QA 5EHYA 2XS0A 5JRSA 4C3PA 5IZFA 1Q97A 3G15A 3T9TA 4Y72A 1WVYA 4XRJA 5GNKA 3AOXA 2VO0A 1DAWA 4EQUA 4FSMA 2YWPA 3S4QA 3IO7A 5EM8A 4LUEA 3A7FA 5HKMA 2X1NA 2WO6A 3KXNA 4JT3A 4BKYA 4DEIA 3CP9A 3R7UA 4ZSJA 4H1JA 1WBWA 2QONA 1UWJA 3PPZA 4NW6A 2FH9A 2CN8A 4DT9A 2XF0A 1ATPE 4CFUA 5LVOA 1J91A 4C58A 4Q2AA 5DOSA 4LG4A 5IA4A 4S30A 3TTJA 3ZCLA 4O81A 5IA1A 1JPAA 3W18A 4CYIA 3FQHA 2WOTA 1WVXA 4JDIA 5ETFA 4W9XA 3KF4A 4ZP5A 1URWA 2HY81 3QRIA 2C6MA 2O5KA 2OZOA 3QQHA 3RWQA 2OSCA 2IW9A 1OL7A 3Q04A 2WPAA 3CCNA 2UZTA 5EYDA 4FE2A 4Y46A 4F0GA 3DBQA 3TV6A 4B9DA 3S00A 5J7BA 5CEOA 1YXTA 4UWYA 4DT8A 1AQ1A 3TACA 4PDYA 3BWJA 3PJ2A 2VTOA 3C4EA 2WEIA 4LQMA 2JDTA 1ZOGA 3SRVA 3Q2JA 4BY9E 2UVZA 4PL5A 3SXRA 3V01A 3SOAA 4IAIA 2WAJA 2QG5A 3GU6A 4MXOA 4G3DA 4D1SA 5L2SA 4RC4A 4P5ZA 2R3QA 4I93A 4EOJA 2VTPA 2BR1A 4QNAA 2C3KA 1WFCA 1O9UA 3VS1A 1FMKA 3A7IA 3R8MA 2WTKC 2Z7LA 1IA8A 3E3BX 4AZSA 5JN2A 3WF8A 4OT5A 2UW5A 3LKMA 2B4SB 3H3CA 4DEGA 3E63A 1TQMA 2GMXA 3KB7A 3ZFMA 4EOMA 3AD4A 1R39A 5CS6A 4R3CA 2C6TA 4DG0E 4NFMA 2IW8A 3Q5ZA 4FSTA 2E9NA 3QCSA 4RIOA 4F08A 4RQKA 3EZRA 3D5WA 3KRLA 3QKLA 2IW6A 4F7LA 4L43A 1BUHA 1IR3A 1OL1A 4A07A 4AW2A 3MIAA 1QMZA 4XV1A 4BHNA 4L7FA 3QCYA 3VS6A 2OLCA 3DJ6A 4AW1A 1V1KA 4C35A 2HW7A 4A9SA 4TYHB 3I6WA 4O7LA 3UIBA 5LMKA 2EWAA 4BR3A 4DBXA 4FT3A 3OUKA 3KN6A 3QRKA 4U3ZA 2B9FA 3FUPA 5L2QA 4X3FB 5BVFA 2CGVA 4XX9A 4WIHA 3A7HA 4EOPA 4FTNA 1Y91A 3ZU7A 3D5VA 2XYUA 2RL5A 4IH8A 4IQ6A 4U42A 4RX5A 2ZYBA 2OXDA 1YOJA 3ROCA 4MX9A 3QXPA 4ZZNA 4E3CA 3POOA 1DI9A 4ZY4A 5CTPA 4EOSA 2Z7RA 2C5VA 4EWQA 4QTAA 3OBGA 5K4IA 5DIAA 5HG9A 4E1ZA 3QQGA 3ORIA 5CANA 2C6IA 4QMXA 3VBQA 5K5XA 3KCKA 3MY0A 2XK8A 4JG7A 5FQDC 3T3VA 2VNYA 4WUAA 2I0HA 3VUHA 2XVDA 4NL0A 4FTQA 4APCA 5LVNA 2X4ZA 4YZDA 1IAJA 5EW3A 4L42A 3A61A 2XH5A 4G6LA 1KE7A 2XKFA 3R00A 5EG3A 4BBFA 3MA3A 4P90A 5AFVA 4JDJA 3U51A 5HCZA 5IU2A 3G5DA 4PMSA 2V0DA 4ZJVA 3AT2A 4K77A 3CQUA 3KKVA 4QD6A 5E1SA 1JNKA 2R3HA 3RTPA 4CCBA 4FMQA 1RQQA 4CD0A 3AG9A 3COIA 3EMGA 2O2UA 2UW4A 4ANMA 2RIOA 5J79A 3WZUA 2QOKA 3AC4A 1VR2A 1VYWA 3FZSA 3TWJA 2Z7SA 3PJ1A 1PXMA 3NPCA 1OITA 2WHBA 2ACXA 3OCTA 4WA9A 5LCJA 5K4JA 3L9LA 2UV2A 3AC2A 3UO5A 3ZO2A 4UEUA 4AU8A 5IQDA 2B55A 3HL7A 4BI0A 4N70A 3ZOSA 4KIKA 2HIWA 1OKZA 4ARKA 5AP0A 4FEWA 1DS5A 5AX9A 3PG3A 3NVMB 3I6UA 4GRBA 2C5YA 3PPKA 4PNKA 4FEUA 4IAFA 5HU9A 3SOCA 3WF5A 4D4RA 3BIZA 3A8XA 3DQWA 3MFTA 5DT3A 4L44A 1W83A 5FXQA 5BYZA 5L2TA 3M2WA 3E7VA 3Q9XA 3MDYA 4BI1A 4RVTA 2WTKB 3OTVA 2VV9A 3V8TA 4O7YA 5AP5A 4MXXA 3AMAA 4DH1A 2GNJA 3W2SA 1ZZ2A 4QP4A 5M51A 2I40A 5H3QA 4CFXA 1U54B 4EZ7A 2VWWA 2YM7A 4B8MA 4S34A 1OUYA 1ZYJA 5FWKK 1J1BA 3U87A 2GNLA 4MTAA 3ORPA 5LWNA 1PKDA 1XKKA 4WUNA 3DGKA 2JDRA 4F6SA 3OG7A 4NT4A 2X8DA 5JMSA 2QI8A 2R2PA 1E1VA 3F3UA 3EQFA 3VUGA 5HU3A 5DT4A 4CQGA 1PYEA 2DWBA 3F5GA 4PL3A 2OWBA 2FGIA 3CC6A 3NNXA 3RPSA 3TEIA 4X2JA 4ZZOA 3ZRMA 3C5IA 2PVLA 4YC8A 3TI1A 5CY3A 3KN5A 4JR7A 5IQBA 2YIRA 4QMMA 2QURA 5DEYA 2SRCA 2RFDA 4MD7E 4NJ3A 4H36A 2QLQA 4IZYA 3GOKA 3OVVA 4FSWA 3GC9A 3PXYA 2W1DA 3FYJX 4FSNA 4IJ9A 3UG2A 4OTPA 5CAPA 4U8ZA 3C0HA 3QXOA 2IO6A 3NUAA 3E93A 4YO6A 5HNBA 5L8LA 3BCEA 3UMWA 3CXWA 2WFYA 3HMIA 5KNJA 4XG6A 5M44A 3MH1A 3OOGA 3QAME 3LHJA 5K9IA 1H1RA 5F9EA 4H05A 1Q3WA 2XB7A 2VWXA 3RM6A 3UJGA 3R8ZA 3TT0A 4BDIA 4E5WA 3EN5A 5JFWA 2UW3A 3O0GA 2GQGA 3FMEA 4FTKA 1H00A 3LW0A 4RWLA 2QLUA 1T46A 3QZHA 3TM0A 3ENMA 4G3GA 2XIRA 3AC3A 3GCQA 3HUCA 4PUZA 3WZDA 3NW6A 4NJDA 4K9YA 4J95A 4X7QA 3A4PA 2C5NA 3DZOA 4J7BA 1ZZLA 3OW3A 4GJ3A 3DKFA 4GSBA 4S32A 3FZ1A 4QQCA 2VWBA 5CNOA 5F20A 3DAEA 1X8BA 4NIFB 3WILA 4BYIA 4HW7A 2J9MA 5HO8A 4E20A 4ORKA 1FMOE 2GS2A 5IDPA 2OXXA 3EQCA 5TO8A 4DE4A 1M2QA 4F6WA 3QHWA 3ZZEA 5D12A 2JKOA 3MFSA 4V05A 5EYMA 4YU2A 1B38A 5M4CA 4O27B 4DTBA 5CLPA 3TCPA 1CMKE 3W2OA 4DN5A 3LJ2A 5M4IA 1XBAA 3HMPA 5ANEA 5HBEA 4IFGA 4KSPA 3KMMA 4Z7HA 2OIQA 2YFXA 1SMHA 2XCKA 2J2IB 5FTQA 3GP0A 4NTSA 2W05A 2C0TA 2W7XA 4ZTLA 4F9BA 2V7OA 2R3GA 2CSNA 4I92A 3AGMA 1LP4A 5IQEA 4XP0A 4NU1A 5C8NA 5L6OA 3ZLYA 2BKKA 3RZBA 3ODZX 2OIBA 5CF6A 4YPSA 5JFVA 1H25A 3GB2A 3ZZWA 4CFNA 4O84A 1XH5A 4BCMA 4I4EA 3HA8A 2UW9A 3JUHA 3CD8A 4ASDA 2Q0BA 3F66A 2YM8A 3JY9A 3MPTA 5D1JA 2P55A 2XJ1A 3QGWA 4IDTA 5EYKA 3ZO1A 2DS1A 2XK7A 3CEKA 3O23A 2GCDA 4ID7A 3FPQA 3TL8A 4QQ5A 3F2RA 3UTOA 3OF0A 4HJOA 4LV8A 4ZS0A 3ALOA 4BKZA 3LJ0A 4WSYA 4WNKA 4GFOA 1L3RE 1KE8A 1GIIA 4I3ZA 4QYHA 5HHWA 2EUFB 2WGJA 2OZAA 3FZTA 1P2AA 3PVGA 4NCTA 2QODA 3OW4A 4A9UA 2W4OA 2VAGA 4FA2A 1PJKA 4Y5QA 1H24A 2CGXA 3FV8A 4D2VA 5K3YA 1PXKA 3Q9WA 4RX9A 3C9WA 4RMZA 2GQSA 2VZ6A 3CIKA 4ZSAA 4QOXA 5A46A 2XK3A 3LFFA 3Q96A 5FM2A 2QO2A 4RVLA 2H6DA 2VTJA 4HPUE 3ZRKA 1GIJA 2ZDTA 2B9JA 5AA9A 4FGRA 3FE3A 2XBJA 3ORTA 3OY1A 4IVDA 4GK3A 3BZ3A 4C34A 4F9CA 3PDTA 1FOTA 1FVRA 2VX0A 3QCQA 2RGPA 3P7BA 3QTRA 3UMXA 4O7TA 4QYFA 5CVGA 5AUZA 5HE3A 5C27A 2ZV2A 4GK4A 3NUSA 4L67A 4ACHA 1JWHA 5AJQA 3PP0A 4E5AX 5HE1A 4C33A 2OJJA 3W8LA 4DG3E 4PWNA 4USFA 5C8MA 2CCHA 4WO5A 4EK8A 5HLNA 4BDFA 3VRYA 2BZJA 4F0IA 3Q6UA 2XNEA 4ANSA 1U4DA 2WTVA 2O3PA 5A4EA 2PUPA 2XIZA 4FT7A 4QTCA 3WYYA 4CT1A 3KULA 4AZVA 4KAOA 2ITNA 4L3JA 5KUPA 5CENA 4L01A 4FNZA 5A6OA 3DA6A 1XQZA 5IQGA 4MBLA 2P2HA 1KE9A 2QC6A 2PMNX 5HVYA 4YLJA 4DGLC 2W4KA 4CSVA 1MQ4A 1SM2A 5A54A 1MRYA 2YDIA 3DPKA 4J97A 4YZMA 3GUBA 5CAVA 5HIEA 2UZLA 4M3QA 3F3VA 1OL6A 3NYOA 4FIGA 4ASZA 4E4NA 2VD5A 4F9YA 2VO6A 4A4XA 4APPA 2LAVA 4TW9A 3UQGA 1WBOA 2R64A 2CNUA 3LFCA 4S2ZA 3NDMA 4D1ZA 2CKPA 3IGOA 2PZRA 5B2LA 4G31A 1KE5A 2OJGA 3O17A 3D7ZA 3IDBA 4PP7A 3KVXA 5CI6A 4WG5A 4DEHA 4AA5A 5FUTA 4PX6A 4CV9A 3UO4A 4IANA 5CQWA 4I6BA 1YHVA 3GBZA 4C4HA 5EI6A 3P1AA 5HNIX 1XWSA 3ZDUA 2HCKA 5HI2A 2JDVA 1OKVA 3DNEA 4F9AA 5IQIA 2J5EA 2W9FB 4FX3A 2A4LA 2WQOA 4BGQA 2ETRA 4EK5A 4KB8A 4R1VA 2VWZA 3QHRA 4FSQA 3UVPA 3K54A 2FUMA 4XBUA 5LARA 3JYAA 3Q3BA 5ACKA 5AADA 5CAUA 2BRMA 3O71A 1W82A 3RK7A 2NNWB 5DE2A 4TWCA 4ZY5A 4X6RA 3HMMA 3DLSA 2P0CA 1BLXA 4FK6A 4L9IA 4FGBA 1K2PA 4HZSA 5HTBA 1V0BA 4AT5A 3HMOA 3RK5A 2G2IA 2AUHA 3R02A 5CAOA 4MQ1A 3L1SA 2KULA 4MXAA 4OBOA 1CKJA 4BCQA 3FXWA 4MVFA 3MFUA 4R5SA 1Q99A 2BUJA 4G16A 4CZYB 3CY2A 4HGSA 2RSVA 2W1EA 3P0MA 4O6LA 5AM6A 3VQUA 4AOIA 4YTFA 2XRWA 2V5QA 5CSHA 3BV3A 4FZAB 4FKGA 3ZEPA 2PVHA 5JK3A 3SG8A 2OFUA 5HEZA 3UOKA 3KRXA 3KCFA 3FMLA 5B0XA 4M84A 5AR7A 2PVRA 5EKOA 2XCHA 4AFJA 1JOWB 5F1ZA 4B6LA 4QTBA 3N51A 4Y5HA 5IMEA 4HYIA 2YIYA 2IVVA 3MVHA 5LWMA 2XNBA 4EUTA 3FZOA 2BILB 3LMGA 4R8QA 2C3IB 4ANLA 4CNHA 2YCRA 1XJDA 2WMSA 3ZFXA 4E8AA 2Q83A 3RCJA 2R0UA 4FTJA 3ZO4A 4UXLA 4A4OA 4JBVA 3LE6A 4J52A 4ERWA 2ZMCA 4F65A 3D5UA 4OT6A 3NW7A 5AIKA 1F3MC 3OEZA 2FSTX 2QHMA 4G17A 2NP8A 5H8BA 3ZS5A 3L8VA 3FQSA 2VWIA 3IOPA 4BIBA 2R3KA 3R01A 4AZWA 4RLLA 2J0IA 5LMAA 4UMUA 2BIKB 3F3WA 4KS7A 4QMSA 5EI2A 2Z2WA 5C26A 1OPKA 3SV0A 3HEGA 3I79A 2Y0AA 3Q9ZA 3ZLWA 3IECA 4BTKA 3RHXA 4NH1A 4O82A 4XOZA 4ACDA 3SKCA 2VX3A 4FKOA 4F64A 3IKAA 3Q6WA 3OS3A 4G34A 4LGDA 4W4YA 3VS4A 4F99A 4DFXE 1JSUA 2BAQA 4B99A 3MV5A 3QALE 2V62A 2ZVAA 5ANDA 4DFLA 5CALA 1JVPP 2VNWA 3DOGA 4EQMA 2E9OA 3NYVA 5DN3A 2B53A 3IOKA 2IZTA 4UB7A 1YI3A 3AC5A 1JLUE 2P2IA 3KXGA 2OIDA 4U81A 4WRGA 1P14A 1OL2A 2JGZA 3GCPA 5IEVA 5HE0A 4YZNA 2VTHA 4AUAA 4FV7A 4EONA 2QOHA 5TF9A 3UZRA 5CT0A 5HBHA 4U79A 2PE0A 1MRUA 4KINA 5IISA 2OK1A 4FIEA 4YHTA 5GJFA 5JFSA 2JAVA 3PE2A 4QP9A 3UYSA 3BLRA 4C4FA 3IDCA 2XKEA 3UBDA 1M14A 3WF7A 4E26A 2XM8A 3I0OA 4MNEB 2YM4A 3NAYA 3VS7A 2CJMA 2ZB1A 3R8UA 2PMLX 1Y8YA 4ITJA 4R6VA 3R7YA 4E6CA 2ITYA 2RFSA 4CMUA 4BICA 4UYNA 5CXHA 4GUBA 5J8IA 2REIA 4H3QA 1SZMA 3KMUA 5TKDA 1SVGA 2ZM4A 3EYGA 1JKLA 3GC0A 3W33A 5CNNA 5AUUA 4BDGA 3VBXA 2UVYA 2W96B 5JGBA 3QC9A 5LVMA 5EYCA 4AE6A 3BQRA 3BV2A 4FKSA 5ANJA 3UNKA 1KV2A 5J5SA 5EM5A 2BZKB 2W5AA 3E92A 3LZBA 4X2KA 2B9IA 4M69B 2Y7JA 1PMNA 3VS2A 2V22A 2YLFA 4FSZA 1TQIA 4RA5A 4GG5A 3VS5A 3NVKI 2WTCA 2X6DA 3BRBA 3RP9A 4FSUA 4D2PA 3L9MA 5CU3A 4TWPA 4ASXA 2PVNA 4RIXB 3Q60A 4XP3A 5BVWA 2GQRA 4HYUA 4YSMA 3N4TA 1KE6A 1Q8WA 3B2TA 2C1BA 4QMVA 5FP6A 4F7NA 4RJ8A 3I60A 1APME 2OKRA 3PVUA 4FC0A 1R3CA 1IA9A 4E6DA 1NVSA 4G5PA 2J51A 3A7JA 3BPRA 4YLLA 3MJ1A 4ZTRA 3RNIA 3TZ9A 4C4IA 5IH5A 5E8YA 1IEPA 4MQ2A 4GU6A 2I7QA 1IG1A 2QOQA 3OZ6A 4W4WA 5AUVA 3R22A 3VWAA 4DBNA 2WMBA 3ZLSA 3ORMA 1PRYA 2FYSA 3FI2A 4AGUA 2W1GA 4QMLA 2YIWA 4WBOA 5FTOA 4D2RA 2XIKA 5HTCA 4PP9A 3C7QA 4F6UA 2DQ7X 4XOYA 1YWRA 5F94A 3DDPA 1ZYSA 2F7ZE 2WIHA 3WE4A 4M97A 2FSMX 3BHHA 2QHNA 4ZLOA 2ZAZA 3LMHA 4BB4A 3D7TB 3FWQA 4GFMA 4QMNA 1XBCA 4HGEA 4C3RA 4EYMA 4IXPA 4WD5A 4W9WA 4EHZA 4O83A 3BHVA 2VGOA 2NPQA 3UZTA 2Q0NA 5AP4A 4IJPA 3JVRA 4FVPA 3MW1A 2PWLA 3C4ZA 5C03A 4NM5A 2WEVA 5DGZA 3V6SA 1P5EA 2R3OA 4ZY6A 3GQLA 3FI8A 4M7IA 3PY0A 3OWLA 4K33A 4YJNA 5BYYA 3PA4A 4V0GA 4XRLA 5EDPA 4I20A 3V5TA 2UZNA 3EFJA 3HUBA 5FP5A 3AT3A 1BMKA 4YP8A 3BWFA 4CLIA 5CSXA 3R7IA 3G9LX 2YDJA 4L8MA 4LGGA 3IW8A 4IZ7A 4I21A 5K5NA 3Q4CA 1P4FA 3EFWA 4R3RA 3NUYA 3DB6A 4L53A 3EKKA 2HAKA 3GCSA 5JKGA 3BKBA 1PMUA 3HDNA 4FEQA 4CZUA 4DGMA 2QOLA 5HICA 2BRNA 5M08A 5JZJA 3R9NA 1YXXA 3A60A 2DYLA 4ERKA 2J0MB 3ET7A 4O0XA 4C2WA 4DH8A 3CD3A 3GC7A 5KZIA 2XYNA 3VW8A 4FBXA 3ZSGA 3F3ZA 3WARA 4RRVA 3TKUA 3KEXA 2UZDA 3EHAA 3FMHA 2BHEA 4U80A 2GDOA 4A7CA 4RGJA 2EU9A 3SQQA 4BI2A 2BDFA 2XNOA 5FBOA 5EQYA 2ZB0A 4E6QA 4KRCA 2XJ2A 4LRKA 3GENA 5C1QB 4EK3A 3QLFA 4FKIA 4TYHA 5IH6A 3RBWA 3RAKA 4G5JA 5JQ5A 2OW3A 5CVFA 3V3VA 2A0CX 1XH6A 5CU6A 4QRCA 2R9SA 3BE2A 1RJBA 3TZ7A 1CSNA 4ZTMA 2HW6A 4X3FA 4LYNA 2BIYA 4D2SA 4PPAA 5L3AA 5BUIA 1P4OA 3ZXZA 4Z3VA 5D7VA 3TJCA 5GIOE 4ZSLA 2C5OA 1XH9A 3QTIA 5LMKC 2FSLX 3SA0A 4JQEA 5K0XA 2J6MA 3EL8A 4JS8A 4PTCA 3R7EA 4OBQA 5BYLA 3REPA 4C3FA 1S9IA 4ITIA 1OMWA 2UZEA 1Y6AA 2BZIB 3R73A 4HPTE 4YNEA 3CPBA 5H2UA 1VEBA 4FTRA 3NNWA 5DLSA 3R6XA 3V5QA 4NW5A 3R0TA 2GHGA 4FF8A 3LMIA 4C37A 3S1HA 4FTTA 2W9ZB 1WBSA 4OR5A 2B54A 4QT1A 3CS9A 5FM3A 4F7SA 3PIYA 4DEDA 5M57A 2CDZA 4C4JA 2F7EE 2HK5A 5IMXA 3COHA 4Y85A 5AP3A 3UGCA 3QD4A 4YJTA 4HVSA 4HVHA 4XHKB 1XBBA 5HIDA 3W55A 1PW2A 2HY0A 4WG4A 4RWKA 3Q4TA 4FUXA 3O7LD 4QMZA 4TWNA 2OBJA 3ZM4A 3AC1A 2F49A 3BBWA 1OPJA 5AP7A 4ZK5A 3RPRA 2YWVA 4KIPA 2JIIA 2YABA 3MH2A 4TKSA 4ZTQA 5EW8A 4BCFA 4C59A 1H07A 3G0FA 3EN9A 4O38A 1OIQA 4RWJA 1R0PA 3PY1A 5ANGA 1R1WA 3ZDIA 4JX3A 2VRXA 3C51A 3V04A 4RX8A 3QGYA 4RWIA 5ETCA 4GCJA 2QO9A 3R9HA 2EXCX 4M68A 3A2CA 3NUUA 3R9RA 1REKA 5DNRA 5GINE 3DFAA 1RW8A 2BDWA 2PHKA 2B9HA 3T9IA 1SVHA 3SRVB 3VVHA 1ZMWA 2EB3A 4C0TA 5KHWA 1ZLTA 3C1XA 4D2WA 2RKUA 4QMPA 3GU5A 3PYYA 3RNYA 1Y6BA 2ITPA 4N6YA 3RI1A 3FC1X 3R9OA 4CFWA 4KS8A 3BYMA 5AAFA 3WZEA 4CGAA
chains in the Genus database with same CATH superfamily
4FV9A 4ENXA 5J1VA 4KA3A 3W0SA 1KWPA 3EOCA 4IMYA 1LPUA 2X39A 3JPVA 4K1BA 3VQHA 1ST4A 4O7WA 2NO3A 2PY3A 3OCBA 4EZ5A 3OTUA 5IH4A 5HLWA 4MAOA 3ZUTA 5A4TA 2QR7A 4QP3A 3PIZA 4ZJJA 4HCVA 5I0BA 2P33A 4D55A 2J0LA 3NEWA 5BVNA 5CZHA 1U5QA 5I9UA 4PMMA 2BHHA 3LFQA 3KGAA 4W4XA 5D10A 3WIGA 4FV5A 1NXKA 3DJ7A 5E8VA 4ACCA 3N9XA 1W84A 3NGAA 4UYAA 2QOBA 2XK9A 4CKIA 4HGLA 3U6JA 1CTPE 4FNXA 3MFRA 3NLBA 1AGWA 4JIKA 2Y9QA 3AKKA 3PTGA 4IWDA 2Z7QA 4BJJB 4DGNA 2JFLA 3BU3A 4WNPA 4EUUA 5I9ZA 2I0VA 3ORKA 4A4LA 1NVQA 4MH7A 2YJRA 4CFMA 4EC8A 1U46A 5I9XA 4H58A 4X2GA 2C5XA 3OUNB 3QQKA 2WQNA 1IASA 3FHRA 3NIZA 4C61A 2QOCA 2W1CA 3LFAA 2ZV9A 4EH7A 1YOMA 3AGLA 5FD2A 3SW4A 5E8SA 3NNUA 4MHAA 2WTJA 3OP5A 3P86A 2XEZA 3FI4A 4J96A 2HXQA 3VUKA 4GKIA 5KO1A 5HOAA 5LJJA 4PMPA 2YCSA 2QKRA 4OUCA 3VONA 2X2MA 3KXXA 5CU2A 3NWWA 5AWMA 3MJ2A 1KV1A 4BBEA 3KREA 5JRQA 4H1MA 4IFCA 4BDEA 4YUQA 4DFBA 4JVGA 4YJSA 3D15A 4ANOA 4B4LA 3FXZA 3R8LA 5H9BA 5L8JA 2ZV8A 4BDAA 4O1OA 4KSQA 4F1TA 5F95A 4AS0A 4KUJA 3W0PA 2PMOX 2OI4X 5KE0A 3THBA 4IM0A 3BL7A 3KVWA 4FL2A 4YPDA 5IA3A 5J9ZA 3LCOA 2VWUA 4AAAA 4QPAA 2IJMA 4WT6A 4I6QA 4O91A 4F70A 4QP2A 1NVRA 1YW2A 3QFVA 4FT5A 4FZ7A 4GL9A 4GUEA 4A9YA 3AT4A 5IPJA 1F0QA 4FOBA 4FIJA 4GEOA 3QC4A 2G2HA 3HV6A 4MBJA 5CYIA 5HD7A 2R3JA 5CSPA 3P9JA 3OCSA 5AUYA 4BIDA 2PZPA 2YN8A 3FY2A 2HZNA 2QD9A 2XZSA 1YDSE 3MSSA 3DDQA 4KRDA 2PK9A 4K2RA 4QP7A 5FDPA 4M67A 4E4MA 2HENA 4O2PA 3MVLA 3BYOA 4ALVA 4LRJA 4FKJA 1U5RA 2E9VA 3GFWA 3IW4A 3O8TA 3U4UA 4QPMA 4RG0A 2R3NA 4KIKB 3GVUA 2JDOA 1UVRA 3FKOA 3DAJA 1ERKA 4M14A 2YAAA 4YLKA 5KBRA 4ASEA 4D4VA 3PWYA 5JGAA 3VNTA 4FIHA 3A99A 4BCKA 2CKOA 3LLAA 3LCSA 4ZEGA 1L8TA 2DUVA 1LUFA 2WTWA 4YR8A 1H1PA 4YGAA 4CMTA 3PA5A 3O2MA 4ITHA 2XKCA 3EWHA 4NCTC 5ANKA 4FSRA 3SC1A 2UW6A 3DKOA 3FLNC 3JY0A 2IVTA 2XK6A 3LFDA 3QUPA 4FSYA 4LUDA 4NEUA 3O8UA 3G2FA 5HO7A 3HP2A 2BTSA 2C3LA 3VHKA 2WELA 5HCYA 4BDJA 5EKNA 4JNWA 5FRIA 4AN2A 5BMSA 3R21A 3LFNA 3L8PA 3C0IA 4FUYA 2C6EA 4NFNA 1FVVA 3TDWA 2XM9A 3D9VA 1UA2A 3EKNA 3ZO3A 3BGPA 3GT8A 1BKXA 4FV8A 3TUBA 3DNDA 3AQVA 1HCLA 2Z8CA 3GC8A 4FV6A 4XV9A 5AR5A 2YM6A 4GKHA 1GNGA 3CTHA 3FLZA 4CV8A 4B7TA 4OTGA 5KHXA 5CEIA 4JG8A 4I0SA 3F5XA 4O7NA 2PU8A 4DTKA 2WQEA 3S0OA 2W5BA 3K5VA 4XV3A 3HRBA 4O1PA 3QRJA 4RLKA 2C47A 4A06A 2Z60A 3ORZA 3UZPA 4DITA 3QUDA 5ETAA 2ONLA 4AACA 3LQ8A 4IACA 4U0IA 1UU3A 2P3GX 3QZIA 4FOCA 4G9CA 4P7EA 4TYGA 3CQEA 2X0GA 4BCIA 1WBPA 4C7TA 5E8UA 4DF3A 4NKSA 2O64A 4IAZA 2XKDA 4D0XA 3FMDA 4AP7A 1A48A 2X0QA 3F69A 3UVRA 5CEQA 3MB6A 3H0ZA 1V0OA 4FL3A 4PTGA 3W2QA 2PVKA 5AV1A 3UOLA 3UPXA 4ANQA 1H4LA 2YITA 3DZQA 2HZIA 2JAMA 3R9DA 2UUEA 2WTIA 3SHEA 4QYYA 2R5TA 1UU7A 1W0XC 3GEQA 2BZHB 4O4DA 4PV0A 4BBMA 3LAUA 4J8NA 4LM5A 4G3CA 3ROYA 5I5ZA 1GJOA 4L6QA 5CU0A 4RJ5A 3ZXTA 3RWPA 2CGUA 2GFCA 3DS6A 4HGTA 3UOHA 3E64A 3SDJA 4XG7A 2BVAA 4YJOA 4AT3A 3EZVA 4CEGA 2ITOA 4FEVA 3IK3A 3D2IA 1WVWA 4R7HA 3O96A 3LCKA 4IB3A 4FKPA 3PVWA 4RX7A 5GIPE 3NUNA 4G2FA 2PUNA 4FVRA 3TTIA 5E4HA 4RQVA 2QQ7A 2YM3A 3CJGA 4L7SA 3BYVA 3PJ3A 4M0ZA 5CQUA 4OTWA 3VRZA 1BYGA 2GTMA 4MF0A 1H0WA 4YTHA 4TN6A 3LM5A 2XRUA 1TKIA 3ZMMA 2XBAA 4FODA 4JIAA 3JS2A 2JEDA 5B2KA 4ACGA 4F4PA 1Z57A 4CVAA 2W99B 4HNIA 3NNVA 4AN9A 4QPSA 4CLJA 4BDKA 3HA6A 1GOLA 4WSQA 3ZONA 4EHGA 3FLYA 5E92A 4MKCA 2G2FA 4GVJA 1NT2A 4EH2A 1I09A 4AZEA 1PMEA 5KMNA 4FL1A 5KX8A 1JSTA 1UNHA 3PRIA 3U8WA 4FTMA 4U43A 1OECA 5BNJA 1REJA 3QCXA 4ZXTA 3DTWA 4QQTA 1SYKA 4O7VA 2ITWA 5E90A 1YKRA 1RDQE 3E8CA 3FKLA 4HZRA 4BDBA 4Y73A 2IVUA 2IZUA 2UZOA 3SG9A 2ZM1A 1XMMA 4MWHA 3QTUA 4RIYA 2Y4IC 3OWKA 5LCKA 4QP1A 5HORA 4I5HA 4GT4A 4FKVA 3DLZA 3HDMA 3OWPA 5HX6A 4BZDA 3PY3A 5BVOA 1RE8A 2OZAB 3K2LA 3GCUA 1Q62A 4LRMA 1Y8GA 3AKJA 4M0YA 4C02A 5BPYA 1YI4A 5AP1A 1QPEA 2WB8A 2JBOA 1Q3DA 3SXFA 4O96A 3VF9A 3OT8A 4X0MA 4YZ9A 5AM7A 4GYIA 4BGHA 1M52A 1LEWA 3S2PA 4FKTA 1M2RA 1ZY5A 2X2KA 4RVMA 3QD3A 2O65A 4M8TA 1OB3A 2VUWA 1K3AA 4IZ5A 2GNGA 5GHVA 3TV4A 1V0PA 2WMVA 4UMRA 1IRKA 3GXLA 5DI1A 5AUXA 1NW1A 4CKJA 5GZAA 4EKLA 4FK3A 3OHTA 3KY2A 4Y8DA 3PXRA 3OCGA 2R3IA 4QP8A 2BPMA 3OFMA 2F57A 3MBLA 4JRVA 1UU8A 2F2CB 4I5MA 5EI8A 5FEEA 3VHEA 5C9CA 4CQEA 4RBLA 3KK8A 4O0VA 3G90X 3F7WA 4ZZMA 5DR9A 3AD6A 2FSOX 2WMWA 4O7ZA 2W06A 1EH4A 3BGQA 3MB7A 4EH6A 2WMAA 1VYZA 5IQCA 4GIIA 3M42A 1YVJA 3FLQA 3PE1A 4O7RA 3IQ7A 3GGFA 3P5KA 2WMRA 5TOZA 2PVYA 3KULB 3N4UA 1GZNA 3Q53A 4O0WA 3FLWA 4EQCA 2Y4PA 3BQCA 4F1OA 5HESA 2B7AA 1BL6A 2E9UA 3MWUA 3FEGA 4FTLA 5GJDA 1AD5A 2ERKA 2PE2A 2PYWA 3NYNA 5D41A 1F5QA 1WBNA 3GQIA 4TYEA 4W8DA 2H34A 3O8PA 4DGOA 3DBEA 4FTAA 2ZFYA 4D1XA 5M53A 5HG8A 3RPVA 4DHJA 4FYOA 3U54A 3EQBA 3CGFA 2VTSA 3RVGA 1SNXA 3I4BA 5FTGA 5DYJA 2XALA 5C01A 3DXPA 2YHVA 4M13A 3U9NA 5ICPA 4JBOA 2PTKA 4YZBA 4ZTSA 3FAAA 2CMWA 3GU8A 4DINA 2JIVA 4ZTHA 4WNMA 4IZAA 5EFQA 3F6XA 2QOOA 3E8NA 3G9NA 3OXIA 4EHVA 5HLPA 4USEA 3I5NA 2NYAA 4BCHA 2PZ5A 2JITA 3V6RA 1JKKA 1YI6A 4X6QC 4EH8A 4D9TA 1BX6A 3MA6A 5ACBC 1FVTA 4IAAA 5CZIA 4PPCA 3VUDA 3HAMA 3NSZA 3BU6A 2QO7A 3TNPC 5IA0A 4HCTA 2Y8OA 3QD2B 2WTDA 4TPTA 2YZLA 4CFFA 1YXSA 1URCA 2H9VA 3FL5A 4FKRA 5DHJA 3LXPA 3UIMA 4ZLYA 5GZ8A 5DR6A 2UW0A 5EW9A 2G1TA 4P4CA 2QG7A 1QPJA 1CKPA 4ANNA 3K3IA 3EQRA 3KRWA 2CKEA 4YJPA 5DPVA 4Q9ZA 1YXVA 4EYJA 3DBFA 4HVGA 3ZRLA 3QLGA 5CF5A 2WQBA 4TWOA 2ERZE 4U6RA 2X9EA 2PZIA 3QQJA 4CTBA 4QMWA 4X3JA 2Y4IB 2HWPA 3MY1A 4TTHB 3HZTA 3VBTA 3HNGA 3UO6A 3W32A 4ALUA 4K18A 5D7AA 5JH6A 4DFUA 1Y57A 4R77A 5BV3A 3UIXA 2X0PA 4S31A 4IM3A 4OTRA 1B6CB 4K0YA 4RIWB 3ORNA 5CI7A 4ZTNA 1Z5MA 4JX7A 4YO4A 4BFMA 4TYIA 4IWOA 2OH4A 3HGKA 4C38A 4NSTA 4IX5A 3NS9A 4AN3A 2VGPA 3CTJA 3ZM9A 2G15A 3IW6A 3QTXA 3ANQA 2O63A 1TVOA 3FL4A 5EQPA 3QX2A 3EQDA 3ETAA 2YISA 3CKWA 2VTTA 5IUHA 4AA4A 2GSFA 5AA8A 3W2RA 4M15A 3VBVA 4OTIA 5J95A 4EI4A 2R3LA 4UXQA 4AW5A 1NY3A 2X81A 3DTCA 5FDXA 3KK9A 3G51A 5L2WA 3S95A 4UZDA 5KMMA 2PUIA 2A1AB 4LOPA 4GK2A 3EQPA 3DBCA 2HELA 3BLHA 3HX4A 3MS9A 3NZ0A 2ETMA 4GG7A 4AOJA 5IQFA 4AXAA 1J7UA 2OGVA 3C4CA 2VTQA 3V5JA 3LQ3A 1OL5A 4O0TA 3ORLA 4EH4A 4EHEA 1KOAA 3HKOA 5CT7A 4EBVA 4PDPA 2FB8A 3QBNA 3TUCA 2EB2A 4D0WA 2A19B 2RG5A 4R7BA 4I23A 3BI6A 4U41A 4D4SA 4EK6A 4QTEA 3TV7A 2XMYA 1OBDA 1OGUA 3D94A 3RK9A 3DXQA 2YIXA 4MXZA 3CSVA 4PF4A 4XEYA 4WOVA 1QPCA 4YMJA 2XEYA 2HZ4A 4J8MA 5AV2A 3UNZA 2OFVA 1DM2A 2JKKA 4QMTA 2GNFA 1Q8TA 5FXSA 2J4ZA 3TZMA 4IVAA 1XH7A 1UNGA 4X21A 2PVJA 4IE9A 2GTNA 3TJDA 4RZWA 5DRBA 3Q52A 2W4JA 5HNGA 4IWPA 4RFZA 4LL5A 5T68A 1H27A 4ZIMA 3EN6A 4IW0A 4O22A 3COKA 5HQ0A 3ATTA 4FEXA 3OOMA 3KA0A 4PY1A 1GIHA 4BF2A 5HTIA 1TQPA 5EOBA 4OGRA 3UDZA 1YWVA 4F78A 1JQHA 4IM2A 1G3NA 4I4FA 1UKHA 3C50A 3TNQB 4TNDA 4IVBA 5EDRA 3PXQA 5EH0A 3E7OA 4NUSA 4Q5EA 2IN6A 3PA3A 4J99A 4CYJA 1XR1A 4EOLA 3W0RA 4D2TA 3C0GA 1NA7A 2YAKA 4BRXA 1QCFA 1DAYA 4JDHA 4WNOA 4EK4A 4FKUA 3ZH8A 2ITTA 2QU5A 1ND4A 4NM3A 3ERKA 4XP2A 5E8TA 1UWHA 3HLLA 4L3LA 4EJ7A 3ZBFA 4AA0A 4CT2A 2RFEA 3JVSA 4F09A 4I41A 3D2KA 4AF3A 4AG8A 2FA2A 1WCCA 3G6GA 3MVJA 2GPHA 3U9CA 2G01A 5KMLA 1PKGA 3H9RA 3BX5A 2ITVA 1W7HA 4RJ4A 4ZMEA 2C4GA 4JQ8A 3RPYA 1H1SA 3AD5A 2X9FA 3I7CA 4I24A 4TRLA 3JXWA 4W4VA 1SNUA 3HV7A 5AR2A 3R1NA 3ENHA 4MBIA 4XS2A 2OXYA 3R83A 4EH3A 5HG5A 2CKQA 2F4JA 3HP5A 4BVUA 2BALA 3WZKA 2JFMA 4F63A 2JKQA 4RT7A 5DRDA 5FEDA 4H3PA 3PLAE 2BAKA 4TT7A 2CLQA 4FT0A 3TNIA 3P08A 4DC2A 4G6OA 1J1CA 5ANOA 3VF8A 3GI3A 1ZXEA 2OJIA 3ML1A 4X3FC 3H9FA 5KZ0A 3RHKA 3TNHA 4MWIA 1ZYLA 2UZBA 5J87A 3IS5A 4G1WA 5DVRA 4QMOA 4E6AA 5HVKA 4OTFA 1S9JA 3E8EA 4V01A 3EYHA 4E4XA 3CTQA 2VX1A 1STCE 3RAIA 2HZ0A 3O51A 3SD0A 3KMWA 4DLIA 1OIUA 4K6ZA 3HAVA 3ZSHA 4E7WA 3GCVA 5H8EA 3R04A 2CNQA 5ITAA 3OXZA 5IA5A 1CDKA 3DAKA 2OG8A 3OWJA 2ITXA 3FC2A 4LFIA 1FPUA 5BQ0A 3DCVA 5AIRA 2YJSA 3AMBA 3ODYX 3ACJA 1QPDA 4DGGA 4YNOA 4QYEA 1ZOHA 5J5TA 4OW8A 3WI6A 4XH6A 1O6LA 4O0SA 1W2DA 2EXEA 3KF7A 3KRJA 2X8EA 4CMOA 3FYKX 3VUMA 5CEKA 3DT1A 2VWYA 3FHIA 4G6NA 5I9WA 3GU4A 3FMKA 3LFBA 4BKJA 3QYWA 1OI9A 1WAKA 3BL9A 2ZJWA 4Z55A 4DLJA 5JSMA 1G8AA 1VJYA 1ZY4A 4PL4A 3QTQA 2W17A 1K9AA 2GNIA 1ZRZA 2HOGA 2ITQA 2XNNA 3W2CA 3R8VA 3P78A 2I1MA 4XYFA 5A14A 1ZMVA 3RGFA 4LI5A 2BRHA 5KBQA 4JAIA 2VTMA 2X7OA 2YCQA 2OF2A 3FZPA 4V0GB 3TXOA 4RJ7A 4RJ3A 5J7HA 4KBKA 2QCSA 4YTIA 3V5LA 4JI9A 4U44A 2UW7A 2JIUA 3S3IA 3FJQE 1OZ1A 5M4UA 2X4FA 4FI1A 3W0QA 4E4LA 4XG8A 1J7LA 4BZNA 1XH4A 5EOLA 3QTZA 3VUIA 4ACMA 4MXYA 4YJRA 4JG6A 4AE9A 3VBYA 2GNHA 4KIOA 3LJ1A 4I1ZA 4QYGA 4AZFA 4JL9A 2XIYA 5BUEA 5C8KA 5JFXA 3FMMA 4K11A 4XCUA 2OJFE 3P4KA 4D5HA 4G3FA 3MVMA 3I7BA 3UODA 3CPCA 1Q24A 4XG4A 3NX8A 4O0RA 3FSFA 5AP6A 4DH5A 4YSJA 3VAPA 3PXFA 5CAQA 5AX3A 1XO2B 3F7ZA 4N6ZA 3R7VA 5EDQA 5HZNA 4BTMA 2YM5A 3ZFYA 1FGIA 3BEAA 2J7TA 3U4WA 4MUQA 3POZA 3II5A 4XBRA 4YBJA 4WG3A 5DWRA 3QUEA 3ZYAA 2XNPA 2VTNA 4AQCA 3L8SA 4Y83A 3BLAA 2GHLA 3TDVA 3R2YA 2WU6A 2OJ9A 3A8WA 5B2MA 4D4YA 1KOBA 3QKMA 4N4SA 3T8OA 2BROA 4CG8A 4FTIA 4FV0A 3WE8A 4KBCA 4LOOA 3CGOA 4K8AA 2IZRA 4BCOA 4LMNA 5LVPA 2BDJA 3TUDA 3ID6C 3ELJA 2RG6A 2XJ0A 3EIDA 3LM0A 1U54A 3F61A 3F88A 3EN4A 3L9NA 4JRNA 2B52A 2W1ZA 4KWPA 5B7VA 3AC8A 2ZOQA 2R7IA 2X7GA 4HNFA 5AUWA 2LGCA 3RALA 5I3RA 4D58A 2AC3A 4Q5HA 5IUGA 1HOWA 4IAYA 3KU2A 3PJ8A 1FQ1B 3P79A 1YWNA 3K5UA 1OM1A 4MD8E 3HRFA 1YDTE 5BUJA 5I9VA 5J9YA 1W8CA 2OO8X 3EL7A 3SAYA 4IEBA 5LOHA 1A9UA 2JC6A 4C8BA 4O4EA 2YDKA 3WIKA 4BWPA 4KNBA 2IWIA 3BBTB 3EQGA 4RFYA 3ZEWA 4DH3A 3W0MA 3P23A 2BRBA 2AYPA 2HXLA 5ETIA 4E73A 4L00A 2X6EA 4QMUA 3RPOA 3OT3A 3N4VA 5IQHA 4AZTA 1H01A 5BVKA 3H9OA 2ITUA 3NW5A 3MIYA 5IQAA 3A62A 3TZ8A 2PSQA 3NUPA 3G0EA 3ZTXA 4BHZA 4F0FA 1JSVA 3EQHA 3MESA 1H28A 2JD5A 3QRUA 3WF9A 4I0RA 4JXFA 5CASA 3I81A 3OD6X 4DA5A 1H0VA 3LPBA 4IC8A 4YHFA 2XIXA 1MUOA 3UYTA 3R63A 4YURA 3Q5IA 3VIDA 2CPKE 2ZDUA 1R0EA 3ZC5A 4OAVB 2I0YA 3DQXA 3NRMA 5E7RA 3QA8A 2A98A 2QU6A 4NZWB 4C4EA 3P7AA 2UZUE 3BYUA 2C1AA 2YIQA 3PZEA 2CLXA 4II5A 5L8KA 4NIFA 3TKHA 1IAHA 1TFFA 4S33A 3ZC6A 4GW8A 5IG1A 2C30A 4N0SA 4ZSGA 1PXLA 4ZLZA 4FZDB 1YRPA 2BFYA 3IDPA 4DHIB 3HV4A 2YEXA 3KRRA 4JOAA 2XP2A 4O21A 4RJ6A 3GU7A 4UALA 3EN7A 3VC4A 4FKLA 4J53A 3QWKA 4L68A 4L52A 4RVKA 3UP7A 3E3PA 5E1EA 2V55A 4D9UA 4EOOA 4NM7A 2QNJA 1PXIA 2WKMA 2WMXA 5AV4A 4WKQA 2J0JA 3H30A 5JQ8A 1H26A 5A4QA 1G8SA 1G8JA 4X2FA 3UG1A 5IA2A 1Q61A 3FZRA 3T3UA 4FKWA 3TIZA 1Q8UA 4EBWA 4C57A 2PPQA 1H08A 2YCFA 4FT9A 1WBVA 1M2PA 4PMTA 3R7OA 4YJUA 4CZTA 4DEEA 4F1MA 2WU7A 5FEQA 3QX4A 5AV0A 4LV7A 1ZARA 3F82A 3PSCA 4GH2A 5AP2A 5G1XA 5G6VA 1OUKA 2CN5A 3F5UA 5M09A 4PDOA 1YHSA 5KMJA 5H8GA 3UQFA 5DFPA 3O5AA 5AEPA 5CSVA 5CEMA 4PDSA 5K0KA 4IADA 3UC4A 1LR4A 1OPLA 4KKHA 3ZHPC 1FBNA 1OIRA 1E9HA 2C0IA 1TZDA 2PMIA 4RA4A 4BWXA 4UV0A 4HVDA 3I0QA 4EH9A 4HYSA 3D4QA 3FI3A 2QOFA 4BTFA 2FVDA 2NRUA 1ZYDA 3MGYA 4PPBA 3O7LB 5ANIA 3DJ5A 3FMJA 3VBWA 4BL1A 3JR1A 2Z02A 1Q4LA 1GZOA 4I22A 4Q9SA 3UPZA 3LLTA 3EH9A 3KC3A 4FNWA 3F2NA 2VU3A 4U3YA 5DA3A 5FLFA 4BC6A 5M56A 4I5PA 1MP8A 1Q8YA 3ATSA 3UDSA 4Z7GA 2W1HA 5DMZA 3QL8A 4FV3A 3MPAA 5CVHA 2Y6MA 4I5CA 1YXUA 3HRCA 4BCPA 2OU7A 4OLIA 2ONLC 4EORA 2JLDA 3A7GA 3G33A 3KIOC 1VZOA 2PULA 2IZSA 4NM0A 4H39A 2XAMA 3W0OA 2C6OA 4JLCA 4O6EA 3LXLA 3CKXA 1QL6A 2C6DA 4Z9LA 4DFYA 3EJ1A 5HVJA 3QZFA 3C13A 2VTLA 4JQ7A 3RAWA 4CRLA 2CGWA 4U5JA 5CSWA 4CG9A 1GZKA 2ZV7A 4U9AA 1J3HA 4FKQA 3TNWA 3W1FA 5L2IA 4NWMA 3E5AA 3PIXA 5FG8A 3LVPA 3RKBA 1UKIA 3WF6A 4IB5A 1OKYA 4I0TA 5IEXA 1LEZA 4BDDA 4LL0A 4AFEA 4BN1A 4J1RA 5CWZA 2QVSE 2CNVA 3NUXA 4F9WA 3RM7A 4KABA 5CU4A 3VS3A 2X8IA 4MXCA 2YA9A 3EFLA 3R7GA 3EB0A 1A06A 5FBNC 3Q32A 2WMQA 5DG5A 3FDNA 5AV3A 3LXKA 4BZOA 2WMUA 3PSBA 4Y95A 4EOQA 3D14A 5JT2A 3CR0A 4TZRA 5AAEA 2J90A 3ALNA 3KQ7A 5E9EA 4HOKA 4TNBA 3G6HA 4TY1A 3OROA 4UMQA 3ITZA 4JBPA 4QP6A 3VULA 4BCJA 4D28A 3PWDA 4IX6A 1H8FA 5DR2A 2W1IA 3ACKA 4WHZA 4B8LA 4OTQA 5A3XA 4CKRA 3R28A 3AXWA 1Z9XA 3D83A 3PJCA 3V5PA 4RZVA 3WOWA 3PXKA 5EM6A 3D5XA 2BFXA 2IG7A 1PXPA 4FVQA 2J50A 3UVQA 4M66A 5T6KA 3FSKA 3QQFA 3LFEA 4AWIA 5AMNA 2OF4A 5A9UA 4UWBA 4KD1A 4MEDA 5M55A 1YOLA 3TKIA 3KXHA 3R8PA 3DFCB 5GJGA 1MQBA 4L3PA 4NKAA 4ENYA 3E62A 5KKRC 4UBAA 3DKCA 2ETKA 5BX0A 2XANA 2BTRA 2C0OA 2J5FA 5JZNA 4L45A 5EHLA 4YTCA 4IHPA 4RC2A 4AW0A 4UMPA 2F2UA 3NCZA 4R3PA 4EH5A 5AUTA 3HECA 3GFEA 2ZMDA 4WRSA 4DEBA 2QOIA 4QTDA 2WNTA 3KFAA 1R78A 3QU0A 5DT0A 3DY7A 4ZMFA 1W98A 4UX9A 2C69A 2R3RA 4GFGA 4FYNA 2R3FA 4FV1A 3HMNA 4W8EA 4CXAA 2HYYA 3ZLXA 2E9PA 3MI9A 3PVBA 4IB0A 4PQNA 4IVCA 5E91A 1YDRE 4GIHA 3QYZA 3IG7A 3MH0A 4XMOA 3QZGA 4D5KA 5LVLA 4BWKA 4ZOGA 5E8XA 1MRVA 4NYEA 3F2AA 1PYXA 3COMA 4E5BA 2GS6A 2IF8A 5KMKA 3WBLA 3Q4UA 5E8WA 4FV4A 3RINA 4GYGA 4IAKA 1XH8A 3PLSA 3C4FA 4FZFB 2A2AA 4ZJIA 4X2NA 3ZUVA 3FBVA 3U6IA 4IX3A 3SVVA 4GS6A 3B2WA 3HVCA 3E8DA 4RSSA 2O8YA 3PUPA 3EFKA 4DHZA 5IKWA 2WZJA 3I1AA 4FG8A 3MY5A 4LMUA 2X2LA 3WYXA 4JR3A 5CEPA 3E87A 3NYXA 1CKIA 4DYMA 5JGDA 3RMFA 4M12A 2JKMA 4GU9A 4PTEA 1JAMA 2IPXA 5BVEA 1UV5A 2E2BA 5AR8A 3QWJA 4TL0A 5L6PA 3NFGB 3CLYA 4U97A 1DI8A 2O0UA 4DEAA 4XG3A 3SXSA 3D0EA 3DV3A 2GU8A 5M06A 2R7BA 1PMVA 3O50A 4OBPA 5J9LA 2XNMA 4NK9A 3OEFX 5D9HA 3RZFA 1G5SA 4R1YA 5L6WL 4ZAUA 3TG1A 4A9RA 3DKGA 1PY5A 1O6YA 3H4JA 2XARA 4UY9A 5CF8A 2UZWE 3MYGA 4FIIA 1ZAOA 2I0EA 3W10A 3F5PA 4GT3A 3OXTA 1UU9A 4HCUA 1XMLA 4EKKA 4Z16A 3NAXA 3E88A 3W8QA 4P2KA 3V8SA 1FGKA 1PXOA 3UE4A 3VW6A 5T3QA 1JKTA 4IBMA 5I9YA 4BDHA 5I4NA 1ZWSA 3B8RA 1GAGA 4QMYA 4GT5A 5HCXA 2VWVA 3CE3A 4A9TA 2C68A 5HX8A 3UC3A 2I6LA 2C6LA 4ANBA 1M7NA 3BLQA 5AR4A 3SX9A 5EK7A 3PFYA 3UDBA 1H1WA 1T45A 3L9PA 4RC3A 3IW5A 4C4GA 3UP2A 3EQIA 4AGWA 3PRFA 3BELA 5TE0A 5IDNA 3ULZA 4LV5A 3IPHA 3VS0A 4DH7A 4R7IA 3NCGA 4H3BA 5C4KA 4U45A 4RIWA 3Q4ZA 4J98A 3R1SA 5CF4A 4MNFA 4MD9E 5DBXA 4C62A 2KTYA 4RIYB 2FO0A 2VTAA 1Q8ZA 5KKRB 2BKZA 3P7CA 3OY3A 4KBAA 3H10A 4RFMA 1SVEA 1KUTA 3DK3A 4YC3A 1ZMUA 5A4CA 5M07A 4FR4A 4EZ3A 4XG9A 2J0KA 4P5QA 4FTUA 4FV2A 5FGKA 1M17A 4UWCA 1E1XA 3BEGA 3DK6A 4R5YA 3WZJA 3F3TA 1HCKA 2WOUA 3KL8A 5DH3A 2C3JA 3RAHA 3SGCA