4HPTE

Crystal structure of the catalytic subunit of camp-dependent protein kinase displaying complete phosphoryl transfer of amp-pnp onto a substrate peptide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphoryl transfer by protein kinase a is captured in a crystal lattice.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 100
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hptE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hptE02
3PSDA 2J5EA 4RIXB 3QTWA 2WMBA 5DFPA 1G8SA 1W82A 5JFSA 1E9HA 1KV2A 2VTLA 3FLNC 4IM2A 5ANIA 4ORKA 4AACA 4CFVA 3FMDA 2FB8A 4IC8A 5K0XA 4PTEA 3PDTA 4K1BA 5CSVA 4O7WA 4F7NA 3LCOA 4KD1A 5JGBA 2J0IA 4A9SA 5I9WA 2W0JA 4DGMA 4I6BA 3FWQA 2ZV7A 4Y83A 3QCSA 2GS2A 4FL3A 4GH2A 4XS2A 3PG3A 5BVKA 2PVRA 4XG2A 3GU5A 4C3PA 1RW8A 4G6NA 4YJQA 3DDPA 1Q8ZA 4MXOA 5HCZA 3SHEA 4ZAUA 4B6LA 2R0UA 3DS6A 1KE8A 1PYEA 2JD5A 2W5AA 3KXMA 4LG4A 4DBNA 3HMOA 1NT2A 4RBLA 2J90A 4QTDA 4XHKB 1MUOA 3I0QA 4KA3A 5CALA 5LVNA 5IQIA 3ZSIA 4FEQA 5GJFA 1PY5A 1UWHA 4YPSA 3RK9A 5FQDC 5FEQA 3ZYAA 4W4XA 2GPHA 2ZMCA 5DT3A 2CN5A 3ZLYA 3QGYA 2OW3A 3R21A 4ASDA 3EZVA 2HCKA 3U9CA 5E8YA 5AJQA 3VC4A 3ATTA 4O0VA 2Y4IC 5KMIA 4L7SA 4IDTA 5A4LA 2VTHA 3UJGA 5IEYA 3IK3A 2YDKA 3Q9ZA 5L2QA 1OIQA 2BZJA 3MPAA 2R5TA 2R3PA 3GU4A 2VD5A 4JT3A 4ZY6A 4D1SA 4LRJA 4XG7A 5BUIA 2ESMA 4I24A 5AUUA 3OVVA 5EHOA 2OFUA 3DB8A 2YWPA 2W1ZA 2WQEA 1MRUA 1H1SA 2WHBA 3MGYA 2G2FA 4LL5A 3F3VA 4IVCA 5ACBC 5ETIA 4DFYA 3C0HA 4UYNA 5D11A 2HY0A 3D5WA 5HNGA 3LZBA 3FLZA 3GQIA 1U54B 4NW6A 5AA8A 3LFBA 3ZM9A 4GJ3A 3IKAA 3MWUA 2XJ1A 3NW6A 3OXIA 4O0YA 4AE6A 4O7VA 2C6OA 2VGPA 1B38A 1H0WA 1ZRZA 3PJCA 2ZVAA 2XZSA 2ZAZA 4EC9A 3P08A 4FTLA 4D0XA 3AQVA 5CENA 3LMHA 4Q9SA 4BRXA 2R3NA 4JQEA 4FICA 3WF8A 2UW4A 4MKCA 2ERZE 3GU7A 4HGLA 5BUEA 4C36A 5JGAA 3VJOA 4BKJA 5EK7A 3VUGA 3SXRA 3ULZA 2E2BA 4EWQA 1KWPA 4XBRA 2ITYA 4CNHA 3FMLA 3FLWA 4FEWA 2XJ2A 2VO3A 5D9HA 3PY3A 3NR9A 2PK9A 2PMLX 2YDJA 3FLQA 3L9NA 2X8DA 4L9IA 4NIFB 4E4XA 4ITHA 4QMOA 3ZZEA 5J1VA 2VTJA 5I0BA 2XIXA 2P2IA 2B9FA 2W5HA 3A62A 4FTOA 4U80A 4D55A 4F6SA 3Q96A 4FSYA 3BU6A 3NAYA 3TV7A 4PNKA 2WTDA 3UVQA 1GZNA 3TUCA 4IB3A 4JBOA 1BL6A 5E8TA 4ZLYA 3NW5A 3QA8A 4YP8A 1Y57A 4MEDA 5CU3A 4F64A 3GEQA 5M4CA 4WSYA 3AD4A 3SG8A 1KOAA 4N6YA 5KCVA 3DV3A 3HAMA 4O6EA 4AZFA 2C4GA 1VR2A 4QQ5A 5C4KA 2H9VA 4MYGA 2QODA 5HD7A 4R7BA 3MV5A 1JLUE 3OEZA 5HORA 2QOCA 1ND4A 3MN3A 4ZSJA 2WFYA 1SZMA 3QTSA 4TZRA 3DJ7A 2O64A 4NW5A 5EM5A 1H1PA 1JOWB 2QOIA 4IZYA 3QQKA 4M3QA 3DFCB 4XOZA 3E3BX 4FKJA 1GZ8A 5AP6A 5KMMA 4YMJA 4IAYA 4D4SA 3U8WA 1YQJA 3FLYA 4M68A 4L3PA 4AX8A 2BDWA 3KGAA 2GS7A 4U42A 1L3RE 3WZKA 4EOOA 2CGWA 2VNYA 3OTVA 4V0GA 3ORLA 3AMBA 3UZTA 4BIEA 2YWVA 3GOPA 3R7YA 3S95A 3QXPA 3A7GA 5LXMA 4AWIA 4ZLZA 2X9FA 4XRJA 4NU1A 4ZMEA 1KV1A 4PL5A 3KRJA 4KINA 3F61A 3V5QA 3NS9A 3LFSA 2PE2A 4J71A 4N4SA 4QOXA 2YN8A 3A7JA 2GMXA 2Q0BA 4NM0A 3WF5A 5CS6A 4R7HA 4FV6A 4YZMA 2BZKB 2XA4A 1U5QA 3MTFA 4LOQA 4M69A 4RJ7A 2J0JA 4XH6A 3UIMA 3MYGA 4JDKA 4D2VA 4TL0A 3G6HA 3H9OA 4YZ9A 5C03A 3VIDA 2RG6A 5ANJA 1OL7A 3KU2A 3VS6A 2J2IB 2Y9QA 2A4LA 4DTBA 2W5BA 2G2HA 5EI8A 2CMWA 2GTMA 3O17A 4EHGA 2ITTA 5E8UA 3W16A 2XB7A 3I1AA 1XJDA 5CQWA 3NSZA 3I81A 4J52A 4RZWA 5CT0A 5LVMA 4LGHA 2HWOA 3F3WA 5AP1A 4E5BA 1UU7A 2BFXA 2QC6A 4GFGA 4WT6A 4A07A 4EK6A 3MY5A 3NUSA 5LCKA 2OWBA 4X21A 3FHRA 3NEWA 3OFMA 3TL8A 2UZVA 2BRMA 3VW6A 4ERKA 1OBDA 2RG5A 2VWXA 1YW2A 4QQTA 5CAPA 3SGCA 4AFEA 4Y8DA 2WIHA 2CDZA 3OWLA 3Q52A 3V04A 3VQUA 4CSVA 3FC1X 4I92A 3LOKA 1LEWA 3IG7A 3PIZA 4QP9A 5D10A 4DFNA 3PRFA 3I5ZA 5E1SA 3EKKA 5HE2A 3ZC5A 2B9IA 5GJGA 2GFCA 1ZMWA 4HGSA 5K0KA 4ANNA 5DI1A 2BIYA 3Q32A 3UTOA 3AGLA 3VUMA 1BKXA 3ORZA 5E4HA 3JS2A 4ZIMA 4MBJA 2Y0AA 3S2PA 1OKZA 4EH2A 2V62A 4EOSA 4DEEA 1O6LA 2BILB 2OZAB 1PXKA 3I0OA 4DF3A 3DNEA 4WG3A 2YIXA 4V05A 4D9TA 4DH5A 4JVGA 2QU6A 3OS3A 5CEQA 4O7LA 2WB8A 3F82A 2VWIA 4DH3A 3FZRA 5JFVA 3JVRA 4FYOA 2VNWA 3LXNA 3EQFA 2HXQA 3LCTA 4MXCA 2WO6A 5JQ5A 3LFCA 4C3FA 2WU6A 4UXLA 4CQEA 3VS4A 5A4TA 5BMMA 5HQ0A 3UDBA 2PHKA 3KMUA 1BUHA 5CU4A 3R8ZA 4UYAA 4ZSAA 2VTMA 4DG0E 2F4JA 4LL0A 1SVGA 4R5YA 3W1FA 3NX8A 4UV0A 3DAEA 4FIJA 3KK8A 5GZ9A 4ZZOA 2I0EA 4GYIA 5DH3A 3ZLSA 4TKSA 2QLUA 3R7IA 3ZUVA 5L6WL 1A06A 2PMIA 4K8AA 5M55A 3BZ3A 4BZNA 4PDSA 1WMKA 2CCHA 2WKMA 2QOFA 4RJ6A 4D4RA 4CKIA 3VHEA 5EM7A 3FBVA 4JLCA 3OWJA 4RC2A 4G3EA 4PP9A 3UYSA 4GCJA 1YI3A 4AW0A 4ACMA 2PWLA 1BMKA 3ERKA 3QC4A 2B4SB 4CRLA 3TUDA 3GOKA 3FC2A 4QQJA 4DFLA 2FVDA 4NFMA 5CAUA 4BCMA 4F70A 3R7GA 4EOJA 2HZ0A 2WQBA 4EH5A 1OBGA 2G2IA 4GYGA 2QKWB 4WKQA 4X3FA 4FIIA 1CM8A 5D7VA 3WBLA 4JBVA 4L01A 4WO5A 3NPCA 5FBNC 4BC6A 1K3AA 4O82A 3C0GA 1REJA 2XMYA 2EXEA 4OTPA 4P5QA 4A9UA 5J7HA 5M4IA 3R9RA 3RP9A 3UO4A 5L3AA 2QOKA 5GINE 4EH8A 5H2UA 4USEA 4QRCA 2W06A 3RMFA 4GMYA 3OW3A 4AN9A 4PF4A 3KKVA 1BLXA 3UOKA 1MP8A 4S33A 2PVKA 4D2SA 4U41A 1K9AA 1YWNA 4I6FA 4OTDA 3DK6A 1KUTA 4X3FB 3EHAA 4YLJA 4RRVA 1WBVA 3A7IA 2P2HA 2QURA 2VO7A 2WMXA 3DB6A 4JRVA 5E9EA 2XP2A 3HLLA 4FKRA 5L6PA 1WBTA 2E9OA 3KF7A 3KN6A 5JGDA 5IA4A 1IG1A 3C4CA 2VWWA 2FSOX 2VTPA 3ET7A 4IMYA 4RQKA 2OIQA 4F7LA 4G5JA 2PTKA 3MTLA 3U87A 3RPVA 2HENA 4HJOA 4QYYA 5HE1A 3P7AA 2C3IB 4YBJA 3ZRMA 3PP0A 3I4BA 4FV5A 4EBVA 2X7GA 3PSCA 4FUXA 3IW5A 4LYNA 3Q6UA 2JDSA 1H08A 3G9NA 4FSQA 3HYHA 3K3JA 4YJVA 2DWBA 3CPCA 4YUQA 1UNGA 4RJ3A 4XLIA 3M1SA 4QMQA 2WPAA 3RALA 5LJJA 2YIWA 3QQFA 4AGUA 3EQPA 4JX7A 2O8YA 3CIKA 3U9NA 1LUFA 4U7ZA 4O81A 4K77A 2Y8OA 5EI6A 4R8QA 4D1ZA 2QOQA 4WIHA 3LJ0A 4YU2A 1NVRA 3ODYX 4XBUA 1YXUA 2XK7A 4WNKA 2CKOA 2PE1A 2J6MA 2UV2A 2ZV9A 3DK3A 1PXJA 4FIFA 3EN4A 1P4FA 1B6CB 4WG5A 3U6HA 3VW8A 2CKPA 3RTPA 3TNIA 5AADA 3FL5A 2C5YA 1M52A 4FZ6A 4DINA 2PU8A 1PMNA 4YJPA 3MH0A 4WRSA 5DR2A 3UO5A 4BKYA 2UW5A 4KSPA 4HPUE 1YDTE 2Q83A 1JWHA 2VTSA 3Q4ZA 4FTQA 4QP7A 4UZDA 4ZJJA 1OI9A 2OKRA 3V5PA 3ZXZA 4DEHA 2UZBA 3DAKA 3EYGA 4HVSA 3S0OA 5L4QA 2GU8A 1AGWA 5EYDA 4XV9A 3D2KA 1R0PA 2I0VA 3DK7A 2W1FA 4FSRA 5H9BA 1SNUA 2YCSA 4RFZA 4ZJVA 4TTHB 4IVDA 4BZDA 4L6QA 1U46A 3BPRA 3DBEA 3FZ1A 3KMMA 3QQHA 4GJ2A 5TKDA 5LWNA 3GGFA 4GG5A 3TEIA 4YHJA 3RAIA 4AZSA 2OSCA 3NCZA 2PSQA 4M7IA 1W0XC 4YJSA 2BMCA 3VO3A 3QQLA 3VBWA 4B9DA 2ITXA 5HGIA 2GNIA 4UMQA 3UIBA 3OWKA 5B2MA 2WTJA 1ZXEA 4ACDA 3R9HA 3A7FA 3SW7A 4AE9A 2YZAA 5EW9A 4EOLA 2E9PA 1OPJA 1W7HA 4L44A 1H28A 4OTGA 1WFCA 3VF8A 3SG9A 4F0GA 5BVNA 4KAOA 1E1XA 2X2KA 1TQPA 4O0UA 4G9RA 1UU8A 4XOYA 4XX9A 5IH5A 3PA3A 1JKLA 4W4WA 3EQRA 3MVJA 5HICA 4EHVA 2KTYA 4JR3A 3TJCA 2PVYA 1V0PA 5C01A 3V8TA 3JUHA 5B0XA 3VS0A 3JR1A 3U55A 3PA5A 2WMQA 3LXPA 4AN2A 4DCEA 4CYIA 1YRPA 1SVEA 4JS8A 1PXPA 3OMVA 5IA1A 4F09A 4FMQA 2XEYA 4EQMA 3V8WA 3N4UA 2B55A 4GFMA 5D12A 5FGKA 2FSTX 1SYKA 3NUNA 5EOLA 5AX3A 4D4YA 3V8SA 5J79A 3LKMA 2EXMA 3QA0A 3PPJA 4AA4A 1FVRA 4FVPA 4FKGA 4PP7A 5IMXA 1WBWA 3MJ2A 1ZMVA 3SA0A 2WQOA 1J1CA 3LQ8A 2C30A 5IQHA 3V6SA 5FEDA 2R3KA 4ANQA 3HUCA 4FV8A 2WU7A 3L9MA 3VUHA 1S9JA 4LOOA 5C27A 3H9RA 5D41A 2QU5A 5CVHA 5ACKA 1H27A 3VS2A 1GIHA 3LW0A 2OBJA 5HU9A 3C4FA 3TZ7A 4CT2A 3KN5A 4XV2A 4E4LA 4HPTE 2DYLA 4X2JA 5EW8A 4IAIA 2OIDA 4C8BA 3QCXA 4U45A 4EH7A 4QMUA 4BVUA 3CEKA 5FEEA 4DBXA 4M97A 5M08A 2C6KA 3NVKI 3KA0A 4Z9LA 1IA9A 3UZPA 4HYUA 2CLQA 3E8NA 3O51A 3FZOA 2PL0A 3RAHA 1GOLA 3QKMA 4CYJA 3GCPA 5AV2A 3P86A 5CSXA 4FUYA 5M51A 3BGPA 2C0IA 4ZTSA 5J8IA 5KMLA 3PFQA 4XG8A 4WBOA 5HEZA 4QTEA 4O7RA 4MXYA 3VUDA 4GFOA 2JBPA 2QQ7A 3G51A 3OF0A 3QD4A 4M0ZA 1OL6A 3GU8A 3O8PA 4CKJA 3P79A 3AC5A 5A14A 3R6XA 3M11A 2VWVA 2W4OA 5HLPA 4U3YA 3BI6A 2XS0A 4FV1A 3EQIA 3E62A 1IAJA 3LQ3A 3AGMA 4EWHA 5A4QA 3LMGA 4QQCA 1B39A 5C8NA 3F2RA 3SRVA 2X0GA 3HV3A 5HG5A 5M57A 2A0CX 3FY2A 3CXWA 2XIYA 3ORIA 5AP7A 4J53A 4B7TA 2R3QA 1OKWA 1HOWA 3MH3A 2W4JA 2ZB0A 4KIPA 5FXQA 2GDOA 2XK4A 2BCJA 3U6JA 4BI1A 2JBOA 5DEYA 4I5CA 4C62A 3R8MA 5JK3A 3Q9XA 1GNGA 4GU9A 4JXFA 5AIRA 4RVMA 2GCDA 3BE2A 3D0EA 4EZ3A 4P4CA 2KULA 2ETRA 2IW6A 5DR6A 4L53A 3PVBA 2BR1A 3GBZA 2JKMA 4QP8A 4S30A 4V0GB 4WUAA 4K9YA 3W2CA 5IDPA 3DNDA 4H3PA 1A48A 2P4IA 2XCKA 3P78A 1FQ1B 5HBHA 5HTCA 3G15A 1BYGA 2QG5A 3OEFX 2UW8A 3HMPA 4O27B 5AV1A 5AAFA 4OT5A 3TV4A 3TTIA 3WILA 1OVEA 1ZARA 3F5GA 4BCOA 3QKLA 3IS5A 3D5VA 4OTQA 2WTKC 4YLKA 3WZUA 4DG2E 3OBJA 3FI4A 3NYOA 3ZO1A 4C37A 4FT7A 2UZEA 4B0GA 3ZRKA 2UVZA 3LCDA 2C5NA 2WZJA 2GNLA 4U40A 4QNAA 2YACA 5TF9A 4H3BA 3EFKA 4MQ1A 4QMLA 4UWCA 5CU0A 4R1YA 4Y46A 3NNWA 5B2LA 4YJTA 3CKXA 4IXPA 4P5ZA 3A60A 3FXZA 5J1WA 3JVSA 5J7BA 2XKCA 2RFNA 3AC1A 3D14A 4NYEA 3SV0A 4CZTA 5HTIA 3F3ZA 4FTTA 4FKVA 3UQGA 3B2TA 3CPBA 4HOKA 3WZJA 2WD1A 1OUKA 3KQ7A 2WOUA 2ZDUA 3R02A 1ZOHA 1MRVA 3KULA 4XMOA 2Y6OA 3ZLXA 1H1WA 3A7HA 1YXVA 3H0YA 3G33A 3ZFXA 1JKKA 4AFJA 1GJOA 5CSWA 2RFDA 4R78A 1JVPP 3IONA 4G3DA 4PTGA 4O7SA 2XKDA 5KBRA 3PY1A 2J51A 3EFLA 4FT3A 4G3FA 5BVFA 2F7XE 3K2LA 3DDQA 2OJFE 2JDRA 5M06A 3TXOA 3DOGA 3RVGA 2A1AB 1J91A 5KKRC 1OGUA 4GK4A 4M14A 2GSFA 4XG4A 4EBWA 1G8AA 3ENMA 3W10A 1PYXA 2QI8A 1OIYA 2VAGA 2V22A 3IDPA 3KVXA 4D58A 4W4YA 3EJ1A 3SD0A 5IDNA 3D7TA 5K5NA 4EKKA 4I94A 1P5EA 4DLJA 4FSZA 1GY3A 4ZK5A 3NUAA 3UNZA 3A61A 4L67A 3WYYA 1K2PA 2UW9A 4NH1A 5GZ8A 3PLAE 1YOJA 3UQCA 2BZHB 2O3PA 3VAPA 3CQWA 2XM8A 4F0IA 5C9CA 1E1VA 2GNGA 4TN6A 3HP5A 5K4JA 5M09A 3G0EA 4J8NA 3ZSHA 3HMMA 2V7OA 3QZIA 3RK5A 4XYFA 4CRSA 5CF8A 1WVWA 2JGZA 2OG8A 2PYWA 3KEXA 3PJ2A 4DGLC 4TPTA 2YM7A 3TACA 5BYZA 2R3GA 4H36A 4QTBA 3R7UA 1J3HA 4I6HA 5AR2A 4ANLA 5LMKA 4R3RA 1ATPE 3HKOA 3OT8A 4HCTA 4UEUA 4DG3E 5CY3A 2PZ5A 3RZBA 4EHZA 3DZQA 1APME 4DFXE 5A9UA 1JAMA 4AUAA 3ODZX 4APPA 4ZOGA 1W98A 3QWJA 1IASA 1UKHA 4YC8A 5DN3A 5CF4A 2WMTA 3WIKA 2AC5A 4JOAA 5FUTA 2C68A 2QOLA 1Y8YA 3C1XA 5J87A 4UMUA 3IGGA 4EC8A 4QMMA 5HI2A 3VULA 4F9BA 2XKEA 4L3LA 1H00A 4C2WA 5CWZA 4MCVA 2RF9A 1I09A 4F7SA 5DR9A 4BBFA 4P2KA 4BCJA 5F9EA 1UNHA 3BHVA 3E88A 4IAFA 3A8WA 4F6WA 3MFUA 5A6NA 4HGEA 3GC8A 3PJ8A 4E5WA 4CFUA 5DWRA 4FTNA 4L45A 3FL4A 5IUHA 2BDJA 1NVQA 5CNOA 2Z7SA 4Q2AA 3ROYA 5IA5A 3RKBA 2C6TA 4A9RA 3C51A 2XK3A 3G9LX 4AZWA 4IB1A 3TNHA 1R0EA 4CMTA 3HV4A 4OTRA 4E7WA 5L2IA 1PJKA 3UP2A 4BDGA 4EL9A 4GG7A 2OZAA 1XR1A 4RJ4A 3LJ1A 4BTJA 3V5WA 3LPBA 3V6RA 4KKHA 3IW8A 3QALE 5ETFA 1BX6A 3DFAA 2OXDA 3E7VA 3BRBA 3FMHA 3MSSA 3N9XA 3PPZA 4RJ8A 5I9ZA 1Q24A 3GCQA 4ZTMA 3GCUA 1XBAA 2HZIA 3CLYA 4BR3A 3NYNA 3V5LA 4U97A 3F88A 3ALOA 5FG8A 2YABA 3L1SA 3ZS5A 4B8MA 2X4FA 4QD6A 3CP9A 2HXLA 4U6RA 2XRWA 4AZVA 4NK9A 4QTCA 4RT7A 3GQLA 5GNKA 3VS3A 3O7LD 5HNBA 3D4QA 4FNXA 5HIDA 3L8XA 4BKZA 5HG7A 3S1HA 2OU7A 3LAUA 3GENA 2R0IA 4UMTA 2XNPA 4AT5A 4CCBA 4CTCA 2BRNA 4QMXA 5B7VA 4O2ZA 5HU3A 3Q6WA 2R7IA 4I22A 4R1VA 3RJCA 3UOLA 1FVVA 2I40A 3BIZA 3T9IA 3ZOSA 5F94A 1KOBA 3NAXA 4MNEB 3QLGA 3NDMA 4X2GA 2Y4IB 4FNWA 5HIEA 4FTIA 4LUEA 1QMZA 2X9EA 5IEXA 1FGIA 1CKJA 2W1IA 3PP1A 2PZIA 4G2FA 4A4OA 5EM6A 2P33A 5AV0A 1U59A 1JPAA 3QTQA 4G6OA 4RFYA 3ZUUA 4Y72A 1S9IA 2JIUA 3P23A 4TYHA 4GUBA 5FM2A 2Q0NA 4GV1A 3THBA 5IQBA 4E73A 4C4JA 1XQZA 4BDKA 4U5JA 1BI8A 3D83A 1Q3DA 3KRLA 4FC0A 3RWQA 4JAIA 5CX9A 5HLWA 4FTUA 2YFXA 3GT8A 4PMPA 2IVUA 4BDFA 3QU0A 5LVOA 3POZA 4UN0C 3O71A 5IH6A 3TM0A 5A54A 1GAGA 1M14A 3WI6A 2CJMA 2XK6A 2Y4PA 2PUIA 1NY3A 1OIUA 2HWPA 3F69A 3FQSA 2WMUA 4JJRA 4PDPA 4R3CA 4EUTA 2F7EE 3AC8A 4AT4A 2BHHA 3ZFYA 3MB7A 5IEVA 1CKPA 1PXMA 2RL5A 2HW6A 4IAAA 4DT8A 2QNJA 3RZFA 2BIKB 3R22A 4BCGA 4OBPA 2X1NA 3QX4A 5IQGA 4MHAA 4NCTA 5EHYA 4EQUA 1YI4A 3COKA 2CCIA 4GKIA 2C1AA 4EOMA 5B2KA 4JNWA 2IPXA 2XK8A 2JLDA 3OHTA 3QD3A 4RGJA 4U43A 4X3FC 3ZC6A 3FMNA 4O7YA 3CQUA 3KMWA 4NZWB 5EG3A 3BYUA 4FZ7A 2UZUE 4YNOA 3NMUF 4JQ7A 3BU5A 5HE3A 5CEKA 4LRMA 3FMJA 3N51A 5CEIA 4L3JA 5CZIA 4G16A 4EUUA 2JKOA 5KBQA 3EMGA 4L7FA 4IB0A 3VBYA 4BY9E 3LHJA 3KVWA 4IIRA 4FNYA 4E26A 5HNIX 4EHEA 2YCFA 4XP2A 2GHGA 5DIAA 3DZOA 4RC3A 4O7NA 2PZRA 2R64A 4TNDA 4M66A 3WYXA 5C26A 2VWBA 3E63A 3MFRA 4P90A 4DCAA 4G1WA 4ARKA 3OZ6A 4C4GA 4RSSA 3ZCLA 2IZSA 4AOIA 4DFZE 2HY81 4UWBA 2ITQA 3HRCA 2I0YA 2FH9A 3A4OX 3ZM4A 4BWPA 3BEAA 2GNHA 3MVLA 5DOSA 4DGOA 3CSVA 5CI7A 2EB3A 3VBQA 4QYHA 4E4MA 2H96A 4RWKA 5DYJA 3D9VA 5I4NA 3QQUA 4JDIA 4EK5A 2UZTA 4DEIA 3GFEA 4D0WA 2PVMA 5C1QB 4DEBA 4I23A 2HELA 3DBCA 4I93A 1QL6A 1QPEA 4JL9A 5BVEA 4E6CA 4BDDA 1F3MC 2Z7QA 3CY2A 3O8TA 5TE0A 1DM2A 4DE4A 3A2CA 1XBCA 2C6MA 4ENXA 3Q9WA 4MD8E 4RIXA 4F1MA 5I9XA 4DFBA 3PVWA 3RHXA 2OICA 3KRXA 5JZJA 3FI2A 2YERA 1SNXA 3WZEA 4O38A 4ZJIA 4AOJA 4E1ZA 3N4VA 3R00A 3EKNA 4FIHA 5EH0A 3F7ZA 3JY9A 2ITNA 4TXCA 5FDXA 3Q9YA 2RKUA 2R3FA 4TYEA 3IGOA 3GB2A 3IO7A 3FKNA 3I7BA 5FP5A 2A27A 3DJ6A 1Q99A 3VVHA 2PULA 3F5UA 4X2KA 2YAAA 4MAOA 4XG9A 3ZBFA 1PXLA 2W1HA 1WBSA 3W32A 5CAOA 5HG9A 5J9ZA 1UWJA 5EOBA 3F6XA 2IN6A 4DTKA 2FA2A 3UG1A 5AUVA 3L8PA 3CGOA 5HBJA 3MVMA 2VUWA 2LGCA 2UZDA 2VO0A 4J95A 4O0RA 3UG2A 3CD8A 4FODA 3AG9A 4ZMFA 3NRMA 3HGKA 5HD4A 2XRUA 2JKKA 1JKSA 4OAVB 3JYAA 4ITJA 4BHZA 3AT3A 3KL8A 4XEYA 4F9YA 4C02A 3HX4A 3FQEA 4ANSA 4I1ZA 5HESA 4FVQA 5CI6A 3RPOA 4RIWB 3O7LB 4WG4A 2UVYA 3WOWA 1UV5A 3PXKA 5DE2A 3R7OA 5ICPA 4PDYA 3QFVA 2PZPA 4MWHA 2QHNA 3EFWA 4X6RA 4GT4A 2OZOA 2W7XA 5I9UA 2OF4A 3E5AA 1M7QA 5CXZA 4M67A 3UQFA 4GS6A 4KIOA 3KRWA 4G9CA 5DLSA 2OXXA 4O6LA 4FV2A 1UKIA 4MXZA 2C5XA 1KE7A 2ITUA 3FSKA 5AUXA 3S3IA 4RX7A 1Q5KA 1XH9A 3FYJX 3VQHA 5HCXA 4I4EA 4BYIA 2JC6A 2WMAA 2BHEA 2WQNA 3GCVA 4MK0A 3TNPC 2CNUA 2QKRA 5ANDA 5HBEA 4EH3A 1ZMUA 4LV5A 4YTCA 5TO8A 4AW5A 4A4LA 5AM7A 3CS9A 5KHXA 4DA5A 3I5NA 5E8WA 5AUZA 4C4FA 3C50A 4BDAA 4IBMA 1M17A 3R2YA 4FT9A 4TT7A 3ANQA 4ZTHA 1V0OA 2VU3A 3ACJA 1DAYA 3AT4A 5BVOA 3C5UA 3Q4UA 3RHKA 5IA2A 2PUNA 3BLQA 4RQVA 4BTMA 5BNJA 1PF8A 3AD6A 3DQWA 4A06A 1O6YA 3RAKA 4FSMA 3RM7A 3FI8A 2W9FB 5GIPE 2EU9A 1QCFA 2PZYA 5CSHA 5DEWA 1YWRA 4BZOA 2QR7A 5EQEA 4NIFA 2C6LA 2XUUA 1H8FA 3SC1A 3ULIA 4C3RA 4O96A 3BX5A 3CE3A 2WTWA 5CVGA 3H3CA 2ZOQA 2J50A 4LGGA 4E6AA 3E64A 5D1JA 5HHWA 2NPQA 1J7UA 3P5KA 3ORKA 4FV9A 4E5AX 2YM3A 4ZLOA 2NNWB 5AP5A 4KRCA 3QRKA 3ZO4A 4AZTA 2CGVA 3D7TB 4QP2A 2HAKA 4PPAA 4K33A 4FK6A 4LRKA 5BMSA 2VRXA 4QPAA 2I1MA 2YISA 3OW4A 4PV0A 3CTQA 4CG9A 3MW1A 4IVBA 3F9NA 2XM9A 4O91A 3C5IA 5EI2A 1AQ1A 3OXZA 2X4ZA 5CXHA 4C57A 2Z02A 2XCHA 1Q61A 3ETAA 3LCSA 4FV7A 2JDTA 4FV4A 1TQIA 3V01A 3OOMA 1ZYJA 4N0SA 3KK9A 4O83A 3V5TA 3Q2MA 3RPYA 4U81A 1YOMA 1V0BA 3MVHA 2OGVA 4ZXTA 3VUKA 3QTRA 3ZEPA 3ZO2A 5HO7A 1RDQE 4QPMA 4MF1A 2IVTA 2WEVA 3I6UA 3F5PA 3LXLA 3QC9A 2BTRA 3EWHA 4U44A 4GW8A 2VTNA 5IKWA 2ITOA 5FTQA 5AUTA 1OPLA 1H24A 2OK1A 3F66A 4FOBA 4RX9A 3SDJA 3PE2A 2B53A 3T3VA 5KKRB 4JAJA 3FXXA 1TVOA 1LR4A 2JITA 1BI7A 4JBQA 3FLSA 2Z2WA 3NYXA 4W9WA 5FTOA 5IH4A 4BGHA 2P55A 3QUPA 2F49A 1OITA 4XP3A 2YM4A 5I5ZA 2C5VA 2OJIA 1PKDA 3DCVA 3D2IA 3LFEA 4M69B 4LOPA 4KKGA 1XO2B 4Q5HA 2UZOA 4TYJA 4YC6A 3VN9A 3TNQB 1GZOA 1M2PA 2UVXA 2C3KA 1H0VA 4RJ5A 2XNEA 3PXFA 3VRYA 3Q3BA 4WNOA 2IG7A 4ZS0A 3OC1A 1ZYLA 3KULB 5K5XA 1MQBA 1FPUA 5EFQA 3BGZA 4OAUC 3NNXA 1H4LA 4E93A 3EL8A 2VWUA 3DTCA 4GVJA 3UC4A 4IVAA 4FT5A 3S00A 5AP4A 2X8EA 3UPXA 2ONLC 4C33A 1F5QA 2RFEA 3JPVA 5ETCA 4DYMA 3PWYA 1CKIA 4YJRA 3QTXA 4BTFA 4RIOA 2X7OA 4CLJA 5TT7A 4F7JA 3N4TA 3G0FA 3UP7A 3VBXA 4IEBA 5HE0A 2PPQA 2UW7A 5A6OA 4O7ZA 5IQDA 5EM8A 1H26A 3TTJA 2J0KA 3CJGA 3HP2A 3AD5A 3EL7A 4KIKA 3D5XA 5F95A 4ALUA 4E3CA 1WAKA 1ZY4A 2C5OA 3MFSA 4G31A 3W2OA 3RINA 1OPKA 3UE4A 4EK8A 2ZJWA 4ACCA 4EOQA 4I5PA 1STCE 4RX5A 1QPCA 4K11A 1OMWA 3I6WA 4QYEA 4RPVA 5BYYA 4G17A 3ZMMA 4UBAA 1FMOE 2ZV8A 2IJMA 4I0SA 4ZEGA 5H8EA 4HZRA 1AD5A 3KB7A 3MA3A 4XV1A 3G2FA 5AR4A 3K54A 1ZLTA 4JG7A 2F57A 2GTNA 3KCKA 4MF0A 3DKGA 2V0DA 5AWMA 2XIRA 4L00A 4FI1A 3W2QA 3KY2A 2O5KA 2WXVA 3WZDA 2UW3A 3PXQA 1Z5MA 5AV3A 2ERKA 3C4XA 3PIYA 4IADA 5K4IA 2QO7A 4O1PA 3TIYA 1M2QA 3CY3A 3UNKA 5JZNA 4USFA 3E8DA 4MBIA 5JRQA 4DH7A 4KNBA 4MNEA 3VUIA 3LLTA 3ZRLA 2UW6A 5KO1A 4OBQA 4FKSA 3C4WA 3O0GA 3Q4TA 4PDOA 1YI6A 1ZYCA 2C6DA 3E3PA 3OG7A 3MESA 4RFMA 4OGRA 3OTUA 5AV4A 4FTKA 3F2AA 5JEBA 4F0FA 1Q62A 4LGDA 2J9MA 3SOAA 4X2NA 4JIAA 5C8MA 2I7QA 4HCVA 5E91A 4FKUA 2PMNX 2X6DA 4LQMA 2WMRA 4L43A 5KX8A 1IA8A 4DC2A 4FSWA 4BBMA 4YJOA 3PLSA 3KRRA 4CFMA 1Y91A 2B0QA 3NIEA 4KBKA 2PMOX 3WF6A 4H1JA 3P7CA 3UYTA 4AOTA 3UMXA 2PE0A 3QHWA 4IAKA 3IOPA 2G15A 5IUGA 1JSVA 2UZLA 5L8JA 5ANGA 3FE3A 3FQHA 4DFUA 5DA3A 3TCPA 1OB3A 2V55A 4D1XA 5JSMA 2GHMA 5ANOA 4CTBA 3PTGA 3KF4A 5EYKA 3TWJA 4XLVA 5HTBA 1YHSA 4TY1A 4KWPA 1WVXA 2X81A 2SRCA 3BLRA 1P14A 3HMIA 4M15A 2EWAA 3NUUA 4I3ZA 4D2TA 4XRLA 4PMTA 3TN8A 3BKBA 3U51A 3IW4A 4F9AA 4KS7A 3UOJA 3BV3A 1DI8A 5LMAA 4WNMA 4FVRA 5LCJA 3E7OA 5L2WA 3TIZA 1XWSA 3BHYA 3NUPA 3QQJA 4MD9E 4QMWA 4C35A 2BKZA 3EN9A 4QMNA 5IQFA 5DHJA 3OBGA 4IANA 3TT0A 1WBOA 1Q41A 5G6VA 2Z7RA 3DTWA 4FBXA 4KBCA 2OLCA 2BVAA 2UZWE 2WTCA 4OR5A 4CFWA 2UW0A 4S32A 2YJRA 4U0IA 4YZBA 3IDCA 2CNQA 3OT3A 3KXHA 4IX6A 3FSFA 2QONA 2XKFA 4DGNA 3FUPA 1ZYSA 1RE8A 4GK3A 4YJUA 3RI1A 3R8UA 2X7FA 1J7LA 3FZSA 3M2WA 3TKHA 3LM0A 2H34A 4X6QC 4P7EA 2ZDTA 2YHVA 2O0UA 4IQ6A 4OBOA 4YLLA 5FLFA 4YSJA 3BELA 3IDBA 5AM6A 4I0RA 5M4UA 4FEXA 2B9HA 3TDWA 3MJ1A 2YM8A 4FSUA 2ITWA 4YZDA 3OUNB 4KRDA 3ALNA 4XG6A 3K5VA 1GIJA 3QYZA 4K18A 5E7RA 4YTHA 4BDEA 3EB0A 4DEAA 2PVFA 3DBFA 4HCUA 1TQMA 2E9VA 4LV8A 5JKGA 3ZU7A 1QPDA 2VGOA 2OH4A 2YM6A 3KXGA 4LMNA 3HAVA 3GC7A 1SVHA 5FM3A 4IZ7A 4O0XA 3PVUA 1KSWA 4JQ8A 2Z8CA 3E87A 4C59A 4FL2A 3GCSA 3JXWA 3KCFA 5M53A 1WBPA 4FZAB 4W9XA 5AP2A 4J8MA 4NM3A 1IAHA 4HNIA 3CGFA 3R28A 4AZEA 2FYSA 4AGWA 5BX0A 5I3RA 4NKSA 4Y85A 1YXXA 4ZSLA 4U79A 3GXLA 5CU6A 2RGPA 2CGUA 2JFLA 1FMKA 3BU3A 3BBTB 1M7NA 3BE9A 3DT1A 3P0MA 2R3IA 3REPA 3SOCA 4ACGA 1YKRA 5J5TA 2WMVA 2X8IA 3OCSA 4U9AA 4DEGA 4XCUA 4D2RA 2R3HA 4WA9A 5LARA 4ASZA 1KE6A 2XNMA 1OIRA 2IO6A 3AMAA 5FRIA 4HVIA 2EUFB 2VTTA 3UOHA 1XBBA 2QCSA 4Y95A 4MH7A 2R2PA 3LMIA 4BBEA 3MFTA 5JMSA 4BCFA 3GC0A 1JQHA 1JBPE 5FD2A 4NT4A 3ZXTA 1H1QA 4FZFB 2BZIB 4F08A 4FL1A 3R83A 2BAQA 2CPKE 2HZNA 3LFNA 2IZRA 4FTAA 2RIOA 4AN3A 4BN1A 4FG7A 4EEVA 4QMVA 3FYKX 3R71A 1WZYA 4II5A 3GVUA 3W8LA 5F1ZA 1ZAOA 4BDIA 3FI3A 2ITPA 4D28A 4LFIA 5AA9A 2X39A 4ALVA 3PE1A 4XUFA 3HV7A 3TZ8A 4BDHA 3A8XA 2JAMA 2H8HA 4EZ7A 2GQSA 2BRGA 3FAAA 4W4VA 1F0QA 4PMSA 3QD0A 4FV3A 4CZUA 4UWYA 5AUYA 4JR7A 4RIWA 2C0OA 4FSNA 3OY1A 4RC4A 5HVKA 3DA6A 5E8SA 5ANKA 3VBVA 2ZM3A 2QO9A 3U54A 5CAQA 4IZ5A 3VUTA 2UZNA 3BWJA 4BDBA 4UMPA 2F7ZE 4DAWA 4M8TA 3R8VA 2W05A 1OUYA 1P2AA 1H25A 4C4IA 3OOGA 4QMTA 4XG3A 4FIEA 4RLKA 2Y6MA 3BWFA 1YHWA 5HO6A 5ANEA 4APCA 4GSBA 4XV3A 4CCUA 4D9UA 5KNJA 1OL1A 3COHA 3Q53A 3R04A 4I4FA 3QTIA 5AR8A 3DLZA 4I0TA 3H4JA 4BGQA 4MXXA 2J4ZA 4BCHA 2VV9A 2Z7LA 4C34A 3BQRA 3L8SA 2EXCX 2JDOA 3EFJA 4MX9A 4TYGA 3VWAA 3F3TA 4RG0A 4BTKA 3ELJA 5GHVA 2X2MA 3ZFMA 4BYJA 4PX6A 2GHLA 4TNBA 3FZTA 5KMKA 3L8VA 4MBLA 4ANOA 1R78A 4PRJA 5IZFA 4B99A 1YDSE 4Y5HA 3R7VA 4PWNA 3QTUA 5IA3A 1FOTA 2BRHA 1XH8A 3D15A 5EDPA 5FXSA 4EORA 4TWPA 2WEIA 3GP0A 3OXTA 3TNWA 4E6QA 4RVLA 3TJDA 1VYZA 2BDFA 4QMSA 5DVRA 5HVJA 5CF6A 3SAYA 4UX9A 2ONLA 2ZM1A 1OM1A 3TG1A 3ZUTA 5LQFA 2OFVA 2JIVA 1PW2A 1ZZ2A 2QD9A 5FXRA 3UGCA 2YCRA 4QP1A 4ASXA 3UC3A 4EJ7A 5GJDA 5EKOA 2GQGA 5AAGA 5DMZA 5IQAA 1CTPE 2HIWA 4E20A 3AC3A 3LFFA 3QBNA 2NO3A 4F1OA 3QX2A 2VO6A 3OROA 4BGGA 4NM7A 2XIKA 3G6GA 3PWDA 3QRIA 4RZVA 5T68A 3EN5A 3DBQA 4FTCA 1JSTA 2GNFA 4DN5A 5CEMA 5JQ8A 1FVTA 5KHWA 4H39A 2O2UA 4IH8A 4FKIA 2DQ7X 3I60A 4ASEA 2BUJA 4O7TA 4IC7A 3BEGA 2W1CA 5JRSA 1ZYDA 4YNEA 4L8MA 4IX3A 4QP4A 4FSTA 4JRNA 4AAAA 3ID6C 5H3QA 3DY7A 4NFNA 4I21A 4M12A 2XEZA 3Q60A 3UVRA 3AC4A 4TWCA 5FTGA 5H8GA 3M42A 3POOA 3BQCA 3VBTA 3W33A 3NLBA 3PA4A 5HOAA 4AW2A 4EH9A 4QNYA 2GQRA 1OKVA 4FKLA 4YJNA 4JG6A 4BCIA 4C58A 4CKRA 5J5SA 5JN2A 5EYMA 4AP7A 2YLFA 4EOPA 5HO8A 4J7BA 2W4KA 3ORXA 3SQQA 2VX3A 4HVGA 4TW9A 4FEVA 2PVHA 4S2ZA 3FZPA 2V5QA 4TWOA 3NW7A 4TYIA 2HOGA 5CSPA 3GFWA 4LM5A 2AYPA 3FMMA 5A46A 3QXOA 5EQYA 3NVMB 3UZRA 2QLQA 4AA0A 2ETMA 4YSMA 4ERWA 5BQ0A 4PPBA 2BTSA 4ZY4A 4BIDA 1XH4A 4IM0A 2YAKA 4FOCA 3RBWA 3UMWA 5BUJA 4ZZNA 5HX8A 4K6ZA 2QO2A 5TR6A 4UMRA 2CN8A 4WOVA 3ORNA 1PXOA 4EQCA 3O2MA 4CT1A 3B8QA 3F2NA 3EYHA 3QL8A 5L6OA 1YHVA 3V5JA 2NRUA 1YXTA 4GT5A 1VJYA 1IRKA 5F20A 2FSLX 1LP4A 2XNNA 4FF8A 3L9PA 5FBOA 3LFDA 4MQ2A 4JDHA 3FPMA 4R5SA 5KE0A 4FTMA 2IW9A 3VS5A 4HGTA 4NL0A 4KKEA 4XJ0A 4H1MA 4Z3VA 5AIKA 5KMNA 3EZRA 2PVLA 3W18A 1ZOEA 3MIYA 5K9IA 2OIBA 3BGQA 3QZGA 4N57A 1UA2A 3COIA 3VF9A 3CTJA 5DRDA 4CQGA 4CV9A 1XKKA 3BV2A 4AW1A 2FUMA 2XK9A 2YIYA 4GL9A 3TUBA 2B52A 4WRGA 4BWXA 1NVSA 4XNEA 4AQCA 4X2FA 1PXNA 3BYSA 5BPYA 4IJ9A 4JBPA 1MQ4A 4C0TA 4DHFA 3QZFA 4FYNA 3ENHA 3PPKA 4RIYA 3QKKA 4KIKB 3CCNA 3CBLA 3FY0A 2A2AA 5FWKK 5J95A 3QZHA 4OTFA 4USDA 3CQEA 3OUKA 4FTRA 1V1KA 2JAVA 4LI5A 5T6KA 2H6DA 1ZZLA 5AP0A 4O1OA 4FGBA 3LJ2A 4G3CA 4HYSA 5HKMA 4IWDA 3ZLWA 4OUCA 2WNTA 3P7BA 2W17A 4ENYA 5KZIA 4AGCA 3QTZA 3WF9A 2R3MA 2ZB1A 2OJ9A 4GVAA 4UB7A 5CEPA 1REKA 2YJSA 3DU8A 3R8PA 3DKOA 1DI9A 4RWJA 3CJFA 2F9GA 4YTFA 3RM6A 4L46A 4NTTA 5A3XA 2WGJA 4CFXA 4E6DA 3EQCA 3OP5A 4FKPA 4UY9A 4TYHB 4O0SA 5KUPA 2W1GA 3RNYA 5DGZA 4IM3A 3RPSA 3UVPA 1GIIA 3DXPA 5LMBA 3OCTA 3VNTA 3HA8A 2XYUA 4N70A 4UALA 4BDJA 4FG8A 3BHUA 1Q8YA 4BI2A 3HRBA 2VWYA 4IX4A 4RMZA 4QP6A 3G5DA 1NW1A 1PRYA 3QF9A 3EN7A 3HNGA 4I41A 3E93A 1HCLA 2REIA 3RCJA 1SMHA 2PUPA 4U3ZA 5KMJA 2VTOA 1J7IA 2QG7A 5EDRA 5ETAA 1R3CA 4H3QA 2V7AA 4YPDA 3NUYA 3PUPA 3T3UA 3LQ5A 2E9NA 4ZSGA 2E9UA 2VZ6A 5HIBA 4WBBB 3QUDA 4C7TA 4Z55A 3MY1A 1UU9A 5LVPA 1ERKA 2XNGA 3IPHA 3Q4CA 4ANMA 5LOHA 3QYWA 4YO4A 4FG9A 4GU6A 3L9LA 4MNFA 4BL1A 4NJ3A 3R9NA 3F3UA 4OTWA 3OD6X 2QOOA 3RK7A 3SLSA 4DEDA 1XH5A 4G6LA 5K3YA 3SX9A 4BHNA 3A4PA 4BCPA 5J9YA 3ORMA 1G5SA 2IZUA 3O8UA 4ID7A 4FIGA 3ZEWA 2G01A 1U4DA 3LCKA 2RSVA 4IDVA 4CMUA 4I6QA 2NP8A 3EOCA 4Z7GA 4EI4A 2OJGA 3BLHA 3MH1A 1KE5A 2J7TA 1U54A 1I44A 4PUZA 4RIYB 3HDNA 4F99A 2BAKA 3QCYA 4QYGA 3VHKA 1Q8WA 2XYNA 3SVVA 3FJQE 1VYWA 2HW7A 5CEOA 4EOKA 3NYVA 4IX5A 1YVJA 2R4BA 4J98A 5CYIA 3R30A 4GT3A 5M56A 2A19B 4J99A 3FHIA 2JFMA 4MXAA 4CVAA 4DT9A 1WCCA 3VRZA 5HX6A 2PVJA 4CLIA 1YDRE 1OL2A 2QOHA 4L42A 1Y6AA 1R1WA 3DXNA 3PXZA 2XIZA 1BL7A 4PL3A 2XVDA 1DS5A 4I5MA 2GS6A 3GC9A 3HL7A 4EKLA 4HNFA 5BVDA 3UO6A 2WIPA 2G1TA 4W8DA 5E8ZA 1LPUA 2HYYA 4ZY5A 3BYOA 2W96B 5CU2A 5H8BA 3W2RA 2R3OA 3DBDA 3QLFA 4RVKA 1T45A 3SXFA 1RJBA 2AUHA 2I0HA 3D5UA 4WSQA 5CVFA 4O0TA 5CANA 5L8KA 3CC6A 4I5HA 1A9UA 1H07A 1WVYA 5AP3A 5HCYA 2NRYA 2AC3A 4FKTA 4KBAA 3EQDA 3R73A 3MY0A 4FK3A 4WNPA 5I3OA 3V3VA 5M4FA 3MPTA 3E8CA 2JEDA 2ETKA 2CHLA 2JDVA 5DT0A 3NNUA 4F9CA 2CKEA 4IAZA 5IISA 4D2PA 5IU2A 4OT6A 3R1YA 4N6ZA 5AEPA 1LEZA 3DKFA 4PPCA 1JKTA 2VN9A 3VJNA 3IW6A 4ACHA 3R1QA 3KC3A 5KMOA 4G3GA 3W2SA 1PMEA 2IW8A 3ZH8A 2OH0E 3ZSGA 5DG5A 3EQBA 2B1PA 2GFSA 3ITZA 3QHRA 2XNBA 4YR8A 2XBAA 3LFAA 3R7EA 5IQEA 5CLPA 3GU6A 3QRTA 3R9OA 1O9UA 3Q5ZA 5HVYA 2W1DA 3PVGA 4RWLA 4YURA 1FGKA 3OY3A 4R6VA 2OO8X 4C38A 1ZWSA 5F4NA 1Y8GA 2FO0A 2W1EA 4CFFA 4K2RA 2WTVA 3CR0A 3HA6A 4M0YA 2WELA 3PSBA 5CTPA 5IG1A 2C3JA 2YIRA 4RX8A 4BCNA 1M2RA 3WE8A 4BI0A 2VTAA 2YZLA 4EJNA 5A4EA 4GEOA 3SW4A 2PUUA 4FNZA 3EN6A 5AR5A 5FDPA 4A7CA 2WMSA 4BIBA 2VTQA 3FDNA 2R7BA 2C69A 4QO9A 4EK3A 2P3GX 3AOXA 1VZOA 3QD2B 3UNJA 3LM5A 1Q3WA 3HVCA 1R39A 3MIAA 3Q5IA 3S4QA 4CV8A 5DT4A 5I9YA 2Y7JA 3UPZA 2G9XA 3EQHA 2C6EA 4IHPA 1EH4A 3DLSA 2YDIA 4LMUA 4OTHA 3K5UA 4GUEA 3QCQA 1IR3A 4FKOA 5G1XA 5T3QA 3O23A 4E4NA 5HG8A 3B2WA 4IZAA 4FT0A 1H1RA 3CD3A 2B54A 2EVAA 3DPKA 3FMKA 1H01A 3O50A 4MD7E 4ZTNA 1ZOGA 4J96A 2BAJA 4BF2A 1YWVA 4AS0A 4NUSA 3QAME 3HECA 3W2PA 3RPRA 5CF5A 4JIKA 4H58A 5DRBA 5IQCA 4ZTRA 1P4OA 5AR3A 4F1TA 4FKWA 4O2PA 2J0MB 4BCQA 2YEXA 4IACA 4PY1A 4MWIA 2W9ZB 3U4UA 4TWNA 3PG1A 1NXKA 3BHTA 4CMOA 4IWPA 3C7QA 3RNIA 1UNLA 2OI4X 2YM5A 5DBXA 4F63A 4CG8A 3H10A 5AUWA 4B4LA 5M44A 4CD0A 4FE2A 4FZDB 3MI9A 2HZ4A 3TKIA 4IWQA 4ANBA 3ATSA 4C4EA 4E8AA 3NNVA 4YZCA 2C6IA 3HDMA 3R0TA 3ORTA 3WARA 4FEUA 4NJDA 4Y73A 1KE9A 4AXAA 4BB4A 5AAEA 4QMYA 4V04A 4FX3A 1Z57A 3ZONA 3ANRA 1JNKA 2O65A 3HEGA 3RCDA 3ZZWA 4FTJA 4AT3A 4D4VA 2WTKB 4F65A 4EH4A 3Q2JA 5DPVA 5HLNA 5CQUA 1XH7A 2YIQA 2XNOA 3C4ZA 4S31A 3SRVB 1XH6A 1CDKA 4ZSEA 5D7AA 2OJJA 2Z60A 4DH1A 3WIGA 3IW7A 1RQQA 4GIIA 4JDJA 4M13A 4NKAA 4RVTA 4ZTQA 3ZBXA 3D7ZA 2BPMA 3G90X 3NZ0A 4WD5A 1Q4LA 4JG8A 5E8XA 3U6IA 5E1EA 2CSNA 5LWMA 5AX9A 3QWKA 2B9JA 2ZMDA 3Q04A 4HYIA 3KXXA 2QOBA 2IWIA 3KFAA 5EW3A 3C9WA 3OCBA 4IE9A 2WTIA 4QMZA 5I9VA 4OLIA 2X6EA 4HVDA 4F9WA 5CT7A 2ZV2A 4UXQA 2R9SA 3OWPA 5CZHA 4CGAA 2WAJA 3W8QA 2C47A 1Y6BA 4R7IA 3PJ1A 4A9TA 3ROCA 3C4EA 3VS1A 3RGFA 3WE4A 5L2TA 1JSUA 5CASA 3AC2A 3PY0A 3D94A 2DS1A 3DAJA 4F4PA 4ZS4A 4DH8A 3P1AA 4O21A 1ZY5A 1NA7A 4F6UA 5IA0A 4KUJA 5BYLA 3TDVA 4OW8A 4FKQA 4W8EA 1PXIA 4IWOA 4D5KA 4BICA 3QRUA 2CNVA 4TRLA 3CKWA 2C1BA 4GKHA 1W83A 5JH6A 3BYMA 4NSTA 5LVLA 4X0MA 4YC3A 5LMKC 1OL5A 2QHMA 3AT2A 4K0YA 3DQXA 4FGRA 3BHHA 5AR7A 3PRIA 3PXRA 3I79A 3AMYA 3GUBA 4O0WA 3QRJA 3HZTA 3LVPA 2X2LA 4YTIA 5EKNA 3FV8A 3NWWA 3H30A 5M07A 4Q5EA 4Z16A 3NIZA 2YA9A 4AU8A 3MPMA 4PNIA 3TV6A 3DXQA 4YGAA 4PTCA 3MB6A 3HV5A 4QP3A 4RLLA 3UIXA 1OKYA 2I6LA 1G3NA 4D5HA 1TKIA 5DNRA 3KREA 4FR4A 2O63A 2HK5A 2VX1A 3F5XA 1Q8TA 3R2BA 3P9JA 4IW0A 4NCTC 3HUBA 4JX3A 2C3LA 3MS9A 5CAVA 4QYFA 3GI3A 4XP0A 3BCEA 3R9DA 1PHKA 4KIQA 5L2SA 4QTAA 2R3LA 4X7QA 4A9YA 2OXYA 3EQGA 4Q9ZA 3UIUA 2XH5A 5E90A 3R01A 3E8EA 4WHZA 3NCGA 2ACXA 3SXSA 4LUDA 3T8OA 3ZTXA 2QR8A 1OECA 4JI9A 4R77A 2IVSA 4DITA 2RFSA 1CMKE 1L8TA 4RA5A 3H0ZA 4RWIA 3O96A 5IPJA 4BCKA 3VS7A 5JT2A 1UVRA 3MH2A 2PY3A 1SM2A 1PMUA 4KS8A 4S34A 5TOZA 2XBJA 3RAWA 4C2VA 4NEUA 3I7CA 4BWKA 4PQNA 5IF1A 3CTHA 2WMWA 4DTAA 3UBDA 4ZZMA 4V01A 4J97A 4AGDA 1MRYA 5ITAA 1X8BA 3ORPA 4IB5A 4ITIA 2DUVA 1U5RA 4QT1A 2IZTA 5KZ0A 4CZYB 1W84A 4FV0A 1GZKA 1Z9XA 3PXYA 5BVWA 3R1NA 4HVHA 5J9LA 1WBNA 3ZO3A 5FP6A 1URCA 5IMEA 2YLEA 3FKOA 3TZMA 3LFQA 1URWA 4NTSA 3R8LA 3RWPA 4G34A 1FBNA 4PMMA 4H05A 1PMVA 4KB8A 4YZNA 2BKKA 1OZ1A 3LXKA 4AG8A 1XHAA 4BFMA 3FXWA 2W99B 4HYHA 5CNNA 4EK4A 5JFXA 4WUNA 5AFVA 1FINA 2CGXA 4B8LA 4YO6A 4EOIA 3LE6A 3COMA 2JIIA 3QGWA 2C0TA 2OF2A 3C0IA 3FEGA 4O84A 3HMNA 3K3IA 5L8LA 1UU3A 2BRBA 3AXWA 2CLXA 2R3JA 3EIDA 3II5A 2WOTA 4EONA 5GZAA 2ZM4A 2ITZA 4EH6A 2J5FA 2VTIA 4YHFA 4L52A 4QPSA 3PZHA 2LAVA 2BFYA 4D2WA 5HZNA 5EHLA 3SKCA 3ZHPC 4C4HA 5E8VA 3MDYA 4IJPA 3ACKA 3F7WA 4M84A 2ZYBA 4EZ5A 3KXNA 4MVFA 1CSNA 1IEPA 3DGKA 2P0CA 3PIXA 1O6KA 5EYCA 3LIJA 5AMNA 2VX0A 3PYYA 5EQPA 3IQ7A 2IVVA 4R3PA 1T46A 2VWZA 4RA4A 2GNJA 5A4CA 2FSMX 4KABA 3GNIB 3HRFA 4YHTA 3W55A 3H9FA 4NM5A 4CEGA 3WF7A 2J0LA 4HW7A 3OCGA 3ZDUA 4DLIA 3TI1A 4I20A 4MTAA 3TZ9A 3FKLA 2ITVA 4C61A 4J1RA 3UODA 1YOLA 4IFCA 1DAWA 3LLAA 4QMPA 4ONAA 1YXSA 4AF3A 2PVNA 1HCKA 2FGIA 3HV6A 4ZP5A 4Y5QA 1J1BA 2YCQA 3QUEA 3R1SA 4GRBA 4FA2A 1VEBA 5C4LA 4DGGA 4U8ZA 2CKQA 2BROA 4X3JA 2F2CB 3NGAA 2WQMA 2UUEA 4UZHA 4PL4A 4G5PA 5IUIA 1Q97A 4NWMA 3ZDIA 4ALWA 5C8KA 3E92A 4L68A 3MBLA 3IECA 1W8CA 4HZSA 4BDCA 2QVSE 3FMEA 5E92A 5EDQA 2BALA 3P4KA 4EYMA 2EB2A 3EH9A 3R63A 3FPQA 3V51A 4A4XA 2YITA 1QPJA 2VTRA 3JY0A 4AA5A 4Z7HA 2F2UA 3DJ5A 4IFGA 2XF0A 4KSQA 4OTIA 5JFWA 4O86A 2XJ0A 2B7AA 3C13A 3BYVA 2R3RA 4CXAA 3IOKA 4ZTLA 4EYJA 4GK2A 3DKCA 3BBWA 3NUXA 1PKGA 3PJ3A 3PZEA 3T9TA 2JKQA 3TKUA 4CFNA 3A99A 3QQGA 4O22A 3KXZA 4GIHA 3B8RA 5GIOE 1Q8UA 3MA6A 3U4WA 4YBKA
chains in the Genus database with same CATH superfamily
3PSDA 2J5EA 4RIXB 3QTWA 2WMBA 5DFPA 1G8SA 1W82A 5JFSA 1E9HA 1KV2A 2VTLA 3FLNC 4IM2A 5ANIA 4ORKA 4AACA 4CFVA 1ST4A 3FMDA 2FB8A 4IC8A 5K0XA 4PTEA 3PDTA 4K1BA 5CSVA 4O7WA 4F7NA 3LCOA 4KD1A 5JGBA 2J0IA 4A9SA 5I9WA 2W0JA 4DGMA 4I6BA 3FWQA 2ZV7A 4Y83A 3QCSA 2GS2A 4FL3A 4GH2A 4XS2A 3PG3A 5BVKA 2PVRA 4XG2A 3GU5A 4C3PA 1RW8A 4G6NA 4YJQA 3DDPA 1Q8ZA 4MXOA 5HCZA 3SHEA 4ZAUA 4B6LA 2R0UA 3DS6A 1KE8A 1PYEA 2JD5A 2W5AA 3KXMA 4LG4A 4DBNA 3HMOA 1NT2A 4RBLA 2J90A 4QTDA 4XHKB 1MUOA 3I0QA 4KA3A 5CALA 5LVNA 3AKJA 5IQIA 3ZSIA 4FEQA 5GJFA 1PY5A 1UWHA 4YPSA 3RK9A 5FQDC 5FEQA 3ZYAA 4W4XA 2GPHA 2ZMCA 5DT3A 4BJJB 2CN5A 3ZLYA 3QGYA 2OW3A 3R21A 4ASDA 3EZVA 2HCKA 3U9CA 5E8YA 5AJQA 3VC4A 3ATTA 4O0VA 2Y4IC 5KMIA 4L7SA 4IDTA 5A4LA 2VTHA 3UJGA 5IEYA 3IK3A 2YDKA 3Q9ZA 5L2QA 1OIQA 2BZJA 3MPAA 2R5TA 2R3PA 3GU4A 2VD5A 4JT3A 4ZY6A 4D1SA 4LRJA 4XG7A 5BUIA 3W0OA 2ESMA 4I24A 5AUUA 3OVVA 5EHOA 2OFUA 3DB8A 2YWPA 2W1ZA 2WQEA 1MRUA 1H1SA 2WHBA 3MGYA 2G2FA 4LL5A 3F3VA 4IVCA 5ACBC 5ETIA 4DFYA 3C0HA 4UYNA 5D11A 2HY0A 3D5WA 5HNGA 3LZBA 3FLZA 3GQIA 1U54B 4NW6A 5AA8A 3LFBA 3ZM9A 4GJ3A 3IKAA 3MWUA 2XJ1A 3NW6A 3OXIA 4O0YA 4AE6A 4O7VA 2C6OA 2VGPA 1B38A 1H0WA 1ZRZA 3PJCA 2ZVAA 2XZSA 2ZAZA 4EC9A 3P08A 4FTLA 4D0XA 3AQVA 5CENA 3LMHA 4Q9SA 4BRXA 2R3NA 4JQEA 4FICA 3WF8A 2UW4A 2AEGA 4MKCA 2ERZE 3GU7A 4HGLA 5BUEA 4C36A 5JGAA 3VJOA 4BKJA 5EK7A 3VUGA 3SXRA 3ULZA 2E2BA 4EWQA 1KWPA 4XBRA 2ITYA 4CNHA 3FMLA 3FLWA 4FEWA 2XJ2A 2VO3A 5D9HA 3PY3A 3NR9A 2PK9A 2PMLX 2YDJA 3FLQA 3L9NA 2X8DA 4L9IA 4NIFB 4E4XA 4ITHA 4QMOA 3ZZEA 5J1VA 2VTJA 5I0BA 2XIXA 2P2IA 2B9FA 2W5HA 3A62A 4FTOA 4U80A 4D55A 4F6SA 3Q96A 4FSYA 3BU6A 3NAYA 3TV7A 4PNKA 2WTDA 3UVQA 1VLRA 1GZNA 3TUCA 4O4EA 4IB3A 4JBOA 1BL6A 5E8TA 4ZLYA 3NW5A 3QA8A 4YP8A 1Y57A 4MEDA 5CU3A 4F64A 3GEQA 5M4CA 4WSYA 3AD4A 3SG8A 1KOAA 4N6YA 5KCVA 3DV3A 3HAMA 4O6EA 4AZFA 1W2FA 2C4GA 1VR2A 4QQ5A 5C4KA 2H9VA 4MYGA 2QODA 5HD7A 4R7BA 3MV5A 1JLUE 3OEZA 5HORA 2QOCA 1ND4A 3MN3A 4ZSJA 2WFYA 1SZMA 3QTSA 4TZRA 3DJ7A 2O64A 4NW5A 5EM5A 1H1PA 1JOWB 2QOIA 4IZYA 3QQKA 4M3QA 3DFCB 4XOZA 3E3BX 4FKJA 1GZ8A 5AP6A 5KMMA 4YMJA 4IAYA 4D4SA 3U8WA 1YQJA 3FLYA 4M68A 4L3PA 4AX8A 2BDWA 3KGAA 2GS7A 3UDSA 4U42A 1L3RE 3WZKA 4EOOA 2CGWA 2VNYA 3OTVA 4V0GA 3ORLA 3AMBA 3UZTA 4BIEA 2YWVA 3GOPA 3R7YA 3S95A 3QXPA 3A7GA 5LXMA 4AWIA 4ZLZA 2X9FA 4XRJA 4NU1A 4ZMEA 1KV1A 4PL5A 3KRJA 4KINA 3F61A 3V5QA 3NS9A 3LFSA 2PE2A 4J71A 4N4SA 4QOXA 2YN8A 3A7JA 2GMXA 2Q0BA 4NM0A 3WF5A 5CS6A 4R7HA 4FV6A 4YZMA 2BZKB 2XA4A 1U5QA 3MTFA 4LOQA 4M69A 4RJ7A 2J0JA 4XH6A 3UIMA 3MYGA 4JDKA 4D2VA 4TL0A 3G6HA 3H9OA 4YZ9A 5C03A 3VIDA 2RG6A 5ANJA 1OL7A 3KU2A 3VS6A 2J2IB 2Y9QA 2A4LA 4DTBA 2W5BA 2G2HA 5EI8A 2CMWA 2GTMA 3O17A 4EHGA 2ITTA 5E8UA 3W16A 3PFYA 2XB7A 3I1AA 1ST0A 1XJDA 5CQWA 3NSZA 3I81A 4J52A 4RZWA 5CT0A 5LVMA 4LGHA 2HWOA 3F3WA 5AP1A 4E5BA 1UU7A 2BFXA 2QC6A 4GFGA 4WT6A 4A07A 4EK6A 3MY5A 3NUSA 1TZDA 2OWBA 4X21A 5LCKA 3FHRA 3NEWA 3OFMA 3TL8A 2UZVA 2BRMA 3VW6A 4ERKA 1OBDA 2RG5A 2VWXA 1YW2A 4QQTA 5CAPA 3SGCA 4AFEA 4Y8DA 2WIHA 2CDZA 3OWLA 3Q52A 3V04A 3VQUA 4CSVA 3FC1X 4I92A 3LOKA 1LEWA 3IG7A 3PIZA 4QP9A 5D10A 4DFNA 3PRFA 3I5ZA 5E1SA 3EKKA 5HE2A 3ZC5A 2B9IA 5GJGA 2GFCA 1ZMWA 4HGSA 5K0KA 4ANNA 5DI1A 2BIYA 3Q32A 3UTOA 3AGLA 3VUMA 1BKXA 3ORZA 5E4HA 3JS2A 4ZIMA 4MBJA 2Y0AA 3S2PA 1OKZA 4EH2A 2V62A 4EOSA 4DEEA 1O6LA 2BILB 2OZAB 1PXKA 3I0OA 4DF3A 3DNEA 4WG3A 2YIXA 4V05A 4D9TA 4DH5A 4JVGA 2QU6A 3OS3A 5CEQA 4O7LA 2WB8A 3F82A 2VWIA 4DH3A 3FZRA 5JFVA 3JVRA 4FYOA 2VNWA 3LXNA 3EQFA 2HXQA 3LCTA 4MXCA 2WO6A 4FRFA 5JQ5A 3LFCA 4C3FA 2WU6A 4UXLA 4CQEA 3VS4A 5A4TA 5BMMA 5HQ0A 3UDBA 2PHKA 3KMUA 1BUHA 5CU4A 3R8ZA 4UYAA 4ZSAA 2VTMA 4DG0E 2F4JA 4LL0A 1SVGA 4R5YA 3W1FA 3NX8A 4UV0A 3P5JC 3DAEA 4FIJA 3KK8A 5GZ9A 4ZZOA 2I0EA 4GYIA 5DH3A 3ZLSA 4TKSA 2QLUA 3R7IA 3ZUVA 5L6WL 1A06A 2PMIA 4K8AA 5M55A 3BZ3A 4BZNA 4PDSA 1WMKA 2CCHA 2WKMA 2QOFA 4RJ6A 4D4RA 4CKIA 3VHEA 5EM7A 3FBVA 4JLCA 3OWJA 4RC2A 4G3EA 4PP9A 3UYSA 4GCJA 1YI3A 4AW0A 4ACMA 2PWLA 1BMKA 3ERKA 3QC4A 2B4SB 4CRLA 3TUDA 3GOKA 3FC2A 4QQJA 4DFLA 2FVDA 4NFMA 5CAUA 4BCMA 4F70A 3R7GA 4EOJA 2HZ0A 2WQBA 4EH5A 1OBGA 2G2IA 4GYGA 2QKWB 4WKQA 4X3FA 4FIIA 1CM8A 5D7VA 3WBLA 4JBVA 4L01A 4WO5A 3NPCA 5FBNC 4BC6A 1K3AA 4O82A 3C0GA 1REJA 2XMYA 2EXEA 4OTPA 4P5QA 4A9UA 5J7HA 5M4IA 3R9RA 3RP9A 3UO4A 5L3AA 2QOKA 5GINE 4EH8A 5H2UA 4USEA 4QRCA 2W06A 3RMFA 4GMYA 3OW3A 4AN9A 4PF4A 3KKVA 1BLXA 3UOKA 1MP8A 4S33A 2PVKA 4D2SA 4U41A 1K9AA 1YWNA 4I6FA 4OTDA 3DK6A 1KUTA 4X3FB 3EHAA 4YLJA 4RRVA 1WBVA 3A7IA 2P2HA 2QURA 2VO7A 2WMXA 3DB6A 4JRVA 5E9EA 2XP2A 3HLLA 4FKRA 5L6PA 1WBTA 2E9OA 3KF7A 3KN6A 5JGDA 5IA4A 1IG1A 3C4CA 2VWWA 2FSOX 2VTPA 3ET7A 3BL7A 4IMYA 4RQKA 2OIQA 4F7LA 4G5JA 2PTKA 3MTLA 3U87A 3RPVA 2HENA 4HJOA 4QYYA 5HE1A 3P7AA 2C3IB 4YBJA 3ZRMA 3PP0A 3I4BA 4FV5A 4EBVA 2X7GA 3PSCA 4FUXA 3IW5A 4LYNA 3Q6UA 2JDSA 1H08A 3G9NA 4FSQA 3HYHA 3K3JA 4YJVA 2DWBA 3CPCA 4YUQA 1UNGA 4RJ3A 4XLIA 3M1SA 4QMQA 2WPAA 3RALA 5LJJA 2YIWA 3QQFA 4AGUA 3EQPA 4JX7A 2O8YA 3CIKA 3U9NA 1LUFA 4U7ZA 4O81A 4K77A 2Y8OA 5EI6A 4R8QA 4D1ZA 2QOQA 4WIHA 3LJ0A 4YU2A 1NVRA 3ODYX 4XBUA 1YXUA 2XK7A 4WNKA 2CKOA 2PE1A 2J6MA 2UV2A 2ZV9A 3DK3A 1PXJA 4FIFA 3EN4A 1P4FA 1B6CB 4WG5A 3U6HA 3VW8A 2CKPA 3RTPA 3TNIA 5AADA 3FL5A 2C5YA 1M52A 4FZ6A 4DINA 2PU8A 1PMNA 4YJPA 3MH0A 4WRSA 5DR2A 3UO5A 4BKYA 2UW5A 4KSPA 4HPUE 1YDTE 2Q83A 1JWHA 2VTSA 3Q4ZA 4FTQA 4QP7A 4UZDA 4ZJJA 1OI9A 2OKRA 3V5PA 3ZXZA 4DEHA 2UZBA 3TMOA 3DAKA 3EYGA 4HVSA 3S0OA 5L4QA 2GU8A 1AGWA 5EYDA 4XV9A 3D2KA 1R0PA 2I0VA 3DK7A 2W1FA 4FSRA 5H9BA 1SNUA 2YCSA 4RFZA 4ZJVA 4TTHB 4IVDA 4BZDA 4L6QA 1U46A 3BPRA 3DBEA 3FZ1A 3KMMA 3QQHA 4GJ2A 5TKDA 5LWNA 3GGFA 4GG5A 3TEIA 4YHJA 3RAIA 4AZSA 2OSCA 3NCZA 2PSQA 4M7IA 1W0XC 4YJSA 2BMCA 3VO3A 3QQLA 3VBWA 4B9DA 2ITXA 5HGIA 2GNIA 4UMQA 3UIBA 3OWKA 5B2MA 2WTJA 1ZXEA 4ACDA 3R9HA 3A7FA 3SW7A 4AE9A 2YZAA 5EW9A 4EOLA 2E9PA 1OPJA 1W7HA 4L44A 1H28A 4OTGA 1WFCA 3VF8A 3SG9A 4F0GA 5BVNA 4KAOA 1E1XA 2X2KA 1TQPA 4O0UA 4G9RA 1UU8A 4XOYA 4XX9A 5IH5A 3PA3A 1JKLA 4W4WA 3EQRA 3MVJA 5HICA 4EHVA 2KTYA 4JR3A 3TJCA 2PVYA 1V0PA 5C01A 3V8TA 3JUHA 5B0XA 3VS0A 3JR1A 3U55A 3PA5A 2WMQA 3LXPA 4AN2A 4DCEA 4CYIA 1YRPA 1SVEA 4JS8A 1PXPA 3OMVA 5IA1A 4F09A 4FMQA 2XEYA 4EQMA 3V8WA 2A98A 3N4UA 2B55A 4GFMA 5D12A 5FGKA 2FSTX 1SYKA 3NUNA 5EOLA 5AX3A 4D4YA 3V8SA 5J79A 3LKMA 2EXMA 3QA0A 3PPJA 4AA4A 1FVRA 4FVPA 4FKGA 4PP7A 5IMXA 1WBWA 3MJ2A 1ZMVA 3SA0A 2WQOA 1J1CA 3LQ8A 2C30A 5IQHA 3V6SA 5FEDA 3O5AA 2R3KA 4ANQA 3HUCA 4FV8A 2WU7A 3L9MA 3VUHA 1S9JA 4LOOA 5C27A 3H9RA 5D41A 2QU5A 5CVHA 5ACKA 1H27A 3VS2A 1GIHA 3LW0A 2OBJA 5HU9A 3C4FA 3TZ7A 4CT2A 3KN5A 4XV2A 4E4LA 4HPTE 2DYLA 4X2JA 5EW8A 4IAIA 2OIDA 4C8BA 3QCXA 4U45A 4EH7A 4QMUA 4BVUA 3CEKA 5FEEA 4DBXA 4M97A 5M08A 2C6KA 3NVKI 3KA0A 4Z9LA 1IA9A 3UZPA 4HYUA 2CLQA 3E8NA 3O51A 3FZOA 2PL0A 3RAHA 1GOLA 3QKMA 4CYJA 3GCPA 5AV2A 3P86A 5CSXA 4FUYA 5M51A 3BGPA 2C0IA 4ZTSA 5J8IA 5KMLA 3PFQA 4XG8A 4WBOA 5HEZA 4QTEA 4O7RA 4MXYA 3VUDA 4GFOA 2JBPA 2QQ7A 3G51A 3OF0A 3QD4A 4M0ZA 1OL6A 3GU8A 3O8PA 4CKJA 3P79A 3AC5A 5A14A 3R6XA 3M11A 2VWVA 2W4OA 5HLPA 4U3YA 3BI6A 2XS0A 4FV1A 3EQIA 3E62A 1IAJA 3LQ3A 3AGMA 4EWHA 5A4QA 3LMGA 4QQCA 1B39A 5C8NA 3F2RA 3SRVA 2X0GA 3HV3A 5HG5A 5M57A 2A0CX 3FY2A 3CXWA 2XIYA 3ORIA 5AP7A 4J53A 4B7TA 2R3QA 1OKWA 3W0NA 1HOWA 3MH3A 2W4JA 2ZB0A 4KIPA 5FXQA 2GDOA 2XK4A 2BCJA 3U6JA 4BI1A 2JBOA 5DEYA 4I5CA 4C62A 3R8MA 5JK3A 3Q9XA 1GNGA 4GU9A 4JXFA 5AIRA 4RVMA 2GCDA 3BE2A 3D0EA 4EZ3A 4P4CA 2KULA 2ETRA 2IW6A 5DR6A 4L53A 3PVBA 2BR1A 3GBZA 2JKMA 4QP8A 4S30A 4V0GB 4WUAA 4K9YA 3W2CA 5IDPA 3DNDA 4H3PA 1A48A 2P4IA 2XCKA 3P78A 1FQ1B 5HBHA 5HTCA 3G15A 1BYGA 2QG5A 3OEFX 2UW8A 3HMPA 4O27B 5AV1A 5AAFA 4OT5A 3TV4A 3TTIA 3WILA 1OVEA 1ZARA 3F5GA 4BCOA 3QKLA 3IS5A 3D5VA 4OTQA 2WTKC 4YLKA 3WZUA 4DG2E 3W0PA 3OBJA 3FI4A 3NYOA 3ZO1A 4C37A 4FT7A 2UZEA 4B0GA 3ZRKA 2UVZA 3LCDA 2C5NA 2WZJA 2GNLA 4U40A 4QNAA 2YACA 5TF9A 4H3BA 3EFKA 4MQ1A 4QMLA 4UWCA 5CU0A 4R1YA 4Y46A 3NNWA 5B2LA 4YJTA 3CKXA 4IXPA 4P5ZA 3A60A 3FXZA 5J1WA 3JVSA 5J7BA 2XKCA 2RFNA 3AC1A 3D14A 4NYEA 3SV0A 4CZTA 5HTIA 3F3ZA 4FTTA 4FKVA 3UQGA 3B2TA 3CPBA 4HOKA 3WZJA 2WD1A 1OUKA 3KQ7A 2WOUA 2ZDUA 3R02A 1ZOHA 1MRVA 3KULA 4XMOA 2Y6OA 3ZLXA 1H1WA 3A7HA 1YXVA 3H0YA 3G33A 3ZFXA 1JKKA 4AFJA 1GJOA 5CSWA 2RFDA 2XALA 4R78A 1JVPP 3IONA 4G3DA 4PTGA 4O7SA 2XKDA 5KBRA 3PY1A 2J51A 3EFLA 4FT3A 4G3FA 5BVFA 2F7XE 3K2LA 3DDQA 2OJFE 2JDRA 5M06A 3TXOA 3DOGA 3RVGA 2A1AB 1J91A 5KKRC 1OGUA 4GK4A 4M14A 2GSFA 4XG4A 4EBWA 1G8AA 3ENMA 3W10A 1PYXA 2QI8A 1OIYA 2VAGA 2V22A 3IDPA 3KVXA 4D58A 4W4YA 3EJ1A 3SD0A 5IDNA 3D7TA 5K5NA 4EKKA 4I94A 1P5EA 4DLJA 4FSZA 1GY3A 4ZK5A 1TFFA 3UNZA 3A61A 4L67A 3WYYA 1K2PA 2UW9A 4NH1A 5GZ8A 3NUAA 3PLAE 1YOJA 3UQCA 2BZHB 2O3PA 3VAPA 3CQWA 2XM8A 4F0IA 5C9CA 1E1VA 2GNGA 4TN6A 3HP5A 5K4JA 5M09A 3G0EA 4J8NA 3ZSHA 4QDEA 3HMMA 2V7OA 3QZIA 3RK5A 4XYFA 4CRSA 5CF8A 1WVWA 2JGZA 2OG8A 2XAOA 2PYWA 3KEXA 2IF8A 3PJ2A 4DGLC 4TPTA 2YM7A 3TACA 5BYZA 2R3GA 4H36A 4QTBA 3R7UA 1J3HA 4I6HA 5AR2A 4ANLA 5LMKA 4R3RA 1ATPE 3HKOA 3OT8A 4HCTA 4UEUA 4DG3E 5CY3A 2PZ5A 3RZBA 4EHZA 3UDZA 3DZQA 1APME 4DFXE 5A9UA 1JAMA 4AUAA 3ODZX 4APPA 4ZOGA 1W98A 3QWJA 1IASA 1UKHA 4YC8A 5DN3A 5CF4A 2WMTA 3WIKA 2AC5A 4JOAA 5FUTA 2C68A 2QOLA 1Y8YA 3C1XA 5J87A 4UMUA 3IGGA 4EC8A 4QMMA 5HI2A 3VULA 4F9BA 2XKEA 4L3LA 1H00A 4C2WA 5CWZA 4MCVA 2RF9A 1I09A 4F7SA 5DR9A 4BBFA 4P2KA 4BCJA 5F9EA 1UNHA 3BHVA 3E88A 4IAFA 3A8WA 4F6WA 3MFUA 5A6NA 4HGEA 3GC8A 3PJ8A 4E5WA 4CFUA 5DWRA 4FTNA 4L45A 3FL4A 5IUHA 2BDJA 1NVQA 5CNOA 2Z7SA 4Q2AA 3ROYA 5IA5A 3RKBA 2C6TA 4A9RA 3C51A 2XK3A 3G9LX 4AZWA 4IB1A 3TNHA 1R0EA 4CMTA 3HV4A 4OTRA 4E7WA 5L2IA 1PJKA 3UP2A 4BDGA 4EL9A 4GG7A 2OZAA 1XR1A 4RJ4A 3LJ1A 4BTJA 3V5WA 3LPBA 3V6RA 4KKHA 3IW8A 3QALE 5ETFA 1BX6A 3DFAA 2OXDA 3E7VA 3BRBA 3FMHA 3MSSA 3N9XA 3PPZA 4RJ8A 5I9ZA 1Q24A 3GCQA 4ZTMA 3GCUA 1XBAA 2HZIA 3CLYA 4BR3A 3NYNA 3V5LA 4U97A 3F88A 3ALOA 5FG8A 2YABA 3L1SA 3ZS5A 4B8MA 2X4FA 4QD6A 3CP9A 2HXLA 4U6RA 2XRWA 4AZVA 4NK9A 4QTCA 4RT7A 3GQLA 5GNKA 3VS3A 3O7LD 5HNBA 3D4QA 4FNXA 5HIDA 3L8XA 4BKZA 5HG7A 3S1HA 2OU7A 3LAUA 3GENA 2R0IA 4AXDA 4UMTA 2XNPA 4AT5A 4CCBA 4CTCA 2BRNA 4QMXA 5B7VA 4O2ZA 5HU3A 3Q6WA 2R7IA 4I22A 4R1VA 3RJCA 3UOLA 1FVVA 2I40A 3BIZA 3T9IA 3ZOSA 5F94A 1KOBA 3NAXA 4MNEB 3QLGA 3NDMA 4X2GA 2Y4IB 4FNWA 5HIEA 4FTIA 4LUEA 1QMZA 2X9EA 5IEXA 1W2DA 1FGIA 4F78A 1CKJA 2W1IA 3PP1A 2PZIA 4G2FA 4A4OA 5EM6A 2P33A 5AV0A 1U59A 1JPAA 3QTQA 4G6OA 4RFYA 3ZUUA 4Y72A 1S9IA 2JIUA 3P23A 4TYHA 4GUBA 5FM2A 2Q0NA 4GV1A 3THBA 5IQBA 4O4FA 4E73A 4C4JA 1XQZA 4BDKA 4U5JA 1BI8A 3D83A 1Q3DA 3KRLA 4FC0A 3RWQA 4JAIA 5CX9A 5HLWA 4FTUA 2YFXA 3GT8A 4PMPA 2IVUA 4BDFA 3QU0A 5LVOA 3POZA 4UN0C 3O71A 2XANA 5IH6A 3TM0A 5A54A 1GAGA 1M14A 3WI6A 2CJMA 2XK6A 2Y4PA 2PUIA 1NY3A 1OIUA 2HWPA 3F69A 3FQSA 2WMUA 4JJRA 4PDPA 4R3CA 4EUTA 2F7EE 3AC8A 4AT4A 2BHHA 3ZFYA 3MB7A 5IEVA 1CKPA 1PXMA 2RL5A 2HW6A 4IAAA 4DT8A 2QNJA 3RZFA 2BIKB 3R22A 4BCGA 4OBPA 2X1NA 3QX4A 5IQGA 4MHAA 4NCTA 5EHYA 4EQUA 1YI4A 3COKA 2CCIA 4GKIA 2C1AA 4EOMA 5B2KA 4JNWA 2IPXA 2XK8A 2JLDA 3OHTA 3QD3A 4RGJA 4U43A 4X3FC 3ZC6A 3FMNA 4O7YA 3CQUA 3KMWA 4NZWB 5EG3A 3BYUA 4FZ7A 2UZUE 4YNOA 3NMUF 4JQ7A 3BU5A 5HE3A 5CEKA 4LRMA 3FMJA 3N51A 5CEIA 4L3JA 5CZIA 4G16A 4EUUA 2JKOA 5KBQA 3EMGA 4L7FA 4IB0A 3VBYA 4BY9E 3LHJA 3KVWA 4IIRA 4FNYA 4E26A 5HNIX 4EHEA 2YCFA 4XP2A 2GHGA 5DIAA 3DZOA 4RC3A 4O7NA 2PZRA 2R64A 4TNDA 4M66A 3WYXA 5C26A 2VWBA 3E63A 3MFRA 4P90A 4DCAA 4G1WA 4ARKA 3OZ6A 4C4GA 4RSSA 3ZCLA 2IZSA 4AOIA 4DFZE 2HY81 4UWBA 2ITQA 3HRCA 2I0YA 2FH9A 3A4OX 3ZM4A 4BWPA 3BEAA 2GNHA 3MVLA 5DOSA 4DGOA 3CSVA 5CI7A 2EB3A 3VBQA 4QYHA 4E4MA 2H96A 4RWKA 5DYJA 3D9VA 5I4NA 3QQUA 4JDIA 4EK5A 2UZTA 4DEIA 3GFEA 4D0WA 2PVMA 5C1QB 4DEBA 4I23A 2HELA 3DBCA 4I93A 1QL6A 1QPEA 4JL9A 5BVEA 4E6CA 4BDDA 1F3MC 2Z7QA 3CY2A 3O8TA 5TE0A 1DM2A 4DE4A 3A2CA 1XBCA 2C6MA 4ENXA 3Q9WA 4MD8E 4RIXA 4F1MA 5I9XA 4DFBA 3PVWA 3RHXA 2OICA 3KRXA 5JZJA 3FI2A 2YERA 1SNXA 3WZEA 4O38A 4ZJIA 4AOJA 4E1ZA 3N4VA 3R00A 3EKNA 4FIHA 5EH0A 3F7ZA 3JY9A 2ITNA 4TXCA 5FDXA 3Q9YA 2RKUA 2R3FA 4TYEA 3IGOA 3GB2A 3IO7A 3FKNA 3I7BA 5FP5A 2A27A 3DJ6A 1Q99A 3VVHA 2PULA 3F5UA 4X2KA 2YAAA 4MAOA 4XG9A 3ZBFA 1PXLA 2W1HA 1WBSA 3W32A 5CAOA 5HG9A 5J9ZA 1UWJA 5EOBA 3F6XA 2IN6A 4DTKA 2FA2A 3UG1A 5AUVA 3L8PA 3CGOA 5HBJA 3MVMA 2VUWA 2LGCA 2UZDA 2VO0A 4J95A 4O0RA 3UG2A 3CD8A 4FODA 3AG9A 4ZMFA 3NRMA 3HGKA 5HD4A 2XRUA 2JKKA 1JKSA 4OAVB 3JYAA 4ITJA 4BHZA 3AT3A 3KL8A 4XEYA 4F9YA 4C02A 3HX4A 3FQEA 4ANSA 4I1ZA 5HESA 4FVQA 5CI6A 3RPOA 4RIWB 3O7LB 4WG4A 2UVYA 3WOWA 1UV5A 3PXKA 5DE2A 3R7OA 5ICPA 4PDYA 3QFVA 2PZPA 4MWHA 2QHNA 3AKLA 3EFWA 4X6RA 4GT4A 2OZOA 2W7XA 5I9UA 2OF4A 3E5AA 1M7QA 5CXZA 4M67A 3UQFA 4GS6A 4KIOA 3KRWA 4G9CA 5DLSA 2OXXA 4O6LA 4FV2A 1UKIA 4MXZA 2C5XA 1KE7A 2ITUA 3FSKA 5AUXA 3S3IA 4RX7A 1Q5KA 1XH9A 3FYJX 3VQHA 5HCXA 4I4EA 4BYIA 2JC6A 2WMAA 2BHEA 2WQNA 3GCVA 4MK0A 3TNPC 2CNUA 2QKRA 5ANDA 5HBEA 4EH3A 1ZMUA 4LV5A 4YTCA 5TO8A 4AW5A 4A4LA 5AM7A 3CS9A 5KHXA 4DA5A 3I5NA 5E8WA 5AUZA 4C4FA 3C50A 4BDAA 4IBMA 1M17A 3R2YA 4FT9A 4TT7A 3ANQA 4ZTHA 1V0OA 2VU3A 3ACJA 1DAYA 3AT4A 5BVOA 4QEBA 3C5UA 3Q4UA 3RHKA 5IA2A 2PUNA 3BLQA 4RQVA 4BTMA 5BNJA 1PF8A 3AD6A 3DQWA 4A06A 1O6YA 3RAKA 4FSMA 3RM7A 3FI8A 2W9FB 5GIPE 2EU9A 1QCFA 2PZYA 2X0OA 5CSHA 5DEWA 1YWRA 4BZOA 2QR7A 5EQEA 4NIFA 2C6LA 2XUUA 1H8FA 3SC1A 3ULIA 4C3RA 4O96A 3BX5A 3CE3A 2WTWA 5CVGA 3H3CA 2ZOQA 2J50A 4LGGA 4E6AA 3E64A 5D1JA 5HHWA 2NPQA 1J7UA 3P5KA 3ORKA 4FV9A 4E5AX 2YM3A 3AKKA 4ZLOA 2NNWB 5AP5A 4KRCA 3QRKA 3ZO4A 4AZTA 2CGVA 3D7TB 4QP2A 2HAKA 4PPAA 4K33A 4FK6A 4LRKA 5BMSA 2VRXA 4QPAA 2I1MA 2YISA 3OW4A 4PV0A 3CTQA 4CG9A 3MW1A 4IVBA 3F9NA 2XM9A 4O91A 3C5IA 5EI2A 1AQ1A 3OXZA 2X4ZA 5CXHA 4C57A 2Z02A 2XCHA 1Q61A