4HPTE

Crystal structure of the catalytic subunit of camp-dependent protein kinase displaying complete phosphoryl transfer of amp-pnp onto a substrate peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Phosphoryl transfer by protein kinase a is captured in a crystal lattice.
pubmed doi rcsb
source organism Mus musculus
total genus 100
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hptE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hptE02
2Y8OA 3ANRA 1IAHA 3B2WA 4KAOA 1FVTA 4D2PA 3ENHA 5FXQA 4TNDA 3RAHA 4HNIA 1YHWA 4S31A 4FNXA 4PP7A 3VF9A 2NNWB 4NYEA 3G90X 4I41A 4S32A 5CAOA 4PMTA 3DNDA 4KSPA 4QMXA 1GY3A 4WO5A 4K8AA 4F9BA 2VWXA 4W4YA 4FIEA 5HQ0A 5A6OA 4H39A 3OY3A 4DEEA 3FHIA 4RBLA 3VS4A 3G5DA 3KN5A 1KWPA 1NA7A 4F7SA 1KSWA 3A61A 3MFSA 5A3XA 1QPEA 3QWJA 2BIYA 5BNJA 2FH9A 3U9CA 3Q53A 3P7AA 5AUZA 5JFSA 3O7LD 3PXFA 5GIPE 4O83A 5IQAA 1UU8A 3KRLA 3IW8A 3ZUTA 3ETAA 4XOZA 2F57A 3QRUA 5EOBA 3PJCA 3QZGA 1KE5A 4TW9A 4E6CA 3LXLA 2YM4A 2Z7RA 4YZMA 5GINE 3BI6A 4CKIA 4I1ZA 4G3GA 3VS5A 5AR3A 1VR2A 4YJQA 5B2KA 3R9DA 5C1QB 4E4XA 3U6HA 3NUXA 1OBGA 3BPRA 3WE8A 3L9LA 2XBJA 4WUNA 1I44A 4N70A 5AM6A 5EM6A 2EVAA 3NSZA 4BWXA 3RPRA 4YSJA 4YPSA 4OTIA 3WI6A 2HXQA 2PE2A 4L7SA 3DPKA 3VBVA 3FUPA 4XMOA 3VUIA 3LCKA 2ZV2A 3HVCA 3FWQA 4AW0A 2QR8A 5GZAA 4BDCA 4FZAB 2R3KA 5C8KA 4QPMA 3UOLA 4FIIA 2LGCA 4YJSA 3UP7A 5JK3A 3D7ZA 2VZ6A 2GHGA 4JXFA 4TRLA 4PNIA 3QUPA 4BDFA 4UZDA 3EB0A 3MFTA 2PMOX 3LFSA 4MBLA 4RJ7A 2F7XE 3GFEA 5CEOA 1FPUA 2WMQA 5FM2A 1JSUA 3CR0A 3QA8A 3LCSA 3Q60A 1KV2A 3HRFA 2ZM1A 3F2NA 4EEVA 4JIKA 3M1SA 2OFVA 2Q0NA 5FUTA 2QU6A 3H9OA 1GIHA 2GNJA 2VNWA 3PJ3A 5J7BA 4U81A 5JGDA 3MGYA 3CJFA 4JG7A 3F3VA 2QC6A 1Y6BA 4YC3A 3R01A 2GTNA 2W4JA 1U54A 2ZM4A 4GG7A 4NTSA 5ANDA 2ONLC 3PLSA 2WQNA 3QZIA 4IW0A 4FEVA 4JRVA 1T45A 3PVWA 3ZS5A 5AP1A 5DA3A 4YP8A 5GHVA 4LGGA 4X3FC 2R9SA 3AT4A 3DZQA 3R7OA 1AGWA 1UWJA 2VTNA 4NH1A 4FBXA 5LWMA 2W1EA 3LCDA 5HICA 2ETRA 3N4VA 3G0FA 4PTCA 3ZO1A 2JC6A 2QO2A 3UE4A 3KXMA 3HAMA 2W05A 2J9MA 2VO3A 2YWPA 3DAEA 1WBVA 5L4QA 4WNOA 3UQFA 1WBSA 4M67A 3KXXA 5FTOA 3MB6A 5HESA 5EH0A 3LQ3A 3UNZA 3Q6WA 4O27B 3Q6UA 5KZ0A 5ETFA 5LCKA 4OBPA 4RWKA 4BCJA 2Q0BA 4BIDA 2X4FA 4OTFA 5EKOA 4EKKA 2W4OA 5KKRC 4PDPA 3DB6A 3VUKA 3K3JA 4FV6A 3DV3A 3FMEA 5IMEA 5IQHA 3QZFA 1V0OA 4FKVA 4L9IA 3TKUA 2YEXA 1WMKA 3H0YA 4MD8E 4GS6A 3UNKA 3VRYA 3CXWA 1ZMUA 3JYAA 3EZRA 2JBOA 4K77A 4JBPA 2BAJA 3FL5A 4M69A 4MVFA 2HWPA 3U4UA 3BGZA 3WF7A 2PU8A 2O63A 4KWPA 2OO8X 1E1VA 3QQLA 2E9OA 3A7JA 2XNOA 4ZZMA 4Q5HA 5DPVA 3VUDA 2JFLA 4WNPA 4E1ZA 3EHAA 1XBBA 3LFDA 2FUMA 3LFNA 4FZ7A 4F70A 3GUBA 2J5EA 3RWPA 4E7WA 4FGBA 3RK5A 3Q2JA 3GOPA 5K0XA 4BBFA 4CFNA 2A2AA 3MPMA 3L8XA 4MD9E 3RPSA 5BVFA 3C0GA 5KMNA 2WB8A 3GBZA 4CTCA 2ITUA 2BDJA 3FJQE 3QTWA 4FSTA 5HCYA 3OCGA 3A99A 4APCA 3R1SA 3O8UA 2XKFA 4ZSAA 3LQ5A 4O91A 3P23A 5EG3A 2CNUA 2BHEA 3NVMB 3EL8A 4H05A 1XHAA 3R71A 3FQHA 5ETAA 2W06A 3FLQA 4K0YA 4ZTRA 2DUVA 4DEAA 3F3TA 3HV4A 4B4LA 3VVHA 1UKIA 3C51A 3NX8A 2YM5A 3ZFXA 2QCSA 3PPJA 3RHXA 3POZA 2C68A 3ORIA 2UW4A 5ANKA 1OL7A 5CEQA 4D1XA 3ID6C 4FL1A 3V01A 1B39A 1W83A 3RZFA 5DYJA 2YIWA 3MTLA 2CDZA 3EJ1A 3KVWA 4KSQA 4X7QA 3A62A 3G15A 5EW9A 4BTMA 3QGYA 2PUUA 5ANGA 2DS1A 3F5PA 4ZIMA 4RIYB 2OJIA 4ENYA 2GNIA 3O7LB 3QTSA 5H3QA 5LMAA 2Y0AA 1YWVA 3TTIA 2ZMCA 2P2HA 1SVHA 2WTKC 4ZMFA 2WELA 3ZU7A 2H96A 3QQGA 2IPXA 3RAKA 4IM0A 2XIYA 2FSMX 4YMJA 5H2UA 5T3QA 3KXZA 5AA8A 2YN8A 4YUQA 4J52A 2XM8A 4ACHA 5L2IA 2A19B 3VUMA 1U59A 4IVDA 3OVVA 2GPHA 3HECA 4XS2A 3QD4A 4BDAA 4UMPA 4DINA 5L6OA 1UV5A 4FV2A 2BZKB 3EWHA 2C4GA 2QQ7A 4GJ3A 4PDOA 2PVRA 3ZSGA 3U6IA 2OH0E 4R77A 3QU0A 1O6KA 4XNEA 4DAWA 3LFBA 3VBYA 3LMIA 3G9LX 4G34A 4JI9A 4F65A 3KREA 3PZEA 1ZMWA 3HAVA 3PPKA 4Z9LA 4C57A 3NS9A 4YLJA 1FGKA 3H3CA 3IECA 5C03A 1RQQA 3O8PA 3DLSA 1R39A 5AJQA 5IH4A 5CASA 5BQ0A 1R0PA 1B38A 1FVRA 1YOLA 1IAJA 4P7EA 2PZPA 4FK3A 5GNKA 4DEDA 4EQUA 4RC2A 5EM7A 2OF2A 2R3PA 4J53A 1V0BA 2BTRA 3REPA 4W8EA 1JKLA 2BDWA 3ERKA 2EWAA 4KIPA 3RAIA 4UMRA 3NUYA 3OP5A 2CN8A 3POOA 3OUKA 4MF1A 4NTTA 3FMJA 2F7ZE 2CLQA 3GC0A 1H24A 2Z7LA 3NWWA 3COMA 4R5SA 4M84A 5LOHA 2YITA 2XKDA 2HYYA 1JKKA 3E3PA 4LOOA 5EQEA 4EHZA 2KULA 2ZV8A 5AV4A 3QGWA 4NW5A 4YZNA 1SYKA 4BWKA 4CFVA 5CSHA 3EN5A 5EYCA 2IW8A 4EC9A 5BVEA 3BYVA 2HENA 1A48A 4Z16A 1URWA 4GUEA 3MY5A 3P5KA 2W9FB 5DNRA 4ZTNA 3NNXA 3QQUA 3QKMA 4FSQA 4I6BA 5HVYA 4XP0A 4AGDA 4J7BA 4FYOA 4QMMA 4DT8A 5E8ZA 4OT5A 3CPBA 2J90A 5IMXA 4M15A 2RG5A 3E87A 2BCJA 4HZSA 1TQIA 2VTAA 4LM5A 3SLSA 3FQSA 4FTOA 4JT3A 5KMMA 4XX9A 2JAVA 1OKYA 3QX2A 5CZHA 5FDXA 3RM7A 1CTPE 2VO7A 1Q8UA 4DGOA 5IQFA 4ENXA 3CS9A 4YTHA 3AC4A 2GU8A 5CX9A 4FEQA 2WEIA 5B2MA 5EYKA 2VTRA 1QMZA 2OFUA 2R5TA 2I0EA 2XVDA 2EB2A 4YO6A 2I0VA 1ZYSA 5C9CA 1PF8A 5HORA 5H8BA 1UNGA 4W4WA 3W2SA 3NNUA 3DNEA 3Q04A 4OGRA 4B7TA 1XH6A 4HNFA 5CAQA 2B55A 3RKBA 3W10A 3OD6X 1VJYA 4LV8A 3PSCA 3NYXA 3TNWA 1PMVA 4IBMA 4CD0A 4FTRA 4FT0A 1NW1A 2BMCA 3GT8A 4FV7A 4DFYA 4F4PA 4FR4A 5JRSA 1YOJA 4PTGA 3ENMA 5JZJA 4ZY6A 5EHOA 2AYPA 4EZ7A 5D41A 2R3GA 1H1PA 4DFUA 3SKCA 4MKCA 2GNFA 4U42A 3KL8A 3H4JA 4RG0A 2GNGA 2XNPA 3NDMA 1BL7A 3WIGA 4IVAA 2JEDA 3D14A 3GCVA 5DEWA 4FE2A 4FSUA 4AAAA 1PXJA 2VN9A 4Y72A 5L2SA 2R3MA 4H3BA 1LPUA 4MXCA 4XG2A 1MP8A 4AG8A 3PLAE 2ETMA 3OG7A 3OZ6A 1ZYCA 4PY1A 3C0IA 2OBJA 5KO1A 4KIOA 4RIYA 3FLWA 3ROYA 2SRCA 3RVGA 3ORXA 2ZOQA 4FA2A 2P33A 4C3PA 3ORMA 1Q8ZA 4R1YA 4O6LA 5CSVA 4GV1A 4CYJA 5T68A 4YTFA 3TM0A 3OC1A 2Z60A 3R1NA 4C0TA 5IA2A 3LM0A 3R73A 5AMNA 2CSNA 4RRVA 3AC1A 1YDSE 4L44A 1SVEA 2HW6A 4GMYA 3MIYA 4C4EA 4QT1A 5AAGA 4CGAA 5DT3A 3U9NA 3ZHPC 4WSQA 3FZOA 3A2CA 3K2LA 4D55A 1QPDA 2YDJA 2UZEA 5AR2A 2XK3A 4DITA 4E6DA 4GEOA 3C13A 3FAAA 4BKYA 4EOOA 2E2BA 3EQIA 2CLXA 3OWKA 3VNTA 5BX0A 3F82A 3NYNA 3QCSA 1OITA 3MH3A 4U7ZA 5FBNC 3FQEA 5LMKC 4AZVA 1H8FA 5AV2A 2ZVAA 2XUUA 3IK3A 2RFSA 4YJUA 4J97A 5DHJA 5FEQA 4E8AA 4E3CA 3FLNC 4PV0A 3IW4A 5M56A 2X6DA 2PVLA 3FXXA 4A9SA 3AMAA 1DI9A 3GQIA 4C3FA 2XF0A 3M2WA 5EDRA 1Z5MA 4FSYA 4EH3A 2GTMA 1H0VA 4U3YA 4PL5A 5AR7A 4Q2AA 1LEZA 3I7CA 4IC8A 4FKLA 2AC3A 5K3YA 4HPUE 3SC1A 3QALE 5E8SA 3RAWA 4AFJA 1HOWA 5EOLA 5IUHA 3MESA 1APME 4QQJA 2BRGA 3H10A 2CKQA 2PMLX 1BI7A 4A9UA 2YIXA 5BYZA 2V7OA 3MJ1A 4D4RA 2RIOA 4MHAA 4PDYA 3COHA 3C4FA 3T9TA 4ERWA 4FT5A 3R8LA 2PZYA 3FZTA 4HOKA 4EI4A 5I3RA 3KCKA 3JPVA 3L9NA 4NCTC 4PMPA 1DAWA 3ZZWA 2BKZA 3CD8A 3EYHA 3FI4A 3KU2A 3SAYA 1U46A 3ZO4A 4FKUA 4QP3A 4MCVA 4RX7A 2REIA 1SNXA 2WIHA 1Q3DA 3ODZX 1W84A 3HKOA 3QAME 3BLRA 3R02A 4FEWA 3NUSA 1H28A 1TQMA 3Q32A 2EXMA 1Y6AA 4KRCA 5I9UA 3H9RA 4UY9A 3DKCA 4MF0A 3F5XA 4EL9A 3FC1X 3VBWA 3F66A 3VS3A 2V7AA 5TOZA 2OJGA 2WFYA 5HVJA 4CCBA 4IADA 4EH6A 2QOOA 3ZC6A 3GCUA 1XH7A 4XG6A 4EOIA 4CG9A 4BCKA 2WMUA 3PIXA 3QTIA 5C27A 3R7VA 1GZ8A 3GFWA 5CU2A 4YJNA 5DRBA 4O7YA 4X2JA 2YM6A 3SOAA 4Y5QA 3ZXTA 1ZARA 3G33A 4IX6A 5HTCA 1TVOA 4EHVA 3AC5A 1OIYA 1OPJA 3DZOA 3KEXA 4LFIA 3LKMA 4FT3A 5HNBA 3SXFA 4H3PA 1P5EA 3UTOA 4G2FA 2BIKB 4II5A 2J5FA 2XB7A 3IW6A 3ULIA 2PULA 3QTXA 3UVRA 2Z7QA 3FXZA 4QMPA 4AW2A 3GQLA 5CSPA 1V1KA 2Y6OA 4HGSA 2XK7A 3Q3BA 4IQ6A 3DQXA 4TYHA 4G3CA 4EH2A 4FT7A 3OCBA 3R0TA 4N6YA 5DLSA 4BI2A 4ASEA 3NNVA 3NYVA 3HV3A 5L2QA 3PJ2A 4QMVA 2JITA 5LARA 2V22A 4AZWA 2W1DA 1PMEA 3LOKA 4I6QA 2EB3A 1JWHA 4L43A 4KD1A 2CKPA 2VUWA 2Y9QA 5F4NA 4M8TA 3PDTA 4ANSA 1T46A 4XJ0A 4ZLZA 4KABA 5AA9A 4O38A 3GNIB 4FV4A 1JSTA 5CZIA 3KMUA 2UV2A 1Q4LA 2JIVA 4FKIA 4DEIA 3P0MA 5HG5A 2OXXA 3TNQB 3RP9A 4AGUA 5KX8A 2H6DA 4GKIA 4QNAA 3MV5A 4JBQA 4FTCA 3A8XA 4JR3A 3I7BA 5E92A 4I92A 2ZJWA 3EQCA 3ZTXA 1ZAOA 3Q9ZA 2XK8A 4ZS0A 2CHLA 4GW8A 2HELA 4ASZA 4AT3A 1KE6A 4BZDA 5M09A 4R7BA 4EJNA 4BICA 2X2KA 2HZ0A 1MRVA 2E9UA 3MS9A 3LJ1A 4XYFA 2XK9A 2ITQA 4D1ZA 1UKHA 4EOMA 4RC4A 4GH2A 4FSMA 1GNGA 4K33A 4XH6A 3NR9A 4RVLA 3RCDA 3UDBA 4DG0E 3TUDA 2PUNA 3EZVA 3PP0A 4FVQA 5GZ9A 1XKKA 4A9TA 1VYZA 3QCQA 3UMWA 3ZBXA 5A4QA 5BUIA 2C6OA 2JAMA 3MTFA 2WQEA 2OJ9A 4ZLYA 4CMOA 2R64A 4XP3A 1XWSA 3QLGA 3MA3A 3ZBFA 4QPAA 4WOVA 3QQFA 2YCRA 3TT0A 5AR4A 1OL1A 3R2BA 4IAIA 4QP8A 4D28A 4F6SA 3S4QA 2J51A 3S0OA 5L2WA 4FTTA 2YHVA 2J0IA 5CF5A 2VTTA 2YCSA 3E63A 3LMHA 4D2RA 4R1VA 4QO9A 1PY5A 2PE0A 4IDTA 3EOCA 1W8CA 1Q61A 4IACA 1UA2A 5JQ5A 2VTHA 3VULA 3OUNB 4YTCA 3MWUA 2CCHA 4R78A 5EM5A 4O0WA 5GJGA 3A4PA 1NVRA 5LJJA 1YDRE 3DJ7A 5FG8A 4D4VA 3NW7A 3SGCA 3RWQA 3ZSIA 3FI2A 4ANOA 2YLEA 4BC6A 5LVOA 3AMBA 3LXPA 3G6HA 3E7VA 2FB8A 2QNJA 2P0CA 2XA4A 4KNBA 3CQUA 3R9HA 3UYSA 2X7GA 4BKZA 4EJ7A 3LFFA 5CT7A 1E9HA 3M42A 4YJPA 3ZO3A 4A07A 2F49A 3V5TA 4TPTA 4B6LA 2VU3A 4NM3A 2VD5A 4C35A 4YGAA 1Q24A 4EONA 1BI8A 1Q8TA 3PVUA 3OOGA 4I20A 4L3JA 2X7OA 2G15A 2JKOA 3KXHA 4GVJA 4YBJA 4C4HA 1YI3A 4B8MA 4UMTA 4QMWA 1JOWB 5EW3A 3UNJA 3EN4A 1GAGA 4R7IA 2OKRA 5HU9A 3OW4A 5IISA 2J0MB 2VTPA 4UMQA 4QTDA 3GU8A 4I5HA 3TZ8A 3CTJA 3F6XA 3OF0A 1VEBA 4NU1A 3PVBA 4ACMA 2FGIA 3MIAA 3TV4A 4EH5A 3UG2A 4D0XA 4OR5A 4AGWA 5EFQA 2H8HA 3GC9A 5HNGA 5IA1A 2PPQA 4D2WA 2NPQA 2OLCA 2J2IB 2G2FA 3OXZA 5BYLA 4BI0A 4DGLC 3DAKA 1H01A 4BHNA 4Y8DA 2IW6A 4L67A 3PVGA 5I9ZA 3FMNA 3Q4ZA 2ITYA 3I79A 3KCFA 5IQCA 1Q41A 5CU0A 3GU5A 4F1TA 5KMJA 1VYWA 4CCUA 4H58A 4IJPA 2UW3A 5CWZA 5AP6A 4PDSA 4BDBA 4B99A 3F3UA 2C3LA 5AADA 3KN6A 2BRBA 3I1AA 4IANA 1H1SA 4ZSEA 4ZSJA 3WZKA 5CEPA 3VF8A 4XRLA 3RALA 2OU7A 2XK6A 1XO2B 3ACJA 4YPDA 5DGZA 1H25A 4FV0A 4FVPA 2X8IA 5HTIA 5K4IA 3BWFA 2HAKA 4P4CA 2BDFA 4LMUA 3CGFA 3E8CA 4KKHA 5DN3A 3RJCA 4UX9A 4QMUA 3CPCA 5BVOA 3QA0A 4Y83A 3KRJA 2JGZA 3PRFA 4MWHA 1PHKA 2R3HA 3A7GA 3BWJA 5AV1A 2ZAZA 2GQRA 3E3BX 4G6NA 3AGLA 5BVDA 2W9ZB 4HGEA 1KUTA 2YZLA 2QLUA 5HIDA 5E8YA 3HZTA 3IOKA 3T8OA 3ITZA 3R63A 2R2PA 2QVSE 1Q8WA 4E5AX 2R3IA 3P79A 3D9VA 3FXWA 4O0TA 5DIAA 4ZY4A 3QQKA 4C3RA 2Y4IC 3E7OA 4IAZA 3IW5A 4EK4A 3O50A 4F0GA 4XG3A 5TE0A 1KOAA 4JLCA 2XIXA 3SW7A 2W1CA 2QONA 2OF4A 4FF8A 5HHWA 4AUAA 1R3CA 5JSMA 4ITIA 4M13A 3DJ5A 4XEYA 3NCGA 2XYUA 4IAYA 3FLYA 3IW7A 4JRNA 4X3FB 1OZ1A 4DFLA 4PNKA 4GU6A 3PA3A 5E8WA 3RINA 5JQ8A 4FX3A 4XV1A 3DCVA 1ZOEA 3I5ZA 3PWYA 4IWPA 3CQWA 2OGVA 3FPMA 4JNWA 2WMSA 4HCTA 3GCPA 4DEBA 4HGLA 4F7NA 5JFXA 5AX9A 4C2WA 2OIBA 1XH4A 4ZMEA 5LXMA 4BCQA 4W4XA 4PL4A 5BYYA 4ZSGA 3UZPA 5ACBC 2R3QA 3OS3A 5IQIA 4GT4A 3LFCA 5CVFA 4BTKA 4MXYA 2QD9A 2ZB0A 5KMIA 3ZDUA 4Z7HA 2J0JA 4QD6A 5KKRB 1RDQE 4L46A 4C02A 5IZFA 1CKPA 2XNMA 2J50A 2OG8A 2YCFA 4NIFA 3ZUVA 5ITAA 4DA5A 4BF2A 3NIZA 4EYJA 3Q2MA 2YERA 3MY1A 4AQCA 5AIKA 5AX3A 2PYWA 1TKIA 3D5WA 3E8EA 3H9FA 1Q3WA 2C69A 3PYYA 4FKJA 4E5WA 4EZ3A 3I5NA 1H07A 2X9EA 3EN6A 2XKCA 4XG7A 2GQGA 3W1FA 1NY3A 2XK4A 2WHBA 3T3UA 2OIDA 3ZO2A 3C4XA 1WVWA 2PVJA 3OROA 3GU7A 3PRIA 3PY0A 3ORKA 4E5BA 2W1IA 2B4SB 4FTLA 4JDKA 4FKQA 2UW7A 1M17A 4UWBA 2YAAA 5AUXA 1BKXA 4HW7A 5FXRA 1KE9A 4YZCA 4PRJA 1GIIA 4IX4A 4EOSA 5AAEA 2C0IA 2ZV7A 4CZTA 5J1VA 2W1GA 2C6MA 3FKNA 4EUUA 2R0IA 3HL7A 2J7TA 2ZDTA 3R22A 4FOCA 4OBOA 4MNFA 4ALWA 3S3IA 2XNGA 3ZMMA 3QQJA 3FZRA 4AA5A 3ORPA 3HX4A 3W2PA 3QF9A 5KE0A 2BAQA 3CTHA 3IGOA 3DBCA 1H27A 2R3NA 3HV5A 5CSWA 5AP7A 1Y57A 5IUIA 3ZLWA 4D2TA 5DMZA 5M08A 4UN0C 5FEEA 1QPJA 4OTDA 2EUFB 3DT1A 3G6GA 4YR8A 5HNIX 3UJGA 4QOXA 3TZ7A 2WGJA 4MXZA 5HE1A 3NNWA 4CZUA 4FKRA 3SVVA 5EYDA 4EQMA 2ITOA 3BE2A 4XG8A 3HP2A 3PY1A 3I4BA 4O0UA 3SG9A 3F69A 2XM9A 3BU5A 2BROA 2C5YA 3HA8A 5AV0A 4NEUA 4RJ6A 1P4OA 4AZSA 3Q5IA 3MN3A 2WTKB 3QL8A 1NVSA 2VGPA 1H26A 5J9LA 1K2PA 3SD0A 1LEWA 4I22A 3KK9A 5C26A 4QQTA 1NVQA 2VWZA 3NGAA 3GOKA 4RMZA 4CT2A 1U4DA 3FSKA 3ULZA 3ALOA 1K3AA 3HMNA 4MQ2A 4BKJA 3F9NA 4O84A 3AC2A 4GVAA 5HCXA 1XBAA 4G6OA 5C8MA 2B9HA 4KKEA 2UZLA 2V5QA 2YJRA 2ZMDA 4I93A 4O7ZA 1ZYDA 3KRWA 4TWNA 3DXQA 5IU2A 3AD5A 4UEUA 4DH3A 2QOHA 4ZEGA 5GZ8A 3HRCA 4AZFA 3TWJA 4Z7GA 3DY7A 2PSQA 2WEVA 4FG8A 1F3MC 1ZZLA 2UZOA 3LLTA 4GJ2A 4OAVB 3LPBA 3T9IA 4RX9A 5K5XA 1Z9XA 2GSFA 3AQVA 3FZSA 4M14A 3KF7A 3CD3A 3FYKX 3O17A 3ATTA 1OL2A 5BUJA 4O96A 1B6CB 1M7NA 3WF8A 3V5QA 4CLJA 2ONLA 3HLLA 4RFYA 1M2PA 2J0LA 5FRIA 5I3OA 5E4HA 2OXYA 1OL5A 1Z57A 2WNTA 3MBLA 5TO8A 4EK8A 3QCXA 4BWPA 4Q5EA 4X3FA 2LAVA 3PXZA 2HZNA 4RIOA 1WVXA 3MH2A 4E20A 2C6EA 1RJBA 4BTJA 4K11A 2VGOA 3BHTA 4ZY5A 1WBWA 3D5UA 1U5QA 2I1MA 4K6ZA 4PPCA 2HIWA 1F0QA 3NZ0A 3PE1A 3Q9YA 4RGJA 5I0BA 3ZFMA 3VS0A 3MVMA 4C4IA 3DK3A 4OTPA 3ATSA 4C38A 5HKMA 2UZUE 3LJ0A 3KFAA 4FKOA 2WMWA 4C4GA 3BLHA 3O96A 1KE7A 1OL6A 3MH0A 2ITWA 4B8LA 5M44A 4RPVA 3BHYA 2YIRA 3SX9A 3GU6A 4IAFA 4QQCA 4I0RA 1Q99A 4RQVA 3BCEA 5AIRA 1WBTA 4QP7A 4RX5A 2O0UA 1AD5A 2VWIA 5IQDA 2W5HA 4O0SA 2BRNA 3VN9A 3ZLXA 3R6XA 2XCHA 1QCFA 3PXRA 4KBCA 4U5JA 5FP6A 3VUTA 4YHJA 5CEKA 4BGHA 5ANJA 4N4SA 5AP4A 2ITTA 3SRVB 4RLKA 3RCJA 4PTEA 4FNZA 5L3AA 3PA4A 5J87A 4FZDB 5FWKK 2E9VA 3ORNA 3VWAA 3SA0A 1H1WA 4BCOA 5EDPA 1R78A 2VTMA 2XYNA 2ZV9A 1CKIA 2CCIA 1XBCA 3KK8A 3NAXA 5IF1A 3EQDA 3KMMA 1JKSA 4FG7A 3RI1A 4O0VA 4QMNA 4O0YA 4J95A 2HCKA 4NZWB 5EDQA 2QG5A 4YTIA 5KHWA 4BCGA 4AN2A 5E9EA 4DH5A 3R1QA 4ACDA 3QC9A 4RVMA 3H30A 2GMXA 3THBA 5AP0A 2VWVA 5HE2A 4AACA 4W9XA 5CLPA 4CT1A 4XOYA 1A9UA 5B7VA 4XBRA 3F5GA 5I9YA 4CTBA 3NW5A 4EOLA 2OSCA 2VNYA 3QTRA 4IWOA 1SMHA 3CEKA 5CQWA 3TV6A 4O2ZA 4I4FA 4WKQA 4RIXB 3V8SA 3W8QA 3CSVA 1CMKE 5FDPA 3LAUA 2YZAA 1W7HA 2YFXA 2PMIA 2JFMA 3C5UA 4J71A 4L42A 4OBQA 3Q52A 2FSTX 2R3FA 5KMOA 3EMGA 2QR7A 4QP6A 4U40A 4D5KA 4GT5A 1YDTE 3OWJA 4GCJA 4LOQA 1WCCA 4TYJA 3U54A 4GYGA 4ZJVA 4GK3A 1IR3A 1M14A 4GFGA 4A9YA 4G9CA 4MXOA 4U41A 1DS5A 4YLLA 3RK7A 4DFXE 4IAAA 4HYSA 3UIBA 2QO7A 2IWIA 1J91A 2YACA 4GFMA 1JSVA 2W4KA 4IVBA 4XUFA 4C59A 3W2OA 1KOBA 4JDIA 5CU4A 4RZWA 3TL8A 1YHVA 4O7RA 4D5HA 4HGTA 3ZEWA 3P7CA 3M11A 3P86A 3RGFA 4I0TA 3DJ6A 2UUEA 4BI1A 3QTZA 2QKRA 5B2LA 4YJVA 2BKKA 4DE4A 2CN5A 3QD0A 1ZMVA 3CGOA 3EQPA 5CEMA 2ZM3A 3EQRA 4TYHB 4TXCA 2HW7A 4EK3A 4ASXA 3BV3A 4H1MA 4ZTSA 2QG7A 4KB8A 4ZXTA 4JOAA 5D7VA 4E26A 4XP2A 4AGCA 2YABA 4IE9A 3A7HA 4KINA 2WIPA 3B8QA 4MBJA 3RM6A 4F7JA 5HGIA 4TWOA 2FA2A 2XNBA 4FSNA 4M68A 3CTQA 4XG4A 3V5JA 4DLIA 5DE2A 4CSVA 5LQFA 4HYUA 5DT4A 1UU7A 2UVXA 4EOJA 3R1YA 4AU8A 4MNEB 5L8JA 4A4OA 1UWHA 5HLNA 5FLFA 4BYIA 2Y4PA 3D7TB 3S00A 4ANMA 5CI6A 4MQ1A 4D2SA 1UVRA 3Q9XA 2E9PA 3PUPA 4JVGA 4Q9SA 3CC6A 1E1XA 4BBEA 2QKWB 5IDNA 2QO9A 3D0EA 3QRTA 4OTWA 3VC4A 4O7WA 3BX5A 3BKBA 2BRHA 5AUWA 4FT9A 3QYWA 4FUXA 1L3RE 4G6LA 2F2UA 5C4LA 2WMAA 3FY2A 4JX7A 3QRJA 4GYIA 3VQHA 4IZAA 4H36A 4O7SA 1MRUA 3BHHA 2C3JA 1WFCA 3B2TA 4IWQA 3BEGA 3KB7A 4MH7A 4D4SA 2R0UA 3FYJX 4FEUA 2QODA 4ALUA 4K2RA 3IPHA 4JG8A 3FSFA 4HYHA 3FMKA 3LZBA 2JLDA 3EFWA 5LWNA 2C5XA 2G9XA 4ASDA 2XZSA 3OTUA 4J98A 1PKDA 5F20A 4EC8A 3EQFA 5IKWA 4KS7A 3QX4A 4AWIA 3C5IA 3R7IA 1Q62A 3W2RA 3IDCA 4FC0A 1OKVA 4FV1A 3JY9A 3TNPC 4LGHA 3ZOSA 4YHFA 3R8PA 4I94A 4YHTA 4DG2E 2J6MA 4BDEA 1O9UA 2C5VA 3CY3A 4W9WA 4CFXA 3SRVA 1G8SA 4FI1A 2QLQA 4FYNA 5J8IA 2VX1A 4Q9ZA 3FI8A 4IVCA 3C50A 3LQ8A 4F1MA 3UZRA 1ZYJA 3UIMA 5I4NA 3U51A 2HZIA 2IZUA 4KKGA 2VAGA 3A7IA 4QMOA 4ERKA 4YJTA 4O1PA 3TJDA 2W17A 4P5ZA 1PJKA 4KIQA 4O7LA 4YJRA 5EI2A 5HG9A 3VHKA 4A9RA 4C8BA 1OKWA 2OK1A 3NUPA 3DBDA 3IOPA 4QTBA 3SOCA 4Z55A 1UU9A 2BZHB 3PPZA 4J1RA 3W8LA 3ZRMA 4FIGA 5JGBA 4FIFA 2IVVA 3P78A 1SM2A 4J99A 1O6LA 2R4BA 5HO7A 4IZ5A 2YA9A 3Q4UA 3JS2A 4U43A 3NUUA 4RX8A 3QCYA 5FP5A 4XV3A 1S9JA 4U6RA 4A7CA 2QHNA 4QRCA 2YLFA 3E62A 4FTNA 3VUGA 4RIXA 2WMXA 4GU9A 5KMLA 4Y95A 1A06A 4F7LA 5DH3A 2F2CB 3R8ZA 2O64A 1ZY4A 2VO6A 3K54A 3RHKA 5BUEA 3EYGA 4CEGA 4WUAA 4W8DA 3U6JA 3TN8A 4QP4A 5E91A 4AX8A 2R3LA 3QZHA 5DG5A 2GFSA 4I3ZA 3ZLSA 2VRXA 1J7UA 3F3WA 2X1NA 2Z8CA 3GEQA 3VRZA 4CFUA 4KIKB 2VTJA 3TJCA 1OPKA 1ZRZA 2PVNA 4QYYA 3TIZA 5IA3A 5AUTA 5CALA 3EL7A 5CAUA 5J9ZA 1H08A 3C4CA 4L7FA 1YI6A 2DWBA 2XNEA 5CT0A 4JBVA 3VS2A 4P90A 4D0WA 3NUNA 3QQHA 1PKGA 1FGIA 3B8RA 4DN5A 2UW6A 3TTJA 4D2VA 3HGKA 4FTUA 4J8NA 4EOPA 2ERKA 4I23A 5M4UA 4GSBA 5CEIA 2VO0A 3I6UA 3E88A 4PX6A 5HU3A 5JGAA 3HRBA 4IXPA 4CLIA 3DGKA 5E8UA 1LR4A 3V5PA 2CGUA 3BIZA 3ZC5A 5CENA 4K1BA 4TY1A 3KVXA 4HVIA 3PIZA 2NP8A 3L9PA 2ITZA 3QYZA 4BIEA 3VW6A 4UYAA 3E93A 3QHRA 1XR1A 4G1WA 3FKLA 4WIHA 1IRKA 4HCVA 4DEHA 3ACKA 5EHYA 1WBPA 2OXDA 3Q4TA 2JDVA 3AT2A 3QRKA 5E8VA 4DH8A 5AFVA 2P3GX 3EKKA 4NM7A 1URCA 3V3VA 5ETIA 3ZLYA 2ZB1A 4G3EA 4MK0A 5HG7A 3E8DA 3FZPA 3R7UA 4DGNA 1FMKA 1YXSA 4MNEA 3QTQA 4O0XA 1W98A 1X8BA 3OBGA 1DI8A 3D7TA 3QXPA 4IZYA 4TWCA 2GS2A 4AW5A 5LMKA 2WD1A 4MEDA 4WBBB 4I21A 1YQJA 2XJ1A 3I0OA 1BL6A 2FVDA 3RTPA 3FLSA 5CVGA 4NKSA 5M4FA 2H34A 1PRYA 5EQYA 1ZLTA 2B1PA 3PA5A 5AP3A 4F63A 3HEGA 4FUYA 3JVRA 3R9OA 4JIAA 4ALVA 2RFNA 4L68A 4MTAA 1WZYA 2PVMA 5J95A 1PXIA 2GQSA 1Q5KA 4USDA 3TEIA 4ORKA 1WBOA 3C0HA 4A4LA 4V01A 4QMLA 4CFWA 2XBAA 2YM3A 4F0FA 4CG8A 2C47A 4H3QA 3KMWA 2BFYA 1H0WA 5HLPA 5I9WA 2B52A 4WG3A 1OM1A 3FMLA 2QOLA 2YM8A 4QPSA 4KUJA 2F9GA 4JAJA 5AM7A 4IX5A 4IWDA 3UODA 3ROCA 5KNJA 5IQGA 4USEA 5IQBA 4BZOA 4AN9A 2IG7A 4G16A 3LLAA 4NCTA 4NSTA 3PG3A 4NUSA 4KRDA 2WU7A 4TT7A 4HVSA 5A6NA 5G6VA 5HEZA 3LFQA 3P7BA 4PUZA 3LHJA 5KCVA 2IJMA 2YIYA 4D4YA 5BMMA 1PXLA 4I4EA 4C58A 4UALA 2OIQA 4U8ZA 4JBOA 5CY3A 1HCLA 1Q8YA 2CGVA 2WTDA 3D2IA 2X8EA 4RSSA 3BHVA 5JRQA 5EI6A 1NXKA 3U8WA 2BRMA 2UW9A 2IVSA 4UWYA 3GCQA 2C6DA 1H4LA 4BVUA 1IG1A 4Y73A 2A1AB 3QUDA 5GJDA 4F08A 4ZLOA 5M53A 3NUAA 3GC8A 3PZHA 1PXOA 4QP9A 4U97A 3KRRA 3TZMA 5JFVA 4NK9A 5M55A 4RIWB 3RK9A 3OT8A 2R3RA 3KF4A 4GL9A 3U4WA 1BMKA 4NIFB 3MPTA 2RSVA 3PXQA 3WF5A 3LFAA 3ORLA 4UZHA 4QMYA 4OTGA 4U9AA 3VAPA 4D9TA 4E73A 4I24A 4FOBA 2WTIA 3QKKA 1OUKA 2R3OA 3MSSA 4QMQA 4AP7A 2B54A 3FDNA 3C4WA 4JJRA 5JZNA 1LUFA 2FSLX 3R9RA 2G1TA 2I40A 1JLUE 2C5NA 3FMMA 4EH7A 4LRJA 5DT0A 5FQDC 3OW3A 2PUPA 3UIUA 4AZTA 3VHEA 5M57A 3TDWA 4UB7A 4CKJA 4CRSA 1CKJA 2RL5A 1IASA 4I0SA 3OMVA 4L52A 1ZOGA 2UW5A 4NW6A 4EK5A 1YVJA 3D94A 3GENA 4NM5A 4QYGA 4RA5A 4YZDA 4L6QA 2HOGA 2XH5A 2GS7A 3AT3A 3OY1A 4C37A 3UZTA 4AE9A 5K5NA 5D11A 4AS0A 4PWNA 4F9YA 1FOTA 2WTCA 3WZEA 4OAUC 5HG8A 3W18A 3ZEPA 2WMRA 3ZXZA 3DB8A 2BVAA 3OCTA 3R00A 5A4CA 3R7GA 2CMWA 4KIKA 4U3ZA 4WNKA 2VTQA 4FIJA 4MAOA 5E1EA 4IFGA 2GHMA 4EH8A 2P4IA 5J1WA 4WNMA 3TI1A 3FL4A 4ACCA 4NWMA 2EU9A 2XJ0A 3VS6A 5DEYA 4CV8A 2PL0A 1FBNA 3UMXA 1VZOA 3UPZA 4JR7A 5A14A 3UIXA 3QFVA 3QLFA 4OTQA 3TNIA 4ZSLA 2I6LA 4QQ5A 5IEYA 1ND4A 2VX3A 4RJ5A 4RWLA 5LMBA 3BYUA 2I7QA 1OVEA 3KRXA 3VQUA 4CYIA 2O5KA 3L8VA 5IDPA 1FMOE 3WF6A 5CI7A 4M97A 4CFMA 3R8MA 3WYYA 4FMQA 3V6RA 2GNHA 3WZUA 4BDIA 3TKIA 5J5TA 1ZY5A 4DFBA 4C33A 1OI9A 3KXNA 3UPXA 4AA0A 4RJ4A 4O1OA 5AP5A 4AT4A 2Y4IB 3P08A 2J4ZA 3EIDA 2YJSA 3QXOA 1W82A 1P14A 4JQEA 4E93A 4I5MA 2C5OA 3MH1A 4FVRA 4X2GA 3WBLA 3ZZEA 3FKOA 4F9AA 5F95A 4ANLA 2YM7A 5FEDA 3QWKA 4MWIA 4X3JA 4MBIA 3RPVA 3AD4A 3KGAA 2X9FA 1Y8GA 2VWBA 4DLJA 5CXHA 1V0PA 4HVHA 3PP1A 2H9VA 4LOPA 3HDMA 4NFMA 3GU4A 3EKNA 2UZTA 4AT5A 4IB3A 5ANEA 3KKVA 4AOIA 4C36A 4TTHB 2O8YA 3C4EA 4CXAA 2RG6A 2UZWE 4OTRA 5D9HA 4I6HA 3UQGA 4L45A 1OMWA 3ZONA 2W5BA 5HIBA 4E6AA 3MFUA 4IC7A 4TZRA 4PPBA 3QUEA 3OTVA 4U80A 4R3RA 2BILB 4BY9E 4WT6A 4FZFB 1W0XC 2QOQA 3G51A 1BLXA 3JY0A 4YZBA 4EZ5A 2JDSA 2RFEA 3OEZA 4IFCA 3DXPA 4NJDA 4BDHA 3KC3A 3TXOA 2IVUA 2X2MA 3BYSA 3KULB 1SZMA 2WZJA 3NLBA 5IG1A 3MB7A 4PP9A 4ONAA 5CNOA 3CBLA 2VTSA 4IX3A 3EFKA 3EN7A 4O6EA 3W16A 4E4NA 5I9VA 4N6ZA 5JN2A 3TIYA 2B53A 5HBEA 3EH9A 3PJ1A 1J1CA 2PZ5A 4IM3A 1PW2A 4FV8A 2IVTA 4DTBA 4F64A 3KA0A 2PVYA 3NCZA 3BZ3A 4R8QA 4YC8A 3R9NA 5CXZA 5HI2A 3COIA 2WTJA 4BB4A 1J3HA 3F7ZA 3EQBA 3DA6A 5CAPA 1YOMA 3HDNA 3OWPA 1ATPE 3P4KA 3R28A 4RIWA 1XH5A 2VX0A 4ZK5A 2W7XA 3AOXA 2WPAA 4FODA 5HX6A 4M0YA 2JDRA 4CMTA 4IB0A 4EK6A 4DGGA 5FGKA 3MY0A 3A4OX 5FTQA 4JL9A 5M4CA 2UZVA 4WG4A 3R21A 1M2QA 1GZNA 3AG9A 3D5VA 3DBEA 3FHRA 3AC8A 3LE6A 3RBWA 2G01A 3S1HA 3BYOA 3N9XA 4L8MA 4BCHA 2UVZA 5HD7A 2HY0A 3HMIA 2HXLA 1WBNA 5D12A 2C1AA 4JG6A 5DR2A 5F9EA 1OPLA 5TR6A 2R3JA 3IQ7A 2QI8A 4IJ9A 2NRYA 5CANA 2BZJA 5GIOE 2YCQA 1ZWSA 4LRMA 3TDVA 3HYHA 2C6LA 4W4VA 4DFNA 5HLWA 4BHZA 4GKHA 1PXMA 2Y6MA 3I6WA 3RPOA 4AOTA 3GGFA 3CCNA 4PPAA 3W2QA 2GS6A 3GCSA 2W1ZA 3WYXA 4YSMA 5CTPA 4FNWA 4O7NA 3DS6A 2O2UA 3E5AA 3IDPA 2GFCA 5EW8A 5HOAA 3SDJA 3FMHA 2IZRA 3IS5A 3NPCA 4FSZA 4HJOA 5DFPA 2DQ7X 2JIIA 4RA4A 4QTEA 3ZRKA 1RE8A 4EORA 2OI4X 3AGMA 5H8EA 2UW8A 1PYXA 5BVKA 2R7BA 5E90A 3O23A 4NKAA 2Z02A 2B0QA 4EHEA 4BZNA 1U5RA 4LMNA 4FKPA 3C4ZA 2F4JA 4BN1A 1O6YA 1Y8YA 1YWRA 2WMBA 4NM0A 1YXTA 2WU6A 3K5UA 3WE4A 4B0GA 1L8TA 2QOBA 4DC2A 4XCUA 2C3KA 2O3PA 4S34A 5BPYA 2HWOA 4MYGA 4ZAUA 3MDYA 2WTWA 5M51A 2X39A 5CAVA 3EQGA 2XEZA 3ALNA 2KTYA 4GK2A 4RLLA 3F5UA 3PXKA 4FICA 2JDOA 2WMVA 5HX8A 1UNHA 5L6WL 1S9IA 2HY81 3UYTA 1XQZA 4RJ3A 3OHTA 1K9AA 3HP5A 3UP2A 3PSDA 2PE1A 3LXNA 2X6EA 4RVKA 1CDKA 1I09A 4KBKA 3QTUA 2QOKA 1IEPA 4R3PA 2UZDA 4OW8A 5F94A 3BGQA 4FL3A 5IA4A 1PMUA 3OFMA 5IPJA 3W55A 3O8TA 4UBAA 3WZJA 1CM8A 3BRBA 4X6RA 4DTAA 4F1OA 1WVYA 4LGDA 4ZOGA 4FTJA 3N4TA 1AQ1A 3CIKA 4HVGA 2RFDA 1M2RA 1KE8A 4BCMA 2AUHA 4O22A 4EWQA 2WMTA 4OT6A 4E6QA 3OWLA 1ZZ2A 3ZSHA 1OKZA 4X0MA 5FXSA 3PG1A 3OCSA 2OWBA 3R7YA 3O71A 5L8LA 4ZS4A 4BFMA 2YISA 4BCFA 3SW4A 1OGUA 3BBWA 3BQCA 4M66A 4UYNA 5DBXA 5CF8A 2Y7JA 2YWVA 4UXQA 1M7QA 3O51A 3BYMA 4XBUA 4BGQA 4IHPA 1YHSA 4JX3A 4IMYA 3F2AA 3KULA 1UU3A 3HNGA 4CFFA 2JBPA 4GRBA 3UQCA 3G0EA 3DFCB 3IGGA 5D1JA 3GVUA 1ZXEA 1GJOA 3DLZA 4JAIA 2CNVA 4PMSA 3CKWA 2C0TA 4QP2A 2V62A 4E4LA 3NYOA 3OOMA 5AUVA 3ORTA 4YBKA 5AP2A 4EOQA 1FQ1B 3S95A 5LVNA 3QHWA 2HZ4A 2C6KA 5A4EA 1YW2A 4LUEA 3TV7A 1P2AA 2QU5A 5IA0A 5K4JA 3FBVA 2CNQA 3OXIA 2VWYA 3RPYA 4X2KA 1ZOHA 4GFOA 4RVTA 3IDBA 5LVMA 4CQEA 3E64A 3FC2A 4JDJA 1NT2A 4UV0A 2V0DA 3U55A 3V5WA 4QYEA 3HMOA 4HPTE 2ACXA 4RWJA 1J1BA 1KV1A 2W5AA 4MX9A 5DVRA 4V0GB 5DRDA 4O86A 4TWPA 3ZFYA 4ACGA 3R8UA 2JKQA 4CKRA 4DHFA 2CGXA 3GXLA 2I0YA 3ANQA 5H9BA 5BVWA 3L8PA 1PMNA 3VBTA 5A4TA 2OZOA 2Z7SA 4Y5HA 3R8VA 3WZDA 4ARKA 4F9CA 4BDDA 4FGRA 2E9NA 3P1AA 4DT9A 4S2ZA 2BFXA 4EQCA 2P55A 4BDKA 4XG9A 3MJ2A 3IG7A 3D83A 3QKLA 4ZZOA 3VJNA 3CKXA 4L3PA 4B9DA 2V55A 4DYMA 4ANBA 3LW0A 1ERKA 2PZIA 3UVQA 3WOWA 2OICA 4EYMA 2WKMA 5HCZA 2B7AA 4G5PA 2A4LA 1UNLA 4FG9A 4MXAA 3R83A 4UMUA 3ZRLA 5I5ZA 4FSRA 4RWIA 2IZTA 1REJA 4EH4A 4ANQA 4I5PA 2UVYA 1JBPE 3CE3A 3FE3A 4ZTLA 5C8NA 3ORZA 3BHUA 5HBJA 4J8MA 4YNOA 5G1XA 3NIEA 1JQHA 2WTVA 2W96B 4O2PA 1IA8A 2BAKA 4R3CA 2XJ2A 2OJJA 4WRSA 4C7TA 1LP4A 1EH4A 4WD5A 2YDKA 3MPAA 4M3QA 3IO7A 4BL1A 3DK6A 4L00A 5CVHA 3UGCA 2WOTA 1P4FA 3G9NA 3GP0A 3CP9A 4YZ9A 5CNNA 4QMSA 4AW1A 4FKTA 5KBQA 2BR1A 1CSNA 4ZP5A 3VUHA 4U79A 2W1FA 4C4FA 4DF3A 3ET7A 2PZRA 3PFQA 5D7AA 5HO6A 1DM2A 2IN6A 3ZUUA 4QMTA 3CLYA 1ZYLA 5IA5A 2VV9A 2PHKA 3QRIA 3FV8A 4FL2A 4LRKA 4OUCA 3U87A 4BCPA 3JVSA 3L9MA 5IEVA 2B9IA 4IAKA 2XNNA 4JDHA 2FYSA 3E8NA 4DCAA 4QYHA 4FTKA 3E92A 3OBJA 4LYNA 3W32A 4HYIA 3KY2A 2WQBA 4RQKA 4J96A 5CYIA 4BYJA 5C4KA 3WIKA 5IH5A 3LCTA 4RC3A 5A4LA 4IEBA 3ZM9A 4OLIA 3TNHA 3LIJA 3EN9A 4BTFA 4D58A 2XCKA 4GT3A 3MA6A 4FTQA 4CRLA 3TUCA 3UOJA 5FM3A 4BRXA 5CQUA 3DTWA 4EUTA 4FKWA 5KBRA 5AUYA 1REKA 4ITJA 4Y85A 4ZJIA 1BX6A 5GJFA 4ID7A 1QPCA 5L8KA 2UW0A 5HO8A 3MYGA 3OEFX 3QD2B 1M52A 3PE2A 5KUPA 5LVLA 2AC5A 2QOIA 3HMMA 1BYGA 3PTGA 5AR5A 5TF9A 4C34A 4F99A 3V8TA 4F09A 3D15A 3FY0A 1JAMA 2X2LA 4CNHA 4EH9A 4GUBA 5J5SA 2WO6A 2XKEA 4FK6A 5ICPA 3DBQA 4ZTMA 3F3ZA 2G2IA 1YXUA 2PTKA 4FV3A 2B9JA 5AEPA 4G17A 4MXXA 4JQ8A 4IH8A 5HE0A 4BGGA 4UWCA 3QC4A 4PMMA 2W0JA 3GI3A 1YI4A 3HUBA 2FO0A 3V51A 4TYGA 4WA9A 1FINA 4AN3A 4DGMA 4FV9A 3V8WA 3C1XA 3F88A 4FEXA 5FBOA 4QTCA 2VTIA 3UC3A 1H1RA 1OIRA 1YXVA 4HZRA 3DAJA 2GDOA 2QHMA 4O7VA 2JKMA 4GG5A 5FD2A 3NW6A 5ANOA 4RFMA 3JR1A 2XIKA 3L1SA 2ZYBA 3R04A 2BPMA 3S2PA 3UBDA 4BR3A 3C9WA 4HVDA 4RZVA 4YJOA 2NRUA 3BEAA 3BQRA 2B9FA 4S30A 4IB1A 3DDQA 3C7QA 3ZCLA 3DKFA 4AF3A 1J7LA 3LFEA 2YIQA 4Y46A 4AFEA 4YURA 4LQMA 1SVGA 3VIDA 1JPAA 5KMKA 3FEGA 4JQ7A 3HMPA 5B0XA 4BCNA 4O7TA 3KQ7A 3IONA 4TYIA 3TACA 3LXKA 3FPQA 1MQ4A 2EXCX 3GC7A 4M7IA 3HV6A 4GK4A 5AV3A 2IZSA 4O21A 4USFA 4V0GA 4ZJJA 4L53A 4A4XA 3FI3A 1OBDA 2CJMA 4X21A 1G8AA 2G2HA 3PXYA 4WBOA 4M0ZA 4XRJA 2X7FA 3UVPA 4D1SA 5EQPA 4CV9A 3NMUF 3FZ1A 5HVKA 2CGWA 2GCDA 3ZDIA 2EXEA 2VWWA 3A8WA 3BE9A 4ZTHA 2W99B 3DKOA 5H8GA 4DCEA 4BDJA 2BHHA 4C62A 1JNKA 1H1QA 1MUOA 2PVKA 4CVAA 4DBXA 4FKGA 3FLZA 4FKSA 4XLVA 3UO6A 2JIUA 5IH6A 4L01A 4WG5A 3VBQA 5BVNA 1DAYA 1XH8A 5AUUA 5JKGA 4QYFA 3DU8A 2OJFE 4TN6A 1JVPP 3IKAA 2ITVA 3GB2A 3HV7A 1GZKA 4FNYA 2ERZE 3H0ZA 4ZZNA 4JS8A 2PVFA 5CF4A 4LL0A 2F7EE 5TT7A 5AR8A 5HZNA 5E8XA 3DBFA 4FSWA 4NFNA 4F6WA 4U0IA 3BLQA 1OB3A 3D2KA 4GIIA 3R7EA 4DEGA 3LM5A 4N57A 2CKEA 3DQWA 4ZTQA 4G3DA 4BBMA 4TYEA 4LL5A 5J9YA 1R0EA 2XMYA 3PJ8A 4A06A 3O0GA 4FTIA 2WQOA 5I9XA 1GIJA 3F7WA 4XV2A 2P2IA 3DOGA 4X6QC 5IEXA 2Z2WA 3MFRA 3N51A 4X2NA 4C4JA 5M4IA 4KS8A 3NVKI 1MRYA 2OZAB 1XJDA 4BCIA 4MD7E 1BUHA 3A7FA 5EYMA 3DDPA 3TCPA 2YDIA 2XP2A 2A0CX 4AXAA 3L8SA 4AZEA 4G5JA 4AE6A 2PWLA 2FSOX 4ANNA 2VTOA 2C30A 3ELJA 2WXVA 5M06A 1RW8A 3LMGA 4RT7A 5CU3A 3NAYA 3R30A 4UXLA 1Y91A 3V04A 3SV0A 5DOSA 2GNLA 2VWUA 2C0OA 2PY3A 3EFJA 5EI8A 1XH9A 4TKSA 2IW9A 3RZBA 4DH1A 4EBWA 2OW3A 2W1HA 4DFZE 5JH6A 3I60A 4FTMA 4EWHA 1JKTA 5E7RA 3HA6A 3I0QA 3UOKA 1WAKA 4U45A 5CU6A 4IM2A 5CS6A 4H1JA 3SQQA 5LCJA 3AD6A 4P5QA 3HUCA 4R7HA 3I81A 3TKHA 2HK5A 4I5CA 3VJOA 5J7HA 3Q5ZA 3EQHA 4HCUA 2PVHA 3VBXA 1Q97A 2PMNX 4QNYA 2BUJA 4P2KA 5A46A 5JMSA 3TZ9A 1TQPA 4XHKB 5K9IA 4FTAA 4DG3E 4F0IA 3QBNA 4DTKA 2BTSA 1PXKA 4GIHA 3V5LA 3VS7A 5EK7A 3DXNA 4D9UA 4CZYB 3F2RA 1SNUA 3BGPA 1OUYA 2OH4A 1J7IA 3CQEA 3JUHA 4Z3VA 2RF9A 4K18A 5A9UA 5M07A 2XEYA 1QL6A 3A60A 4R5YA 5ANIA 2A27A 1G3NA 1IA9A 5L6PA 2JKKA 1G5SA 2ITPA 1GOLA 2X0GA 3Q96A 2WAJA 4IDVA 3D5XA 4KA3A 5E1SA 5F1ZA 3SHEA 5HD4A 5JEBA 5HE3A 2UZBA 4WSYA 3MW1A 4BDGA 4C2VA 4YO4A 2C1BA 2CKOA 3TG1A 3OT3A 4R6VA 4YNEA 2PUIA 4I6FA 4FZ6A 1FVVA 1MQBA 4NL0A 1YRPA 3MVJA 4RJ8A 3UO5A 4O0RA 2QURA 3NRMA 5E8TA 2BZIB 4ITHA 4L3LA 5HBHA 5T6KA 2I0HA 2ZDUA 4YU2A 5L2TA 4AA4A 5KZIA 3CJGA 4PF4A 4M12A 5EHLA 4TNBA 2O65A 3PY3A 4AOJA 3W2CA 4F6UA 3SXRA 4DH7A 2RKUA 4YLKA 4QTAA 5ETCA 3EFLA 3QD3A 3BELA 4IZ7A 4LI5A 1GZOA 3MVLA 4FV5A 1YXXA 3UC4A 5HTBA 2X4ZA 2J0KA 2XRWA 2ITXA 3MVHA 2UZNA 5DWRA 2ESMA 3ZYAA 2Q83A 3G2FA 4RFZA 3TUBA 3Q9WA 2XS0A 4C61A 3K3IA 3WF9A 4WHZA 1R1WA 4PL3A 5D10A 3SG8A 1YWNA 3AC3A 3UOHA 4EOKA 4F9WA 2WOUA 5C01A 4O81A 2BALA 2CPKE 3RMFA 3II5A 3SXSA 3VW8A 3BV2A 3AMYA 3F61A 3LJ2A 4EKLA 4BIBA 4E4MA 5J79A 1STCE 4IIRA 2DYLA 3VS1A 4NT4A 2X8DA 2ITNA 4XV9A 4O82A 1YKRA 1OIUA 5IQEA 2NO3A 3LCOA 4CMUA 3AXWA 4V05A 4IB5A 3KXGA 1H00A 3UG1A 3R2YA 2ETKA 4EHGA 4G9RA 5KHXA 4PQNA 1U54B 5DR6A 3PWDA 5FTGA 3MI9A 5JT2A 2QOFA 3DK7A 2JDTA 3RNIA 1PXNA 3CY2A 4APPA 4EBVA 3NEWA 5LVPA 5TKDA 4S33A 4X2FA 5AWMA 3UO4A 3OXTA 4K9YA 5CSXA 4KBAA 3BU6A 2C3IB 4DBNA 3COKA 3WILA 5JFWA 5IUGA 3Q4CA 3VO3A 4QP1A 1HCKA 2PK9A 1OECA 5EM8A 5DI1A 2VTLA 5K0KA 5CF6A 3FMDA 2XIRA 4V04A 4XLIA 3T3VA 5AAFA 3ODYX 4LG4A 4LV5A 3ZM4A 3JXWA 3DFAA 1PYEA 4FIHA 3ZH8A 2OZAA 5EKNA 3V6SA 3W33A 1PXPA 2C6TA 2R7IA 2XRUA 3DKGA 2YAKA 4G31A 5A54A 3BU3A 4LUDA 4OTHA 2QOCA 3DTCA 1F5QA 5ACKA 1OIQA 5BMSA 5HIEA 2C6IA 3BBTB 4NJ3A 2RGPA 2X81A 2IO6A 3PIYA 4U44A 4CQGA 3PSBA 3N4UA 3LVPA 3RNYA 2WQMA 4QMZA 3WARA 2GHLA 2JD5A 3D4QA 4TL0A 3K5VA 5DR9A 4YC6A 2XIZA 4M69B 3O2MA 3P9JA 4WRGA 4G3FA 4N0SA
chains in the Genus database with same CATH superfamily
2Y8OA 3ANRA 1IAHA 3B2WA 4KAOA 1FVTA 4D2PA 3ENHA 5FXQA 4TNDA 3RAHA 4HNIA 1YHWA 4S31A 4FNXA 4PP7A 3VF9A 2NNWB 4NYEA 3G90X 4I41A 4S32A 5CAOA 4PMTA 3DNDA 4KSPA 4QMXA 1GY3A 4WO5A 4K8AA 4F9BA 2VWXA 4W4YA 4FIEA 5HQ0A 4QDEA 5A6OA 4H39A 3OY3A 4DEEA 3FHIA 4RBLA 3VS4A 3G5DA 3KN5A 1KWPA 1NA7A 4F7SA 1KSWA 3A61A 3MFSA 5A3XA 1QPEA 3QWJA 2BIYA 5BNJA 2FH9A 3U9CA 3Q53A 3P7AA 5AUZA 5JFSA 3O7LD 3PXFA 5GIPE 4O83A 5IQAA 1UU8A 3KRLA 3IW8A 3ZUTA 3ETAA 4XOZA 2F57A 3QRUA 5EOBA 3PJCA 3QZGA 1KE5A 4TW9A 4E6CA 3LXLA 2YM4A 2Z7RA 4YZMA 5GINE 3BI6A 4CKIA 4I1ZA 4G3GA 3VS5A 5AR3A 1VR2A 4YJQA 5B2KA 3R9DA 5C1QB 4E4XA 3U6HA 3NUXA 1OBGA 3BPRA 3WE8A 3L9LA 2XBJA 4WUNA 1I44A 4N70A 5AM6A 5EM6A 2EVAA 3NSZA 4BWXA 3RPRA 4YSJA 4YPSA 4OTIA 3WI6A 2HXQA 2PE2A 4L7SA 3DPKA 3VBVA 3FUPA 4XMOA 3VUIA 3LCKA 4QDVA 2ZV2A 3HVCA 3FWQA 4AW0A 2QR8A 5GZAA 4BDCA 4FZAB 2R3KA 5C8KA 4QPMA 3UOLA 4FIIA 2LGCA 4YJSA 3UP7A 5JK3A 3D7ZA 2VZ6A 2GHGA 4JXFA 4TRLA 4PNIA 3QUPA 4BDFA 4UZDA 3EB0A 3MFTA 2PMOX 3LFSA 4MBLA 4RJ7A 2F7XE 3GFEA 5CEOA 1FPUA 2WMQA 5FM2A 3P5JC 1JSUA 3CR0A 3QA8A 3LCSA 3Q60A 1KV2A 3HRFA 2ZM1A 3F2NA 4EEVA 4JIKA 3M1SA 2OFVA 2Q0NA 5FUTA 2QU6A 3H9OA 1GIHA 2GNJA 2VNWA 3PJ3A 5J7BA 4U81A 5JGDA 3MGYA 3CJFA 4JG7A 3F3VA 2QC6A 1Y6BA 3KIOC 4YC3A 3R01A 2GTNA 2W4JA 1U54A 2ZM4A 4GG7A 4NTSA 5ANDA 2ONLC 3PLSA 2WQNA 3QZIA 4IW0A 4FEVA 4JRVA 1T45A 3PVWA 3ZS5A 5AP1A 5DA3A 4YP8A 5GHVA 4LGGA 4X3FC 4AXDA 2R9SA 3AT4A 3DZQA 3R7OA 1AGWA 1UWJA 2VTNA 4NH1A 4FBXA 5LWMA 2W1EA 3LCDA 5HICA 2ETRA 3N4VA 3G0FA 4PTCA 3ZO1A 2JC6A 2QO2A 3UE4A 3KXMA 3HAMA 2W05A 2J9MA 2VO3A 2YWPA 3DAEA 1WBVA 5L4QA 4WNOA 3UQFA 1WBSA 4M67A 3KXXA 5FTOA 3MB6A 5HESA 3UDTA 5EH0A 3LQ3A 3UNZA 3Q6WA 4O27B 3Q6UA 5KZ0A 5ETFA 5LCKA 4OBPA 4RWKA 4BCJA 2Q0BA 4BIDA 2X4FA 4OTFA 5EKOA 4EKKA 2W4OA 5KKRC 4PDPA 3DB6A 3VUKA 3K3JA 4FV6A 3DV3A 3FMEA 5IMEA 5IQHA 3QZFA 1V0OA 4FKVA 4L9IA 3TKUA 2YEXA 1WMKA 3H0YA 4MD8E 4GS6A 3UNKA 3VRYA 3CXWA 1ZMUA 3JYAA 3EZRA 2JBOA 4K77A 4JBPA 2BAJA 3FL5A 4M69A 4MVFA 2HWPA 3U4UA 3BGZA 3WF7A 2PU8A 2O63A 4KWPA 2OO8X 1E1VA 3QQLA 2E9OA 3A7JA 2XNOA 4ZZMA 4Q5HA 5DPVA 3VUDA 2JFLA 4WNPA 4E1ZA 3EHAA 1XBBA 3LFDA 2FUMA 3LFNA 4FZ7A 4F70A 3AKKA 3GUBA 2J5EA 3RWPA 4E7WA 4FGBA 3RK5A 3Q2JA 3GOPA 5K0XA 4BBFA 4CFNA 2A2AA 3MPMA 3L8XA 4MD9E 3RPSA 5BVFA 3C0GA 5KMNA 2WB8A 3GBZA 4CTCA 2ITUA 2BDJA 3FJQE 3QTWA 4FSTA 5HCYA 3OCGA 3A99A 4APCA 3R1SA 3O8UA 2XKFA 4ZSAA 3LQ5A 4O91A 3P23A 5EG3A 2CNUA 2BHEA 3NVMB 3EL8A 4H05A 1XHAA 3R71A 3FQHA 5ETAA 2W06A 3FLQA 4K0YA 4ZTRA 2DUVA 4DEAA 3F3TA 4DHZA 3HV4A 4B4LA 3VVHA 1UKIA 3C51A 3NX8A 2YM5A 3ZFXA 2QCSA 3PPJA 3RHXA 3POZA 2C68A 3ORIA 2UW4A 5ANKA 1OL7A 5CEQA 4D1XA 3ID6C 4FL1A 3V01A 1B39A 1W83A 3RZFA 2XAMA 5DYJA 2YIWA 3MTLA 2CDZA 3EJ1A 3KVWA 4KSQA 4X7QA 3A62A 3G15A 5EW9A 4BTMA 3QGYA 2PUUA 5ANGA 2DS1A 3F5PA 4ZIMA 4RIYB 2OJIA 4ENYA 2GNIA 3O7LB 3QTSA 5H3QA 5LMAA 2Y0AA 1YWVA 3TTIA 2ZMCA 2P2HA 1SVHA 2WTKC 4ZMFA 2WELA 3ZU7A 2H96A 3QQGA 2IPXA 3RAKA 4IM0A 2XIYA 2FSMX 4YMJA 5H2UA 5T3QA 3KXZA 5AA8A 2YN8A 4YUQA 4J52A 2XM8A 4ACHA 5L2IA 2A19B 3VUMA 1U59A 4IVDA 3OVVA 2GPHA 3HECA 4XS2A 3QD4A 4BDAA 4UMPA 4DINA 5L6OA 1UV5A 4FV2A 2BZKB 3EWHA 2C4GA 2QQ7A 4GJ3A 4PDOA 2PVRA 3ZSGA 3U6IA 2OH0E 4R77A 3QU0A 1O6KA 4XNEA 4DAWA 3LFBA 3VBYA 3LMIA 3G9LX 4G34A 4JI9A 4F65A 3KREA 3PZEA 1ZMWA 3HAVA 3PPKA 4Z9LA 4C57A 3PFYA 3NS9A 4YLJA 1FGKA 3H3CA 3IECA 5C03A 1RQQA 3O8PA 3DLSA 1R39A 5AJQA 5IH4A 5CASA 5BQ0A 1R0PA 1B38A 1FVRA 1YOLA 1IAJA 4P7EA 2PZPA 4FK3A 5GNKA 4DEDA 4EQUA 4RC2A 5EM7A 2OF2A 2R3PA 4J53A 1V0BA 2BTRA 3REPA 4W8EA 1JKLA 2BDWA 3ERKA 2EWAA 4KIPA 3RAIA 4UMRA 3NUYA 3OP5A 2CN8A 3POOA 3OUKA 4MF1A 4NTTA 3FMJA 2F7ZE 2CLQA 3GC0A 1H24A 2Z7LA 3NWWA 3COMA 4R5SA 4M84A 5LOHA 2YITA 2XKDA 2HYYA 1JKKA 3E3PA 4LOOA 4AQKA 5EQEA 4EHZA 2KULA 2ZV8A 5AV4A 3QGWA 4NW5A 4YZNA 1SYKA 4BWKA 4CFVA 5CSHA 3EN5A 5EYCA 2IW8A 4EC9A 4AAYA 5BVEA 3BYVA 2HENA 1A48A 4Z16A 1URWA 2IF8A 3MY5A 3P5KA 4GUEA 2W9FB 5DNRA 4ZTNA 3NNXA 3QQUA 3QKMA 4FSQA 4I6BA 5HVYA 4XP0A 4AGDA 4J7BA 4FYOA 4QMMA 4DT8A 5E8ZA 4OT5A 3CPBA 2J90A 5IMXA 4M15A 3NFGB 2RG5A 3E87A 2BCJA 4HZSA 1TQIA 2VTAA 4LM5A 3SLSA 3FQSA 4FTOA 4JT3A 5KMMA 2XARA 4XX9A 2JAVA 1OKYA 3QX2A 5CZHA 5FDXA 3RM7A 1CTPE 2VO7A 1Q8UA 4DGOA 5IQFA 4ENXA 3CS9A 4YTHA 3AC4A 2GU8A 5CX9A 4FEQA 2WEIA 5B2MA 5EYKA 2VTRA 1QMZA 2OFUA 2R5TA 2I0EA 2XVDA 2EB2A 4YO6A 2I0VA 1ZYSA 5C9CA 1PF8A 5HORA 5H8BA 1UNGA 4W4WA 3W2SA 3NNUA 3DNEA 3Q04A 4OGRA 4B7TA 1XH6A 4HNFA 5CAQA 2B55A 3RKBA 3W10A 3OD6X 1VJYA 4LV8A 3PSCA 3NYXA 3TNWA 1PMVA 4IBMA 4CD0A 4FTRA 4FT0A 1NW1A 2BMCA 3GT8A 4FV7A 4DFYA 4F4PA 4FR4A 5JRSA 1YOJA 4PTGA 3ENMA 5JZJA 4ZY6A 5EHOA 2AYPA 4EZ7A 5D41A 2R3GA 1H1PA 4DFUA 3SKCA 4MKCA 2GNFA 4U42A 3KL8A 3H4JA 4RG0A 2GNGA 2XNPA 3NDMA 1BL7A 3WIGA 4IVAA 2JEDA 3D14A 3GCVA 5DEWA 4FE2A 4FSUA 4AAAA 1PXJA 2VN9A 4Y72A 5L2SA 2R3MA 4H3BA 1LPUA 4MXCA 4XG2A 1MP8A 4AG8A 3PLAE 2ETMA 3OG7A 3OZ6A 1ZYCA 4PY1A 3C0IA 2OBJA 5KO1A 4KIOA 4RIYA 3FLWA 3ROYA 2SRCA 3RVGA 3ORXA 2ZOQA 4FA2A 2P33A 4C3PA 3ORMA 1Q8ZA 4R1YA 4O6LA 5CSVA 4GV1A 4CYJA 5T68A 4YTFA 3TM0A 3OC1A 2Z60A 3R1NA 4C0TA 5IA2A 3LM0A 3R73A 5AMNA 3W0NA 2CSNA 4RRVA 3AC1A 1YDSE 4L44A 1SVEA 2HW6A 4GMYA 3MIYA 4C4EA 4QT1A 5AAGA 4CGAA 5DT3A 3U9NA 3ZHPC 4WSQA 3FZOA 3A2CA 3K2LA 4D55A 1QPDA 2YDJA 2UZEA 5AR2A 2XK3A 4DITA 4E6DA 4GEOA 3C13A 3FAAA 4BKYA 4EOOA 2E2BA 3EQIA 2CLXA 3OWKA 3VNTA 5BX0A 3F82A 3NYNA 3QCSA 1OITA 3MH3A 4U7ZA 5FBNC 3FQEA 5LMKC 4AZVA 1H8FA 5AV2A 2ZVAA 2XUUA 3IK3A 2RFSA 4YJUA 4J97A 5DHJA 5FEQA 4E8AA 4E3CA 3FLNC 4PV0A 3IW4A 5M56A 2X6DA 2PVLA 3FXXA 4A9SA 3AMAA 3ML1A 1DI9A 3GQIA 4C3FA 2XF0A 3M2WA 5EDRA 1Z5MA 4FSYA 4EH3A 2GTMA 1H0VA 4U3YA 4PL5A 5AR7A 4Q2AA 1LEZA 3I7CA 4IC8A 4FKLA 2AC3A 5K3YA 4HPUE 3SC1A 3QALE 5E8SA 3RAWA 4AFJA 1HOWA 5EOLA 5IUHA 3MESA 1APME 4QQJA 2BRGA 3H10A 2CKQA 2PMLX 1BI7A 4A9UA 2YIXA 5BYZA 2V7OA 3MJ1A 4D4RA 2RIOA 4MHAA 4PDYA 3COHA 3C4FA 3T9TA 4ERWA 4FT5A 3R8LA 2PZYA 3FZTA 4HOKA 4EI4A 5I3RA 3KCKA 4DDIA 3JPVA 3L9NA 4NCTC 4PMPA 1DAWA 3ZZWA 2BKZA 3CD8A 3EYHA 3FI4A 3KU2A 3SAYA 1U46A 3ZO4A 4FKUA 4QP3A 4MCVA 4RX7A 2REIA 1SNXA 2WIHA 1Q3DA 3ODZX 1W84A 3HKOA 3QAME 3BLRA 3R02A 4FEWA 3NUSA 1H28A 1TQMA 3Q32A 2EXMA 1Y6AA 4KRCA 5I9UA 3H9RA 4UY9A 3DKCA 4MF0A 3F5XA 4EL9A 3FC1X 3VBWA 3F66A 3VS3A 2V7AA 5TOZA 2OJGA 2WFYA 5HVJA 4CCBA 4IADA 4EH6A 2QOOA 3ZC6A 3GCUA 1XH7A 4XG6A 4EOIA 4CG9A 4BCKA 2WMUA 3PIXA 3QTIA 5C27A 3R7VA 1GZ8A 3GFWA 5CU2A 4YJNA 5DRBA 4O7YA 4X2JA 2YM6A 3SOAA 4Y5QA 3ZXTA 1ZARA 3G33A 4IX6A 5HTCA 1TVOA 4EHVA 3AC5A 1OIYA 1OPJA 3DZOA 3KEXA 4LFIA 3LKMA 4FT3A 5HNBA 3SXFA 4H3PA 1P5EA 3UTOA 4G2FA 2BIKB 4II5A 2J5FA 2XB7A 3IW6A 3ULIA 2PULA 3QTXA 3UVRA 2AQXA 2Z7QA 3FXZA 4QMPA 4AW2A 3GQLA 5CSPA 1V1KA 2Y6OA 4HGSA 2XK7A 3Q3BA 4IQ6A 3DQXA 4TYHA 4G3CA 4EH2A 4FT7A 3OCBA 3R0TA 4N6YA 5DLSA 4BI2A 4ASEA 3NNVA 3NYVA 3HV3A 5L2QA 3PJ2A 4QMVA 2JITA 5LARA 2V22A 4AZWA 2W1DA 1PMEA 3LOKA 4I6QA 2EB3A 1JWHA 4L43A 4KD1A 2CKPA 2VUWA 2Y9QA 5F4NA 4M8TA 3PDTA 4ANSA 1T46A 4XJ0A 4ZLZA 4KABA 5AA9A 4O38A 3GNIB 4FV4A 1JSTA 5CZIA 3KMUA 2UV2A 1Q4LA 2JIVA 4FKIA 4DEIA 3P0MA 5HG5A 2OXXA 3TNQB 3RP9A 4AGUA 5KX8A 2H6DA 4GKIA 4QNAA 3MV5A 4JBQA 4FTCA 3A8XA 4JR3A 4FRFA 3I7BA 5E92A 4I92A 2ZJWA 3EQCA 3ZTXA 1ZAOA 3Q9ZA 2XK8A 4ZS0A 2CHLA 4GW8A 2HELA 4ASZA 4AT3A 1KE6A 4BZDA 5M09A 4R7BA 4EJNA 4BICA 2X2KA 2HZ0A 1MRVA 2E9UA 3MS9A 3LJ1A 4XYFA 2XK9A 2ITQA 4D1ZA 1UKHA 2NYAA 4EOMA 4RC4A 4GH2A 4FSMA 1GNGA 4K33A 4XH6A 3NR9A 4RVLA 3RCDA 3UDBA 4DG0E 3TUDA 2PUNA 3EZVA 3PP0A 4FVQA 5GZ9A 1XKKA 4A9TA 1VYZA 3QCQA 3UMWA 3ZBXA 5A4QA 5BUIA 2C6OA 2JAMA 3MTFA 2WQEA 2OJ9A 4ZLYA 4CMOA 2R64A 4XP3A 1XWSA 3QLGA 3MA3A 3ZBFA 4QPAA 4WOVA 3QQFA 2YCRA 3TT0A 5AR4A 1OL1A 3R2BA 4IAIA 4QP8A 4D28A 4F6SA 3S4QA 2J51A 3S0OA 5L2WA 4FTTA 2YHVA 2J0IA 5CF5A 2VTTA 2YCSA 3E63A 3LMHA 4D2RA 4R1VA 4QO9A 1PY5A 2PE0A 4IDTA 3EOCA 1W8CA 1Q61A 4IACA 1UA2A 5JQ5A 2VTHA 3VULA 3OUNB 4YTCA 3MWUA 2CCHA 4R78A 5EM5A 4O0WA 5GJGA 3A4PA 1NVRA 5LJJA 1YDRE 3DJ7A 5FG8A 4D4VA 3NW7A 3SGCA 3RWQA 3ZSIA 3FI2A 4ANOA 2YLEA 4BC6A 5LVOA 3AMBA 3LXPA 3G6HA 3E7VA 2FB8A 2QNJA 2P0CA 2XA4A 4KNBA 1ST4A 3CQUA 3R9HA 3UYSA 2X7GA 4BKZA 4EJ7A 3LFFA 5CT7A 4O4FA 1E9HA 3M42A 4YJPA 3ZO3A 4A07A 2F49A 3V5TA 4TPTA 4B6LA 2VU3A 4NM3A 2VD5A 4C35A 4YGAA 1Q24A 4EONA 1BI8A 1Q8TA 3PVUA 3OOGA 4I20A 4L3JA 2X7OA 2G15A 2JKOA 3KXHA 4GVJA 4YBJA 4C4HA 1YI3A 4B8MA 4UMTA 4QMWA 1JOWB 5EW3A 3UNJA 3EN4A 1GAGA 4R7IA 2OKRA 5HU9A 3OW4A 5IISA 2J0MB 2VTPA 4UMQA 4QTDA 3GU8A 4I5HA 3TZ8A 3CTJA 3F6XA 3OF0A 1VEBA 4NU1A 3PVBA 4ACMA 2FGIA 3MIAA 3TV4A 4EH5A 3UG2A 4D0XA 4OR5A 4AGWA 5EFQA 2H8HA 3GC9A 5HNGA 5IA1A 3W0MA 2PPQA 4D2WA 2NPQA 2OLCA 2J2IB 2G2FA 3OXZA 5BYLA 4BI0A 4DGLC 3DAKA 1H01A 4BHNA 4Y8DA 2IW6A 4L67A 3PVGA 5I9ZA 3FMNA 3Q4ZA 2ITYA 3I79A 3KCFA 5IQCA 1Q41A 5CU0A 3GU5A 4F1TA 5KMJA 1VYWA 4CCUA 4H58A 4IJPA 2UW3A 5CWZA 5AP6A 4PDSA 4BDBA 4B99A 3F3UA 2C3LA 4AXFA 5AADA 3KN6A 2BRBA 3I1AA 4IANA 1H1SA 4ZSEA 4ZSJA 3WZKA 5CEPA 3VF8A 4XRLA 3RALA 1W2CA 2OU7A 1XO2B 2XK6A 3ACJA 4YPDA 1H25A 4FV0A 4FVPA 2X8IA 5DGZA 5HTIA 5K4IA 3BWFA 2HAKA 4P4CA 2BDFA 4LMUA 3CGFA 3E8CA 4KKHA 5DN3A 3RJCA 4UX9A 4QMUA 3CPCA 5BVOA 3QA0A 4Y83A 3KRJA 2JGZA 3PRFA 4MWHA 1PHKA 2R3HA 3A7GA 3BWJA 5AV1A 2ZAZA 2GQRA 3E3BX 4G6NA 3AGLA 5BVDA 2W9ZB 4HGEA 1KUTA 2YZLA 2QLUA 5HIDA 5E8YA 3HZTA 3IOKA 3T8OA 3ITZA 3R63A 2R2PA 2QVSE 1Q8WA 4E5AX 2R3IA 3P79A 3D9VA 3FXWA 4O0TA 5DIAA 4ZY4A 3QQKA 4C3RA 2Y4IC 3E7OA 4IAZA 3IW5A 4EK4A 3O50A 4F0GA 4XG3A 5TE0A 1KOAA 4JLCA 2XIXA 3SW7A 2W1CA 2QONA 2OF4A 4FF8A 5HHWA 4AUAA 1R3CA 5JSMA 4ITIA 4M13A 3DJ5A 4XEYA 3NCGA 2XYUA 4IAYA 3FLYA 3IW7A 4JRNA 4X3FB 1OZ1A 4DFLA 4PNKA 4GU6A 3PA3A 5E8WA 3RINA 5JQ8A 4FX3A 4XV1A 3DCVA 4DHJA 1ZOEA 3I5ZA 3PWYA 4IWPA 3CQWA 2OGVA 3FPMA 4JNWA 2WMSA 4HCTA 3GCPA 4DEBA 4HGLA 4F7NA 5JFXA 5AX9A 4C2WA 2OIBA 1XH4A 4ZMEA 5LXMA 4BCQA 4W4XA 4PL4A 5BYYA 4ZSGA 3UZPA 5ACBC 2R3QA 3OS3A 5IQIA 4GT4A 3LFCA 5CVFA 4BTKA 4MXYA 2QD9A 2ZB0A 5KMIA 3ZDUA 4Z7HA 2J0JA 4QD6A 5KKRB 1RDQE 4L46A 4C02A 5IZFA 1CKPA 2XNMA 2J50A 2OG8A 2YCFA 4NIFA 3ZUVA 5ITAA 4DA5A 4BF2A 3NIZA 4EYJA 3Q2MA 2YERA 3MY1A 4AQCA 5AIKA 5AX3A 2PYWA 1TKIA 3D5WA 3E8EA 3H9FA 1Q3WA 2C69A 3PYYA 4FKJA 4E5WA 4EZ3A 3I5NA 1H07A 2X9EA 3EN6A 2XKCA 4XG7A 2GQGA 3W1FA 1NY3A 2XK4A 2WHBA 3T3UA 4O4DA 2OIDA 3ZO2A 3C4XA 1WVWA 2PVJA 3OROA 3GU7A 3PRIA 3PY0A 3ORKA 4E5BA 2W1IA 2B4SB 4FTLA 4JDKA 4FKQA 2UW7A 1M17A 4UWBA 2YAAA 5AUXA 1BKXA 4HW7A 5FXRA 1KE9A 4YZCA 4PRJA 1GIIA 4IX4A 4EOSA 5AAEA 2C0IA 2ZV7A 4CZTA 5J1VA 2W1GA 2C6MA 3FKNA 4EUUA 2R0IA 3HL7A 2J7TA 2ZDTA 3R22A 4FOCA 4OBOA 4MNFA 4ALWA 3S3IA 2XNGA 3ZMMA 3QQJA 3FZRA 3BL9A 4AA5A 3ORPA 3HX4A 3W2PA 3QF9A 5KE0A 2BAQA 3CTHA 3IGOA 3DBCA 1H27A 2R3NA 3HV5A 5CSWA 5AP7A 1Y57A 5IUIA 3ZLWA 4D2TA 5DMZA 5M08A 4UN0C 5FEEA 1QPJA 4OTDA 2EUFB 3DT1A 3G6GA 4YR8A 5HNIX 3UJGA 4QOXA 3TZ7A 2WGJA 4MXZA 5HE1A 3NNWA 4CZUA 4FKRA 3SVVA 5EYDA 4EQMA 2ITOA 3BE2A 4XG8A 3HP2A 3PY1A 3I4BA 4O0UA 3SG9A 3F69A 2XM9A 3BU5A 2BROA 2C5YA 3HA8A 5AV0A 4NEUA 4RJ6A 1P4OA 4AZSA 3Q5IA 3O5AA 3MN3A 2WTKB 3QL8A 1NVSA 2VGPA 1H26A 5J9LA 1K2PA 3SD0A 1LEWA 4I22A 3KK9A 5C26A 4QQTA 1NVQA 2VWZA 3NGAA 3GOKA 4RMZA 4CT2A 1U4DA 3FSKA 3ULZA 3ALOA 1K3AA 3HMNA 4MQ2A 4BKJA 3F9NA 4O84A 3AC2A 4GVAA 5HCXA 1XBAA 4G6OA 5C8MA 2B9HA 4KKEA 2UZLA 2V5QA 2YJRA 2ZMDA 4I93A 4FJVA 4O7ZA 1ZYDA 3KRWA 4TWNA 3DXQA 5IU2A 3AD5A 4UEUA 4DH3A 2QOHA 4ZEGA 5GZ8A 3HRCA 4AZFA 3TWJA 4Z7GA 3DY7A 2PSQA 2WEVA 4FG8A 1F3MC 1ZZLA 2UZOA 3LLTA 4GJ2A 4OAVB 3LPBA 3T9IA 4RX9A 5K5XA 1Z9XA 2GSFA 3AQVA 3FZSA 4M14A 3KF7A 3CD3A 3FYKX 3O17A 3ATTA 1OL2A 1W2FA 5BUJA 4O96A 1B6CB 1M7NA 3WF8A 3V5QA 4CLJA 2ONLA 3HLLA 4RFYA 1M2PA 2J0LA 5FRIA 5I3OA 5E4HA 2OXYA 1OL5A 1Z57A 2WNTA 3MBLA 5TO8A 4EK8A 3BLAA 3QCXA 4BWPA 4Q5EA 4X3FA 2LAVA 3PXZA 2HZNA 4RIOA 1WVXA 3MH2A 4E20A 2C6EA 1RJBA 4BTJA 4K11A 2VGOA 3BHTA 4ZY5A 1WBWA 3D5UA 1U5QA 2I1MA 4K6ZA 4PPCA 2HIWA 1F0QA 3NZ0A 3PE1A 3Q9YA 4RGJA 5I0BA 3ZFMA 3VS0A 3MVMA 4C4IA 3DK3A 4OTPA 3ATSA 4C38A 2IEWA 5HKMA 2UZUE 3LJ0A 3KFAA 4FKOA 2WMWA 4C4GA 3BLHA 3O96A 1KE7A 1OL6A 3MH0A 2ITWA 4B8LA 5M44A 4RPVA 3BHYA 2YIRA 3SX9A 3GU6A 4IAFA 4QQCA 4I0RA 1Q99A 4RQVA 3BCEA 5AIRA 1WBTA 4QP7A 4RX5A 2O0UA 1AD5A 2VWIA 5IQDA 2W5HA 4O0SA 2BRNA 3VN9A 3ZLXA 3R6XA 2XCHA 1QCFA 3PXRA 4KBCA 4U5JA 5FP6A 3VUTA 4YHJA 5CEKA 4BGHA 5ANJA 4N4SA 5AP4A 2ITTA 3SRVB 4RLKA 3RCJA 4PTEA 2ZFYA 4FNZA 5L3AA 3PA4A 5J87A 4FZDB 5FWKK 2E9VA 3ORNA 3VWAA 3SA0A 1H1WA 4BCOA 5EDPA 1R78A 2VTMA 2XYNA 2ZV9A 1CKIA 2CCIA 1XBCA 3KK8A 3NAXA 5IF1A 3EQDA 3KMMA 1JKSA 4FG7A 3RI1A 4O0VA 4QMNA 4O0YA 4J95A 2HCKA 4NZWB 5EDQA 2QG5A 4YTIA 5KHWA 4BCGA 4AN2A 5E9EA 4DH5A 3R1QA 4ACDA 3QC9A 4RVMA 3H30A 2GMXA 3THBA 5AP0A 2VWVA 5HE2A 4AACA 4W9XA 5CLPA 4CT1A 4XOYA 1A9UA 5B7VA 4XBRA 3F5GA 5I9YA 4CTBA 3NW5A 4EOLA 2OSCA 2VNYA 3QTRA 4IWOA 1SMHA 3CEKA 5CQWA 3TV6A 4O2ZA 4I4FA 4WKQA 4RIXB 3V8SA 3W8QA 3CSVA 1CMKE 5FDPA 3LAUA 2YZAA 1W7HA 2YFXA 2PMIA 2JFMA 3C5UA 4J71A 4L42A 4OBQA 3Q52A 2FSTX 2R3FA 5KMOA 3EMGA 2QR7A 4QP6A 4U40A 4D5KA 4GT5A 3NFFB 1YDTE 3OWJA 4GCJA 4LOQA 1WCCA 4TYJA 3U54A 4GYGA 4ZJVA 3TMOA 4GK3A 1IR3A 1M14A 4GFGA 4A9YA 4G9CA 4MXOA 1TFFA 4U41A 1DS5A 4YLLA 3RK7A 4DFXE 4IAAA 4HYSA 3UIBA 2QO7A 2IWIA 2YACA 1J91A 4GFMA 1JSVA 2W4KA 4IVBA 4XUFA 4C59A 3W2OA 3PUFC 1KOBA 4JDIA 5CU4A 4RZWA 3TL8A 1YHVA 4O7RA 4D5HA 4HGTA 3ZEWA 3P7CA 3M11A 3P86A 3RGFA 4I0TA 3DJ6A 2UUEA 4BI1A 3QTZA 2QKRA 5B2LA 4YJVA 2BKKA 4DE4A 2CN5A 3QD0A 1ZMVA 3CGOA 3EQPA 5CEMA 2ZM3A 3EQRA 4TYHB 4TXCA 2HW7A 4EK3A 4ASXA 3BV3A 4H1MA 4ZTSA 2QG7A 4KB8A 4ZXTA 4JOAA 5D7VA 4E26A 4XP2A 4AGCA 2YABA 4IE9A 3A7HA 4KINA 2WIPA 3B8QA 4MBJA 3RM6A 4F7JA 5HGIA 4TWOA 2FA2A 2XNBA 4FSNA 4M68A 3CTQA 4XG4A 3V5JA 4DLIA 5DE2A 4CSVA 5LQFA 4AXCA 4HYUA 5DT4A 1UU7A 2UVXA 4EOJA 3R1YA 4AU8A 4MNEB 5L8JA 4A4OA 1UWHA 5HLNA 5FLFA 4BYIA 2Y4PA 3D7TB 3S00A <