3MDYA

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
320
Chain Sequence
b'ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFIPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1B
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 107
structure length 320
sequence length 329
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mdyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mdyA01
4H1JA 4KKEA 2R3FA 2YWPA 3D7ZA 4YHFA 1PKDA 3L9LA 3TEIA 4O21A 3LCKA 3PVWA 3UC3A 3OUNB 4GT3A 5A3XA 5E7RA 2BKKA 2BIKB 4I0TA 3LQ8A 5T6KA 5K5XA 1Q8YA 4KB8A 3R1YA 4BWXA 1B38A 5DEYA 4AT3A 3OEZA 2O0UA 4FTUA 5L3AA 2V7AA 3BLRA 4ZZOA 5AP7A 4BCFA 1OIQA 5HI2A 3GQLA 4EYMA 2ETRA 2VTAA 3Q32A 4IEBA 3LXKA 4IWQA 4KNBA 3QA8A 1AGWA 4G17A 4UYAA 3SOCA 5J1VA 4PRJA 5HO6A 1Q8UA 5AUXA 4O81A 1ZRZA 4UB7A 3ODYX 5HGIA 4UWCA 3DLZA 4RWLA 4BI0A 4MXZA 2R0IA 2UV2A 4HVGA 1M2PA 2WIPA 2YIXA 3AC8A 4RA5A 3ZS5A 5M4FA 3OD6X 5BYLA 5L8LA 5IUHA 3GXLA 4E20A 3UZTA 5E8SA 2IZRA 2OWBA 3ZBXA 3EIDA 3G5DA 4YP8A 2F4JA 3FZPA 2ETKA 4FYNA 2XCKA 2HAKA 4ZTLA 4Q2AA 3MJ2A 4JG7A 4HGSA 4DCEA 3FKLA 3GEQA 4FSYA 3W2QA 5LMKC 3JY0A 2R9SA 2OO8X 4HOKA 4O7YA 5JRQA 1MRUA 3WI6A 2OXYA 1OKVA 2ERKA 3PXRA 4O7SA 3R9OA 2UVXA 4QMMA 3E87A 3C4EA 4NM5A 4B99A 2IG7A 4X0MA 4ANNA 5M4CA 2ZDUA 2XKCA 3KN5A 3QQHA 4J99A 2R3RA 4WO5A 3MWUA 2C5XA 2VWYA 1ZY5A 4H36A 4H3BA 4LUDA 4NJDA 3VIDA 4ENYA 3NS9A 4ACHA 5CAPA 2O8YA 4JDHA 3E7OA 3L8VA 3SRVB 1ZOGA 4RJ6A 4ZOGA 3UOHA 4MYGA 3RZFA 4P2KA 1PYXA 2C3LA 2XK4A 2ZV7A 3ULIA 2OJGA 1WBOA 4PNKA 1WBTA 5EKOA 4MQ2A 3SRVA 2RSVA 3EH9A 3TXOA 3ID6C 3BWFA 1X8BA 2JIIA 3MH0A 3P79A 2UZNA 4AXAA 5T3QA 2ITPA 1PYEA 3G0FA 1KE5A 4C33A 2VUWA 4I1ZA 4QQTA 4Y46A 2BZJA 3HLLA 2RKUA 3LJ0A 3KULA 4IFGA 4L01A 2RG6A 1FVRA 3KEXA 4M8TA 2GMXA 5I4NA 4EK3A 3DXQA 5CF4A 2FSMX 2XNNA 4R7IA 5EW8A 4K0YA 1H1RA 2XYNA 5HESA 3LE6A 2F7ZE 3DU8A 3OOMA 3BWJA 4FBXA 5E91A 4UMPA 3F3TA 2Z7LA 3FUPA 2O64A 4HZSA 3CQUA 3AMAA 3DAEA 2C5YA 3UIMA 1DS5A 4CLJA 2WMVA 3GUBA 2WFYA 4MVFA 5AA8A 5CNOA 2R4BA 4D0XA 4ZY4A 1H25A 4F9WA 1PMNA 5IISA 3A8XA 2B1PA 1ATPE 2QO7A 4ITJA 4FZ6A 4BGQA 5A4CA 4M68A 1H01A 1B39A 1WFCA 3GT8A 2WAJA 1WVXA 4QMTA 3PJ8A 4HYIA 1JBPE 4FV9A 1IEPA 3B8RA 4AAAA 5HTBA 1DM2A 2WU7A 2YZLA 2OIDA 2XA4A 4U80A 4G16A 2X1NA 1J91A 3KC3A 2PMIA 4A4OA 4AZTA 3Q53A 2X2LA 4YJPA 2Y4PA 4R3CA 4BCKA 1OIUA 4KIOA 2Q83A 3MVHA 2OICA 4FKIA 5ETIA 5BUEA 3DCVA 3WYXA 3A7JA 4FR4A 2UZOA 4KIKB 4LGDA 3T3VA 4A9RA 5AR7A 4R7BA 2OF2A 2VWBA 4DGNA 2NO3A 1T45A 1BKXA 3CY2A 1JKLA 4GFMA 4P5ZA 4ANBA 4KIKA 5B7VA 3LMIA 4FT7A 2ONLC 3ZZEA 2J0IA 3BE2A 4FIEA 4IVCA 2OJJA 2ITWA 4YTHA 3VRZA 1PHKA 4GW8A 3C0HA 4QP2A 2G2FA 1YQJA 2OI4X 4BL1A 3BIZA 3CXWA 4JX3A 4AFEA 3CEKA 4N6YA 4OTRA 4PMSA 3SD0A 3D9VA 3UJGA 2P2HA 3FYJX 5KE0A 1H1SA 3Q6UA 3S3IA 2XF0A 3RINA 1H27A 5HICA 5BVDA 3R8PA 5DHJA 2H9VA 5IDNA 3MB6A 1QMZA 4FV1A 3RWPA 2I7QA 4G3CA 4E5AX 4MNFA 3V5LA 3UNKA 3G90X 4E7WA 2XH5A 4IANA 4NKSA 3VUHA 3RPYA 4U79A 5AUYA 1R1WA 3QKKA 4WNPA 5FDXA 5LVPA 4YLJA 2AC5A 3PPZA 3ZO2A 3TIZA 4DG3E 4FIHA 4I6FA 2W1CA 5IEYA 2XS0A 4C35A 2WMTA 1KSWA 2QOLA 4GIIA 3IKAA 4GS6A 4N70A 3IW4A 2XMYA 3V51A 3HUCA 3VF8A 4D2RA 3BV2A 3MPAA 5L6PA 2CNQA 2I0VA 2ZYBA 2X4FA 3VW8A 3C4XA 4QMLA 3ULZA 5AUUA 4NTTA 1XH4A 2J0MB 4E4NA 3IDCA 3NUPA 4C2WA 4PMPA 5HU9A 1WVYA 2GTMA 3HP2A 4FSRA 2UW8A 5IPJA 4Z55A 1IAHA 5ETCA 4DFZE 4YJSA 3PYYA 4IBMA 4OBOA 4AUAA 4IX6A 3AT3A 2E2BA 3DS6A 3I0QA 5DRBA 3S00A 4RVTA 4RPVA 1MRYA 3M42A 2CNVA 3SA0A 5L8KA 4CFVA 2R3MA 3U51A 2GSFA 2ZMDA 4D4VA 3IGOA 3MSSA 2WQMA 3GCUA 4GJ2A 1SYKA 4CFFA 1H8FA 1KE9A 1XBCA 3NRMA 4CQGA 4FI1A 3V5PA 4YPSA 2W17A 2WU6A 2XK7A 4RGJA 2CLXA 3I7BA 4CZYB 4Z16A 3I6WA 3ZO1A 4EH5A 2A1AB 2QHMA 2BR1A 5B2MA 4TW9A 3GU4A 1GIHA 4EOPA 1BUHA 3EN6A 4NM3A 3EHAA 3TKUA 3ZRLA 1JLUE 2X2MA 2QOBA 3LHJA 4L53A 1KV1A 1KWPA 3JYAA 4LQMA 3FY2A 3R8LA 4DH5A 3EN4A 3ZYAA 1OKWA 2GNJA 4EONA 1IA8A 4F7SA 2C0OA 1L3RE 3LLTA 2Q0BA 5CEMA 5HO7A 2B54A 3JUHA 4L52A 4BDCA 5IQHA 3UYSA 1J7LA 2XK8A 3FZSA 2C69A 4L67A 5HQ0A 5FLFA 4IAKA 4RJ7A 2PVRA 2ITXA 3AD5A 4WSQA 4ALVA 3BEAA 1GNGA 1S9JA 4QP3A 4FKOA 4NCTA 4HYHA 3UIXA 5DE2A 3H0YA 4ZSGA 3T9TA 3CPBA 4BDGA 3LFEA 4O38A 5CQWA 2B9JA 3FXXA 2R3KA 2HCKA 1H28A 4FKTA 4YLLA 3IW8A 4A7CA 2B9FA 3QQGA 2XIZA 1H4LA 3CP9A 3MN3A 2QG5A 2O5KA 2XIXA 3KRLA 4EC9A 4H3PA 2RFSA 4QQJA 5KKRC 3PJ3A 4Y73A 2ITOA 4U7ZA 4RFZA 4NW5A 3MB7A 4HNIA 1GAGA 4O1PA 3FI3A 5TE0A 4DFXE 4NIFB 3UO6A 2AC3A 3TUCA 3VN9A 3DQXA 4J52A 2VO6A 5I3RA 1PJKA 4F0GA 1Q4LA 3ZO4A 3KY2A 2W4JA 2WEVA 4QT1A 3V6SA 3VJOA 2PWLA 5GJFA 1Y57A 1REJA 3BE9A 4L3LA 4NTSA 3GC0A 3Q5ZA 4APPA 5JQ5A 1V0OA 1GY3A 1ZYJA 4QP6A 4BCPA 5C4KA 1Q8TA 4E6CA 5HLNA 2C1BA 3POZA 3HZTA 4AZWA 1IG1A 3HRCA 4FG7A 4ANLA 4O7ZA 3MJ1A 5I0BA 2ZM4A 2OZOA 2R5TA 3UVPA 4ALWA 4C3RA 5L6OA 5HX8A 3ORPA 4CCUA 3CD8A 2VTHA 2OGVA 3CPCA 1LPUA 1JPAA 2W9ZB 4QTBA 5EYKA 1T46A 4FT0A 5ACBC 5IA4A 3SLSA 4DLJA 5BVKA 3ZUTA 3KRRA 4F6WA 4TNBA 4BDDA 4RC2A 3D0EA 3KRXA 3Q3BA 4WBOA 4MX9A 5ANIA 2BRGA 4UMTA 5AP3A 4YUQA 3AGMA 3EQFA 3PXQA 2R3HA 3JVRA 4NKAA 3Q2JA 5KMIA 3HL7A 3UOKA 3QD3A 4FNWA 5HU3A 3SXRA 5KO1A 2BFXA 4F7LA 3GNIB 3MFTA 4G9RA 5HE1A 4QD6A 1NT2A 3A7GA 2PUIA 3VS6A 2XK9A 4YZDA 3JPVA 2C6IA 3JS2A 1PMUA 4D2PA 4J97A 2W1HA 3EN9A 4CCBA 2X0GA 4RSSA 5DRDA 1YXXA 3DK7A 3P7AA 5F20A 4MWIA 1UA2A 4MAOA 4RLKA 5CWZA 2I0EA 3SG9A 2X81A 2GS7A 1YXVA 2PZIA 2BRHA 5DI1A 3RK7A 4DG2E 4NM0A 3CQEA 4L45A 4UWBA 2DWBA 3CBLA 3B8QA 2YCSA 5KMNA 2C6EA 4BRXA 4C7TA 2B53A 3WBLA 3C51A 3HMPA 3EMGA 2BRBA 2CCIA 3P0MA 3ATTA 3ETAA 5CVHA 5CF8A 1F3MC 4ASZA 4GRBA 2YM4A 3A99A 4NWMA 2OK1A 2VWIA 2PUNA 2PMLX 3H30A 4HVIA 3HECA 2FSLX 4WRGA 4F65A 3UQCA 4CEGA 2BZKB 3L9NA 4S31A 4JAJA 1E1VA 3O8PA 3C0GA 2DUVA 4IAZA 3FWQA 1AQ1A 2JIVA 2W1GA 2ZOQA 2B4SB 5HVYA 3VF9A 3VVHA 5A46A 4NFNA 5HZNA 2V7OA 4HPTE 2ZJWA 3ZUUA 3V04A 3OFMA 4M66A 3MY5A 4TXCA 2WB8A 4B7TA 2ZDTA 4J1RA 1PMEA 4OTQA 4BZNA 3NNWA 4NH1A 3W18A 5A6NA 3OY3A 5AWMA 5DFPA 2UZTA 4CG8A 3DV3A 3BX5A 3NNUA 5H3QA 4DEAA 1OBGA 1HCLA 4JG8A 3KXGA 4DFNA 1XQZA 3QCYA 1H1PA 3Q60A 3QGYA 4GH2A 3ERKA 2R2PA 2P4IA 3QC4A 5GJGA 1P4OA 4GK4A 5L8JA 4O0YA 4G5JA 5HBEA 5IH6A 5AIRA 2B9IA 4ITHA 2HWPA 2XKDA 4M12A 4GKHA 2CKPA 3WF8A 3KXXA 3PIXA 1M17A 5EOBA 4E8AA 4JRVA 4I21A 4IAYA 3EQCA 5TO8A 1FBNA 2CGUA 3CS9A 4FKVA 4KS7A 3G9NA 3F5PA 3HRFA 3DLSA 3PXFA 4ASXA 1WBVA 4RWIA 2VTIA 4UMRA 3O23A 2LAVA 4HVSA 4O7RA 3O7LD 3QGWA 3FPQA 4M13A 2HZ0A 2VRXA 3ACKA 3MH1A 4ZTHA 4CD0A 3A7FA 3OXZA 4GSBA 4BYJA 2R7BA 3UODA 3T8OA 4G3GA 1UVRA 4CQEA 4ANSA 4TL0A 3VBYA 3E7VA 3KK9A 4FTRA 2I0YA 3BQRA 3DY7A 4LM5A 2PVYA 1XBBA 5A14A 2BTSA 5J8IA 2REIA 4E3CA 4ZSAA 3VAPA 5CYIA 4D28A 3SV0A 2UVYA 3PIZA 3OWJA 4FG9A 4JOAA 4YBKA 5AR5A 3VS2A 1U5RA 3F3ZA 4WA9A 2F2CB 3WILA 3RK9A 2C5VA 2BRMA 3KL8A 3ORIA 4IQ6A 1WAKA 5J7HA 2GHGA 4EOQA 2C3KA 3LFCA 4UXLA 5J5TA 1JQHA 5FEEA 5L6WL 1WVWA 4EK4A 4F0IA 1Z57A 2PVNA 2GNFA 3A8WA 3C4FA 3FSFA 1J3HA 1LR4A 1BI8A 2XNPA 1DAWA 3DQWA 1UWHA 3W2RA 4BCNA 4IB0A 2YCFA 3QX4A 4BTJA 5CTPA 4F1OA 5KZ0A 3PSDA 4CZUA 4ZTRA 3DJ7A 3GFEA 4X3FA 3MVLA 5GHVA 1OVEA 3QL8A 3VUKA 2Y6MA 5EM8A 1FMOE 4TT7A 1YWVA 4FV8A 5AUWA 3R22A 3LQ3A 2W1ZA 4BGHA 4X6RA 5DPVA 2QOQA 2V5QA 4GUEA 4R8QA 4J95A 1OECA 3NW6A 4FSQA 4HJOA 1YHWA 4QMSA 5FWKK 1ZZLA 3N4UA 1DI9A 4PUZA 1RW8A 3Q9YA 4G6LA 4WOVA 4XG3A 5I9ZA 3PIYA 2XEZA 3ZSIA 4WT6A 2ITYA 3D2KA 5FP5A 2UZLA 2JDTA 3NZ0A 4MKCA 4RZWA 3ZFXA 2CKOA 5DR2A 1XH8A 4ZZMA 4D5HA 3BHUA 5EM7A 3R1SA 3V8TA 4EOMA 5KNJA 2WTIA 5A4EA 3NIZA 2C30A 2XNMA 3Q5IA 3TDVA 4JS8A 5GZ9A 3NVKI 4IDTA 2YJSA 4YZMA 2P0CA 4RZVA 5HIBA 4CFNA 3NPCA 4MD7E 1CKPA 1WBNA 5CEIA 4IXPA 2WO6A 3IK3A 3R1QA 1GOLA 4GYGA 2QR7A 4MD8E 4RQKA 5D1JA 2QKWB 5IA0A 2X2KA 4FEVA 4Z9LA 2V0DA 4B9DA 2OG8A 4E93A 2OBJA 3CR0A 4F09A 5J9YA 4IDVA 5HX6A 4EHVA 3A2CA 2EXEA 3FAAA 4BTFA 2PE0A 3LXLA 3QX2A 2J0LA 5AP4A 3NNXA 4CV8A 2ITVA 5JSMA 2OW3A 4BCMA 5IMXA 2WMXA 2ZAZA 3IGGA 3OXTA 4WG3A 3E8EA 3VNTA 4O7VA 4M14A 2F7EE 5L2WA 4DTAA 4PTGA 2NPQA 3FE3A 3A4PA 3GU6A 3C9WA 3MTFA 2IVTA 2YJRA 4JG6A 4UZHA 1YHVA 4YC6A 2UW6A 3GCSA 4S33A 4QPAA 4BICA 1SVHA 3VS3A 3SG8A 2Y9QA 3R9HA 3R9DA 3TZMA 4RIXA 3DPKA 4DGLC 4O82A 4FTMA 3BU3A 3MFRA 5ANJA 1ZY4A 3I4BA 4ACCA 3LMHA 4FL1A 4UYNA 4CMUA 3D94A 3BYOA 3LPBA 3NWWA 4E6AA 4QMPA 3O8TA 3A61A 5F95A 3WIGA 5HORA 3E3BX 1F5QA 5FRIA 5IA5A 4TN6A 5M07A 4KBKA 2C5NA 5M4UA 3WZDA 4RJ3A 2HY81 3ANQA 3OUKA 4NK9A 4DGMA 4L6QA 1XO2B 3CCNA 4FTAA 3UC4A 3NW7A 5AM6A 3OW3A 1Y91A 2OJ9A 3UNZA 2UW3A 2W4OA 2OH4A 2WQEA 3QFVA 4M67A 2XNEA 4IWDA 4OW8A 3KK8A 3RALA 3TI1A 1U59A 2IJMA 4K2RA 4KIQA 4TRLA 5AV2A 4RMZA 3LFNA 4FIFA 4YGAA 2YACA 4GUBA 4RG0A 3NX8A 4CKIA 4CLIA 4MBIA 4QYYA 4LMUA 4GG5A 2X7GA 4C3PA 3FMEA 3LFDA 4NCTC 2PMOX 5D41A 5DLSA 5IZFA 4XS2A 3TNWA 3KMMA 5K0KA 4IM0A 5AV3A 2PUPA 3NNVA 4AE6A 3R30A 4G6NA 1WMKA 3GU8A 4XRLA 4U3YA 4EH3A 3HNGA 1OKZA 3EQBA 3F7WA 2CSNA 2ETMA 3ZC5A 1QCFA 4DEBA 3FZ1A 3KRWA 3EQRA 3IW7A 3AC2A 3FSKA 4FODA 4RX7A 1PXPA 2WMAA 5ANGA 3RK5A 4CRLA 4E4XA 1W8CA 3COKA 1XR1A 2IN6A 4FTKA 2GHMA 3MI9A 3DBDA 4M0YA 4YNOA 1H26A 4BKJA 3MY1A 3ZDUA 1PXLA 1S9IA 4MXYA 2YABA 3HEGA 5AJQA 4QMOA 1A9UA 3NUNA 4R3PA 5HE3A 3QQFA 4BCQA 3GP0A 5EW9A 4C59A 4EQUA 3AC4A 3R73A 4IWOA 3RWQA 4AT5A 4YC8A 2VTRA 4GU6A 2X6EA 4XV2A 5HTCA 3PZHA 3BRBA 5HCXA 3TV7A 3ZRKA 1JNKA 2R64A 4PP9A 4W4YA 1ZYSA 5JT2A 1LEWA 2JKOA 3COMA 2F9GA 3OBGA 5LVNA 4ALUA 1YRPA 4MBJA 2XCHA 5BUIA 5IQAA 3IOKA 5CXZA 2EUFB 3SOAA 4A9SA 5IQIA 4JQ8A 3P1AA 4AA4A 4C62A 3KRJA 4GG7A 4ZS0A 5HIDA 1H0WA 3EOCA 4O6EA 4ZSLA 2VO7A 3OY1A 3I0OA 1YI4A 3P7CA 5DT4A 2CHLA 2YITA 3WF6A 4RJ5A 4AG8A 3BLHA 4I22A 3JXWA 2XBJA 4RX8A 4X2JA 1TVOA 4EJNA 1NVQA 4QPSA 3RTPA 3BCEA 2WHBA 5A54A 2Z02A 1P4FA 3FI8A 3RCDA 1BX6A 2XKEA 3CGOA 4FT3A 3RVGA 3HRBA 3FQHA 4USEA 5KBQA 2PVKA 2C6OA 4KABA 4UXQA 3EFLA 3FLQA 4FVRA 2ACXA 3RNIA 4I3ZA 3QCQA 4YTIA 3UPXA 2YZAA 3C4CA 4LGHA 2XJ0A 4J98A 5LWNA 1JSUA 4WUNA 4KINA 3TNIA 1P2AA 1ZMUA 2Z8CA 5KHWA 5FXQA 2O2UA 4PNIA 5K4JA 1ZWSA 1GIJA 2J4ZA 2XYUA 3DBQA 4TWCA 5FTOA 5JMSA 2UUEA 4TYEA 3TT0A 4ARKA 5HLWA 2YM8A 5J9LA 5FXSA 2XKFA 2QLQA 3LJ1A 3P7BA 1R39A 2WTWA 2C3JA 3UQGA 2GDOA 4CFMA 3R01A 1QPCA 4QQ5A 4EH4A 2C3IB 1ZMWA 4QMXA 2RGPA 4ASDA 3VWAA 4WD5A 2CCHA 4IVAA 3CSVA 4FKQA 3O50A 5M06A 3ALOA 3D2IA 1PXOA 3ZC6A 5IA2A 2ITNA 2CKEA 2P3GX 2WMWA 3LFSA 5A4QA 2YCRA 3I7CA 2CJMA 3E5AA 3K3IA 4Y83A 4ZZNA 4YJTA 3I5NA 5I9XA 3ORTA 1J1CA 4V04A 3UMWA 5ANEA 3MV5A 5C1QB 3G51A 5CSWA 3EQDA 2GTNA 2R3GA 2QO9A 5KBRA 4AOJA 4AQCA 4CKJA 4IAFA 4MXCA 4RLLA 5J9ZA 3NYVA 5E4HA 3HA8A 4GK2A 2BCJA 5CT7A 3S2PA 4IJ9A 4RFYA 3VO3A 4KD1A 4FSUA 3PRFA 3FYKX 3COIA 3TZ8A 5F1ZA 4CKRA 3WE8A 4L00A 4W4VA 4U43A 4L44A 5HCYA 3R7UA 3MBLA 2J5FA 3QC9A 4R1YA 4AZSA 4FKJA 5F9EA 5D10A 2YCQA 4XCUA 3PJ1A 3U9CA 3BU5A 4I0SA 4D9TA 1H24A 3CQWA 4LFIA 3K54A 5BMSA 4W8DA 4X21A 4ZTQA 3UPZA 2YDJA 3FI2A 3V01A 3DDQA 2QNJA 3Q4UA 3R7GA 2B55A 5D11A 4TPTA 2OZAB 3ODZX 3W16A 4ZMEA 5CF6A 4CSVA 2WKMA 5M4IA 3KREA 1ZYDA 2HYYA 3RZBA 2PVJA 3V5QA 3BQCA 2QHNA 3RP9A 3IW6A 5JFVA 2SRCA 2C47A 2X9EA 3H4JA 2OZAA 1UKHA 4RVMA 4D9UA 5CAUA 4HGTA 4I41A 4BDIA 1GZOA 3PA3A 5AV0A 2CGVA 3UOLA 1MP8A 4G5PA 3DNEA 4IX5A 3HMOA 4YR8A 5KMJA 5A9UA 3GU7A 4AA0A 3C7QA 4JX7A 4MBLA 4JQEA 5CU4A 5IG1A 4QMVA 4X2GA 4W4WA 3PDTA 1U4DA 5LVLA 4IIRA 3EN5A 3MIAA 4ERKA 1TQIA 3GU5A 5FP6A 3ITZA 1YW2A 3CGFA 1APME 3TG1A 4EOLA 2B0QA 5HKMA 4LRMA 3EKNA 4EYJA 3OCBA 3VW6A 5AV1A 4V0GB 5I9UA 3SC1A 4E5WA 4F0FA 1OBDA 4FV6A 4A9UA 3NW5A 4AZEA 2WMQA 5BVFA 4EH6A 5J79A 4R5SA 2IW9A 4V0GA 4X3FC 4EH8A 2VX0A 5IQEA 2OFVA 3MW1A 3FZRA 2VWVA 5AP1A 4ASEA 1FGIA 3ENHA 3FMMA 5FXRA 3LLAA 2OJIA 4U45A 4D4RA 4JVGA 3LVPA 3DAJA 3QXOA 1YKRA 2JKMA 1QPEA 3LW0A 2G15A 3EB0A 4M7IA 2XNGA 4BBEA 5CU6A 3OVVA 2JLDA 4IZYA 3HP5A 1E1XA 5I9VA 3SAYA 4IM3A 4IH8A 4JDKA 4BKYA 3WZEA 5CENA 4TYGA 3POOA 4EQMA 1ND4A 5C01A 2VTJA 4MXOA 2VTLA 4R5YA 3VQUA 1M2QA 2IVVA 4D1SA 5DYJA 5HE0A 2JFLA 1LEZA 3E92A 3QZGA 4O7WA 1XH6A 3DK6A 5E9EA 3GB2A 3I81A 1NXKA 4O0XA 4WKQA 1XH9A 2CPKE 4Z7HA 4OAVB 5LXMA 3ZLYA 5LWMA 3LCDA 3ZEPA 4O0WA 3ZUVA 4MNEB 4I24A 4CFWA 4D4SA 3NUSA 4WRSA 4MK0A 1KOBA 4H1MA 2R3JA 2BPMA 3DKCA 4FSWA 2W1IA 5JRSA 2BILB 3PY3A 3SGCA 2BRNA 3LIJA 4II5A 2B52A 3UP2A 3ZEWA 3EN7A 3FKOA 5IEXA 1PMVA 4BHZA 1JKTA 4MNEA 4WNKA 3TCPA 4PDYA 1OL6A 3PY0A 4IVDA 4Q5HA 4E26A 5BVOA 3IW5A 4BDFA 4TTHB 5ITAA 4AOTA 1IA9A 2HZIA 3UVRA 2WQOA 3LFQA 4N6ZA 5JFSA 4B0GA 4FZ7A 4EI4A 4FZAB 3W1FA 1Z5MA 2WGJA 4L7FA 3FXZA 4U0IA 4PMTA 4YJUA 3UMXA 4DGGA 3UP7A 5C8NA 3L1SA 4XOYA 1YXUA 5DIAA 1Q99A 2BHHA 2J6MA 3H9RA 3Q9ZA 3TACA 3MA3A 3U55A 3G6HA 3EQIA 2ESMA 4LI5A 3MIYA 1V0BA 4A4LA 3THBA 1Z9XA 4PMMA 3CTHA 2BAKA 2J5EA 3FMDA 2UZEA 4FICA 5KMKA 2Y0AA 5FTGA 4OAUC 4QMWA 3PG3A 4QTDA 4XV9A 3QF9A 4FKRA 3C5UA 1CKIA 4MCVA 4CXAA 4IMYA 3UQFA 4PDPA 4WNOA 1HOWA 4C4HA 4IACA 3TIYA 3FJQE 4EOJA 4F1TA 2FVDA 2X8DA 4AW5A 5HCZA 3NSZA 4XG7A 4XJ0A 3U4UA 5BNJA 4O96A 4FV2A 5DT3A 2HZ4A 2OSCA 3GCVA 3FBVA 4Y85A 4P4CA 5IDPA 4K1BA 4FX3A 2YDKA 3QQLA 4BI1A 4I5PA 4O0SA 4DITA 4YJNA 2W1DA 3MTLA 2C68A 4IAAA 4UV0A 5FM3A 4R6VA 3W8LA 2YLEA 4YZNA 3IOPA 4ANOA 4YJVA 4C36A 4G3FA 4KIPA 5AP2A 3FZOA 4JBVA 2OH0E 4U97A 5FQDC 2ITQA 4QYEA 3RJCA 3D14A 5IH5A 5E1EA 2BDFA 3EL7A 3HGKA 3ZXZA 5I9YA 4ZTMA 1JVPP 2C4GA 2WMSA 3KXHA 5AADA 3EQPA 4NIFA 4AS0A 2WTDA 1VYZA 3F3WA 5JGAA 4OLIA 1YI3A 2UW7A 1RQQA 2HELA 2XZSA 2V62A 2X6DA 3OBJA 1UU7A 2OU7A 5FBOA 5EI8A 3BYVA 3HA6A 4ZSEA 3C5IA 1VZOA 3DBFA 1PXNA 3PVGA 4ERWA 1XKKA 3MFSA 4Y72A 5FG8A 3G15A 1LP4A 5EHYA 2WELA 3GENA 4NEUA 4FKUA 3PUPA 2FA2A 1VYWA 3TJCA 4GK3A 4I94A 3CY3A 4F6UA 1DAYA 3DXPA 4ACDA 5K4IA 2J50A 1KE8A 2WOUA 3BKBA 4AP7A 4C37A 5H9BA 3OEFX 4DT9A 1BI7A 1U54B 2RIOA 3B2TA 4OR5A 2YISA 2VTQA 3R8MA 5JH6A 2QR8A 2BDJA 3PFQA 3UVQA 4ZIMA 4CMTA 3PY1A 2CDZA 4PDOA 3A7IA 3IDPA 1OPKA 5E8VA 4XP0A 4BVUA 3O7LB 5BVEA 2CGWA 4EUUA 1NVSA 1U54A 2YDIA 4LG4A 4DGOA 3ORMA 4BHNA 5HVJA 4AGCA 4H05A 1Y8YA 4C38A 4PP7A 4USFA 2IVUA 1I09A 5L2QA 4DEHA 4F9CA 3LM5A 1LUFA 2ZB1A 4PPCA 4QPMA 5BYYA 1H00A 4BN1A 1J7IA 5KCVA 4U9AA 4RVKA 2PZRA 1JOWB 2QURA 4MF1A 4KSQA 1IASA 4NFMA 3UYTA 3R21A 3S4QA 3IECA 3E3PA 4IB3A 3I1AA 3V8WA 3VUDA 3OMVA 3LFFA 5D7VA 1PXKA 2BIYA 4K8AA 4U3ZA 2HIWA 4J8MA 5CEKA 4W4XA 5KMMA 5AP5A 4BDEA 4DAWA 3HVCA 3FXWA 5CEOA 3ACJA 4D2SA 1PW2A 2EB2A 3IO7A 3M11A 3PP0A 4OT6A 1OL5A 4PPBA 3TV6A 3TTIA 3U8WA 3HDNA 3C0IA 4EOSA 4BIDA 1GZNA 4FC0A 4UBAA 4E73A 2ZMCA 4QYFA 3GQIA 4QOXA 3D5XA 3CIKA 2VAGA 4GFGA 4I20A 4U42A 3NUUA 4RWKA 2PSQA 2P55A 2UW9A 4GJ3A 3DA6A 2GS2A 3BHHA 2W5BA 2YM5A 3CJGA 3AD6A 3PE2A 3F82A 5T68A 4BCOA 2VO3A 4C4IA 1I44A 3BGQA 5E90A 4HW7A 3DAKA 2BAQA 3E8CA 1UU8A 4IAIA 5C8KA 3EZRA 4L43A 3HV4A 2PVMA 4EWHA 3E93A 2X4ZA 3WIKA 3BEGA 4RIWB 4EK6A 2H34A 4DEGA 4EORA 4MH7A 5IA3A 3EQGA 3C50A 3U9NA 3ZONA 3EFWA 1WBPA 2UZUE 2OLCA 4BWKA 1R0EA 1CKJA 2W4KA 4RIWA 3QYZA 4RBLA 4V05A 5CU2A 4E6QA 2R3NA 4EOIA 4YSJA 5IQDA 1M7QA 4WBBB 1BMKA 2EXMA 4XG2A 2JAVA 3VULA 5IQBA 2WOTA 5IEVA 1Q3WA 1F0QA 3AMBA 4FTIA 4YO6A 4AW1A 2ZV2A 5E8XA 3NYXA 2OJFE 2ZM3A 3QRKA 5CZHA 2E9OA 2FYSA 2VWXA 4XH6A 5M51A 2VTTA 5GIPE 1OGUA 1A48A 1SZMA 3CE3A 2NP8A 5FUTA 1BL6A 3BHTA 4JXFA 4IC8A 4RQVA 4YC3A 3RBWA 2JIUA 4GEOA 5EKNA 4BTKA 1CMKE 3WZUA 5EQEA 3CD3A 1K3AA 3IQ7A 3AXWA 4Q5EA 1M52A 4CT1A 3F2RA 3D15A 1BL7A 3BBTB 1EH4A 1ZXEA 2ZB0A 3C4ZA 3D7TB 4PDSA 4ANMA 4O6LA 4IC7A 3ZO3A 3HV5A 3GOPA 4IM2A 5JZJA 3TV4A 1R3CA 4GT5A 3FHIA 1UV5A 4IWPA 3ATSA 5IKWA 2WQNA 4FSNA 2QOOA 4AFJA 2YA9A 5DR6A 4UMQA 3NUAA 3OS3A 4YZCA 4LYNA 3RAIA 4FGBA 4FSMA 3UZPA 3Q9XA 3O51A 4AN2A 5CSHA 4F08A 2W9FB 4DCAA 2FGIA 5AX9A 5AA9A 3DFAA 4I5CA 2W0JA 2YM3A 5I9WA 3S1HA 1QPJA 3SKCA 5IMEA 3IONA 5G6VA 3F5UA 3QQKA 4YU2A 3B2WA 2BKZA 3FC2A 4WNMA 1YWNA 1FVVA 1SVGA 5LARA 1STCE 4KSPA 5GIOE 3E8NA 4RIYB 2ZV8A 3E64A 2YFXA 2WEIA 4IB1A 4FA2A 4JI9A 4CTBA 3HAMA 2PY3A 1MRVA 3FI4A 4TWPA 4GYIA 2JFMA 4IADA 5DMZA 3ZM9A 3I6UA 2C6DA 1Y6AA 1FMKA 4A4XA 3QALE 4MF0A 5M09A 4IX4A 5I5ZA 3QWKA 4CTCA 3EFKA 4RRVA 5CY3A 3VUMA 5E8ZA 5M57A 5CAOA 1H0VA 4C4FA 3F5GA 1ZOHA 3O2MA 4JLCA 4OBQA 1MQ4A 2JDRA 2QI8A 3CTJA 3PXYA 4JT3A 4ONAA 4BCJA 3SW4A 4A9YA 4D5KA 4FV0A 4U6RA 5EYDA 1M7NA 5EM6A 3QD0A 3R83A 4DFYA 2F57A 3RM6A 3HX4A 2ZVAA 5LMBA 1TQPA 3O8UA 2YAAA 3ZMMA 2QO2A 2Y4IB 3DNDA 2YEXA 4J96A 1O9UA 1W98A 3LQ5A 5HE2A 3MH2A 3LAUA 4FT9A 3NDMA 4R1VA 2QQ7A 5BPYA 2ZV9A 1ZYLA 5BQ0A 4O7NA 4E5BA 2WXVA 3PLAE 3R9RA 2VTMA 2WTCA 4XBUA 1M2RA 3I79A 4HCTA 3GGFA 5HBJA 5AFVA 2G2HA 5GZAA 3TM0A 3NCZA 3UE4A 3FLYA 4M15A 3AGLA 4O0TA 2GCDA 4BZDA 3LFBA 4HCUA 3T9IA 5LVOA 5F4NA 3O71A 5J87A 3D5UA 2BZIB 2Y8OA 2JC6A 1H08A 4DG0E 2VTPA 4MHAA 5CQUA 4QRCA 1GZKA 4C4EA 2JEDA 5CAVA 1J1BA 1OPLA 4G1WA 4BTMA 2GNHA 2QC6A 2XJ1A 3NAYA 4LL5A 3L8PA 4EEVA 4GIHA 3OTVA 4ORKA 4NJ3A 5EFQA 5EOLA 4EKKA 4R77A 2JBPA 4CG9A 2QOIA 3ENMA 4F6SA 5J1WA 5CEQA 3F2NA 3ALNA 3V3VA 3R8ZA 1QL6A 3BYSA 1ZOEA 2HXQA 3KXNA 2GNGA 5L2TA 3HUBA 4LL0A 4RC4A 4V01A 4TYIA 3ZCLA 3CJFA 2XM9A 2W5HA 1QPDA 1JSTA 4X7QA 1W83A 3VBXA 4FTNA 4L8MA 3R04A 1DI8A 4PWNA 4UY9A 4EZ7A 4F9BA 5EG3A 3VS1A 5LCJA 4QMNA 2ITUA 3DJ6A 3R7OA 3W2OA 3I5ZA 4L3PA 4FKLA 4KUJA 3H3CA 1FOTA 2R3PA 2JKQA 2YIYA 4X2NA 3WE4A 4BCIA 4EBWA 2J90A 4F7JA 1UU9A 3UIBA 4XMOA 4ACMA 1M14A 4DFUA 3P4KA 1OL1A 3L9MA 4YMJA 4C2VA 4ZXTA 4J71A 1SM2A 4U41A 3EZVA 4AWIA 2GNLA 2I40A 4GT4A 2Q0NA 3K3JA 2O63A 3LZBA 3NUYA 4ZP5A 5GNKA 2GQGA 3H10A 4EZ5A 3QTXA 2R3QA 3COHA 3PA4A 4FTQA 1OUYA 5IU2A 3ZTXA 4JIKA 4QP7A 3NGAA 5JK3A 2A27A 3R7IA 3VBWA 4O0VA 3DKGA 4KBAA 3UDBA 4E6DA 5AX3A 2WTKB 4QQCA 4ZLOA 2WTVA 2WD1A 4FTTA 1YDRE 2YWVA 1JAMA 4FMQA 2C1AA 2VGPA 1XH7A 5E8YA 3U4WA 3LFAA 3AT2A 4O27B 2ERZE 5KMOA 4HGEA 1GZ8A 5HBHA 4QTCA 4D4YA 2UZWE 2PE2A 5EQPA 5C8MA 2CNUA 2IW8A 2OIBA 2VX3A 3FL5A 3HMIA 3GCPA 1JKKA 3LCTA 3PZEA 4K18A 2AUHA 2XUUA 4WG4A 2G2IA 5ANKA 1Q8WA 5C03A 4JL9A 5B0XA 3U6JA 4J53A 4K6ZA 5KKRB 3RHKA 1R0PA 3FLZA 2DS1A 1H07A 4WG5A 1Q97A 3AC1A 2A0CX 3W55A 4L68A 2R7IA 3QTSA 4DINA 4OT5A 4LUEA 4EUTA 1Q3DA 3VS5A 3MS9A 4PTEA 3L8SA 3VHKA 4EBVA 1O6LA 5F94A 2PUUA 2BMCA 2XJ2A 4FYOA 3K5UA 5CX9A 5AR2A 2BFYA 4HNFA 5DBXA 2VO0A 4AU8A 3F66A 4FUYA 5EDRA 4A06A 4CRSA 5IQGA 2C6KA 4TY1A 3PJCA 2W7XA 4JQ7A 4GFOA 4F9YA 3OCSA 4UALA 3RI1A 1Q41A 2IWIA 4FSTA 2QVSE 3VUGA 4O2ZA 1Q5KA 3DFCB 2I0HA 3KVXA 5ACKA 4DC2A 3TL8A 3BYUA 1KE6A 4TYJA 3OOGA 3AT4A 3LCSA 2XRWA 4USDA 5G1XA 5DT0A 3DZQA 4JIAA 3V8SA 4BIBA 2X7OA 4KS8A 3TNHA 4FOCA 1U46A 3Q9WA 4PX6A 4G6OA 5D9HA 3MVJA 3NYOA 2OXXA 3LXNA 3QZIA 3DDPA 4YJQA 4I23A 4AN9A 3QZFA 3FMNA 3JVSA 1JKSA 3KF7A 5DVRA 5CU0A 2VWUA 3VQHA 4EC8A 2FSTX 3K5VA 2RFDA 1JWHA 3QTUA 5HEZA 4EJ7A 3HV7A 4F9AA 4QNYA 4RVLA 2J51A 3ROCA 2GS6A 4IW0A 1OIYA 2QOFA 5D7AA 5EHOA 2RF9A 3O0GA 4P5QA 3QRJA 3CKWA 4LV8A 3AQVA 4UEUA 3R9NA 3LCOA 2PU8A 4JDJA 4FT5A 4LRJA 4GKIA 3N4TA 3ORNA 4PL5A 2FB8A 3TDWA 4PV0A 2VN9A 3MA6A 3MESA 3DBCA 3G33A 5AV4A 1NVRA 4LGGA 4CFUA 1PXJA 3QD2B 4YBJA 1RJBA 5B2KA 1E9HA 3AMYA 3KCKA 3R0TA 1Y6BA 3VS7A 3CLYA 4NU1A 4OUCA 3ZBFA 3P78A 5EDPA 3REPA 1PRYA 4R78A 1YOLA 3BHVA 3QLFA 4LMNA 4B6LA 4O1OA 3Q96A 4D1XA 3QCSA 4KRDA 2PZYA 4FE2A 3EWHA 3AC3A 3T3UA 3QD4A 3GC7A 3VC4A 4CFXA 2I6LA 3OF0A 3FMLA 5GZ8A 1YDTE 2XNOA 1ZYCA 3QWJA 3O96A 3QQUA 3VRYA 3S95A 4Y5QA 4BYIA 5HNIX 2FUMA 4MD9E 4BF2A 4DLIA 2E9UA 3PVBA 5IUIA 4AE9A 5J7BA 4FNYA 5AP0A 1ERKA 5C4LA 3R28A 3N9XA 2J9MA 4XP3A 3PSBA 3VBTA 4F1MA 2VV9A 3W8QA 4CT2A 4DTKA 3UZRA 3VJNA 4ZLYA 4BDKA 2QKRA 3DBEA 3C13A 4JR3A 4TYHB 5KX8A 4DEDA 2G01A 4C61A 3H9FA 4TKSA 5HLPA 4G3EA 1XWSA 5GJDA 3OHTA 4C4GA 3QXPA 4ZTNA 4LOPA 4DE4A 2FH9A 4AW2A 3KQ7A 3FDNA 4TYHA 4ZJVA 4YLKA 4UX9A 4O0UA 5LOHA 4Q9SA 3RCJA 4FF8A 2P2IA 2YN8A 2FO0A 4WSYA 4XLVA 5FM2A 5JEBA 5DG5A 5IQFA 5BUJA 3SVVA 3W32A 3EKKA 5AP6A 3WZJA 4UMUA 1RDQE 3II5A 3R63A 4XEYA 1V0PA 3JR1A 3ORLA 4Z7GA 2WMBA 3L9PA 4DT8A 4I6QA 2YIQA 4QP1A 2Z7QA 4FSZA 1R78A 5KUPA 3Q04A 1SNXA 2HW7A 3P9JA 3QTQA 3BGPA 3OROA 4G31A 3WF5A 3KFAA 1OMWA 3P23A 1G5SA 4LOQA 3V5JA 4JJRA 4M3QA 2PE1A 3PVUA 2Z2WA 4O22A 4QTEA 5C26A 2IVSA 5IA1A 4EQCA 5EI6A 4AX8A 3M2WA 5D12A 5H2UA 5KHXA 3KULB 3KF4A 5AMNA 3IDBA 3N4VA 1YOJA 4W9WA 5ETAA 4BR3A 3P5KA 3QRUA 5AR3A 4I93A 5FEQA 4KWPA 1G8AA 3SQQA 2RFEA 1O6KA 4DA5A 5CEPA 2EB3A 4TWNA 3GOKA 4FIJA 4P7EA 5E8WA 4GVAA 3W33A 5B2LA 5FBNC 2H6DA 3RNYA 4FIGA 3FQSA 2UW0A 4WHZA 3Q4TA 3MPMA 3D5VA 1P5EA 1SVEA 2O65A 3VBVA 4AGUA 2JAMA 3PWDA 4PPAA 4RX9A 5IH4A 3UIUA 3FKNA 4NM7A 3RPSA 5CASA 4XG4A 2BTRA 1REKA 3OTUA 5JQ8A 4C3FA 4CMOA 2IW6A 4N57A 3AOXA 4S30A 2VD5A 4FZDB 3SW7A 3SX9A 4WIHA 5JN2A 4BDBA 3HDMA 2PYWA 1OIRA 2XM8A 1CSNA 3TNPC 3V5WA 5CXHA 3IG7A 3OG7A 5LMAA 4KRCA 5CZIA 3F88A 2VU3A 2RG5A 3Q4ZA 5CI6A 5HIEA 4ENXA 4C8BA 5A4LA 4B4LA 2GNIA 3QLGA 5AUTA 4DH8A 2WPAA 3OZ6A 2HY0A 4PL3A 4FKSA 2VWWA 3HV3A 3D5WA 2R3IA 5TF9A 3E88A 3AD4A 2Y4IC 4J7BA 4RJ8A 4BZOA 3OWKA 3DGKA 4OTFA 3RKBA 2GHLA 4K11A 2YM7A 4PQNA 4YZBA 4DFBA 1UWJA 3PG1A 3A60A 4FTJA 3DKFA 4I6HA 5CNNA 5ANDA 2R3LA 3UG1A 5EK7A 4BB4A 3JY9A 1MUOA 2W1FA 3HMNA 3GVUA 4KKGA 3PP1A 2BUJA 3ZH8A 4AA5A 4NYEA 5CU3A 3WOWA 3UO5A 2H96A 1ZLTA 1V1KA 4O86A 2NRUA 3UTOA 5K0XA 2QOCA 1FQ1B 3QAME 4FOBA 5BVWA 2A4LA 4QMUA 4A07A 4F70A 2OXDA 4IE9A 5H8GA 2PPQA 4MXXA 4MTAA 2Y6OA 4XG8A 5DH3A 5AUZA 3VS4A 4F99A 3DJ5A 3QTZA 4HYUA 4O2PA 5LCKA 2QODA 3U87A 1OI9A 3SDJA 2E9NA 3W2PA 4I92A 5EI2A 3GCQA 3FLNC 4RT7A 5FD2A 3F9NA 4YTFA 3BI6A 3TNQB 1SNUA 3UGCA 3MDYA 5TR6A 3NAXA 2QCSA 2YHVA 4AGWA 4E4LA 4M84A 1FVTA 2PVLA 4B8LA 3FMHA 2PMNX 2XNBA 4FG8A 3KA0A 3IS5A 3HAVA 3FY0A 5HG5A 2CMWA 5AAEA 4QP4A 4O7TA 5HG8A 3WARA 4BBMA 4D2WA 2C0IA 1W0XC 2HWOA 4U40A 3KU2A 4JBQA 5HD4A 4O84A 3PPKA 1KOAA 1NY3A 4HYSA 3UBDA 1H1WA 3KMUA 2UZBA 1ZMVA 1G8SA 5BX0A 3FEGA 3ZOSA 3BYMA 4FTOA 2OKRA 4I6BA 5BMMA 4IZAA 5CSPA 2QOKA 4BCHA 1IRKA 3FMKA 5AAGA 1UKIA 4I0RA 4FL2A 1TQMA 4DBNA 4FNXA 3L8XA 4G2FA 4IHPA 1FINA 4I4FA 4N0SA 4CYJA 4UN0C 1O6YA 2AYPA 5AAFA 4NW6A 4FKWA 5BVNA 3P86A 4DEEA 4XG6A 2QG7A 4MWHA 1WZYA 3KN6A 3ZZWA 1IAJA 3DTWA 3HYHA 3M1SA 2WTKC 5EQYA 5I3OA 4YURA 4D2VA 5HVKA 3EYGA 2LGCA 4FL3A 4QMYA 4QP8A 4YPDA 5E92A 3E63A 5TT7A 1A06A 4CNHA 4FV5A 2EVAA 3MYGA 3C4WA 4M97A 1CTPE 2VX1A 3OCTA 5DR9A 5FTQA 4TWOA 2HZNA 3K2LA 3TJDA 3MGYA 4JBOA 3Q2MA 3QU0A 4XHKB 3QZHA 2PULA 4IJPA 3UO4A 4DHFA 5A4TA 5H8BA 1YXTA 1URCA 1YI6A 3BGZA 2R3OA 4OTPA 4C02A 2JDSA 4OGRA 5HG7A 1FGKA 4FV4A 3EFJA 3R7YA 2FSOX 2G9XA 4FEQA 1RE8A 3TUDA 3AG9A 2UVZA 4ITIA 5LQFA 1MQBA 2KULA 5HNGA 3DB8A 3KMWA 3CTQA 5AEPA 4O83A 2PZPA 4EKLA 2QU5A 1FPUA 3DOGA 3FHRA 4C34A 4D1ZA 1W7HA 2C6TA 4BDAA 1SMHA 3UNJA 4AF3A 3ZSHA 4NL0A 4L46A 4XP2A 3A7HA 5EYCA 4BDJA 3KCFA 2ZM1A 2CN5A 4OTIA 3F2AA 3OT3A 1OITA 3OP5A 3NUXA 3BV3A 1OUKA 3QBNA 3ZRMA 3ZFMA 3QTRA 4CVAA 3R71A 4CGAA 4YJOA 3BLQA 4YZ9A 4U44A 4FIIA 3DZOA 2HENA 3ELJA 4O0RA 3ET7A 4L42A 4ZTSA 4BC6A 1W82A 2RL5A 2WMRA 4RIOA 3ORXA 2X8EA 3GBZA 3W2SA 4AZFA 4ZLZA 4LRKA 2PZ5A 4P90A 2C6LA 3FZTA 2JITA 2B7AA 3HV6A 4YNEA 2GPHA 5J95A 5M56A 2XB7A 4QTAA 3SHEA 4XG9A 5M53A 3QUEA 1KE7A 4M0ZA 4ANQA 4GCJA 2EU9A 4U8ZA 1PXMA 1B6CB 3S0OA 4HVHA 2GFCA 4XOZA 5C27A 2YM6A 3RAHA 5IUGA 3QUDA 2HW6A 3NR9A 2XK6A 3GC8A 5JFWA 4FEWA 2A19B 5E1SA 4YSMA 5CVFA 1YXSA 2IO6A 3MPTA 4OTHA 4AGDA 3E8DA 5AR8A 4D0WA 4EOOA 3EL8A 3WF9A 3Q4CA 4RC3A 4APCA 3LM0A 3P08A 2VTOA 4FK3A 5CSXA 4M69B 4EH9A 4DYMA 4AOIA 4BGGA 5M08A 3OWPA 4ACGA 3EYHA 3ZLSA 1JSVA 4NSTA 4M69A 2W1EA 4D58A 3GI3A 2BVAA 3WZKA 3ZSGA 1OKYA 2J2IB 4XBRA 2B9HA 2UW4A 2JKKA 3ZLWA 5M44A 1K9AA 1UNGA 3DT1A 3GFWA 1VR2A 4EK8A 4AT4A 3RPOA 1BLXA 3U54A 3NMUF 2F49A 3DB6A 4KBCA 4UWYA 2QU6A 3R7EA 4HCVA 4H3QA 4RWJA 4EHGA 2BAJA 4EHZA 1CDKA 1UU3A 4IZ7A 5ICPA 3CKXA 5CT0A 5LMKA 4FVQA 3FQEA 4CYIA 2Z7RA 4EL9A 2WMUA 5JZNA 3QRTA 4QMZA 5FDPA 2XIYA 3TZ9A 4DF3A 4LOOA 1Q62A 5AUVA 3QKLA 2VTSA 3R2YA 4JRNA 3TKIA 4C0TA 2VTNA 2X7FA 3GC9A 3QCXA 4FV7A 5AIKA 4XV3A 1Q61A 4S2ZA 5E8TA 2UW5A 4YHJA 4QYHA 2GQRA 4GU9A 5M55A 4ZJJA 3KXMA 4X2KA 1HCKA 5AR4A 3R8UA 5E8UA 2XIRA 1U5QA 4FVPA 4RA4A 4OTGA 4NT4A 4TNDA 4ZY6A 4FV3A 5HNBA 2HXLA 3NYNA 2G1TA 2XVDA 3OWLA 3PJ2A 4XRJA 1OL2A 1WBWA 2YERA 3NLBA 2ITZA 3R2BA 3Q6WA 1PY5A 4K33A 4EHEA 3H9OA 4LV5A 4AN3A 3BU6A 4FEXA 2QOHA 3G2FA 4EWQA 2CLQA 5HG9A 4BBFA 2WTJA 5CSVA 4BFMA 5C9CA 3EQHA 1K2PA 3MH3A 3D7TA 1AD5A 3FLSA 4OTWA 3BPRA 2YIRA 4GL9A 5JFXA 2GU8A 3I60A 3PXKA 5HO8A 4HGLA 4IVBA 1YWRA 4TZRA 3WF7A 5L2IA 3U6IA 3R6XA 2I1MA 4NUSA 2VGOA 4D2TA 5ANOA 3FL4A 2Z7SA 1WBSA 4YO4A 1UNHA 4XX9A 3DK3A 3TKHA 3MY0A 4B8MA 5CI7A 3W2CA 1XJDA 3RM7A 4ZMFA 4DTBA 2R0UA 3G9LX 1Q8ZA 4PTCA 5EDQA 4DFLA 5IQCA 3PE1A 2IZUA 2W5AA 4FK6A 4RIYA 3O17A 4HVDA 4N4SA 3WYYA 3TUBA 5CAQA 2BROA 4Q9ZA 2J7TA 4L9IA 4CV9A 3ANRA 3QQJA 2C0TA 3FC1X 3RHXA 2BZHB 4GMYA 3QTWA 3TZ7A 4D55A 3IPHA 5HHWA 3SXSA 4I4EA 3OW4A 2IZSA 1XHAA 4QO9A 4XUFA 1XBAA 3ORZA 2C6MA 3PXZA 2NNWB 1CM8A 2EWAA 1ZARA 2UZVA 4Y95A 3VS0A 4X3FB 4E1ZA 5BYZA 4O7LA 2ITTA 3LXPA 5CALA 4E4MA 3F3UA 3F6XA 3UOJA 3PWYA 3SXFA 4I5MA 4RJ4A 3V6RA 2OIQA 3F69A 5LVMA 4U81A 5TOZA 4MEDA 4OTDA 3LOKA 4QP9A 2J0KA 1YDSE 5LJJA 3QUPA 2BALA 2F7XE 4XYFA 3F5XA 2WNTA 2ONLA 3TTJA 4F63A 3PRIA 5JKGA 3F61A 4BKZA 2EXCX 2WZJA 3KGAA 2XIKA 2YLFA 4MQ1A 3DXNA 4YHTA 5GINE 1OZ1A 4DN5A 4FUXA 2X8IA 4QNAA 1UNLA 4WUAA 2XEYA 2XK3A 4XV1A 4F7NA 4DH3A 4ZK5A 1Y8GA 3RMFA 2UZDA 4YJRA 5DWRA 3QA0A 3NEWA 4Y8DA 5DNRA 3ZM4A 2QLUA 4HPUE 4FKGA 4BDHA 5HD7A 3VHEA 2DYLA 4S34A 3R1NA 2YAKA 1KV2A 4EH7A 2JGZA 5EYMA 2BHEA 4XNEA 4G34A 3OC1A 3UG2A 5TKDA 1OL7A 1ZZ2A 3VBQA 4L3JA 2KTYA 4PY1A 3BHYA 1PKGA 3N51A 4YTCA 2GQSA 4KAOA 5EHLA 4IFCA 2V55A 3BELA 3C1XA 3QKMA 4O91A 4Y5HA 2BDWA 2J0JA 2X9FA 4ZSJA 5K9IA 3LMGA 4BY9E 2HK5A 2V22A 2XRUA 3KKVA 5JGBA 5CVGA 1G3NA 1VJYA 3RGFA 2W99B 2W06A 5JGDA 3ZFYA 4EOKA 2W05A 5HTIA 3NIEA 2E9PA 1YOMA 4JDIA 4R7HA 2XP2A 2PVHA 2JDOA 4ID7A 4XLIA 2RFNA 5DGZA 1L8TA 4DH7A 4I5HA 5K5NA 4BI2A 4PF4A 3R02A 1XH5A 4QMQA 2GFSA 3KVWA 4RIXB 3FLWA 2OF4A 3R8VA 3NCGA 1W84A 3HMMA 4JNWA 4R3RA 2C5OA 2VNYA 3RPRA 2CN8A 4G9CA 3ROYA 3Q52A 3R00A 3QRIA 5AM7A 1OB3A 3FMJA 3OT8A 5CF5A 1H1QA 3PSCA 3TN8A 3HKOA 3PTGA 4ZY5A 3D4QA 5DEWA 4X3JA 1GJOA 4K77A 3VUTA 4J8NA 5DOSA 3TWJA 3W10A 4A9TA 3U6HA 2CGXA 2QONA 1P14A 4Z3VA 2HOGA 5CANA 4NZWB 3AC5A 4UZDA 5HOAA 4FTCA 4AZVA 2A2AA 2E9VA 4ZEGA 3OCGA 4EH2A 4FEUA 2QD9A 2PL0A 2XBAA 4RFMA 2H8HA 1Q24A 1KUTA 4AW0A 5EW3A 4F4PA 4BWPA 3KB7A 3CC6A 4G3DA 5KMLA 3ZU7A 5KZIA 3E62A 2YIWA 4PL4A 5K3YA 2PHKA 2P33A 4C4JA 4DH1A 4W9XA 1WCCA 1IR3A 3FV8A 3DTCA 4L7SA 4CZTA 3F7ZA 4FNZA 2X39A 2WQBA 3F3VA 5ETFA 3VUIA 4FZFB 3KXZA 2IPXA 2PK9A 3ZLXA 1J7UA 4IZ5A 5DA3A 4FTLA 4GV1A 5CLPA 4FKPA 1YHSA 2NRYA 3LKMA 4H58A 3RPVA 4C58A 5H8EA 1OPJA 2JBOA 2IZTA 2VWZA 5CS6A 3ORKA 3EJ1A 4JAIA 3PPJA 3ZXTA 4JR7A 4GVJA 3RAKA 2Z60A 3OXIA 4K9YA 1OM1A 4KKHA 1YVJA 3RAWA 2JD5A 2PTKA 3MVMA 5EM5A 3QTIA 4X6QC 4RX5A 5J5SA 4DEIA 4FGRA 4F64A 1VEBA 1GIIA 5DN3A 3G6GA 1BYGA 5FEDA 4DBXA 4IX3A 3A4OX 1NW1A 4H39A 3ZDIA 1PXIA 3BZ3A 3D83A 3NVMB 3R7VA 1URWA 4JBPA 4OBPA 2Y7JA 2WIHA 1NA7A 2O3PA 4X2FA 4W8EA 4U5JA 5L4QA 4ZAUA 5EH0A 3FPMA 3LJ2A 3H0ZA 4AACA 2CKQA 2VNWA 4KA3A 3MFUA 1PF8A 4BCGA 4ZS4A 5A6OA 2OFUA 4QYGA 4ZJIA 3G0EA 3V5TA 1ZAOA 2PVFA 1TKIA 3PLSA 4BIEA 5L2SA 2W96B 5FGKA 2DQ7X 4C57A 2F2UA 5IF1A 3QYWA 4EK5A 3QHRA 2VZ6A 3DKOA 3BBWA 4S32A 4EZ3A 4IB5A 4MXAA 4HZRA 3PA5A 2JDVA 3A62A 3QHWA 3ZHPC
chains in the Genus database with same CATH superfamily
4H1JA 4KKEA 2R3FA 2YWPA 3D7ZA 4YHFA 1PKDA 3L9LA 3TEIA 4O21A 3LCKA 3PVWA 3UC3A 3OUNB 2IF8A 4GT3A 4DHZA 5A3XA 5E7RA 2BKKA 2BIKB 4I0TA 3LQ8A 5T6KA 5K5XA 1Q8YA 4KB8A 3R1YA 4BWXA 1B38A 5DEYA 4AT3A 3OEZA 2O0UA 4FTUA 5L3AA 2V7AA 3BLRA 4ZZOA 5AP7A 4BCFA 1OIQA 5HI2A 3GQLA 4EYMA 2ETRA 2VTAA 3Q32A 4IEBA 3LXKA 4IWQA 4KNBA 3QA8A 1AGWA 4G17A 4UYAA 3SOCA 5J1VA 4PRJA 5HO6A 1Q8UA 5AUXA 3PUFC 4O81A 1ZRZA 4UB7A 3ODYX 5HGIA 4UWCA 3DLZA 4RWLA 2XALA 4BI0A 4MXZA 2R0IA 2UV2A 4HVGA 1M2PA 2WIPA 2YIXA 3AC8A 4RA5A 3ZS5A 5M4FA 3OD6X 5BYLA 5L8LA 5IUHA 3GXLA 4E20A 3UZTA 5E8SA 2IZRA 2OWBA 3ZBXA 3EIDA 3G5DA 4YP8A 2F4JA 3FZPA 2ETKA 4FYNA 2XCKA 2HAKA 4ZTLA 4Q2AA 3MJ2A 4JG7A 4HGSA 4DCEA 3FKLA 3GEQA 4FSYA 3W2QA 5LMKC 3JY0A 2R9SA 2OO8X 4HOKA 4O7YA 3AKKA 5JRQA 1MRUA 3WI6A 2OXYA 1OKVA 2ERKA 3PXRA 4O7SA 3R9OA 2UVXA 4QMMA 3E87A 3C4EA 4NM5A 4B99A 2IG7A 4X0MA 4ANNA 5M4CA 2ZDUA 2XKCA 3KN5A 3QQHA 4J99A 2R3RA 4WO5A 3MWUA 2C5XA 2VWYA 1ZY5A 4H36A 4H3BA 4LUDA 4NJDA 3VIDA 4ENYA 3NS9A 4ACHA 5CAPA 2O8YA 4JDHA 3E7OA 3L8VA 3SRVB 1ZOGA 4RJ6A 4ZOGA 3UOHA 4MYGA 3RZFA 4P2KA 1PYXA 2C3LA 2XK4A 2ZV7A 3ULIA 2OJGA 1WBOA 4PNKA 1WBTA 5EKOA 4MQ2A 3NFGB 3SRVA 2RSVA 3EH9A 3TXOA 3ID6C 3BWFA 1X8BA 2JIIA 3MH0A 3P79A 2UZNA 4AXAA 5T3QA 2ITPA 1PYEA 3G0FA 1KE5A 4C33A 2VUWA 4I1ZA 4QQTA 4Y46A 2BZJA 4AQKA 3HLLA 2RKUA 3LJ0A 3KULA 4IFGA 4L01A 2RG6A 1FVRA 3KEXA 4M8TA 2GMXA 5I4NA 4EK3A 3DXQA 5CF4A 2FSMX 2XNNA 4R7IA 5EW8A 4K0YA 1H1RA 2XYNA 5HESA 3LE6A 2F7ZE 3DU8A 3OOMA 3BWJA 4FBXA 5E91A 4UMPA 3F3TA 2Z7LA 3FUPA 2O64A 4HZSA 3CQUA 3AMAA 3DAEA 2C5YA 3UIMA 1DS5A 4CLJA 2WMVA 3GUBA 2WFYA 4MVFA 5AA8A 5CNOA 2R4BA 4D0XA 4ZY4A 1G8JA 1H25A 4F9WA 1PMNA 5IISA 3A8XA 2B1PA 1ATPE 1TZDA 2QO7A 4ITJA 4FZ6A 4BGQA 5A4CA 4M68A 1H01A 1B39A 1WFCA 3GT8A 2WAJA 1WVXA 4QMTA 3PJ8A 4HYIA 1JBPE 4FV9A 4AXDA 1IEPA 3B8RA 4AAAA 5HTBA 1DM2A 2WU7A 2YZLA 2OIDA 2XA4A 4U80A 4G16A 2X1NA 1J91A 3KC3A 2PMIA 4A4OA 4AXCA 4AZTA 3Q53A 2X2LA 4YJPA 2Y4PA 4R3CA 4BCKA 1OIUA 4KIOA 2Q83A 3MVHA 2OICA 4FKIA 5ETIA 5BUEA 3DCVA 3WYXA 3A7JA 4FR4A 2UZOA 4KIKB 4LGDA 3T3VA 4A9RA 5AR7A 4R7BA 2OF2A 2VWBA 4DGNA 2NO3A 1T45A 1BKXA 3CY2A 1JKLA 4GFMA 4P5ZA 4ANBA 4KIKA 5B7VA 3LMIA 4FT7A 2ONLC 3ZZEA 2J0IA 3BE2A 4FIEA 4IVCA 2OJJA 2ITWA 4YTHA 3VRZA 1PHKA 4GW8A 3C0HA 4QP2A 2G2FA 1YQJA 2OI4X 4BL1A 3BIZA 3CXWA 4JX3A 4AFEA 3CEKA 4N6YA 4OTRA 4PMSA 3SD0A 4DDIA 3D9VA 3UJGA 1W2CA 2P2HA 3FYJX 5KE0A 1H1SA 3Q6UA 3S3IA 2XF0A 3RINA 1H27A 5HICA 5BVDA 3R8PA 5DHJA 2H9VA 5IDNA 3MB6A 1QMZA 4FV1A 3RWPA 2I7QA 4G3CA 4E5AX 4MNFA 4DHIB 3V5LA 3UNKA 3G90X 4E7WA 2XH5A 4IANA 4NKSA 3VUHA 3RPYA 4U79A 5AUYA 1R1WA 3QKKA 4WNPA 5FDXA 5LVPA 4YLJA 2AC5A 3PPZA 3ZO2A 3TIZA 4DG3E 4FIHA 4I6FA 2W1CA 5IEYA 2XS0A 4C35A 2WMTA 1KSWA 2QOLA 4GIIA 3IKAA 4GS6A 4N70A 3IW4A 2XMYA 3V51A 3HUCA 3VF8A 4D2RA 3BV2A 3MPAA 5L6PA 2CNQA 2I0VA 2ZYBA 2X4FA 3VW8A 3C4XA 4QMLA 3ULZA 5AUUA 4NTTA 1XH4A 2J0MB 4E4NA 3IDCA 3NUPA 4C2WA 4PMPA 5HU9A 1WVYA 2GTMA 3HP2A 4FSRA 2UW8A 5IPJA 4Z55A 1IAHA 5ETCA 4DFZE 4YJSA 3PYYA 4IBMA 4OBOA 4AUAA 4IX6A 3AT3A 2E2BA 3DS6A 3I0QA 5DRBA 3S00A 4RVTA 4RPVA 1MRYA 3M42A 2CNVA 3SA0A 5L8KA 4CFVA 2R3MA 3U51A 2GSFA 2ZMDA 4D4VA 3IGOA 3MSSA 2WQMA 3GCUA 4GJ2A 1SYKA 4CFFA 1H8FA 1KE9A 1XBCA 3NRMA 4CQGA 4FI1A 3V5PA 4YPSA 2W17A 2WU6A 2XK7A 4RGJA 2CLXA 3I7BA 4CZYB 4Z16A 3I6WA 3ZO1A 4EH5A 2A1AB 2QHMA 2BR1A 5B2MA 4TW9A 3GU4A 1GIHA 4EOPA 1BUHA 3EN6A 4NM3A 3EHAA 3TKUA 3ZRLA 1JLUE 2X2MA 2QOBA 3LHJA 4L53A 1KV1A 1KWPA 3JYAA 4LQMA 3FY2A 3R8LA 4DH5A 3EN4A 3ZYAA 1XMLA 1OKWA 2GNJA 4EONA 1IA8A 4F7SA 2C0OA 1L3RE 3LLTA 2Q0BA 5CEMA 5HO7A 2B54A 3JUHA 4L52A 4BDCA 5IQHA 3UYSA 1J7LA 2XK8A 3FZSA 2C69A 4L67A 5HQ0A 5FLFA 4IAKA 4RJ7A 2PVRA 2ITXA 3AD5A 4WSQA 4ALVA 3BEAA 1GNGA 1S9JA 4QP3A 4FKOA 4NCTA 4HYHA 3UIXA 5DE2A 3H0YA 4ZSGA 3T9TA 3CPBA 4BDGA 3LFEA 4O38A 5CQWA 2B9JA 3FXXA 2R3KA 2HCKA 1H28A 4FKTA 4YLLA 3IW8A 4A7CA 2B9FA 3QQGA 2XIZA 1H4LA 3CP9A 3MN3A 2QG5A 2O5KA 2XIXA 3KRLA 4EC9A 4H3PA 2RFSA 4QQJA 5KKRC 3PJ3A 4Y73A 2ITOA 2AQXA 4U7ZA 4RFZA 4NW5A 3MB7A 4HNIA 1GAGA 4O1PA 3FI3A 5TE0A 4DFXE 4NIFB 3UO6A 2AC3A 3TUCA 3VN9A 3DQXA 4J52A 2VO6A 5I3RA 1PJKA 4F0GA 1Q4LA 3ZO4A 3KY2A 2W4JA 2WEVA 4QT1A 3V6SA 3VJOA 2XAMA 2PWLA 5GJFA 1Y57A 1REJA 3BE9A 4L3LA 4NTSA 3GC0A 3Q5ZA 4APPA 5JQ5A 3ML1A 1V0OA 1GY3A 1ZYJA 4QP6A 4BCPA 5C4KA 1Q8TA 4E6CA 5HLNA 2C1BA 3POZA 3HZTA 4AZWA 1IG1A 3HRCA 4FG7A 4ANLA 4O7ZA 3MJ1A 5I0BA 2ZM4A 2OZOA 2R5TA 3UVPA 4ALWA 4C3RA 5L6OA 5HX8A 3ORPA 4CCUA 3CD8A 2VTHA 2OGVA 3CPCA 1LPUA 1JPAA 2W9ZB 4QTBA 5EYKA 1T46A 4FT0A 5ACBC 5IA4A 3SLSA 4DLJA 5BVKA 3ZUTA 3KRRA 4F6WA 4TNBA 4BDDA 4RC2A 3D0EA 3KRXA 3Q3BA 4WBOA 4MX9A 5ANIA 2BRGA 4UMTA 5AP3A 4YUQA 3AGMA 3EQFA 3PXQA 2R3HA 4O4EA 3JVRA 4NKAA 3Q2JA 5KMIA 3HL7A 3UOKA 3QD3A 4FNWA 5HU3A 3SXRA 5KO1A 2BFXA 4F7LA 3GNIB 3MFTA 4G9RA 5HE1A 4QD6A 1NT2A 3A7GA 2PUIA 3VS6A 2XK9A 4YZDA 3JPVA 2C6IA 3JS2A 1PMUA 4D2PA 4J97A 2W1HA 3EN9A 4CCBA 2X0GA 4RSSA 5DRDA 1YXXA 3DK7A 3P7AA 5F20A 4MWIA 1UA2A 4MAOA 4RLKA 5CWZA 2I0EA 3SG9A 2X81A 2GS7A 1YXVA 2PZIA 2BRHA 5DI1A 3RK7A 4DG2E 4NM0A 3CQEA 4L45A 4UWBA 2DWBA 3CBLA 3B8QA 2YCSA 5KMNA 2C6EA 4BRXA 4C7TA 2B53A 3WBLA 3C51A 3HMPA 3EMGA 2BRBA 2CCIA 3P0MA 3ATTA 3ETAA 5CVHA 5CF8A 1F3MC 4ASZA 4GRBA 2YM4A 3A99A 4NWMA 2OK1A 2VWIA 2PUNA 2PMLX 3H30A 4HVIA 3HECA 2FSLX 4WRGA 4F65A 3UQCA 4CEGA 2BZKB 3L9NA 4S31A 4JAJA 1E1VA 3O8PA 3C0GA 2DUVA 4IAZA 3FWQA 1AQ1A 2JIVA 2W1GA 2ZOQA 2B4SB 5HVYA 3VF9A 3VVHA 5A46A 4NFNA 5HZNA 2V7OA 4HPTE 2ZJWA 3ZUUA 3V04A 3OFMA 4M66A 3MY5A 4TXCA 2WB8A 4B7TA 2ZDTA 4J1RA 1PMEA 4OTQA 4BZNA 3NNWA 4NH1A 3W18A 5A6NA 3OY3A 5AWMA 5DFPA 2UZTA 4CG8A 3DV3A 3BX5A 3NNUA 5H3QA 4DEAA 1OBGA 1HCLA 4JG8A 3KXGA 4DFNA 1XQZA 3QCYA 1H1PA 3W0OA 3Q60A 3QGYA 4GH2A 3ERKA 2R2PA 2P4IA 3QC4A 3BL9A 5GJGA 1P4OA 4GK4A 5L8JA 4O0YA 4G5JA 5HBEA 5IH6A 5AIRA 2B9IA 4ITHA 2HWPA 2XKDA 4M12A 4GKHA 2CKPA 3WF8A 3KXXA 3PIXA 2AEGA 1M17A 5EOBA 4E8AA 4JRVA 4I21A 4IAYA 3EQCA 5TO8A 1FBNA 2CGUA 3CS9A 4FKVA 4KS7A 3G9NA 3F5PA 3HRFA 3DLSA 3PXFA 4ASXA 1WBVA 4RWIA 2VTIA 4UMRA 3O23A 2LAVA 4HVSA 4O7RA 3O7LD 3QGWA 3FPQA 4M13A 2HZ0A 2VRXA 3ACKA 3MH1A 4ZTHA 4CD0A 3A7FA 3OXZA 4GSBA 4BYJA 2R7BA 3UODA 3AKJA 3T8OA 4G3GA 1UVRA 4CQEA 4ANSA 4TL0A 3VBYA 3E7VA 3KK9A 4FTRA 2I0YA 3BQRA 3DY7A 4LM5A 2PVYA 1XBBA 5A14A 2BTSA 5J8IA 2REIA 4E3CA 4ZSAA 3VAPA 5CYIA 4D28A 3O5AA 3SV0A 2UVYA 3PIZA 3OWJA 4FG9A 4JOAA 4YBKA 5AR5A 3VS2A 1U5RA 3F3ZA 4O4CA 2F2CB 4WA9A 3WILA 3RK9A 2C5VA 2BRMA 3KL8A 3ORIA 4IQ6A 1WAKA 5J7HA 2GHGA 4EOQA 2C3KA 3LFCA 4UXLA 5J5TA 1JQHA 5FEEA 5L6WL 1WVWA 4EK4A 4F0IA 1Z57A 2PVNA 2GNFA 3A8WA 3C4FA 3FSFA 1J3HA 1LR4A 1BI8A 2XNPA 1DAWA 3DQWA 1UWHA 3W2RA 4BCNA 4IB0A 2YCFA 3QX4A 4BTJA 5CTPA 4F1OA 5KZ0A 3PSDA 4CZUA 4ZTRA 3DJ7A 3GFEA 4X3FA 3MVLA 5GHVA 1OVEA 3QL8A 3VUKA 2Y6MA 5EM8A 1FMOE 4TT7A 1YWVA 4FV8A 5AUWA 3R22A 3LQ3A 2W1ZA 4BGHA 4X6RA 5DPVA 2QOQA 2V5QA 4GUEA 4R8QA 4J95A 1OECA 3NW6A 4FSQA 4HJOA 1YHWA 4QMSA 5FWKK 1ZZLA 3N4UA 1DI9A 4PUZA 1RW8A 3Q9YA 4G6LA 4WOVA 4XG3A 5I9ZA 3PIYA 2XEZA 3ZSIA 4WT6A 2ITYA 3D2KA 5FP5A 2UZLA 2JDTA 3NZ0A 4MKCA 4RZWA 3ZFXA 2CKOA 5DR2A 1XH8A 4ZZMA 4D5HA 3BHUA 5EM7A 3R1SA 3V8TA 4EOMA 5KNJA 2WTIA 5A4EA 3NIZA 2C30A 2XNMA 3Q5IA 3TDVA 4JS8A 5GZ9A 3NVKI 4IDTA 2YJSA 4YZMA 2P0CA 4RZVA 5HIBA 4CFNA 3NPCA 4MD7E 1CKPA 1WBNA 5CEIA 4IXPA 2WO6A 3IK3A 3R1QA 1GOLA 4GYGA 2QR7A 4MD8E 4RQKA 5D1JA 2QKWB 5IA0A 2X2KA 4FEVA 4Z9LA 2V0DA 4B9DA 2OG8A 4E93A 2OBJA 3CR0A 4F09A 5J9YA 4IDVA 5HX6A 4EHVA 3A2CA 2EXEA 3FAAA 4BTFA 2PE0A 3LXLA 3QX2A 2J0LA 5AP4A 3NNXA 4CV8A 2ITVA 5JSMA 2OW3A 4BCMA 5IMXA 2WMXA 2ZAZA 3IGGA 3OXTA 4WG3A 3E8EA 3VNTA 4O7VA 4M14A 2F7EE 2IEWA 5L2WA 4DTAA 4PTGA 2NPQA 3FE3A 3A4PA 3GU6A 3C9WA 3MTFA 2IVTA 2YJRA 4JG6A 4UZHA 1YHVA 4YC6A 2UW6A 3GCSA 4S33A 4QPAA 4BICA 1SVHA 3VS3A 3SG8A 2Y9QA 3R9HA 3R9DA 3TZMA 4RIXA 3DPKA 4DGLC 4O82A 4FTMA 3BU3A 3MFRA 5ANJA 1ZY4A 3I4BA 4ACCA 3LMHA 4FL1A 4UYNA 4CMUA 3D94A 3BYOA 3LPBA 3NWWA 4E6AA 4QMPA 3O8TA 3A61A 5F95A 3WIGA 5HORA 3E3BX 1F5QA 5FRIA 5IA5A 4TN6A 3UDZA 4KBKA 2C5NA 5M4UA 5M07A 3WZDA 4RJ3A 2HY81 3ANQA 3OUKA 4NK9A 4DGMA 4L6QA 1XO2B 3CCNA 4FTAA 3UC4A 3NW7A 5AM6A 1XMMA 3OW3A 1Y91A 2OJ9A 3UNZA 2UW3A 2W4OA 2OH4A 2WQEA 3QFVA 4M67A 2XNEA 4IWDA 4OW8A 3KK8A 3RALA 3TI1A 1U59A 2IJMA 4K2RA 4KIQA 4TRLA 5AV2A 4RMZA 3LFNA 4FIFA 4YGAA 2YACA 4GUBA 4RG0A 3NX8A 4CKIA 4CLIA 4MBIA 4QYYA 4LMUA 4GG5A 2X7GA 4C3PA 3FMEA 3LFDA 4NCTC 2PMOX 5D41A 5DLSA 5IZFA 4BJJB 4XS2A 3TNWA 3KMMA 5K0KA 4IM0A 5AV3A 2PUPA 3NNVA 4AE6A 3R30A 4G6NA 1WMKA 3GU8A 4XRLA 4U3YA 4EH3A 3HNGA 1OKZA 3EQBA 3F7WA 2CSNA 2ETMA 3ZC5A 1QCFA 4DEBA 3FZ1A 3KRWA 3EQRA 3IW7A 3AC2A 3FSKA 4FODA 4RX7A 1PXPA 2WMAA 5ANGA 3RK5A 4CRLA 4E4XA 1W8CA 3COKA 1XR1A 2IN6A 4FTKA 2GHMA 3MI9A 3DBDA 4M0YA 4YNOA 3KIOC 1H26A 4BKJA 3MY1A 3ZDUA 1PXLA 1S9IA 4MXYA 2YABA 3HEGA 5AJQA 4QMOA 1A9UA 3NUNA 4R3PA 5HE3A 3QQFA 4BCQA 3GP0A 5EW9A 4C59A 4EQUA 3AC4A 3R73A 4IWOA 3RWQA 4AT5A 4YC8A 2VTRA 4GU6A 2X6EA 4XV2A 5HTCA 3PZHA 3BRBA 5HCXA 3TV7A 3ZRKA 1JNKA 2R64A 4PP9A 4W4YA 1ZYSA 5JT2A 1LEWA 2JKOA 3COMA 2F9GA 3OBGA 5LVNA 4ALUA 1YRPA 4MBJA 2XCHA 5BUIA 5IQAA 3IOKA 5CXZA 2EUFB 3SOAA 4A9SA 5IQIA 4JQ8A 4O4FA 3P1AA 4AA4A 4C62A 3KRJA 1ST0A 4GG7A 4ZS0A 5HIDA 1H0WA 3EOCA 4O6EA 4ZSLA 2VO7A 3OY1A 3I0OA 1YI4A 3P7CA 5DT4A 2CHLA 2YITA 3WF6A 4RJ5A 4AG8A 3BLHA 4I22A 3JXWA 2XBJA 4RX8A 4X2JA 1TVOA 4EJNA 1NVQA 4QPSA 3RTPA 3BCEA 2WHBA 5A54A 2Z02A 1P4FA 3FI8A 3RCDA 1BX6A 2XKEA 3CGOA 4FT3A 3RVGA 3HRBA 3FQHA 4USEA 5KBQA 2PVKA 2C6OA 4KABA 4UXQA 3EFLA 3FLQA 4FVRA 2ACXA 3RNIA 4I3ZA 3QCQA 4YTIA 3UPXA 2YZAA 3C4CA 4LGHA 2XJ0A 4J98A 5LWNA 1JSUA 4WUNA 4KINA 3TNIA 1P2AA 1ZMUA 2Z8CA 5KHWA 5FXQA 2O2UA 4PNIA 5K4JA 1ZWSA 1GIJA 2J4ZA 2XYUA 3DBQA 4TWCA 5FTOA 5JMSA 2UUEA 4TYEA 3TT0A 4ARKA 5HLWA 2YM8A 5J9LA 5FXSA 2XKFA 2QLQA 3LJ1A 3P7BA 1R39A 2WTWA 2C3JA 3UQGA 2GDOA 4CFMA 3R01A 1QPCA 4QQ5A 4EH4A 2C3IB 1ZMWA 4QMXA 2RGPA 4ASDA 3VWAA 4WD5A 2CCHA 4IVAA 3CSVA 4FKQA 3O50A 5M06A 3ALOA 3D2IA 1PXOA 3ZC6A 5IA2A 2ITNA 2CKEA 2P3GX 2WMWA 3LFSA 5A4QA 2YCRA 3I7CA 2CJMA 3E5AA 3K3IA 4Y83A 4ZZNA 4YJTA 3I5NA 5I9XA 3ORTA 1J1CA 4V04A 3UMWA 5ANEA 3MV5A 5C1QB 3G51A 5CSWA 3EQDA 2GTNA 2R3GA 2QO9A 5KBRA 4AOJA 4AQCA 4CKJA 4IAFA 4MXCA 4RLLA 5J9ZA 3NYVA 5E4HA 3HA8A 4GK2A 2BCJA 5CT7A 3S2PA 4IJ9A 4RFYA 3VO3A 4KD1A 4FSUA 3PRFA 3FYKX 3COIA 3TZ8A 5F1ZA 4CKRA 3TMOA 3WE8A 4L00A 4W4VA 4U43A 4L44A 5HCYA 3R7UA 3MBLA 2J5FA 3QC9A 4R1YA 4AZSA 4FKJA 5F9EA 5D10A 2YCQA 4XCUA 3PJ1A 3U9CA 3BU5A 4I0SA 4D9TA 1H24A 3CQWA 4LFIA 3K54A 5BMSA 4W8DA 4X21A 4ZTQA 3UPZA 2YDJA 3FI2A 3V01A 3DDQA 2QNJA 3Q4UA 3R7GA 2B55A 5D11A 4TPTA 2OZAB 3ODZX 3W16A 4ZMEA 5CF6A 4CSVA 2WKMA 5M4IA 3KREA 1ZYDA 2HYYA 3RZBA 2PVJA 3V5QA 3BQCA 2QHNA 3RP9A 3IW6A 5JFVA 2SRCA 1VLRA 2C47A 2X9EA 3H4JA 2OZAA 1UKHA 4RVMA 4D9UA 5CAUA 4HGTA 4I41A 4BDIA 1GZOA 3PA3A 5AV0A 2CGVA 3UOLA 1MP8A 4G5PA 3DNEA 4IX5A 3HMOA 4YR8A 5KMJA 5A9UA 3GU7A 4AA0A 3C7QA 4JX7A 4MBLA 4JQEA 5CU4A 5IG1A 4QMVA 4X2GA 4W4WA 3PDTA 1U4DA 5LVLA 4IIRA 4LV7A 3EN5A 3MIAA 4ERKA 1TQIA 3GU5A 5FP6A 3ITZA 1YW2A 3CGFA 1APME 3TG1A 4EOLA 4AAYA 2B0QA 5HKMA 4JMQA 4LRMA 3EKNA 4EYJA 3OCBA 3VW6A 1ST4A 5AV1A 4V0GB 5I9UA 3SC1A 4E5WA 4F0FA 1OBDA 4FV6A 4A9UA 3NW5A 4AZEA 2WMQA 5BVFA 4EH6A 5J79A 4R5SA 2IW9A 4V0GA 4X3FC 4EH8A 2VX0A 5IQEA 2OFVA 3MW1A 3FZRA 2VWVA 5AP1A 4ASEA 1FGIA 3ENHA 3FMMA 5FXRA 3LLAA 2OJIA 4U45A 4D4RA 4JVGA 3LVPA 3DAJA 3QXOA 1YKRA 2JKMA 1QPEA 3LW0A 2G15A 3EB0A 4M7IA 2XNGA 4BBEA 5CU6A 3OVVA 2JLDA 4IZYA 3HP5A 1E1XA 5I9VA 3SAYA 4IM3A 4IH8A 4JDKA 4BKYA 3WZEA 5CENA 4TYGA 3POOA 4EQMA 1ND4A 5C01A 2VTJA 4MXOA 2VTLA 4R5YA 3VQUA 1M2QA 2IVVA 4D1SA 3NFFB 5DYJA 5HE0A 2JFLA 1LEZA 3E92A 2ZFYA 3QZGA 4O7WA 1XH6A 3DK6A 5E9EA 3GB2A 3I81A 1NXKA 4O0XA 4WKQA 2XANA 1XH9A 2CPKE 4Z7HA 4OAVB 5LXMA 3ZLYA 5LWMA 4O4DA 3LCDA 3ZEPA 4O0WA 3ZUVA 4MNEB 4I24A 4CFWA 4D4SA 3NUSA 4WRSA 4MK0A 1KOBA 4H1MA 2R3JA 2BPMA 3DKCA 4FSWA 4FJVA 2W1IA 5JRSA 2BILB 3PY3A 3SGCA 2BRNA 3LIJA 4II5A 2B52A 3UP2A 3ZEWA 3EN7A 3FKOA 5IEXA 1PMVA 4BHZA 1JKTA 4MNEA 4WNKA 3TCPA 4PDYA 1OL6A 3PY0A 4IVDA 4Q5HA 4E26A 5BVOA 4DHJA 3IW5A 4BDFA 4TTHB 5ITAA 4QEBA 4AOTA 1IA9A 2HZIA 3UVRA 2WQOA 3LFQA 4N6ZA 5JFSA 4B0GA 4FZ7A 4EI4A 4FZAB 3W1FA 1Z5MA 2WGJA 4L7FA 3FXZA 4U0IA 4PMTA 4YJUA 3UMXA 4DGGA 3UP7A 5C8NA 3L1SA 4XOYA 1YXUA 5DIAA 1Q99A 2BHHA 2J6MA 3H9RA 3Q9ZA 3TACA 3MA3A 3U55A 3G6HA 4LDTA 3EQIA 2ESMA 4LI5A 3MIYA 1V0BA 4A4LA 3THBA 4O4BB 1Z9XA 4PMMA 3CTHA 2BAKA 2J5EA 3FMDA 2UZEA 4FICA 5KMKA 2Y0AA 5FTGA 4OAUC 4QMWA 3PG3A 4QTDA 4XV9A 3QF9A 4FKRA 3C5UA 1CKIA 4MCVA 4CXAA 4IMYA 3UQFA 4PDPA 4WNOA 1HOWA 4C4HA 4IACA 3TIYA 3FJQE 4EOJA 4F1TA 2FVDA 2X8DA 4AW5A 5HCZA 3NSZA 4XG7A 4XJ0A 4FRFA 3U4UA 5BNJA 3BL7A 4O96A 4FV2A 5DT3A 2HZ4A 2OSCA 3GCVA 3FBVA 4Y85A 4P4CA 5IDPA 4K1BA 4FX3A 2YDKA 3QQLA 4BI1A 4I5PA 4O0SA 4DITA 4YJNA 2W1DA 3MTLA 2C68A 4IAAA 4UV0A 5FM3A 4R6VA 3W8LA 2YLEA 2X0OA 4YZNA 3IOPA 4ANOA 4YJVA 4C36A 3W0NA 4G3FA 4KIPA 5AP2A 3FZOA 4JBVA 2OH0E 4U97A 5FQDC 2ITQA 4QYEA 3RJCA 3D14A 5IH5A 5E1EA 2BDFA 3EL7A 3HGKA 3ZXZA 5I9YA 4ZTMA 1JVPP 2C4GA 2WMSA 3KXHA 5AADA 3EQPA 4NIFA 4AS0A 2WTDA 1VYZA 3F3WA 5JGAA 4OLIA 1YI3A 2UW7A 1RQQA 2HELA 2XZSA 2V62A 2X6DA 3OBJA 1UU7A 2OU7A 5FBOA 5EI8A 3BYVA 3HA6A 4ZSEA 3C5IA 4MUQA 1VZOA 3DBFA 1PXNA 1TFFA 3PVGA 4ERWA 1XKKA 3MFSA 4Y72A 5FG8A 3G15A 1LP4A 5EHYA 2WELA 3GENA 4NEUA 4FKUA 3PUPA 2FA2A 1VYWA 3TJCA 4GK3A 4I94A 3CY3A 4F6UA 1DAYA 3DXPA 4ACDA 5K4IA 2J50A 1KE8A 2WOUA 3BKBA 4AP7A 4C37A 5H9BA 3OEFX 4DT9A 1BI7A 1U54B 2RIOA 3B2TA 4OR5A 2YISA 2VTQA 3R8MA 5JH6A 2QR8A 2BDJA 3PFQA 3UVQA 4ZIMA 4CMTA 3PY1A 2CDZA 4PDOA 3A7IA 3IDPA 1OPKA 5E8VA 4XP0A 4BVUA 3O7LB 5BVEA 2CGWA 4EUUA 1NVSA 1U54A 2YDIA 4LG4A 4DGOA 3ORMA 4BHNA 5HVJA 4AGCA 4H05A 1Y8YA 4C38A 4PP7A 4USFA 2IVUA 1I09A 5L2QA 4DEHA 4F9CA 3LM5A 1LUFA 2ZB1A