4P90A

Crystal structure of the kinase domain of human pak1 in complex with compound 15
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
293
structure length
272
Chain Sequence
DEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMEVAIKQMKELIINEILVMRENKNPNIVNYLDSYLELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQIKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Identification and optimisation of 7-azaindole PAK1 inhibitors with improved potency and kinase selectivity.
doi rcsb
source organism Homo sapiens
total genus 84
structure length 272
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p90A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p90A01
4ANOA 4FMQA 1GY3A 4EWHA 4KSQA 1NVQA 1RQQA 3OTVA 4BI1A 1W83A 5IH6A 3PSDA 1W8CA 2OF4A 4OR5A 3G0EA 3F3WA 3JYAA 3W2OA 5DR2A 3IW8A 1K2PA 3E63A 2IN6A 3FLYA 2OU7A 2WEVA 4G3DA 3R7EA 1S9IA 3PPJA 3R8UA 2BR1A 1SVHA 2ITNA 2GFSA 2JKMA 2QURA 3CY2A 1YOMA 5IQBA 1XH4A 3BQRA 3QBNA 4ZS4A 3RPYA 4CZYB 2WQNA 4DH1A 2WEIA 5FD2A 2FO0A 3PP1A 3JVSA 5AP2A 3Q4ZA 3TDWA 5TKDA 3KN6A 4LM5A 4M84A 4QQCA 4O0UA 2CDZA 3P7AA 1XH6A 3UVPA 4QMMA 3RMFA 1FGIA 2VWWA 2GQSA 1XJDA 5IQEA 5KE0A 1JKTA 2W4OA 4X21A 3RALA 4EOPA 2QOKA 2CNQA 4V0GB 1MUOA 4AX8A 1Q97A 4MNEA 4F1MA 5I9ZA 2WMWA 2OIDA 3HGKA 4PMSA 3JR1A 3IW7A 3R2BA 4FOBA 4RLKA 1PXPA 3FL4A 2QOIA 3BE2A 1MQBA 3OG7A 4C4HA 3FC2A 3PE1A 4WD5A 3UOKA 3ZFYA 2IO6A 4D2WA 4ERWA 4TYIA 4X3FA 3DQWA 2ZMCA 4IAYA 3ZUVA 4AN3A 4BCKA 3S1HA 3R1SA 5BVEA 3V8TA 3TV4A 3IW6A 4FUXA 4QD6A 5HVKA 5T6KA 4F65A 4IVAA 4Y8DA 1GIHA 4YZDA 4DA5A 2OG8A 4FEVA 3KXXA 5E7RA 3PY0A 3AC4A 2E9OA 3THBA 1WBVA 3ZLYA 2JKKA 3HDMA 4I4EA 4XV2A 3D5XA 3LCSA 2YDJA 3VS7A 4L7FA 4FNXA 3ZO1A 2ONLA 2X7GA 3AT4A 3NYOA 3EN6A 3U54A 3UOJA 4HYUA 5AV3A 4LI5A 4RVTA 3GI3A 2JKQA 3PG3A 2WMUA 4FIFA 3W2RA 4BDIA 4J8MA 4WBBB 3BLRA 2X4ZA 4YC3A 3VN9A 4L8MA 4WRGA 3O51A 2P2IA 3FC1X 3TEIA 3D2KA 3PZHA 3PY1A 2YN8A 3MJ2A 1ZLTA 2BAQA 4IX5A 4MBJA 3VQHA 4EH9A 2G15A 2VGOA 3OCBA 4QRCA 4MKCA 4MXZA 3NMUF 3PRIA 4OTHA 3AMAA 5CU3A 1VYWA 2X0GA 4O27B 2GQGA 3FI4A 3EFWA 3NWWA 5AP7A 2JFLA 5AEPA 5KMNA 4EJ7A 1KE8A 5I0BA 3UO4A 4EUTA 5M56A 4DEBA 4ZY4A 1NT2A 3T3UA 3V5TA 1KOBA 2ITUA 2XUUA 3DBEA 4FYOA 4Q9SA 2ZV9A 5LCJA 4MK0A 3FWQA 2C0TA 2PWLA 3TJCA 4TYGA 4ZTRA 3U4UA 3VUMA 3UIXA 2WAJA 5DOSA 3FQHA 5FTOA 3FI8A 4L00A 4FEUA 1M17A 5TT7A 2IVUA 4M69A 4C36A 5FDXA 4NM3A 1P4FA 3DJ5A 4F99A 2C5VA 3OF0A 3LAUA 1ZZLA 3TM0A 4QQTA 2JBOA 4QPSA 1UNLA 4BZOA 3F5UA 4FSUA 3FPMA 3ZRKA 3Q9XA 3HAMA 4QPMA 5DN3A 5A46A 3QC9A 2PMNX 3QYWA 4F9CA 3BKBA 1PF8A 5G1XA 3RNIA 3WZUA 4ACGA 3DPKA 4XV1A 3TUCA 4YZCA 3R9RA 2BILB 2PL0A 2PZYA 3Q9ZA 4P2KA 4C4JA 5M4UA 5IMEA 4U45A 3O2MA 1CKPA 5KMJA 2R3KA 1KSWA 2UW6A 2XNPA 4UZDA 4CRSA 4I6BA 4EH4A 4OTIA 4M13A 4S2ZA 4AA5A 4J98A 4O86A 2I0HA 5DHJA 5DT0A 3TWJA 5I4NA 4HOKA 4NCTC 3RNYA 2HZIA 1U54B 2NRYA 3NUUA 1Q8TA 4RWIA 2UW0A 5H3QA 3G5DA 2YWVA 2OZAA 4CQEA 4TKSA 2EB2A 3C4XA 4HYSA 4D1SA 3DKCA 2GDOA 2UUEA 4KWPA 3DFAA 4FV4A 4KINA 4LRMA 4XX9A 4KBCA 4KUJA 3IW4A 3E92A 1VJYA 3EL8A 3I5NA 1PXLA 4FTOA 5KHXA 3KY2A 4MAOA 5HX8A 4FL2A 1UU9A 4FSQA 4RX5A 2BDJA 4RJ6A 4ACDA 3A62A 3VS4A 3RJCA 3CQEA 2PE1A 2RIOA 3VS6A 4JQ8A 4OBOA 5CSWA 4Q5HA 5F20A 4AF3A 4EQUA 2R3PA 5IQFA 3FMKA 3MYGA 3RPVA 2W1FA 4L46A 5HE3A 3GC8A 4FSRA 4IB1A 4LV5A 1Z5MA 3I0OA 1UNGA 4JIKA 5J95A 4DG2E 2WTKC 3DDPA 4OT6A 2WHBA 5BYLA 4JBOA 4XG3A 2R7BA 4EZ3A 4PDOA 2YABA 3AGMA 5HNBA 2VAGA 4L7SA 3LFFA 5HIDA 4O6LA 3QTXA 4RJ5A 3E7OA 3EL7A 4IHPA 5EI6A 1WCCA 1VYZA 3E5AA 1OGUA 3PPZA 5EYDA 5FEEA 4AGWA 3CY3A 2IVTA 2ZB1A 4NW6A 4USFA 4MQ2A 2F57A 4JBQA 4U0IA 4IZ5A 2IVVA 3BGPA 2VTIA 4AT3A 1UU3A 5AP3A 1B6CB 3QWKA 4MQ1A 4RFZA 5HE1A 2GFCA 4KSPA 5AR3A 2BVAA 4BI0A 3JPVA 2Y4PA 5AUXA 5IDNA 3QX2A 4RWLA 4ANMA 4NIFA 3TNWA 3GT8A 4NJ3A 2F7ZE 1J3HA 4BZNA 4MH7A 5E1EA 4D2RA 1KV2A 2AYPA 3V6RA 1IRKA 4JXFA 2VX1A 4YLLA 3FE3A 4ERKA 5IA4A 3BE9A 3MN3A 4QNAA 1V0PA 5J87A 2YHVA 3HECA 4CEGA 3KULA 4E1ZA 3O7LB 3QTWA 3PXFA 3FZSA 3DB8A 2PUNA 3UOHA 3ETAA 1UV5A 4CFFA 4FL1A 5FEQA 2CGUA 5B7VA 2XK8A 2X6EA 4FT0A 2YM4A 2HW6A 1ZMVA 5A9UA 5JGBA 1G8AA 4GFOA 2X7OA 4PMMA 4D4VA 5GZAA 4ZZOA 2O8YA 4MEDA 1Q62A 2OJIA 3QHRA 3QQJA 4S33A 4WG3A 4ZP5A 4DFZE 3PJ8A 4ZJJA 1W7HA 3SA0A 1WVWA 1RJBA 4YHFA 4ZSEA 5AM7A 4IVBA 4APPA 2QKRA 4UALA 4PPCA 4BCJA 5AX3A 3GOPA 1FPUA 2Q0BA 5GJFA 1ZYCA 4IZ7A 2YIYA 4D5KA 3KCKA 4CZTA 1OL7A 3PVGA 4FKRA 5ANEA 3TXOA 4B99A 4E93A 3DKGA 2CKQA 3HUBA 4IAIA 3SC1A 3SRVB 1GZ8A 4UZHA 3G9LX 4WUNA 4C37A 4QMXA 2FA2A 1S9JA 4FKGA 4JBVA 3H10A 3MBLA 4MD7E 3DJ6A 4RIXA 4A9UA 3EQDA 1WBPA 4TY1A 4BKZA 2WMSA 5AAFA 4DEEA 3ORIA 1H8FA 3CD3A 3QRKA 5GNKA 3HA6A 3V8SA 5C9CA 1ZAOA 1NW1A 3RWQA 3BHYA 2REIA 3QGYA 5IKWA 4CFMA 4ZTMA 2OJ9A 3DKOA 4DFNA 4RIOA 3AXWA 4RWKA 1J91A 3R7GA 4W4VA 2H6DA 4AZFA 4JG8A 4ZEGA 5AM6A 2BALA 5E8ZA 2GNIA 4BCQA 3DA6A 3G6GA 3HA8A 2VTOA 2XKDA 3KRLA 4H1MA 3UNJA 3ZO3A 1FQ1B 4WA9A 4BBMA 1XBBA 4AFJA 4IB5A 4KIPA 5HGIA 1ZMWA 4JR7A 3C51A 4AZSA 5M09A 4M0ZA 3B2WA 4FKSA 3TI1A 5EDRA 1H08A 3QUDA 1KOAA 3E8DA 3CXWA 3HNGA 3MFUA 4L3PA 4RFYA 4YSMA 5EDQA 2VZ6A 2WMRA 4ZXTA 4EH6A 4F1OA 1Q8YA 1YXTA 2YAAA 4MHAA 3DXQA 4YJUA 4S31A 4UWCA 1XO2B 1ZMUA 3SAYA 4ZJVA 2J0LA 1NVRA 5I3OA 4EBWA 5B0XA 1GIJA 3D7ZA 2PPQA 4IJPA 5TF9A 1PXNA 2E2BA 2CGVA 3F7WA 3FZRA 3PG1A 4JL9A 4TTHB 5L6WL 3SOCA 3RGFA 5HBHA 2WQEA 5BMSA 3JXWA 2XH5A 3I60A 2RG6A 3CTQA 4J52A 2PMOX 5CSVA 4W9WA 4FEQA 3MI9A 5AAEA 2WQOA 5BYZA 4YNEA 4C57A 4WNKA 3R2YA 4AGCA 1PXJA 1TQMA 1K3AA 4FVQA 4UN0C 3CKWA 3I6WA 4MD9E 4YJNA 2GSFA 5D10A 2JD5A 2OGVA 2R3OA 4I21A 4NFMA 4NM5A 4D28A 5IQHA 3Q96A 3QF9A 4AE9A 4RIWB 1G3NA 4AT5A 4FEXA 4OBQA 2C6KA 3WF5A 1ZY4A 3DLZA 4A4XA 2PHKA 3G15A 3MH2A 3GC0A 4XBUA 3A7IA 4BYIA 5M4IA 3ITZA 4I5PA 3N51A 3BU5A 4BF2A 2GNLA 4G9RA 3R7OA 4O84A 5L2TA 3CPCA 4EZ7A 1KE6A 5K4IA 2QI8A 3QRUA 4FKIA 3TNQB 3CTJA 3R28A 2YM5A 2ZV2A 1OECA 3VUDA 4HGLA 4YJTA 3NAYA 3U9CA 3ZLXA 4AA0A 4FV6A 3RK9A 3D5UA 4K1BA 2BAJA 3E8EA 1LPUA 1M2QA 2B9FA 4M8TA 4CFNA 4O7NA 1K9AA 4CT2A 1MRUA 2CCIA 3ZSGA 4BC6A 2C69A 3H9RA 4DG0E 4EOSA 4O91A 3G51A 4G31A 2UVZA 4IAZA 4EH5A 5AWMA 1FVTA 1E9HA 1VR2A 2RFSA 1URCA 3CC6A 3QRJA 4RLLA 1RE8A 5DEWA 1H1QA 4I92A 4PMPA 4CGAA 4XJ0A 3QCXA 5M08A 5HNIX 4J99A 4F7LA 3BYMA 4N4SA 3EKKA 3LM0A 3QQUA 3L8PA 3ROCA 4F0IA 1FINA 2BRMA 3EWHA 4FOCA 4LMNA 4UYAA 5BYYA 3SXRA 2G2HA 4CD0A 1XH8A 4DLJA 3R00A 5JSMA 1XBAA 5CXZA 2C6DA 4IM2A 3LMIA 2OO8X 3JY0A 4GCJA 4X0MA 3UG1A 2PVMA 3S4QA 2WELA 2J0KA 4F9BA 5IISA 3LQ3A 4JNWA 3HAVA 3OT8A 3QD0A 4E5BA 2WTVA 2YISA 1ZYJA 4BDJA 3TT0A 3FEGA 2CMWA 3LFSA 2X4FA 3LFQA 3UJGA 4Z55A 4ARKA 4D1XA 4FT9A 2ZAZA 1DAYA 2EXEA 3ZEPA 2BPMA 2C6MA 2HENA 2VRXA 4FTUA 3PRFA 4FZAB 4JJRA 2C0IA 2W4JA 3PPKA 4BDAA 1OIRA 4YJOA 1PMVA 3B8RA 4BI2A 5BUJA 3F6XA 4IM0A 3SX9A 4GRBA 3ZCLA 4XP3A 4A7CA 4LOOA 1WBSA 4JDIA 3VS2A 2A0CX 2XRUA 1Q8UA 4R8QA 2VNYA 4F1TA 4H3PA 3VS1A 4FTAA 5D41A 3Q9YA 4AW0A 4HW7A 2JDTA 2R3RA 3LCDA 2XF0A 2UW3A 3VUGA 4MTAA 4BWXA 1BX6A 3NR9A 3ATSA 5J9ZA 3NYXA 3AD5A 4H39A 5C4KA 3QA0A 1WMKA 2YACA 3C50A 3IPHA 5JGDA 5E91A 1SYKA 1YI6A 4AN9A 3BEAA 3DFCB 5FEDA 4CFVA 1J7UA 3KXZA 3UO5A 3QQHA 4V05A 5BVWA 5DRBA 2ZM3A 2HIWA 2G01A 2CLXA 4QYEA 4X2NA 3F66A 4PWNA 4RG0A 2KTYA 5DIAA 1JKLA 2WU6A 3FMNA 5FXQA 5H8BA 4D2TA 3UYSA 5BNJA 3F82A 4GK2A 4KD1A 3AC8A 1OM1A 4NU1A 5HU3A 4DCAA 4NTTA 4FIJA 4HGSA 4Y72A 4IADA 4CYIA 4DE4A 3B8QA 2F9GA 5GJDA 4HVDA 4RZVA 4BTFA 4FG9A 4QTDA 5AV2A 1REJA 2JDRA 3EN5A 4XG4A 4FEWA 3D15A 2F49A 1JKSA 1IA8A 2WIPA 4HVGA 4ASXA 2ZMDA 5CU4A 4O38A 2ZDUA 3C0IA 5LVLA 4P4CA 2ACXA 3VBQA 3GU7A 3PWDA 4TYEA 3TZ7A 2HELA 4BBFA 5J1WA 2XKFA 3EQCA 4OAVB 3HMMA 3OTUA 3EYGA 2BZJA 2XYNA 3C0GA 4MNFA 5DR9A 3VO3A 1BI8A 2X8EA 4KBAA 2ETKA 4XOZA 2C3KA 3UDBA 5LJJA 4G5PA 2UW8A 3D9VA 3MVJA 5AIKA 3GCSA 5EW8A 3L9NA 2O65A 2BDFA 3FQSA 3QGWA 3KFAA 5GHVA 4Y5HA 4C61A 4YSJA 4DFXE 5AP0A 4D9UA 4WG4A 1OPKA 3VHEA 4QP9A 3DAKA 2NO3A 4UB7A 4NWMA 4R3PA 2OLCA 1MP8A 2PZIA 4G5JA 3FHRA 5F9EA 3OBGA 4XRLA 5IUIA 4MBLA 4ACHA 3DXPA 3WZDA 4DFBA 3O17A 1OKVA 1YHVA 4I6QA 5EI8A 3OOGA 3DTCA 4U9AA 2DWBA 5KNJA 4F09A 2J5EA 3LXKA 2J5FA 3POOA 4KIKA 3IS5A 2EVAA 4V01A 5FDPA 3VIDA 2GQRA 5FGKA 3LLAA 3QRIA 4DLIA 4NCTA 2PZ5A 5ACKA 2PVFA 2VTHA 4R3RA 3EIDA 4LGHA 4O0SA 5D11A 4D9TA 3RI1A 2BAKA 3O96A 5KMKA 3BGZA 1IR3A 3NUSA 4IAFA 5EI2A 5C03A 3BI6A 4ZJIA 4K18A 3RPSA 4ALVA 4MBIA 5ITAA 5E9EA 4I1ZA 5DYJA 4RX9A 5AV4A 4DEGA 4NH1A 5L8LA 3LOKA 2QOCA 5EDPA 2J6MA 2VN9A 2OIBA 3GBZA 3HMOA 3K54A 2ERKA 4QT1A 4AFEA 2Y4IB 4P5ZA 4P90A 2CNVA 4H1JA 3P23A 2FSTX 4YZMA 2WGJA 5DT3A 5H9BA 1H26A 4Q9ZA 4OTPA 4B4LA 3MGYA 3A61A 2OZOA 4NT4A 4BKYA 2YM7A 4XMOA 3II5A 3R73A 3LJ0A 1H1RA 2XB7A 3PA4A 1MRVA 4RA5A 1U5QA 3UQFA 5HCYA 2PTKA 4KKEA 4AP7A 4S32A 3BRBA 4DEHA 2YZAA 3CTHA 4IX4A 4FVRA 4EZ5A 2JDOA 3VF8A 5HNGA 3QD4A 1H25A 4ZLOA 5HIEA 2W5AA 2WIHA 2UVXA 4II5A 3MH1A 3PLSA 4AGUA 5HX6A 5IA1A 1L8TA 2C6LA 3EHAA 5M53A 5CTPA 3V5WA 3EB0A 3N9XA 3PA5A 5HG8A 5HOAA 5AA9A 1BKXA 2C5NA 3GCPA 4FIHA 2C3JA 5ETFA 5IZFA 5J7HA 4YHTA 1LP4A 4FV5A 4E6QA 4PMTA 5HBEA 3IDCA 5EOBA 4JAJA 1JSTA 3KRXA 1CMKE 5DWRA 2PE0A 3R9OA 5BUEA 4IC7A 4AACA 4BCNA 3NIZA 5J5SA 3LQ5A 2BKKA 2PMIA 4FE2A 4E5WA 4FICA 5CXHA 4ORKA 1P5EA 4A9TA 4FBXA 4DGNA 5M4FA 3WZKA 4RJ4A 3HKOA 3GGFA 4GKIA 2UZVA 2ZVAA 3HDNA 2EUFB 4FTJA 4H36A 3EQGA 3OC1A 3QTUA 4FTIA 4CRLA 5C8NA 3BYUA 3LJ2A 2C5XA 4K9YA 2BZHB 1U59A 1YWRA 3DAEA 4YJQA 1YW2A 3FMDA 1YHSA 4DBNA 4YZNA 3P7CA 2IW9A 5LMBA 3HRBA 2KULA 3A4OX 3SW4A 5IPJA 5AR5A 4YMJA 2GU8A 5CEQA 4FX3A 2XNMA 4KS7A 5DT4A 3DQXA 3SQQA 4ZSJA 4O7VA 2BTSA 5AX9A 1M2PA 2VTRA 3GQLA 5CAPA 4YLJA 4GMYA 2XK3A 3OWKA 5IUGA 2QOQA 3UNZA 3CBLA 4DGOA 5I9UA 5FUTA 4JT3A 4F7JA 1AD5A 4U81A 3ODZX 4CNHA 2CHLA 3ACJA 5E8YA 5CZIA 2PVJA 3S00A 4KAOA 4A9YA 1WAKA 2YWPA 4GH2A 4A06A 3BLHA 1YXXA 5AUWA 4LYNA 3G33A 3UBDA 4QTEA 3W33A 4PV0A 3DBQA 5CENA 3ZXZA 5DRDA 3R63A 3COMA 2W96B 3P78A 5DI1A 3DT1A 3Q6UA 3H30A 4H3BA 2RFEA 2HXLA 4IWOA 4UX9A 3N4UA 5DPVA 3FLNC 5AIRA 2YA9A 1GJOA 1W98A 3MA3A 3MPTA 4XLIA 5GZ8A 4WBOA 3NAXA 2VWZA 3KMWA 3GEQA 5E92A 2JIUA 1XQZA 3AG9A 4LQMA 2IWIA 3LFBA 1NVSA 4C58A 3SGCA 4O6EA 3MH0A 5E8WA 3MFSA 4TPTA 4GK3A 1H07A 2CLQA 3SG8A 4BFMA 2OK1A 1M7QA 4G1WA 4A4LA 2WPAA 5HLWA 3O8TA 3CCNA 3GU4A 3R8ZA 2QOLA 5HTIA 4D2PA 4GG7A 2X39A 4AS0A 3NVMB 4W4WA 2B9HA 5AUZA 4N57A 4LL0A 4QYHA 4O7WA 3EN4A 2R3QA 1QPJA 3LFCA 4OUCA 2RL5A 4QTCA 3EMGA 4N0SA 3KK8A 3G90X 3QKMA 4JAIA 1BL7A 4Y46A 4AZVA 3LCTA 2OW3A 2QHNA 3OXZA 5EHOA 1KWPA 1URWA 3WYYA 2G2IA 2P55A 3Q5IA 3QQGA 3E7VA 4O2PA 3UGCA 3UVRA 2A1AB 5JFVA 4NW5A 2QHMA 5HE0A 4BY9E 4D2SA 5J1VA 4NL0A 2EB3A 4EOQA 4AW5A 2UZBA 4DH8A 2R3IA 4FNWA 4ALWA 3MPAA 2C3IB 3BYSA 3KC3A 3NUNA 3QD3A 4W4YA 3VBXA 3ZLWA 2RGPA 1VEBA 3FJQE 4RA4A 4WHZA 3OFMA 4YU2A 5G6VA 2QKWB 2VWUA 3U87A 3ZFXA 4JBPA 4FF8A 5LVOA 2XM8A 3DK6A 3B2TA 3EQHA 3Q9WA 4BZDA 5JFWA 5LWMA 1U46A 4U43A 4FV1A 4OTFA 4BDDA 3HMIA 2PVYA 3D7TB 5BVDA 2FSOX 5JRSA 4AT4A 3R30A 4TNDA 4DGMA 4JIAA 4IMYA 2XEYA 1R78A 5GIPE 2B55A 4B0GA 3VC4A 3RHKA 4YGAA 5I9YA 4TWNA 4B7TA 4EKLA 3W10A 1ZOGA 3OHTA 3W8LA 2I1MA 2HWPA 4XNEA 5K0XA 4EI4A 4ZK5A 3WE8A 4PTGA 2F2CB 4JRVA 1XKKA 2Z7LA 3PXQA 1R1WA 4K33A 4JX7A 5K9IA 5HE2A 1L3RE 2YIXA 2ETMA 4KKGA 4G3EA 4U41A 5KKRB 4DFYA 3NNVA 4HPUE 2CKPA 4LV8A 3UIBA 2GNFA 5EQYA 4M68A 1UKIA 1OZ1A 1YOJA 4XH6A 5A3XA 1M7NA 2H8HA 4BCPA 3FXXA 4PTEA 1PXKA 1M52A 4RVKA 3Q32A 1ZOHA 5ETCA 2LAVA 2GS2A 4C02A 3D5VA 3F69A 4GIIA 4MX9A 5AR2A 3WZEA 4D2VA 4DGGA 3BGQA 1OIQA 3NDMA 4TN6A 2CGWA 4EK5A 5AUYA 5JK3A 2VNWA 2W99B 2A2AA 3NX8A 4BICA 5BVOA 2HCKA 1PMEA 4O21A 2V22A 2UW9A 2VTPA 1E1VA 3EFLA 3LVPA 3WE4A 3SXSA 3L1SA 1XH9A 2C1AA 4Y83A 5ANGA 3LXPA 3P08A 3TL8A 3UE4A 4BB4A 4U8ZA 4U3ZA 3HRCA 5JQ8A 5BUIA 4FZDB 5D7VA 3F88A 4FKJA 3P9JA 5AV1A 3QCYA 3ERKA 4K77A 4DFLA 3BELA 1JSVA 4MYGA 3T9TA 2ZYBA 5IA5A 4APCA 2WMVA 3V8WA 4FV8A 4E20A 1CTPE 3VNTA 1Y8GA 3VW6A 3SLSA 4HCUA 2X7FA 3VF9A 5BVFA 4JX3A 3A99A 3Q2JA 4WNMA 3KRRA 5J5TA 4FG8A 4IM3A 4QMSA 4FV0A 4KNBA 4BWKA 1OIYA 1DI8A 3A8WA 3GVUA 2WQMA 4XV3A 3V04A 1PKDA 4L43A 3MA6A 4BR3A 2OWBA 3FMLA 4PPBA 2YM8A 4C62A 1F0QA 2IPXA 5EQPA 3QZGA 4BGHA 5IDPA 1SZMA 5GZ9A 4GIHA 2C68A 2XNEA 4PF4A 3ZH8A 3QCQA 5IA2A 5AJQA 2XNBA 4E7WA 1WZYA 3NW5A 2JEDA 5IA3A 2O0UA 4V0GA 1Q5KA 2YLEA 4FSNA 4RRVA 2WTCA 4O0VA 5HVJA 5KMLA 1B39A 2HXQA 1X8BA 3M42A 4L68A 4JG7A 4N70A 3SOAA 4EK3A 5KBQA 5L2SA 5M07A 5BX0A 1QCFA 2PVNA 2W1GA 2XCHA 4XP2A 5J8IA 2JAMA 4BBEA 4AG8A 2JLDA 4I24A 5A54A 3IO7A 3N4TA 3LKMA 3F5XA 4RQVA 2BIYA 4U6RA 5AUTA 2A27A 4L9IA 4Y5QA 3C0HA 5M55A 3WF9A 3UQCA 1YWNA 4O7SA 4BDHA 5E8XA 3G6HA 4CLIA 4OLIA 3NUYA 5CYIA 1Q61A 5K4JA 2CN5A 2UZDA 3DZQA 4I20A 4KB8A 3P86A 5EYKA 1UNHA 4IQ6A 4GSBA 2XYUA 3QZIA 3FV8A 3H9OA 4BVUA 4FKPA 2XBJA 3UP7A 3F7ZA 3QALE 4RIYB 3FI2A 1AQ1A 2UZWE 3ZC6A 5LMKC 2WOUA 1FBNA 4F08A 1JQHA 3P5KA 3VHKA 4O7YA 1ZOEA 4FKOA 1OL1A 5EW9A 3GU8A 3KK9A 4ZSLA 5HO8A 3EH9A 4M14A 4E3CA 4JS8A 1JPAA 3L9LA 3KL8A 2XJ0A 5EW3A 3VS0A 3GOKA 4R78A 3Q04A 4D4SA 4HJOA 3AC1A 3HLLA 2XA4A 4RPVA 4G16A 2WTWA 4BIDA 2VTMA 2JIIA 4BGQA 3UZTA 2XKEA 5CSXA 2BFXA 4X2FA 4HVIA 2PZPA 3I81A 1SNXA 4V04A 2WO6A 3VS5A 4BCIA 4E6CA 2JBPA 5DR6A 4MF0A 1ATPE 3O71A 3OCGA 4NFNA 4WRSA 3C4ZA 4NUSA 5LMAA 5EM5A 3MWUA 5C8KA 4O0YA 4YJSA 5A14A 2VO3A 3PE2A 3LCKA 3PVWA 4FGBA 1NA7A 4TYHB 4AOTA 2W1DA 3BHHA 3VUIA 4F0GA 4XLVA 3BPRA 3ZUTA 2ERZE 4JDKA 1P14A 3VJOA 4E4NA 3DB6A 4PX6A 3KA0A 1IG1A 1FOTA 1OUYA 3ZHPC 5LWNA 2Z7RA 5TR6A 2E9VA 5CF6A 3U55A 2WMQA 3KF4A 4FKUA 1VZOA 4C35A 5BQ0A 4O96A 1OPJA 2VX0A 3P79A 3RM7A 4JOAA 2J0JA 3TIZA 3CSVA 4K0YA 4E4MA 2NP8A 4BDBA 5LARA 1GAGA 2NPQA 1OL5A 2OJGA 3KRJA 4YJVA 4CFXA 2HZNA 4WUAA 4OTGA 4QOXA 4PNIA 4F63A 3R9NA 4GU9A 3I7CA 4U97A 2PVKA 5AR7A 3HVCA 3KXMA 4FZ6A 4R7BA 4HGEA 3FMMA 3DKFA 5AMNA 4C8BA 3CGFA 4X6QC 2WZJA 5ACBC 3A8XA 4ANNA 4R1YA 3P4KA 3C5UA 1V0OA 2PVHA 2W5HA 4ZLZA 2GHLA 3MFTA 3NNWA 5H8EA 2I40A 3WIKA 4IJ9A 5KMMA 2Y6OA 4OGRA 1YQJA 3D14A 4G17A 4FTQA 3OW4A 4JRNA 1DAWA 5CU2A 1U54A 5HI2A 2BIKB 4A4OA 4F9WA 2ITOA 3NNUA 5C1QB 3A2CA 2W5BA 1QPEA 3CKXA 2WTDA 2ETRA 4IDTA 4GJ2A 5CWZA 3VBVA 3UNKA 2YLFA 2ITXA 3LM5A 4C7TA 1UU7A 4PNKA 1JWHA 1Y8YA 2R3GA 3COKA 2XK7A 4U44A 3FKNA 4JDJA 4F70A 3FLZA 4NK9A 4I0TA 5CI7A 3FDNA 1Q8ZA 4TNBA 4O81A 2Y4IC 1YDRE 5DNRA 3QQLA 4XG6A 3UP2A 1EH4A 2W9ZB 4U3YA 2ZM4A 2ITTA 4ITHA 3E62A 5DLSA 3TTJA 1J1BA 2XBAA 2PU8A 2V7AA 3VRZA 5I5ZA 4EONA 4GUBA 4KABA 3L9PA 3VULA 4R1VA 4BCHA 3JY9A 2DYLA 4G6LA 4TT7A 4EOJA 4ZY5A 5CEPA 4CG9A 3QTZA 4B8LA 2XVDA 4QMZA 3VW8A 3F3UA 4O2ZA 3VQUA 3HUCA 3Q6WA 4C2VA 4AOIA 4AW2A 4C3RA 3Q53A 1WBTA 4G34A 4ZIMA 2R0UA 4D1ZA 3U4WA 4TRLA 1IA9A 4JQ7A 3NPCA 3ANRA 4JDHA 3S95A 2BROA 2YCRA 1T46A 3MIYA 4UEUA 3RWPA 2WQBA 2OH0E 4XUFA 2BHHA 3R8LA 4BDFA 5HORA 3NSZA 5IQIA 4YP8A 1OPLA 2UZUE 3QQKA 3UC4A 2H9VA 5LCKA 2ZJWA 4JVGA 2BMCA 2W1CA 3IECA 3IONA 3R1NA 4Z16A 1G8SA 5JEBA 3LQ8A 5FBNC 4DINA 3KCFA 5CASA 1JKKA 4ZTHA 5CF5A 3A7HA 4B6LA 2Q0NA 2ZM1A 3E8CA 1BUHA 1E1XA 3DXNA 1W84A 4NM0A 3UQGA 4ZTQA 3FLWA 4USEA 4GYIA 5CAOA 4RIYA 1H28A 2WTIA 4BN1A 4QP2A 4S34A 3QD2B 3RAWA 2VTJA 2PK9A 3S2PA 3NNXA 4AAAA 4D55A 3SV0A 2CCHA 1IAHA 3NUXA 4XYFA 4YO4A 4M0YA 1PXIA 3HYHA 3AD6A 3AGLA 3F2NA 3I7BA 3ID6C 3O8UA 1GZOA 4ACMA 2O63A 5BMMA 4ANSA 3G2FA 4ASZA 4AQCA 5CY3A 3VJNA 4C4EA 3LCOA 4AXAA 2GMXA 4EK8A 1NY3A 2YCFA 1UVRA 4LOQA 2V5QA 3AMYA 5I9XA 4XHKB 2EU9A 3M1SA 1DM2A 2X9EA 3KEXA 5AFVA 4GEOA 5C4LA 2OI4X 2E9PA 4D4YA 4BL1A 2R4BA 3MY5A 3AQVA 3RAHA 3VBTA 5F1ZA 3ACKA 4G3GA 5IUHA 2C6IA 5DG5A 1H4LA 4M3QA 4TWPA 3EN7A 2GTMA 4K11A 5HG5A 3V5LA 3ORXA 3ZUUA 3VUKA 2GS7A 4CTBA 3OP5A 2BZIB 1ZARA 4DAWA 3R7VA 5DVRA 1H0WA 4NM7A 3RPOA 2G1TA 2XK9A 3BWJA 3SRVA 3UYTA 3TUDA 2OXXA 4ALUA 3KVWA 4QYYA 5IQDA 3E8NA 2Z8CA 3ZU7A 3DLSA 2B0QA 4YPDA 3WILA 4OTWA 3MDYA 5HESA 1XR1A 4IIRA 4XP0A 3QLFA 4PTCA 5HVYA 3SKCA 5CEOA 4RWJA 2H34A 4NTSA 1YXVA 2UZEA 5J79A 1JOWB 5KZ0A 3ALOA 4MXOA 3GP0A 3OCSA 3TNPC 2J2IB 3EZVA 4FV7A 3GXLA 4OW8A 5DEYA 3I5ZA 5KBRA 3PYYA 2W4KA 3AD4A 4CQGA 5BPYA 2YJSA 4CT1A 4CCUA 3IKAA 3PWYA 5JGAA 2V62A 3W2PA 3HRFA 5LXMA 3R04A 3P7BA 4YZ9A 4QQ5A 3MESA 2RSVA 5CQWA 5ICPA 2PYWA 1H27A 1KUTA 1FMOE 1OVEA 3U8WA 3NYVA 3P1AA 3ULZA 4FSTA 1YDTE 4BIBA 4ZTLA 5FP6A 3M2WA 1Y91A 5CAVA 4M97A 3HEGA 3TV6A 2AUHA 3OD6X 2I7QA 3RINA 3ZO4A 3NW6A 1FVRA 4KA3A 4FL3A 3PXRA 4Q2AA 3W16A 5EM6A 4AE6A 4DTKA 3TG1A 5J7BA 5AP4A 5FQDC 4ZZMA 4PRJA 3RM6A 3ORNA 2Y0AA 4DEIA 5AADA 4IB0A 3NIEA 5BVKA 1YI4A 4I5CA 3ZONA 4IEBA 4AZTA 3FKLA 4PP9A 2DUVA 2W0JA 3R0TA 5HO7A 1H1WA 3VVHA 2CSNA 3MVMA 4JG6A 4U42A 4LFIA 3G9NA 2VTAA 5JZJA 4EK4A 3TZMA 2PE2A 4H58A 2XJ1A 2XNNA 4YNOA 2FH9A 4RIWA 4MVFA 4R5SA 4IACA 2R3FA 4FTCA 5CZHA 3ET7A 4PDPA 5TOZA 3ROYA 2X2MA 1KV1A 3H0YA 2VWBA 4J53A 2ITYA 3UZPA 3KVXA 3QTIA 5J9LA 1ZZ2A 2OF2A 3IGGA 3OWPA 3Q4TA 4L3JA 4PUZA 4FKVA 4YLKA 4O22A 5KKRC 4DH7A 2JDSA 5FM3A 4BKJA 4YBKA 2X1NA 4S30A 4FTMA 2E9NA 3E93A 3HV4A 3NW7A 3FZ1A 3WOWA 4QMPA 1JNKA 4LGDA 4LRKA 4FTTA 4OTDA 4RBLA 3Q52A 4GS6A 1V0BA 2BRHA 2BUJA 2PUUA 2UZTA 3KN5A 4FIEA 4MNEB 2WFYA 2QU5A 1Y6AA 2DQ7X 1DS5A 4MWIA 4UMQA 5BVNA 4PL4A 4TWCA 2I0YA 1AGWA 3UO6A 1YI3A 3NCZA 3WF8A 4EQCA 4ZZNA 4LG4A 3LFEA 3F2AA 4YJRA 3G0FA 3LHJA 2VUWA 3AC5A 2BZKB 4L45A 4X3FB 3VBWA 1Z9XA 4CMTA 3OOMA 3U6JA 4GT3A 4EC8A 3TKHA 3PUPA 5K5XA 2Y6MA 3REPA 4IANA 5B2KA 1H00A 3MTLA 3E87A 4I22A 4CCBA 4DCEA 4FA2A 2J50A 3D4QA 5LOHA 2YJRA 4ENXA 2C4GA 2QNJA 5A6NA 3ZLSA 5ANDA 4D5HA 3ORZA 4ZMEA 1SM2A 4L3LA 2XIRA 5GINE 4EJNA 4IB3A 1OKZA 4J95A 5F94A 5L2QA 1HCKA 3CE3A 3PJCA 3PXZA 5HCXA 4XEYA 4F7SA 3OWJA 2VO7A 1YXSA 2YIRA 3FMJA 2IVSA 2XEZA 5HKMA 5E8UA 3R9HA 2IZSA 4KS8A 2O5KA 3RKBA 5HCZA 2AC3A 4YTFA 5IA0A 2OJFE 2B9IA 4X3JA 4M66A 2YERA 4HPTE 4HGTA 3RK5A 4FK6A 4R5YA 2WMXA 2WB8A 4QMNA 4EHZA 4HVSA 1O6LA 3IDPA 4BTKA 1YVJA 4E8AA 4X2GA 3WBLA 2BTRA 3D5WA 4IXPA 4U7ZA 5A6OA 3TCPA 1LR4A 1HOWA 3DBDA 2Z7QA 4FSZA 5HTBA 4F9AA 3NUAA 2ZOQA 4C0TA 4NKSA 4MXYA 4O0RA 2CKEA 3DY7A 5LMKA 3OUNB 3ZOSA 4UMPA 1J7LA 4Y85A 4GL9A 3GCVA 2WMBA 4M69B 3CJGA 4GT5A 1BI7A 4YTCA 1Q4LA 5KUPA 5C27A 2OIQA 2F7EE 5CSPA 4MF1A 5FXRA 2UW4A 3CP9A 3EOCA 3GC7A 4TWOA 1Y57A 2HOGA 5L6OA 4F0FA 1MQ4A 4J97A 3R9DA 1OKYA 4M15A 4AUAA 2YDKA 5AP6A 5FWKK 4PPAA 1H24A 4R7HA 4DG3E 1I09A 3LPBA 5I9VA 1PY5A 4FODA 1PMNA 2QLUA 4IFCA 4HNIA 2R64A 2VX3A 3BEGA 4O1PA 4RVMA 3TNHA 4GUEA 1WBNA 2Z02A 5H2UA 3EQBA 2VWYA 3C1XA 2FSLX 3EN9A 3QTSA 3MSSA 2YDIA 3QZFA 5HZNA 4FKQA 1PJKA 4JLCA 3KREA 4F6WA 3DZOA 1J1CA 3E3PA 2XKCA 4YO6A 5JZNA 3TZ9A 1CM8A 4ONAA 3DBCA 3GU5A 3KGAA 2VV9A 3ZTXA 4AW1A 3AOXA 3KF7A 4GYGA 3RTPA 4EOOA 3ALNA 4QMLA 3WYXA 4CMOA 3CQUA 3V3VA 4UYNA 3WI6A 3PIZA 4ANLA 4EUUA 3RBWA 4QMUA 2J0IA 2OZAB 2XK4A 3Q2MA 4MXCA 2G2FA 3AC2A 2CN8A 3DNDA 3PZEA 5CX9A 4FVPA 3TTIA 2PUPA 1FVVA 3CGOA 3A7GA 4IX6A 4O1OA 1F3MC 4EHVA 4F9YA 2PY3A 5L8JA 4EC9A 5JRQA 1J7IA 2QVSE 4FT3A 2FB8A 3SG9A 4EHGA 2J90A 3OROA 3ZDUA 2IW8A 2F7XE 2OXYA 2WD1A 4H3QA 3E3BX 3ORKA 4CKJA 5AP1A 3GCUA 2C5OA 3BHUA 3E64A 3QZHA 4TZRA 3D2IA 3UODA 5CS6A 2PVRA 5FLFA 5IEXA 2V0DA 2F4JA 3LE6A 2GTNA 4EWQA 3RAKA 3FHIA 3TV7A 5HLPA 2YAKA 4YUQA 5GIOE 3BIZA 3UVQA 2YZLA 1RDQE 5EFQA 3WF6A 2HYYA 3C9WA 4NSTA 3FY0A 3HV5A 2ESMA 3CEKA 3C4CA 4D0WA 5CU6A 4C4FA 3PSBA 3JVRA 3HP5A 1UU8A 2X8IA 3IDBA 2JGZA 2O64A 3VWAA 3ZS5A 1WBOA 1O9UA 3GB2A 2QO2A 3ORPA 1GNGA 1DI9A 3F3VA 4ZSGA 3UMWA 4Y73A 1KE7A 3POZA 4NZWB 4ANQA 3W8QA 3UZRA 2QO7A 3FQEA 4CMUA 3DK7A 4EYMA 3LZBA 2ITVA 3C4FA 2XJ2A 4ZY6A 3SD0A 3ZMMA 4BRXA 4CTCA 1IAJA 3KRWA 1GZNA 4X2JA 4EOLA 3NVKI 4YURA 2ITQA 4FI1A 3MY0A 4NIFB 2ZV7A 4CXAA 5AA8A 5LVMA 1H1SA 3FYJX 4HZRA 2QG5A 2GS6A 2HWOA 4GJ3A 5FTQA 2UZLA 3ZM9A 4QMYA 4QTBA 3GFEA 3MPMA 4EYJA 3DK3A 4CLJA 1OB3A 4DFUA 2IZUA 3GU6A 4DEAA 1RW8A 3KULB 4LGGA 1IASA 4IVDA 3NUPA 4IX3A 4R7IA 4QMVA 4CKIA 4AA4A 3W55A 1ZYLA 2YCQA 4DH3A 5KCVA 3ZBXA 3NLBA 4CFWA 1OBGA 4QP6A 4AOJA 4C34A 4I93A 5DH3A 4DGLC 4QP3A 4K6ZA 1T45A 2UVYA 2QODA 5AP5A 3PVUA 1P4OA 1APME 3ZSIA 4FC0A 2B4SB 1NXKA 4BCGA 2OH4A 5CNNA 2OFVA 5CF4A 4UMUA 3CS9A 5E1SA 4J1RA 4GT4A 3MY1A 1BMKA 3LMGA 2QONA 2V55A 4LRJA 4W9XA 3KXGA 2C0OA 2WMAA 1F5QA 1REKA 2LGCA 3KU2A 5LVNA 5EKNA 5CT7A 2GCDA 4FT7A 4GVJA 4QP7A 3RZFA 3IOKA 5IEYA 4FKLA 4RVLA 4IAAA 4IZYA 4RIXB 4WG5A 5CANA 2WKMA 4IDVA 4E4XA 2GNJA 4OBPA 2QCSA 2QU6A 2UV2A 3BV2A 3W2SA 3EQRA 3ZDIA 1A48A 5HHWA 5L8KA 2PVLA 2CJMA 5FG8A 2P4IA 5JMSA 5AR8A 3I79A 4BWPA 5CQUA 3TKUA 3F2RA 1Q3DA 3CD8A 4U80A 1G5SA 1O6YA 3PSCA 5AUVA 5JKGA 1TQPA 2QOFA 4FSWA 3O50A 3ZYAA 4HCTA 4K2RA 4FNZA 4FV9A 1FMKA 4CSVA 4CYJA 3PJ3A 3O8PA 3QA8A 5ETAA 5A4EA 5FP5A 3IG7A 4UV0A 3ATTA 3C4WA 2W7XA 3UG2A 5EK7A 4UXLA 4TL0A 1BLXA 4RJ7A 2V7OA 5KHWA 3H9FA 4FK3A 5D1JA 3EQPA 3V5PA 4FSMA 4HZSA 4ZSAA 4XG7A 4IWQA 2QG7A 1YDSE 4HYHA 4LOPA 4CVAA 5CAQA 2J4ZA 4RZWA 3PIYA 3ZO2A 1OI9A 4FTRA 3DJ7A 4N6ZA 3RCDA 2W06A 4IAKA 1ZWSA 3FXZA 5HLNA 4I0SA 5CVGA 3CJFA 5K5NA 3QTRA 5B2MA 5I3RA 2OJJA 3S0OA 2YM3A 4Y95A 3DDQA 3R21A 4QYGA 1Z57A 4RX7A 4GU6A 5A4QA 2PSQA 4PL5A 3PY3A 4RJ8A 2HY0A 2PMLX 5L2IA 4PP7A 3MJ1A 3HL7A 2VWXA 3U6IA 5ANKA 2XS0A 1OIUA 3AMBA 3DS6A 5D9HA 3ZRMA 4G6NA 3BHTA 3HMNA 2GNHA 5K0KA 4E6DA 1WBWA 3VUTA 2E9UA 4JQEA 2VGPA 3DOGA 4FKWA 3GENA 4KIOA 3R6XA 3ULIA 2XCKA 3S3IA 3OT3A 3PFQA 2C47A 2VTNA 5KZIA 3TZ8A 5L4QA 1LEZA 3EKNA 4BGGA 3FI3A 4YJPA 4DITA 3W2CA 2NNWB 2FGIA 2QD9A 1YHWA 1Q41A 1P2AA 3MB7A 2XIXA 5DE2A 3QU0A 2BCJA 4BDKA 4H05A 4FR4A 3LFDA 2GHGA 4FKTA 4NJDA 4RFMA 4UY9A 4D58A 4O83A 4PDYA 4DTBA 3RVGA 2Z7SA 4MXAA 3GQIA 3GUBA 5J9YA 3LLTA 2W1HA 2VO6A 2PZRA 3KXHA 3O7LD 3QFVA 3K2LA 3BBTB 4QPAA 3HV3A 1SVGA 1SMHA 2RKUA 3OBJA 3R7YA 4BTJA 2XIZA 3LFNA 2HY81 4Z7HA 3LW0A 4LMUA 4R6VA 4RQKA 1ND4A 3N4VA 2HK5A 1PYXA 3C5IA 2CNUA 3QYZA 5F95A 3BU3A 2IZTA 2RFDA 4IW0A 4IWPA 5FRIA 2UZNA 4WOVA 3GNIB 1ERKA 1XH5A 4JI9A 5HG7A 4G2FA 4UMRA 3BU6A 3D7TA 4DF3A 3VS3A 3DGKA 3SHEA 3QKLA 1WVXA 2A19B 1CSNA 4TW9A 3WARA 4BDCA 1A06A 4QMTA 1B38A 5FTGA 4XRJA 4HYIA 1QL6A 3FY2A 4ASDA 4FGRA 3T8OA 2XIYA 4YBJA 5JT2A 3PIXA 2VTLA 3OS3A 3JUHA 3CLYA 4CG8A 4EH3A 3MB6A 4QP8A 1CKJA 2R3MA 3BQCA 5EM8A 4F6UA 2IG7A 2WXVA 2XK6A 4RX8A 3I4BA 4C2WA 2QQ7A 5JH6A 4TYJA 4R77A 1YRPA 3BLQA 4RJ3A 3KB7A 3W18A 2VTSA 1H1PA 4CKRA 4RC2A 3EFKA 2C5YA 3DV3A 3NZ0A 5D12A 4G9CA 3QX4A 3OY1A 1R0PA 2ZDTA 3EQIA 5B2LA 1OITA 1KE5A 1GIIA 1GZKA 1W82A 4IWDA 3IGOA 5T68A 4ZLYA 5CVHA 4F6SA 4IZAA 3I0QA 1O6KA 5D7AA 4XG8A 3Q4UA 2OKRA 4U79A 4C33A 3SVVA 4O82A 4FSYA 4F64A 4I41A 5KMOA 3DTWA 4MXXA 3K5UA 4GK4A 4UMTA 4MD8E 3RHXA 4XS2A 5FXSA 1KE9A 3W2QA 4BHNA 4GFMA 2R3NA 3UMXA 4RGJA 5IEVA 2YM6A 2I0EA 3NEWA 5CF8A 3W32A 3PJ2A 1XWSA 4WNOA 3GFWA 4GW8A 2FVDA 3BYVA 4L01A 4DHFA 2R3LA 2JITA 5EH0A 3RZBA 5AAGA 2EWAA 2OBJA 2P33A 4C3PA 4AU8A 3I1AA 3F3TA 3F5PA 4YZBA 3UC3A 2C30A 2YIWA 2WTJA 2X2LA 5C01A 2CGXA 5CEIA 2CPKE 2WU7A 5KO1A 3SXFA 3AT3A 4BCFA 2PULA 5JN2A 3K3IA 5M06A 3L9MA 3HP2A 4X3FC 4EH2A 2BRNA 3OEFX 3F3ZA 4O7TA 2RG5A 3V01A 4QTAA 4ANBA 4CV9A 4IFGA 3CR0A 1Q99A 2XRWA 4QMQA 4C38A 3QTQA 4YC6A 4DT8A 2Y8OA 4O0XA 3FSFA 4JR3A 2WMTA 2ONLC 5CI6A 3QUPA 4BDGA 4DC2A 3MVLA 2RFNA 1SVEA 3TN8A 3FLQA 1LEWA 2WOTA 3FBVA 1OKWA 2R0IA 2W17A 5HQ0A 4ZS0A 5F4NA 3ZRLA 5M57A 1UKHA 2C1BA 1JLUE 2IJMA 4WO5A 2P0CA 3QKKA 2BRGA 5TO8A 4BHZA 3ZM4A 3CQWA 3COHA 1PKGA 2R3JA 4FZFB 4XCUA 1GOLA 3FMEA 4XG2A 3RP9A 3PXYA 3EQFA 3QXOA 2WNTA 4BTMA 3COIA 3F5GA 4EK6A 5A4TA 2QLQA 2EXCX 3MW1A 1ZYDA 4GVAA 3QAME 3HMPA 3BV3A 2QOHA 2Q83A 5M44A 3R8PA 4QYFA 3OW3A 4I6HA 5HG9A 5JFSA 5DMZA 3JS2A 4K8AA 4DH5A 2HZ4A 3PP0A 3FZOA 4WNPA 2XNGA 4YPSA 5IU2A 3OVVA 2W9FB 5EOLA 4F4PA 1H01A 3WF7A 1PHKA 4X2KA 3T3VA 2C6OA 2GHMA 3A7JA 4LL5A 3L8SA 3R1YA 3UIUA 1PMUA 2FUMA 1M2RA 2JAVA 2W1ZA 1R3CA 3MS9A 4KIKB 4HVHA 5CSHA 1MRYA 4ACCA 4EBVA 2YFXA 3IQ7A 2ITWA 1Y6BA 2QOOA 2VTTA 1JVPP 3PVBA 4PDSA 3MH3A 3FZPA 4UWYA 4I4FA 2XIKA 3TNIA 3GC9A 2W1EA 3OWLA 4XOYA 4FG7A 4YHJA 4C4IA 2R5TA 4GV1A 4I94A 4IBMA 1Q24A 4QNYA 1TVOA 4ID7A 4KBKA 2RF9A 1STCE 5IF1A 3DCVA 3NS9A 4C4GA 3RAIA 4I6FA 3CPBA 3BHVA 2IW6A 4CFUA 3ZFMA 4X6RA 2Z2WA 3MIAA 3EZRA 3R83A 2VD5A 4U40A 2Z60A 3CIKA 3R22A 1YWVA 3R8MA 1CKIA 3A4PA 4IE9A 4TYHA 4YR8A 3M11A 5CEMA 4OAUC 4NYEA 3FYKX 1PYEA 1PW2A 2B7AA 4WKQA 4UBAA 3H3CA 3LXNA 5C8MA 1A9UA 4MCVA 1BL6A 4QP4A 1OMWA 5L3AA 5I9WA 3OUKA 4B9DA 5IH4A 4WSYA 3R02A 2ITPA 4FTLA 5EM7A 4DTAA 3IK3A 3ORLA 4IC8A 1JSUA 2JKOA 3IOPA 4J71A 3V5QA 5FBOA 2B53A 3LXLA 4N6YA 3HV6A 3VRYA 3ZXTA 3BYOA 4I23A 4LUEA 1YKRA 4RSSA 5CEKA 3U51A 4EOMA 2WTKB 2J7TA 1ZRZA 4L44A 1XH7A 1BYGA 2P2HA 3F9NA 4L6QA 3UIMA 3UTOA 4E5AX 4DT9A 2UZOA 3PXKA 5C26A 2IZRA 4D0XA 3ORMA 4MWHA 4EORA 3ENMA 2R2PA 3WZJA 3ZSHA 4I3ZA 1JBPE 4I5MA 1YXUA 1QMZA 3VUHA 4EL9A 5A4CA 3DU8A 4YC8A 4FTKA 3Q5ZA 2Y9QA 3NCGA 3R7UA 2BRBA 4RC3A 4LUDA 3LFAA 2QO9A 5CVFA 2HZ0A 4TXCA 2X8DA 1R39A 4EKKA 3LMHA 4FT5A 1CDKA 2F2UA 4NKAA 5HO6A 4KRDA 1LUFA 2B9JA 4D4RA 3QC4A 2X81A 4RT7A 3ZZEA 2BKZA 5JQ5A 2QC6A 4AZEA 4C59A 4F7NA 4Z7GA 2HW7A 1PXOA 3I6UA 4J96A 3SDJA 2B52A 2B54A 5HD7A 3W1FA 2B1PA 2PUIA 2QR8A 3V6SA 3MVHA 3ZEWA 2DS1A 3OZ6A 3OEZA 3UPZA 4QMWA 2Y7JA 3F61A 2I0VA 3FSKA 3MV5A 4BIEA 5HU9A 4ENYA 3SW7A 3A7FA 5IMXA 1SNUA 3KMMA 2X9FA 4FZ7A 4L53A 3D83A 3R1QA 3V5JA 3ZZWA 2XNOA 4NEUA 1YOLA 3FPQA 4G6OA 4KRCA 4IVCA 3ORTA 3TDVA 5HD4A 3OY3A 3UOLA 3HZTA 1UWJA 2XZSA 3KXNA 5JFXA 4B8MA 3L8VA 4X7QA 1V1KA 3FKOA 4G3FA 4Q5EA 1UWHA 4J8NA 3MTFA 3FXWA 4G3CA 2UW7A 1OL2A 1TKIA 3OMVA 5ANJA 4KIQA 4P5QA 5TE0A 4WT6A 5EKOA 4BDEA 4O7RA 2P3GX 1OL6A 1ZY5A 2JIVA 4GKHA 3PA3A 4O7ZA 4QP1A 3ZC5A 1PRYA 3NYNA 5AUUA 3U6HA 1OUKA 3OXIA 2OXDA 4ZTSA 4I0RA 3FMHA 4EH8A 4GFGA 5EQEA 4OTQA 3UPXA 4FNYA 4AWIA 5A4LA 3AT2A 3FL5A 5E8TA 2ITZA 3FUPA 4AN2A 3DNEA 5DFPA 4BYJA 5LVPA 4HNFA 2JFMA 2JDVA 2W05A 3R8VA 1FGKA 4A9RA 3OXTA 3EYHA 2YEXA 4FV2A 3R7IA 2NRUA 3RPRA 4UXQA 5H8GA 2FYSA 4L52A 2SRCA 4L67A 3QXPA 3H0ZA 1Q8WA 5EYCA 4EOKA 1ZYSA 3PDTA 3FZTA 4M67A 3BZ3A 5M4CA 4A9SA 2C6TA 4RMZA 3QUEA 4L42A 5GJGA 2H96A 2QR7A 5KX8A 2W1IA 4DN5A 3TACA 4ITIA 3PLAE 4YTIA 3O0GA 3BWFA 3QHWA 5T3QA 4FYNA 5CAUA 4HCVA 3LIJA 1WVYA 4OT5A 2O2UA 4PL3A 3D94A 3OCTA 4XV9A 4ZTNA 1Q3WA 4CZUA 3H4JA 5M51A 3QLGA 4O0WA 2UW5A 4AGDA 1ZXEA 4EOIA 5CLPA 2VWVA 2R3HA 5K3YA 5EHLA 3Q60A 5HTCA 3AC3A 4DYMA 5FM2A 2CKOA 2VTQA 3PTGA 5ANIA 2VU3A 3D0EA 4RC4A 4ASEA 2BHEA 4FIIA 3P0MA 4W8DA 2OFUA 5CU0A 4EQMA 2C3LA 1QPCA 2J0MB 3ODYX 4WIHA 2OSCA 5ANOA 5EG3A 2R7IA 4WSQA 4ZAUA 3ENHA 3PJ1A 5HBJA 3VAPA 3NRMA 5EYMA 2YITA 2YIQA 4FUYA 4USDA 3C13A 4EEVA 3E88A 4E73A 4KKHA 2X2KA 3Q4CA 5CNOA 4ZOGA 5LQFA 2BFYA 3ELJA 4U5JA 5L2WA 5KMIA 3KQ7A 3EFJA 4IH8A 1HCLA 4OTRA 4R3CA 1R0EA 2R9SA 2ZV8A 3TJDA 3DBFA 3LJ1A 5DGZA 5HIBA 3T9IA 4E4LA 4P7EA 1U5RA 4Z3VA 4CV8A 3VBYA 3QCSA 5IG1A 2I6LA 1W0XC 5AV0A 5IH5A 2XM9A 1OBDA 4M12A 2XP2A 2G9XA 5E8SA 3TUBA 2VO0A 3WIGA 1QPDA 1XHAA 3BX5A 5HEZA 4YTHA 5E4HA 3A60A 3K5VA 1TQIA 4PQNA 4UWBA 2A4LA 3RCJA 3U9NA 4A07A 1H0VA 4DEDA 3HX4A 4E6AA 3C7QA 3ZBFA 2O3PA 3L8XA 2VWIA 4FTNA 3KMUA 2YCSA 4ZMFA 4BCOA 5E90A 4C3FA 3TKIA 3QL8A 3QQFA 4J7BA 4Z9LA 5IQAA 2QOBA 2ZB0A 3KKVA 1I44A 4M7IA 3QRTA 4QQJA 5L6PA 3O23A 5CALA 2AC5A 2J9MA 3IW5A 3NGAA 3Q3BA 4W4XA 2XMYA 2EXMA 4I5HA 3GCQA 4PY1A 3R01A 1M14A 3BBWA 4AZWA 2BDWA 4EH7A 2GNGA 4EHEA 3MFRA 4W8EA 1WFCA 1U4DA 3HV7A 2HAKA 4XBRA 5HICA 4DBXA 5IQCA 4QMOA 3V51A 5DA3A 5IQGA 4BCMA 4XG9A 4O7LA 3ANQA 1PXMA 3DAJA 3EJ1A 2X6DA 3R71A 4GG5A 3BCEA 4E26A 5AR4A 3TIYA 4O0TA 2OICA 3RK7A 3K3JA 1XBCA 2J51A 4QO9A 3QWJA 5E8VA 1JAMA 2JC6A 4FV3A 3FLSA 1UA2A 2GPHA 2FSMX 3FAAA 5ETIA 3C4EA 5EHYA 5CT0A 5DBXA 4ITJA 4FIGA 2C6EA 1IEPA
chains in the Genus database with same CATH superfamily
4AQKA 4ANOA 2X0OA 4FMQA 1GY3A 4EWHA 4KSQA 1NVQA 1RQQA 3OTVA 4BI1A 1W83A 5IH6A 3PSDA 1W8CA 2OF4A 4OR5A 4MUQA 3G0EA 3F3WA 3JYAA 3W2OA 5DR2A 3IW8A 1K2PA 3E63A 2IN6A 3FLYA 2OU7A 2WEVA 4G3DA 3R7EA 1S9IA 3PPJA 3R8UA 2BR1A 1SVHA 2ITNA 2GFSA 2JKMA 2QURA 3CY2A 1YOMA 5IQBA 1XH4A 3BQRA 3QBNA 4ZS4A 3RPYA 4CZYB 2WQNA 4DH1A 2WEIA 5FD2A 2FO0A 3PP1A 3JVSA 5AP2A 3Q4ZA 3TDWA 5TKDA 3KN6A 4LM5A 4M84A 4QQCA 4O0UA 2CDZA 3P7AA 1XH6A 3UVPA 2XALA 4QMMA 3RMFA 1FGIA 2VWWA 2GQSA 1XJDA 5IQEA 5KE0A 1JKTA 2W4OA 4X21A 3RALA 4EOPA 2QOKA 2CNQA 4V0GB 1MUOA 4AX8A 1Q97A 4MNEA 4F1MA 5I9ZA 2WMWA 2OIDA 3HGKA 4PMSA 3JR1A 3IW7A 3R2BA 4FOBA 4RLKA 1PXPA 3FL4A 2QOIA 3BE2A 1MQBA 3OG7A 4C4HA 3FC2A 3PE1A 4WD5A 3UOKA 3ZFYA 2IO6A 4D2WA 4ERWA 4TYIA 4X3FA 3DQWA 2ZMCA 4IAYA 3ZUVA 4AN3A 4BCKA 3S1HA 3R1SA 5BVEA 3V8TA 3TV4A 3IW6A 4FUXA 4QD6A 5HVKA 5T6KA 4F65A 4IVAA 4Y8DA 1GIHA 4YZDA 4DA5A 2OG8A 4FEVA 3KXXA 5E7RA 3PY0A 3AC4A 2E9OA 3THBA 1WBVA 3ZLYA 2JKKA 3HDMA 4I4EA 4XV2A 3D5XA 3LCSA 2YDJA 3VS7A 4L7FA 4FNXA 3ZO1A 2ONLA 2X7GA 3AT4A 3NYOA 3EN6A 3U54A 3UOJA 3W0MA 4HYUA 5AV3A 4LI5A 4RVTA 3GI3A 2JKQA 3PG3A 2WMUA 4FIFA 3W2RA 4BDIA 4J8MA 4WBBB 3BLRA 2X4ZA 4YC3A 3VN9A 4L8MA 4WRGA 3O51A 2P2IA 3FC1X 3TEIA 3D2KA 3PZHA 3PY1A 2YN8A 3MJ2A 1ZLTA 2BAQA 4IX5A 4MBJA 3VQHA 4EH9A 2G15A 2VGOA 3OCBA 4QRCA 4MKCA 4MXZA 3NMUF 3PRIA 4OTHA 3AMAA 5CU3A 1VYWA 2X0GA 4O27B 2GQGA 3FI4A 3EFWA 3NWWA 5AP7A 2JFLA 5AEPA 5KMNA 4EJ7A 1KE8A 5I0BA 3UO4A 4EUTA 5M56A 4DEBA 4ZY4A 1NT2A 3T3UA 3V5TA 1KOBA 2ITUA 2XUUA 3DBEA 4FYOA 4Q9SA 2ZV9A 5LCJA 4MK0A 3FWQA 2C0TA 2PWLA 3TJCA 4TYGA 4ZTRA 3U4UA 3VUMA 3UIXA 2WAJA 5DOSA 3FQHA 5FTOA 3FI8A 4L00A 4FEUA 1XMLA 1M17A 5TT7A 2IVUA 4M69A 4C36A 5FDXA 4NM3A 1P4FA 3DJ5A 4F99A 2C5VA 3OF0A 3LAUA 1ZZLA 3TM0A 4QQTA 2JBOA 4QPSA 1UNLA 4BZOA 3F5UA 4FSUA 3FPMA 4O4DA 3ZRKA 3Q9XA 3HAMA 4QPMA 5DN3A 5A46A 3QC9A 2PMNX 3QYWA 4F9CA 3BKBA 1PF8A 5G1XA 3RNIA 3WZUA 4ACGA 3DPKA 4XV1A 3TUCA 4YZCA 3R9RA 2BILB 2PL0A 2PZYA 3Q9ZA 2NYAA 4P2KA 4C4JA 5M4UA 5IMEA 4U45A 3O2MA 1CKPA 5KMJA 2R3KA 1KSWA 2UW6A 2XNPA 4UZDA 4CRSA 4I6BA 4EH4A 4OTIA 4M13A 4S2ZA 4AA5A 4J98A 4O86A 2I0HA 5DHJA 5DT0A 3TWJA 5I4NA 4HOKA 4NCTC 3RNYA 2HZIA 1U54B 2NRYA 3NUUA 1Q8TA 4RWIA 2UW0A 5H3QA 3G5DA 2YWVA 2OZAA 4CQEA 4TKSA 2EB2A 3C4XA 4HYSA 4D1SA 3DKCA 2GDOA 2UUEA 4KWPA 3DFAA 4FV4A 4KINA 4LRMA 4XX9A 4KBCA 4KUJA 3IW4A 3E92A 1VJYA 3EL8A 3I5NA 1PXLA 4FTOA 5KHXA 3KY2A 4MAOA 5HX8A 4FL2A 1UU9A 4FSQA 4RX5A 2BDJA 4RJ6A 4ACDA 3A62A 3VS4A 3RJCA 3CQEA 2PE1A 2RIOA 3VS6A 4JQ8A 4OBOA 5CSWA 4Q5HA 5F20A 4AF3A 4EQUA 2R3PA 5IQFA 3FMKA 3MYGA 3RPVA 2W1FA 4L46A 5HE3A 3GC8A 4FSRA 4IB1A 4LV5A 1Z5MA 3I0OA 1UNGA 4JIKA 5J95A 4DG2E 2WTKC 3DDPA 4OT6A 2WHBA 4LV7A 4JBOA 5BYLA 4XG3A 2R7BA 4EZ3A 4PDOA 2YABA 3AGMA 5HNBA 2VAGA 4L7SA 3LFFA 5HIDA 4O6LA 3ML1A 3QTXA 4RJ5A 3E7OA 3EL7A 4IHPA 5EI6A 1WCCA 1VYZA 3E5AA 1OGUA 3PPZA 5EYDA 5FEEA 4AGWA 3CY3A 2IVTA 2ZB1A 4NW6A 4USFA 4MQ2A 2F57A 4JBQA 4U0IA 4IZ5A 2IVVA 3BGPA 2VTIA 4AT3A 3W0OA 1UU3A 5AP3A 1B6CB 3QWKA 4MQ1A 4RFZA 5HE1A 2GFCA 4KSPA 5AR3A 2BVAA 4BI0A 3W0NA 3JPVA 2Y4PA 5AUXA 5IDNA 3QX2A 4RWLA 4ANMA 4NIFA 3TNWA 3GT8A 4NJ3A 2F7ZE 1J3HA 4BZNA 4MH7A 5E1EA 4D2RA 1KV2A 2AYPA 3V6RA 1IRKA 4JXFA 2VX1A 4YLLA 3FE3A 4ERKA 5IA4A 3BE9A 3MN3A 4QNAA 1V0PA 5J87A 2YHVA 3HECA 4CEGA 3KULA 4E1ZA 3O7LB 3QTWA 3PXFA 3FZSA 3DB8A 2PUNA 3UOHA 3ETAA 1UV5A 4CFFA 4FL1A 5FEQA 2CGUA 5B7VA 2XK8A 2X6EA 4FT0A 2YM4A 2HW6A 1ZMVA 5A9UA 5JGBA 1G8AA 4GFOA 2X7OA 4PMMA 4D4VA 5GZAA 4ZZOA 2O8YA 4MEDA 1Q62A 2OJIA 3QHRA 3QQJA 4S33A 4WG3A 4ZP5A 4DFZE 3PJ8A 4ZJJA 3W0PA 1W7HA 3SA0A 1WVWA 1RJBA 4YHFA 4ZSEA 5AM7A 4IVBA 4APPA 2QKRA 4UALA 4PPCA 4BCJA 5AX3A 3GOPA 1FPUA 2Q0BA 5GJFA 1ZYCA 4IZ7A 2YIYA 4D5KA 3KCKA 4CZTA 1OL7A 3PVGA 4FKRA 5ANEA 3TXOA 4B99A 4E93A 3DKGA 2CKQA 3HUBA 4IAIA 3SC1A 3SRVB 1GZ8A 4UZHA 3G9LX 4WUNA 4C37A 4QMXA 2FA2A 1S9JA 4FKGA 4JBVA 3H10A 3MBLA 4MD7E 3DJ6A 4RIXA 4A9UA 3EQDA 1WBPA 4TY1A 4BKZA 2WMSA 5AAFA 4DEEA 3ORIA 1H8FA 3CD3A 3QRKA 5GNKA 3HA6A 3V8SA 5C9CA 1ZAOA 1NW1A 3RWQA 3BHYA 2REIA 3QGYA 5IKWA 4CFMA 4ZTMA 2IF8A 2OJ9A 3DKOA 4DFNA 4RIOA 3AXWA 4RWKA 1J91A 3R7GA 4W4VA 2H6DA 4AZFA 4JG8A 4ZEGA 5AM6A 2BALA 5E8ZA 2GNIA 4BCQA 3DA6A 3G6GA 3HA8A 2VTOA 2XKDA 3KRLA 4H1MA 3UNJA 3ZO3A 1FQ1B 4WA9A 4BBMA 1XBBA 4AFJA 4IB5A 4KIPA 5HGIA 1ZMWA 4JR7A 3C51A 4AZSA 5M09A 4M0ZA 3B2WA 4FKSA 3TI1A 5EDRA 1H08A 3QUDA 1KOAA 3E8DA 3CXWA 3HNGA 3MFUA 4L3PA 4RFYA 4YSMA 5EDQA 2VZ6A 2WMRA 4ZXTA 4EH6A 4F1OA 1Q8YA 1YXTA 2YAAA 4MHAA 4AAYA 3DXQA 4YJUA 4S31A 4UWCA 1XO2B 1ZMUA 3SAYA 4ZJVA 2J0LA 1NVRA 5I3OA 4EBWA 5B0XA 1GIJA 3D7ZA 2PPQA 4IJPA 5TF9A 1PXNA 2E2BA 2CGVA 3F7WA 3FZRA 3PG1A 4JL9A 4TTHB 5L6WL 3SOCA 3RGFA 5HBHA 2WQEA 5BMSA 3JXWA 2XH5A 3I60A 2RG6A 3CTQA 4J52A 2PMOX 5CSVA 4W9WA 4FEQA 3MI9A 5AAEA 2WQOA 5BYZA 4YNEA 4C57A 4WNKA 3R2YA 4AGCA 1PXJA 1TQMA 1K3AA 4FVQA 4UN0C 3CKWA 3I6WA 4MD9E 4YJNA 2GSFA 5D10A 2JD5A 2OGVA 2R3OA 4I21A 4NFMA 4NM5A 4D28A 5IQHA 3Q96A 3QF9A 4AE9A 4RIWB 1G3NA 4AT5A 4FEXA 4OBQA 2C6KA 3WF5A 1ZY4A 3DLZA 4A4XA 2PHKA 3G15A 3MH2A 3GC0A 4XBUA 3A7IA 4BYIA 5M4IA 3ITZA 4I5PA 3N51A 3BU5A 4BF2A 2GNLA 4G9RA 3R7OA 4O84A 5L2TA 3CPCA 4EZ7A 1KE6A 5K4IA 2QI8A 3QRUA 4FKIA 3TNQB 3CTJA 3R28A 2YM5A 2ZV2A 1OECA 3VUDA 4HGLA 4YJTA 3NAYA 3U9CA 3ZLXA 3UDSA 4AA0A 4FV6A 3RK9A 3D5UA 4K1BA 2BAJA 3E8EA 1LPUA 1M2QA 2B9FA 4M8TA 4CFNA 4O7NA 1K9AA 4CT2A 4FJVA 1MRUA 2CCIA 3ZSGA 4BC6A 2C69A 3H9RA 4DG0E 4EOSA 4O91A 3G51A 4G31A 2UVZA 4IAZA 4EH5A 5AWMA 1FVTA 4QDEA 1E9HA 1VR2A 2RFSA 1URCA 3CC6A 3QRJA 4RLLA 1RE8A 5DEWA 1H1QA 4I92A 4PMPA 4CGAA 4XJ0A 3QCXA 5M08A 5HNIX 4J99A 4F7LA 3BYMA 4N4SA 3EKKA 3LM0A 3QQUA 3L8PA 3ROCA 4F0IA 1FINA 2BRMA 3EWHA 4FOCA 4LMNA 4UYAA 5BYYA 1ST4A 3SXRA 2G2HA 4CD0A 1XH8A 4DLJA 3R00A 5JSMA 1XBAA 5CXZA 2C6DA 4IM2A 3LMIA 2OO8X 3JY0A 4GCJA 4X0MA 4O4FA 3UG1A 2PVMA 3S4QA 2WELA 2J0KA 4F9BA 5IISA 3LQ3A 4JNWA 3HAVA 3OT8A 3QD0A 4E5BA 2WTVA 2YISA 1ZYJA 4BDJA 3TT0A 3FEGA 2CMWA 3LFSA 2X4FA 3LFQA 3UJGA 4Z55A 4ARKA 4D1XA 4FT9A 2ZAZA 1DAYA 2EXEA 3ZEPA 2BPMA 2C6MA 2HENA 2VRXA 4FTUA 3PRFA 4FZAB 4JJRA 2C0IA 2W4JA 3PPKA 4BDAA 1OIRA 4YJOA 1PMVA 3B8RA 4BI2A 3AKKA 5BUJA 3F6XA 4IM0A 3SX9A 4GRBA 3ZCLA 4XP3A 4A7CA 4LOOA 1WBSA 4JDIA 3VS2A 2A0CX 2XRUA 1Q8UA 4R8QA 2VNYA 4F1TA 4H3PA 3VS1A 4FTAA 5D41A 2X0PA 3Q9YA 4AW0A 4HW7A 2JDTA 2R3RA 3LCDA 2XF0A 2UW3A 3VUGA 4MTAA 4BWXA 1BX6A 3NR9A 3ATSA 5J9ZA 3NYXA 3AD5A 4H39A 5C4KA 3QA0A 1WMKA 2YACA 3C50A 3IPHA 5JGDA 5E91A 1SYKA 1YI6A 4AN9A 3BEAA 3DFCB 5FEDA 4CFVA 1J7UA 3KXZA 3UO5A 3QQHA 4V05A 5BVWA 5DRBA 2ZM3A 2HIWA 2G01A 2CLXA 4QYEA 4X2NA 3F66A 4PWNA 4RG0A 2KTYA 5DIAA 1JKLA 2WU6A 3FMNA 5FXQA 5H8BA 4D2TA 3UYSA 5BNJA 3F82A 4GK2A 4KD1A 3AC8A 1OM1A 4NU1A 5HU3A 4DCAA 4NTTA 4FIJA 4HGSA 4Y72A 4IADA 4CYIA 3NFFB 4DE4A 3B8QA 2F9GA 5GJDA 4HVDA 4RZVA 4BTFA 4FG9A 4QTDA 5AV2A 1REJA 2JDRA 3EN5A 4XG4A 1OGYA 3D15A 4FEWA 2F49A 1JKSA 1IA8A 2WIPA 4HVGA 4BJJB 4ASXA 2ZMDA 5CU4A 4O38A 2ZDUA 3C0IA 5LVLA 4P4CA 2ACXA 3VBQA 3GU7A 3PWDA 4TYEA 3TZ7A 2HELA 4BBFA 5J1WA 2XKFA 3EQCA 4OAVB 3HMMA 3OTUA 3EYGA 2BZJA 2XYNA 3C0GA 4MNFA 5DR9A 3VO3A 1BI8A 4JMQA 2X8EA 4KBAA 2ETKA 4XOZA 2C3KA 3UDBA 5LJJA 4G5PA 2UW8A 3D9VA 3MVJA 5AIKA 3GCSA 5EW8A 3L9NA 2O65A 2BDFA 3FQSA 3QGWA 3KFAA 5GHVA 4Y5HA 4C61A 4YSJA 4DFXE 5AP0A 4D9UA 4WG4A 1OPKA 3VHEA 4QP9A 3DAKA 2NO3A 4UB7A 4NWMA 4R3PA 2OLCA 1MP8A 2PZIA 4G5JA 3FHRA 5F9EA 3OBGA 4XRLA 5IUIA 4MBLA 4ACHA 3DXPA 3WZDA 4DFBA 3O17A 1OKVA 1YHVA 4DHZA 4I6QA 5EI8A 3OOGA 3DTCA 4U9AA 2DWBA 5KNJA 4F09A 2J5EA 3LXKA 2J5FA 3POOA 4KIKA 3IS5A 2EVAA 4V01A 5FDPA 3VIDA 2GQRA 5FGKA 3LLAA 3QRIA 4DLIA 4NCTA 2PZ5A 5ACKA 2PVFA 2VTHA 4R3RA 3EIDA 4LGHA 4O0SA 5D11A 4D9TA 3RI1A 2BAKA 3O96A 5KMKA 3BGZA 1IR3A 3NUSA 4IAFA 5EI2A 5C03A 3BI6A 4ZJIA 4K18A 3RPSA 4ALVA 4MBIA 5ITAA 5E9EA 4I1ZA 5DYJA 4RX9A 5AV4A 4DEGA 4NH1A 5L8LA 3LOKA 2QOCA 5EDPA 2J6MA 2VN9A 2OIBA 3GBZA 3HMOA 3K54A 2ERKA 4QT1A 4AFEA 2Y4IB 4P5ZA 4P90A 2CNVA 4H1JA 3P23A 2FSTX 4YZMA 2WGJA 5DT3A 5H9BA 1H26A 4Q9ZA 4OTPA 4B4LA 3MGYA 3A61A 2OZOA 4NT4A 4BKYA 2YM7A 4XMOA 3II5A 3R73A 3LJ0A 1H1RA 2XB7A 3PA4A 1MRVA 4RA5A 1U5QA 3UQFA 5HCYA 2PTKA 4KKEA 4AP7A 4S32A 3BRBA 4DEHA 2YZAA 3CTHA 4IX4A 4FVRA 4EZ5A 2JDOA 3VF8A 5HNGA 3QD4A 1H25A 4ZLOA 5HIEA 2W5AA 2WIHA 2UVXA 4II5A 3MH1A 3PLSA 4AGUA 5HX6A 5IA1A 1L8TA 2C6LA 2IEWA 3EHAA 5M53A 5CTPA 3V5WA 3EB0A 3N9XA 3PA5A 5HG8A 5HOAA 5AA9A 1BKXA 2C5NA 3GCPA 4FIHA 2C3JA 5ETFA 5IZFA 5J7HA 4YHTA 1LP4A 4FV5A 4E6QA 4PMTA 4QEBA 5HBEA 3IDCA 5EOBA 4JAJA 1JSTA 3KRXA 1CMKE 5DWRA 2PE0A 3R9OA 5BUEA 4IC7A 4AACA 4BCNA 3NIZA 5J5SA 3LQ5A 1G8KA 2PMIA 2BKKA 4FE2A 4E5WA 4FICA 5CXHA 4ORKA 1P5EA 4A9TA 4FBXA 4DGNA 5M4FA 3WZKA 4RJ4A 3HKOA 3GGFA 4GKIA 2UZVA 2ZVAA 3HDNA 2EUFB 4FTJA 4H36A 3EQGA 3OC1A 3QTUA 4FTIA 4CRLA 5C8NA 3BYUA 3LJ2A 2C5XA 4K9YA 2BZHB 1U59A 1YWRA 3DAEA 4YJQA 1YW2A 3FMDA 1YHSA 4DBNA 4YZNA 3P7CA 2IW9A 5LMBA 3HRBA 2KULA 3A4OX 3SW4A 5IPJA 5AR5A 4YMJA 2GU8A 5CEQA 4FX3A 2XNMA 4KS7A 5DT4A 3DQXA 3SQQA 4ZSJA 4O7VA 2BTSA 5AX9A 1M2PA 2VTRA 3GQLA 5CAPA 4YLJA 4GMYA 2XK3A 3OWKA 5IUGA 2QOQA 3UNZA 3CBLA 4DGOA 5I9UA 5FUTA 4JT3A 4F7JA 1AD5A 4U81A 3ODZX 4CNHA 2CHLA 3ACJA 5E8YA 5CZIA 2PVJA 3S00A 4KAOA 4A9YA 1WAKA 2YWPA 4GH2A 4A06A 3BLHA 1YXXA 5AUWA 4LYNA 3G33A 3UBDA 4QTEA 3W33A 2AEGA 4PV0A 3DBQA 5CENA 3ZXZA 5DRDA 3R63A 3COMA 2W96B 3P78A 5DI1A 3DT1A 3Q6UA 3H30A 4H3BA 2RFEA 2HXLA 4IWOA 4UX9A 3N4UA 5DPVA 4EOOA 3FLNC 5AIRA 2YA9A 1GJOA 1W98A 3MA3A 3MPTA 4XLIA 5GZ8A 4WBOA 3NAXA 2VWZA 3KMWA 3GEQA 5E92A 2JIUA 1XQZA 3AG9A 4LQMA 2IWIA 3LFBA 1NVSA 4C58A 3SGCA 4O6EA 3MH0A 5E8WA 3MFSA 4TPTA 4GK3A 1H07A 2CLQA 3SG8A 4BFMA 2OK1A 1M7QA 4G1WA 4A4LA 2WPAA 5HLWA 3O8TA 3CCNA 3GU4A 3R8ZA 2QOLA 5HTIA 4D2PA 4GG7A 2X39A 4AS0A 3NVMB 4W4WA 2B9HA 5AUZA 4N57A 4LL0A 4QYHA 4O7WA 3EN4A 2R3QA 1QPJA 3LFCA 4OUCA 2RL5A 4QTCA 3EMGA 4N0SA 3KK8A 3G90X 3QKMA 4JAIA 1BL7A 4Y46A 4AZVA 3LCTA 2OW3A 2QHNA 3OXZA 5EHOA 1KWPA 1URWA 3WYYA 2G2IA 2P55A 3Q5IA 3QQGA 3E7VA 4O2PA 3UGCA 3UVRA 2A1AB 5JFVA 4NW5A 2QHMA 5HE0A 4BY9E 4D2SA 5J1VA 4NL0A 2EB3A 4EOQA 4AW5A 2UZBA 4DH8A 4AXCA 2R3IA 4FNWA 4ALWA 3MPAA 2C3IB 3BYSA 3KC3A 3NUNA 3QD3A 4W4YA 3VBXA 3ZLWA 2RGPA 1VEBA 3FJQE 4RA4A 4WHZA 3OFMA 4YU2A 5G6VA 2QKWB 2VWUA 3U87A 3ZFXA 4JBPA 4FF8A 5LVOA 2XM8A 3DK6A 3B2TA 3EQHA 3Q9WA 4BZDA 5JFWA 5LWMA 1U46A 4U43A 4FV1A 4OTFA 4BDDA 3HMIA 2PVYA 3D7TB 5BVDA 2FSOX 5JRSA 4AT4A 3R30A 4TNDA 4DGMA 4JIAA 4IMYA 2XEYA 1R78A 5GIPE 2B55A 4B0GA 3VC4A 3RHKA 4YGAA 5I9YA 4TWNA 4B7TA 4EKLA 3W10A 1ZOGA 3OHTA 3W8LA 2I1MA 2HWPA 4XNEA 5K0XA 4EI4A 4ZK5A 3WE8A 4PTGA 2F2CB 4JRVA 1XKKA 2Z7LA 3PXQA 1R1WA 4K33A 4JX7A 5K9IA 5HE2A 1L3RE 2YIXA 2ETMA 4KKGA 4G3EA 4U41A 5KKRB 4DFYA 3NNVA 4HPUE 2CKPA 4LV8A 3UIBA 2GNFA 5EQYA 4M68A 1UKIA 1OZ1A 1YOJA 4XH6A 5A3XA 1M7NA 2H8HA 4BCPA 3FXXA 4PTEA 1PXKA 1M52A 4RVKA 3Q32A 1ZOHA 5ETCA 2LAVA 2GS2A 4C02A 3D5VA 3F69A 4GIIA 4MX9A 5AR2A 3WZEA 4D2VA 4DGGA 3BGQA 1OIQA 3NDMA 4TN6A 2CGWA 4EK5A 5AUYA 5JK3A 2VNWA 2W99B 2A2AA 3NX8A 4BICA 5BVOA 2HCKA 1PMEA 1TZDA 4O21A 2V22A 2UW9A 2VTPA 1E1VA 3EFLA 3LVPA 3WE4A 3SXSA 3L1SA 1XH9A 2C1AA 4Y83A 5ANGA 3LXPA 3P08A 3TL8A 3UE4A 4BB4A 4U8ZA 4U3ZA 3HRCA 5JQ8A 5BUIA 4FZDB 5D7VA 3F88A 4FKJA 3P9JA 5AV1A 3QCYA 3ERKA 4K77A 4DFLA 3BELA 1JSVA 4MYGA 3T9TA 2ZYBA 5IA5A 4APCA 2WMVA 3V8WA 3W0QA 4FV8A 4E20A 1CTPE 3VNTA 1Y8GA 3VW6A 3SLSA 4HCUA 2X7FA 3VF9A 5BVFA 4JX3A 3A99A 3Q2JA 4WNMA 3KRRA 5J5TA 4FG8A 4IM3A 4QMSA 4FV0A 4KNBA 4BWKA 1OIYA 1DI8A 3A8WA 3GVUA 2WQMA 4XV3A 3V04A 1PKDA 4L43A 3MA6A 4BR3A 2OWBA 3FMLA 4PPBA 2YM8A 4C62A 1F0QA 2IPXA 5EQPA 3QZGA 4BGHA 5IDPA 1SZMA 5GZ9A 4GIHA 2C68A 2XNEA 4PF4A 3ZH8A 3QCQA 5IA2A 5AJQA 2XNBA 4E7WA 1WZYA 3NW5A 2JEDA 5IA3A 1G8JA 2O0UA 4V0GA 1Q5KA 2YLEA 4FSNA 4RRVA 2WTCA 4O0VA 5HVJA 5KMLA 1B39A 2HXQA 1X8BA 3M42A 4L68A 4JG7A 4N70A 3SOAA 4EK3A 5KBQA 5L2SA 5M07A 5BX0A 1QCFA 2PVNA 2W1GA 2XCHA 4XP2A 5J8IA 2JAMA 4BBEA 4AG8A 1ST0A 2JLDA 4I24A 5A54A 3IO7A 3N4TA 3LKMA 3F5XA 4RQVA 2BIYA 4U6RA 5AUTA 2A27A 4L9IA 4Y5QA 3C0HA 5M55A 3WF9A 3UQCA 1YWNA 4O7SA 4BDHA 5E8XA 3G6HA 4CLIA 4OLIA 3NUYA 5CYIA 1Q61A 5K4JA 2CN5A 2UZDA 3DZQA 4I20A 4KB8A 3P86A 5EYKA 1UNHA 4IQ6A 4GSBA 2XYUA 3QZIA 3FV8A 3H9OA 4BVUA 4FKPA 2XBJA 3UP7A 3F7ZA 3QALE 4RIYB 3FI2A 1AQ1A 2UZWE 3ZC6A 5LMKC 2WOUA 1FBNA 4F08A 1JQHA 3P5KA 3VHKA 4O7YA 1ZOEA 4FKOA 1OL1A 5EW9A 3GU8A 3KK9A 4ZSLA 5HO8A 3EH9A 4M14A 4E3CA 4JS8A 1JPAA 3L9LA 3KL8A 2XJ0A 5EW3A 3VS0A 3GOKA 4R78A 3Q04A 4D4SA 4HJOA 3AC1A 3HLLA 2XA4A 4RPVA 4G16A 2WTWA 4BIDA 2VTMA 2JIIA 4BGQA 3UZTA 2XKEA 5CSXA 2BFXA 4X2FA 4HVIA 2PZPA 3I81A 1SNXA 4V04A 2WO6A 3VS5A 4BCIA 4E6CA 2JBPA 5DR6A 4MF0A 1ATPE 3O71A 3OCGA 4NFNA 4WRSA 3C4ZA 4NUSA 5LMAA 5EM5A 3MWUA 5C8KA 4O0YA 4YJSA 5A14A 2VO3A 3PE2A 3LCKA 3PVWA 4FGBA 1NA7A 4TYHB 4AOTA 2W1DA 3BHHA 3VUIA 4F0GA 4XLVA 3BPRA 3ZUTA 2ERZE 4JDKA 1P14A 3VJOA 4E4NA 3DB6A 4PX6A 3KA0A 1IG1A 1FOTA 1OUYA 3ZHPC 5LWNA 2Z7RA 5TR6A 2E9VA 5CF6A 3U55A 2WMQA 3KF4A 4FKUA 1VZOA 4C35A 5BQ0A 4O96A 1OPJA 2VX0A 3P79A 3RM7A 4JOAA 2J0JA 3TIZA 3CSVA 4K0YA 4E4MA 2NP8A 4BDBA 5LARA 1GAGA 2NPQA 1OL5A 2OJGA 3KRJA 4YJVA 4CFXA 2HZNA 4WUAA 4OTGA 4QOXA 4PNIA 4F63A 3R9NA 4GU9A 3I7CA 4U97A 2PVKA 4O4BB 5AR7A 3HVCA 3KXMA 4FZ6A 4R7BA 4HGEA 3FMMA 3DKFA 5AMNA 4C8BA 3CGFA 4X6QC 2WZJA 5ACBC 3A8XA 4ANNA 4R1YA 3P4KA 3C5UA 1V0OA 2PVHA 2W5HA 4ZLZA 2GHLA 3MFTA 3NNWA 5H8EA 2I40A 3WIKA 4IJ9A 5KMMA 2Y6OA 4OGRA 1YQJA 3D14A 4G17A 4FTQA 3OW4A 4JRNA 1DAWA 5CU2A 1U54A 5HI2A 2BIKB 4A4OA 4F9WA 2ITOA 3NNUA 5C1QB 3A2CA 2W5BA 1QPEA 3CKXA 2WTDA 2ETRA 4IDTA 4GJ2A 5CWZA 3VBVA 3UNKA 2YLFA 2ITXA 3TMOA 3LM5A 4C7TA 1UU7A 4PNKA 1JWHA 1Y8YA 2R3GA 3COKA 2XK7A 4U44A 3FKNA 4JDJA 4F70A 3FLZA 4NK9A 4I0TA 5CI7A 3FDNA 1Q8ZA 4TNBA 4O81A 2Y4IC 1YDRE 5DNRA 3QQLA 4XG6A 3UP2A 1EH4A 2W9ZB 4U3YA 2ZM4A 2ITTA 4ITHA 3E62A 5DLSA 3TTJA