3MDYA

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
320
Chain Sequence
ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFIPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1B
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 107
structure length 320
sequence length 329
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mdyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mdyA01
4QMMA 4DGMA 5CWZA 2JDVA 3SXRA 1OITA 3UYTA 5ITAA 3EQFA 5LVOA 1NVQA 2XZSA 4BDKA 3BHHA 4I3ZA 4QOXA 4DH3A 1H01A 2PMNX 1OPLA 2QOFA 4YZCA 4YZDA 5KE0A 3P0MA 4P90A 2X2MA 3KF4A 2WHBA 3POOA 4GW8A 5HZNA 2DYLA 4LOQA 4EHVA 5IH5A 2PZYA 4FVQA 4TYHA 3U4UA 5CSHA 4ASEA 3QTRA 3DJ7A 4YUQA 3PP1A 2QU5A 1ZARA 2UW6A 2XNGA 4RGJA 2CJMA 3BBWA 5CI7A 5GNKA 4AN2A 4DEGA 4JQEA 1MUOA 1FQ1B 2BALA 3R30A 4XEYA 3C0IA 4GK2A 4EK4A 5IQAA 1RE8A 2I7QA 4TTHB 4G17A 3WI6A 3P5KA 3UZPA 3QRKA 5C26A 5AP0A 1WBVA 1LEWA 5AUYA 3VS1A 5DRBA 3WF8A 2E9VA 2ITPA 5KHWA 4JDHA 1OL1A 4FL1A 3DS6A 3GENA 1JKKA 2O8YA 2QHNA 3R1SA 1KSWA 5HI2A 5KMIA 5DGZA 4I23A 1ZYLA 1UKHA 4IACA 2YA9A 5K0XA 5IA5A 3TJDA 3QYWA 1TVOA 1FVVA 3PFQA 2ZDUA 3LXNA 4MH7A 2OZOA 4EK8A 3B2WA 4ZTNA 4FVPA 3ZRLA 4DTKA 5IA1A 5FQDC 4I92A 2R3LA 2E9UA 3BQRA 5CYIA 3ZEPA 2R64A 3LCSA 5EYMA 5L6OA 3OP5A 2H9VA 4APCA 4C38A 3SAYA 3PXYA 3Q9ZA 4X2KA 2H34A 3T3UA 5KMMA 2GNLA 3GUBA 4U7ZA 4Z16A 4MWHA 2VTLA 1Q8YA 4JOAA 3KMMA 1MQ4A 4FIGA 3N4TA 2V0DA 4MXAA 3HV3A 1P4OA 3MH3A 2B9HA 1OGUA 3CJGA 3HNGA 2ERKA 4AU8A 4NFNA 4M8TA 3QHRA 3RZBA 4WIHA 3WF7A 1SVEA 3EYHA 4PDYA 3C50A 5DG5A 1H26A 2F2UA 4RZVA 4QQ5A 5IQDA 3RM6A 3DBCA 3DQWA 2VX0A 4MCVA 2OG8A 5FDXA 5J7HA 3K3IA 3F88A 1J1BA 3CTQA 1M7NA 4NT4A 4XH6A 1U54B 4RT7A 3ORIA 5ACKA 4AGWA 5E9EA 4FV8A 3Q9WA 3CKXA 3ALNA 5I3OA 3LFFA 4ZSEA 5IUHA 4NM0A 4RZWA 1YKRA 4IB0A 5JSMA 5JZJA 2QOKA 2P2IA 3PXRA 4QQTA 3ZLSA 3CLYA 1TQPA 4J96A 1YVJA 2UVYA 2W1DA 3CD3A 4RIYA 2BAKA 4EC9A 1OB3A 5LCKA 4AW0A 1PY5A 2REIA 4EOLA 3P86A 5D12A 4JXFA 3AT2A 2C3IB 4LQMA 3WE4A 4ONAA 2OZAB 3BU6A 3W8QA 3P78A 3V04A 2CMWA 4IJ9A 2R3GA 3EH9A 4AGDA 3KRLA 3BE2A 3PVWA 3VO3A 3OEZA 4BBMA 4FNYA 4AZSA 5CTPA 5CSWA 2W06A 5HE2A 3WYYA 3VHEA 4F64A 3LJ2A 5M57A 5J9LA 4MX9A 4L01A 4QP8A 2QU6A 4RWJA 4OBOA 4QTAA 4QMUA 2PZPA 2VTRA 4H3PA 4OTHA 3H9OA 3LCKA 4R7HA 1YOLA 2YDIA 1JKTA 4FODA 2HOGA 4QT1A 5E1EA 4EZ3A 5L8KA 4U42A 4HGLA 5BPYA 1JQHA 4FTUA 5E8TA 1H25A 4F0GA 5LXMA 1UWHA 5C8MA 2R5TA 3F5UA 5AR2A 3SD0A 3KKVA 3DAEA 4EC8A 4QPAA 3QA8A 2OKRA 4XP2A 4OT5A 5AV2A 4IADA 2X8DA 3VUKA 3TXOA 2W1GA 2NRUA 4GMYA 1GIHA 3VUDA 2VTQA 4F9YA 5BYYA 2YZLA 3DU8A 2C3KA 3BWFA 5KCVA 4EH5A 5TT7A 3Q3BA 3BGZA 3OF0A 4XG4A 5AUUA 1Q24A 2UW3A 1KWPA 4UY9A 2YISA 4AG8A 3FYJX 3I0OA 3R2BA 2ONLA 3QQLA 1GZNA 3PIXA 4AW2A 4Y72A 4NJDA 3ZH8A 3LLAA 3F6XA 4M0YA 5ANEA 1YI6A 2F2CB 3UIMA 3PXZA 1XH8A 1ZYCA 2GS2A 3EZVA 3QKMA 3IK3A 3OY1A 4GS6A 4O21A 3MESA 5TE0A 1KE8A 2A0CX 3R71A 1W98A 3S2PA 4ORKA 5EKNA 2VTMA 3PJ2A 2G2FA 5IKWA 3PA3A 4JBOA 3UVRA 4A9SA 3NZ0A 4AZFA 1XH7A 4KIKB 5HNIX 2ETRA 2NPQA 4AGUA 4RC2A 1YQJA 3MIYA 3I1AA 4L3PA 1PYEA 3DTWA 1XBCA 3E93A 4O0XA 4OW8A 4GH2A 5HIDA 2F7EE 4CKRA 4ARKA 5GINE 3FY0A 5EQEA 2P55A 1XO2B 4FV1A 5F20A 4GYIA 5LCJA 4F6UA 4ALWA 4K0YA 5AADA 4FC0A 4F09A 4GU6A 4BY9E 3FQSA 4WOVA 1QL6A 4O7SA 4UALA 5KZ0A 4ASXA 2QQ7A 3D7ZA 5E8SA 1O6KA 2J51A 3LM5A 4IFCA 3UGCA 3IW7A 4RWKA 4PMPA 3C4EA 1ZAOA 1UNGA 5GZ9A 2WIPA 4BCGA 4OGRA 2QOLA 2C6TA 4PX6A 3HA6A 3NW5A 1X8BA 4BTJA 4WHZA 4DFZE 3DKGA 4FTQA 1PXJA 4M0ZA 4X2NA 4BWPA 1RQQA 3HMIA 4X0MA 4A9UA 5EW3A 3OTUA 4ZZMA 3U54A 2XEYA 1R1WA 2BPMA 4D2SA 5A4TA 5HLWA 3VRZA 3TNHA 2JKMA 2QD9A 4YJVA 4Q2AA 2WQBA 3IPHA 3UMWA 3KK9A 4C0TA 2WU7A 4Y8DA 4D9UA 4HVHA 1OVEA 4DEHA 1GZ8A 1H1PA 5L8JA 2WOTA 2YM8A 4I94A 4TYHB 5CX9A 4FT9A 2XKFA 4I5CA 3ZSHA 3RALA 4H58A 3QXPA 4KUJA 4A07A 5AR4A 4F65A 3AC1A 3Q2MA 3OT8A 4EK6A 2ZYBA 1PXLA 3OXIA 1LUFA 3QQGA 1JSTA 2CPKE 2ITNA 4BCFA 4QYHA 2F7ZE 2JIUA 3F3UA 3D94A 1GY3A 3KCKA 3ORZA 1W82A 3GQIA 4YZNA 1BL6A 4GEOA 3ULZA 5IISA 3QKKA 1U5RA 5EOBA 4O83A 2WTJA 3PRIA 3CE3A 3FLSA 4PDSA 3DDQA 4OAVB 4GT4A 5B0XA 3H9RA 5JQ5A 1XH6A 2H8HA 2IG7A 4FUYA 2IZUA 3KXNA 4F63A 4KKGA 2BRBA 2R2PA 4R6VA 4AA0A 3CTJA 3SRVA 4FTLA 3NUAA 3QZFA 1QPEA 3F7ZA 3PXKA 5JFVA 1YXVA 4BDDA 3R8VA 5IA0A 2G15A 2X2LA 2YHVA 3HUCA 3MSSA 3VUIA 4OT6A 3JVSA 3GEQA 3DK7A 4QMWA 1AGWA 4W4XA 3OBJA 4TY1A 4O7YA 2XM9A 4PWNA 4D4RA 5FBNC 5HTBA 2YCSA 5A4EA 4IZAA 4I6HA 3PWDA 3NDMA 3Q4CA 2IZTA 4IAAA 4YHJA 3SVVA 2YDJA 5EW8A 4PTCA 4CFMA 3TZ8A 3FV8A 4FV2A 2XNMA 4V0GA 3PA4A 2R3HA 4PL4A 4G34A 3QYZA 1Q8ZA 4ZMFA 2QO9A 3EJ1A 3A2CA 4YNOA 4D2RA 2JEDA 4OTGA 3U4WA 3VUMA 2XKCA 3TI1A 4C34A 3G9NA 3BPRA 5IMEA 3NR9A 2OFVA 4ZP5A 5AR5A 4CGAA 4QP9A 3FXWA 4M7IA 4QPMA 5HLPA 2OW3A 2Y8OA 5EM5A 1HCLA 5CAOA 1H0VA 3KU2A 2YABA 5ETAA 3M42A 3FLYA 2WMAA 3L9LA 5HG9A 2WU6A 3I6WA 5CNOA 3NEWA 3LPBA 2DQ7X 4CTCA 1P14A 4CRLA 3AQVA 3MTLA 2PMOX 4JL9A 4NJ3A 3FC2A 4D2TA 4TL0A 4XG6A 3QC9A 3GVUA 5I9UA 5BVKA 1WVYA 3F3ZA 4FI1A 5I9YA 3BYOA 1YW2A 3QL8A 4XMOA 4OTQA 3UVQA 4I22A 3V5TA 4DN5A 4ZTHA 4RWLA 4R7BA 4IH8A 3VS6A 4IXPA 2VD5A 5DLSA 3FAAA 3FZ1A 5CASA 4AACA 5EI2A 3GC0A 3H0YA 4DAWA 2YFXA 3KCFA 3PSDA 3ZBXA 3DFCB 2WQOA 1YHSA 4DEAA 4HGTA 4MVFA 3V8TA 2YIYA 4G31A 4EKLA 4ZLZA 4W9XA 4MF0A 5AR7A 4PTEA 3NAYA 4CZUA 1Q8TA 3GFWA 2XKEA 2YJSA 5HQ0A 4J7BA 3W32A 2VN9A 2XCKA 1U59A 2YAAA 2B52A 3Q4ZA 5E8WA 3ALOA 3WE8A 4ZZNA 3RVGA 3MYGA 4GFGA 3GC8A 3NGAA 3OTVA 3UIXA 3WF9A 4YTCA 4D1XA 3DZQA 5BVEA 2WELA 4JBVA 3PYYA 4LRKA 5ANDA 3UC3A 4I6QA 4FK6A 5J95A 3UO5A 5IQFA 2PPQA 3MFSA 3R8UA 3CGFA 3W2OA 4UBAA 3TNWA 4M13A 4C3FA 2HELA 2C5XA 5AIKA 3D5XA 4WSQA 2PZIA 5CQUA 4BVUA 1NW1A 3C5IA 3F3TA 2JITA 3F7WA 1OIQA 3QQUA 4R8QA 3O8UA 3LE6A 3U9NA 4IAKA 4BDHA 3A60A 3VS3A 5IEXA 4OTRA 2E2BA 2UW0A 4MQ1A 3TV6A 4BCMA 1CKPA 3HRCA 1F5QA 4NL0A 2W7XA 3GCPA 4II5A 4IMYA 4KSQA 5AP5A 1P2AA 2RL5A 3UPXA 3R28A 3WZDA 5FG8A 3NWWA 5BVNA 4IEBA 4ZAUA 4X6RA 4P7EA 3OT3A 4WUNA 1H08A 4GT3A 5IUGA 1U5QA 3UC4A 3OCBA 1U4DA 4KRCA 1URCA 4LYNA 3CSVA 4EJNA 2J2IB 4A9RA 4NCTC 1YHVA 3PIYA 5A4LA 3GOPA 4LV5A 3CD8A 4ITHA 4O2ZA 5CS6A 2C0TA 4TYGA 5AV3A 4FNWA 2JFMA 2R3PA 2VWZA 3IECA 4UX9A 2X81A 4QMZA 5HO8A 3V8SA 3ZUUA 3CIKA 3ORNA 4FYOA 4PMTA 4I41A 4V05A 2IZRA 2XNOA 5EM7A 3SQQA 3AT4A 1WBOA 2XA4A 3RCJA 3K3JA 4PPBA 4ASDA 2BRGA 3F3VA 3OXTA 4FKJA 1OIRA 3OCTA 4JAJA 4EH8A 2W1HA 3IKAA 3O51A 4WKQA 5LVMA 4AZVA 2PE1A 3TNPC 1Q61A 1WBTA 5KMOA 2R3NA 3DJ6A 3QU0A 2PY3A 3POZA 4IX3A 2EXMA 2XM8A 1LEZA 4J95A 5DBXA 4ZEGA 4M97A 5LWNA 4I4EA 3ZLXA 5M4UA 1Z5MA 4GV1A 1XWSA 2B0QA 1APME 4CVAA 4XNEA 1XJDA 1ZYSA 4YLLA 2BHEA 4BWKA 3GU5A 3R0TA 4E5WA 2OK1A 3KY2A 1RW8A 1Q5KA 1OL6A 2OJJA 2WKMA 3A7JA 3BU5A 4QP4A 3DLZA 5FXRA 3QHWA 4A4LA 4AZWA 5IUIA 3FC1X 2VAGA 3FUPA 3Q04A 4NM5A 4XBRA 4CV8A 3ZC6A 4S33A 2RFSA 4PRJA 4BFMA 3G51A 3DXPA 4EEVA 4EYMA 4EHGA 3LXKA 2VWXA 1M2QA 1R3CA 4ITIA 2VTHA 3ZONA 5DN3A 3ANRA 4NFMA 3R9OA 4FV4A 4UWCA 4ZY5A 2IZSA 3EWHA 4MF1A 2XBJA 5ETFA 2NRYA 1F0QA 3UBDA 1Q41A 3C0GA 1YOJA 2ZAZA 2IN6A 2VTTA 3GU7A 2OSCA 3OVVA 4TWPA 5IPJA 3VW8A 4FKSA 2B9JA 3DBFA 3Q5ZA 2PVHA 4EOKA 4FIIA 4FV7A 5KX8A 3SRVB 2BMCA 2QVSE 3GNIB 4FMQA 1OUKA 4CFWA 3FMLA 3GP0A 4HVIA 2UW5A 2ZV9A 3ZUTA 4J97A 4XP3A 4AUAA 4K33A 1DAWA 4X6QC 2YDKA 5E8YA 5K5XA 4BR3A 4O0SA 1MQBA 5EYDA 3P08A 4LG4A 5M4IA 2HIWA 4UMTA 3W33A 3W2PA 2C6DA 2WMXA 1H24A 3BEGA 5DA3A 2YACA 2RGPA 3AMYA 4RFMA 5BVFA 3BHYA 4L43A 3UIUA 2NNWB 3V51A 2UZDA 2YIXA 3ZU7A 4BCNA 2C0IA 4QNYA 5B2KA 4KBCA 3VUGA 4FZ7A 3QUPA 2Z60A 5HE1A 2HYYA 4N70A 4FTJA 2OF2A 3BYVA 3S0OA 4JG6A 5C27A 5K3YA 4S32A 4QTDA 4FGBA 3TKIA 2QI8A 3BKBA 3QTQA 4JDKA 2UZVA 4YC3A 4YC6A 3RAWA 1UNHA 3WZKA 2QLQA 4GG5A 4O1PA 5HHWA 4BTKA 5AAGA 2IVSA 4EK3A 4CEGA 2HZ0A 2WMSA 4C4EA 3TV4A 3VUHA 2PVJA 2BZKB 3IDBA 3LXPA 1OMWA 4D5KA 3Q96A 4L7FA 4YJQA 4GYGA 4HZRA 4EWHA 2VWBA 3PE1A 2OWBA 5JRSA 2JIIA 1YDTE 3UJGA 2VRXA 4GKHA 2V22A 5JGDA 2C6EA 2XIKA 1IA9A 3D5WA 3ZCLA 1G8SA 3CPCA 1Q8WA 5CEPA 4ZSGA 1MRUA 3SDJA 3DDPA 3LLTA 3SOCA 4DF3A 4OAUC 2EUFB 1W84A 2P4IA 2QOBA 4J98A 3IOPA 4LL0A 5DYJA 5DE2A 4CLIA 5IA4A 2BTRA 3QFVA 4YPDA 5CAPA 3U6IA 5J1VA 3CQEA 3PLSA 4LI5A 5HGIA 5CANA 4FT5A 4O0YA 3FXZA 5HG8A 2P3GX 2IW8A 3KRXA 3K2LA 3MA3A 3E3BX 4RFYA 3UOLA 1IAHA 3JR1A 3V01A 1YXSA 3WIKA 3C13A 3A8XA 4PQNA 5AAFA 5K4JA 4YC8A 4LUEA 3FZSA 3QCQA 3U87A 3BWJA 3MVMA 2QKRA 4NM7A 2GHGA 3W2CA 2WNTA 5AP7A 3HUBA 4C3PA 2XK8A 4UV0A 3W8LA 2PVKA 2Z7SA 5H8EA 3QWJA 3ZXTA 2OBJA 4NM3A 2I40A 2VO3A 2IVUA 3M11A 2Y4IC 3D5VA 5JGAA 2ITVA 3FZTA 3K5VA 2W0JA 4TYEA 4EWQA 3Q52A 2CDZA 3P79A 4YTIA 4QMXA 3VJOA 1OBDA 3LMGA 3GFEA 2FSTX 2QURA 5DIAA 3RP9A 4BN1A 3BELA 3MW1A 3RMFA 3DKFA 4BDCA 2J90A 3TUCA 3AC3A 2W4OA 3P7CA 3UE4A 5J7BA 1PYXA 5JN2A 4FSQA 3UODA 5IH6A 3F69A 3CY3A 4RMZA 4UMUA 1HCKA 3E7OA 1IEPA 1YDRE 2C6LA 4JQ7A 3IS5A 3PJ3A 3RWQA 1ATPE 2BAJA 5HBJA 5GJGA 5D7VA 4F0IA 4PMSA 3W55A 3IW5A 4XG8A 2UVZA 5HVYA 3FZOA 4PY1A 4HOKA 4RJ3A 4RC3A 5FXQA 4EONA 4QO9A 4I6FA 3PA5A 5HBHA 3RTPA 1PKDA 3DZOA 3H9FA 5DT0A 4RX7A 3R7OA 3VBXA 5BVOA 4BHZA 4LMNA 3CTHA 4Y85A 1FOTA 4R3RA 2EXCX 2HK5A 4CMOA 4G9CA 3G0EA 4GIHA 3BE9A 3V8WA 2X6EA 1W8CA 4PMMA 3ATSA 5JQ8A 5E7RA 4JG7A 2ITXA 2C4GA 2ITTA 3QTZA 4Y73A 4EQUA 4I0TA 5KKRB 4IAFA 3QLGA 3W2QA 4G16A 3ZLYA 3ELJA 2QOQA 3CJFA 4F1TA 5I3RA 5HESA 2NO3A 5CF4A 4G6NA 4KD1A 3SGCA 3OC1A 3E92A 3O50A 4BC6A 3HYHA 3TN8A 2EWAA 4ENXA 3EB0A 5KUPA 5E92A 1IASA 1SYKA 2W5HA 4IHPA 4DC2A 2YITA 2XJ0A 4GVJA 3C4CA 4RIXA 4EORA 4PNIA 2ITWA 4UB7A 2VWUA 4IB3A 4UXLA 4WNPA 2WTKC 2XNPA 4X2JA 2X7GA 5HO7A 4QP6A 3UTOA 3LAUA 2GS7A 3BV3A 4OR5A 1SM2A 2H6DA 2B53A 2FO0A 3DV3A 4HPTE 4RFZA 2OIBA 3PJ1A 2QOHA 3BLHA 2C68A 3UVPA 3NX8A 3HV6A 3R7EA 3UO6A 3AC5A 4D9TA 4D0XA 4X21A 3R00A 4ZSJA 5I5ZA 3TDVA 3A4PA 4D58A 2GU8A 3DPKA 3QTIA 4IW0A 1TQIA 2LAVA 2P33A 5BMMA 4KB8A 1DI9A 4KIQA 2PVYA 2VV9A 1VJYA 4WO5A 1YXTA 3D14A 5EDRA 2EXEA 1BUHA 1J1CA 1H07A 4RLLA 4AZTA 3LOKA 1YI4A 1JNKA 2OO8X 2OXXA 4QYYA 4W8DA 4FSMA 4K11A 4KINA 1PMVA 4EYJA 3AD5A 3MH0A 3FHRA 4DCAA 3K5UA 4RJ7A 3K54A 1ZZLA 4O0RA 1XH9A 4TN6A 5FXSA 2O63A 4F7NA 4XG7A 5FTQA 4X3FB 1T46A 3WARA 1FMKA 3ID6C 3DAJA 4XV1A 5M44A 2VTSA 4KBAA 3WYXA 1VEBA 4AT4A 1JVPP 3LFBA 4B8MA 4ID7A 3PPZA 4C36A 1IAJA 2R3OA 5G6VA 2SRCA 3FLWA 5CSVA 1KV2A 4ZTQA 1R78A 3MJ1A 2KTYA 4QMNA 4USEA 3IGGA 1XBBA 4UEUA 3EQIA 5KZIA 4H36A 2C5NA 2R7IA 4ALVA 4DHFA 5M07A 2QR7A 2A27A 1W7HA 5I9WA 3EIDA 3TWJA 4ACHA 3ORLA 4GIIA 5DMZA 4FG9A 5AA8A 1R0PA 3VF8A 3Q53A 3G90X 4FEWA 5BUIA 1URWA 2OFUA 3I60A 4GG7A 3OD6X 2YLEA 4FUXA 4M67A 4DFXE 3HMMA 1L8TA 3GU8A 4PV0A 2IJMA 2BZIB 4C4GA 5I9VA 4JX3A 1GZOA 1WAKA 3S1HA 3RPYA 2HW6A 4C62A 2J9MA 4J52A 4AF3A 3FEGA 2ONLC 5AP2A 4CXAA 2Z7RA 4L3JA 4WG3A 3RWPA 3H3CA 5HBEA 3FKNA 3NUPA 4IAIA 4JR3A 2W1IA 4TYIA 3FQEA 4XP0A 3SX9A 3LVPA 1SNUA 2BROA 4Y83A 2CSNA 3MPAA 4FTMA 4AOJA 5GJDA 2YERA 2C5VA 4WA9A 4D4VA 4BDGA 4GT5A 4BDAA 2ZB0A 5A46A 4QMYA 4JIKA 3S95A 2Y9QA 4MEDA 3B8QA 3NYVA 5H2UA 3KVWA 5J87A 5BUEA 5DOSA 4G2FA 5FDPA 2PULA 4EQMA 1OIUA 3T3VA 1UV5A 3SA0A 4XX9A 5FUTA 4UZHA 4L67A 4O0UA 2CKOA 4ZJVA 3OZ6A 1ZOGA 5DFPA 4DEDA 5KMJA 2LGCA 1ZOHA 4V01A 2GCDA 4FZFB 1UWJA 3PY0A 3LFSA 2Y6OA 2WZJA 2O65A 3BYSA 2AUHA 3C4FA 4KKEA 2R0UA 4HVSA 5HVKA 4OLIA 4YBJA 4YJNA 1NT2A 3MH2A 3ODZX 4IWPA 4DGNA 3VS4A 3KXHA 4ACDA 3QTUA 5FM2A 2HY81 5IQHA 5LARA 2R3FA 1GIIA 2CGUA 3GCSA 2F49A 2R7BA 4JAIA 2B1PA 4R5SA 3ZFYA 4FSTA 4EOPA 4ZSAA 4ANMA 1Q62A 2X8EA 1JOWB 4G9RA 2JAVA 3C51A 3MFTA 3UYSA 1IG1A 3SKCA 2FB8A 4B4LA 5HU9A 5EI6A 3FSKA 3A7IA 4BL1A 4G1WA 3S3IA 1EH4A 2ERZE 4XHKB 4GFOA 2GDOA 4X3JA 2OJ9A 2QCSA 3PVGA 4AAAA 5GHVA 4BCPA 1ZYJA 4F1OA 5CF5A 1LP4A 1WBWA 4J1RA 4AT5A 5LVPA 5M53A 5HD4A 3KMUA 1PXPA 3LQ8A 3PP0A 4E6DA 3SLSA 3BGPA 5KBQA 3IW4A 4E3CA 2CNQA 2BIYA 2C1AA 4GCJA 1Q8UA 2QR8A 2JKQA 4M68A 3TT0A 2W9FB 4U97A 5HG7A 3RAKA 2PUIA 2E9OA 3EKNA 4FKQA 4HVGA 4DH1A 3QZHA 2ESMA 3AC8A 3PVUA 4MD8E 5TF9A 4BICA 1OL7A 3HDNA 2J0MB 3FI3A 1CM8A 3R7GA 2FH9A 3C4ZA 3TZ7A 5FEDA 4WG4A 3VBYA 1QPDA 4D1ZA 2C6IA 4RVTA 4AW5A 5AV4A 4FKGA 1A48A 3PPKA 2YM6A 3W16A 3DKCA 5DVRA 1VR2A 3RAIA 1PF8A 4U43A 3EOCA 1GNGA 1P4FA 3CBLA 4ZJIA 1GAGA 5HG5A 3VJNA 3B8RA 4BCOA 5JFWA 2GNJA 4M15A 4RG0A 4Z3VA 5HX6A 4QPSA 2WO6A 4XRLA 5TR6A 4FKPA 2YLFA 5M09A 4BKYA 3UNKA 4RIXB 3U55A 4AN3A 3MVJA 4F9BA 1F3MC 5J5SA 3PDTA 2EB3A 2GFCA 2HXLA 5AUWA 1W83A 3TG1A 3KXZA 4LV8A 4I5HA 2C47A 3BBTB 4BDEA 3COMA 3EQHA 3GCUA 4O91A 2YIQA 2WMRA 4AXAA 1K3AA 4FV5A 5CVFA 2HENA 2WQMA 4S31A 2Y0AA 4GSBA 3FPMA 4FT3A 5BYZA 4TYJA 1J7UA 1YHWA 4MKCA 5L6WL 4KA3A 4L45A 4WNKA 1V0BA 2IWIA 2YM5A 2RF9A 5AP6A 3QBNA 4NKAA 5CT7A 3WZEA 2OI4X 3LMHA 2RG6A 4MQ2A 3HL7A 5AMNA 4F6SA 5M4FA 5IQIA 1WVXA 4TRLA 4FV6A 5KMKA 3GT8A 3AOXA 3JY0A 4RWIA 5FM3A 1SVGA 2F7XE 1JBPE 3F3WA 4IVAA 2R9SA 4CYIA 5J5TA 3PPJA 5HO6A 2OICA 3VN9A 3KXXA 1L3RE 2VGOA 2VZ6A 4EKKA 4DE4A 3GXLA 3TUDA 3QD4A 4Q5HA 5AJQA 3A7GA 4PP9A 3VVHA 2QLUA 4D2VA 4F9CA 4YGAA 4PUZA 4FKVA 4NUSA 4JIAA 4WBOA 4WUAA 2UZTA 3G6GA 3TZMA 4TWNA 3ZO1A 1BL7A 4BGGA 3S00A 4ANOA 2VO6A 3ACKA 2RFDA 3MFUA 4ZZOA 4IWOA 2PMLX 5JGBA 3R6XA 3NPCA 5CAVA 3N9XA 3MGYA 1SNXA 2WMQA 2XIRA 4E7WA 3R22A 3MVLA 4O1OA 1WVWA 2HZIA 1OKYA 3D2KA 3BYUA 3UQGA 3ZM9A 2WQNA 3KA0A 1LPUA 4JR7A 4WBBB 2OGVA 3Q6UA 1J3HA 3TIZA 3JUHA 3WF6A 1BKXA 2XEZA 1YDSE 4B9DA 2R3IA 2PVLA 3PY1A 3Q4UA 3QZIA 5HNBA 1H28A 4E6AA 3NIZA 2CLXA 5C4LA 4BI2A 3QXOA 3EFJA 3R7YA 3L9NA 3REPA 3L8XA 3DBEA 2JLDA 2X7OA 2XKDA 3HLLA 3VWAA 5BMSA 3MB7A 3MIAA 3EFWA 1I09A 4U5JA 1Z57A 2PUUA 4QRCA 2JAMA 4O38A 3LQ5A 4C35A 4J8NA 2GQGA 3AC2A 4USDA 4N6ZA 4BBEA 4BIEA 2HWPA 1DM2A 3CQUA 3MWUA 3BHTA 3PTGA 3VULA 4BCIA 4L46A 3UQFA 4E4NA 3AD6A 4RQVA 4FEXA 3E64A 4FKUA 5AX9A 5EFQA 4E6CA 3MY0A 2ZOQA 3LFAA 3PIZA 4NK9A 3DBDA 4A9YA 2BKZA 4CFNA 3L9PA 5CAQA 4IDVA 2RFEA 3DXQA 4O7WA 2OF4A 3GU4A 3NUNA 4FTRA 3RM7A 2C6KA 2YN8A 1B6CB 3R1QA 4O22A 3ANQA 5KKRC 5A14A 4MBJA 1OL5A 5AFVA 5AV0A 1S9IA 3SHEA 3UPZA 2W1ZA 4FTCA 4OTWA 4YNEA 3W1FA 2JBPA 3PZEA 3R63A 4KAOA 4U9AA 4XYFA 3QLFA 3TKHA 3SC1A 4O6LA 4UMRA 1PKGA 2WTIA 3R21A 4O0TA 5CAUA 5KMLA 3U6HA 1WZYA 2XJ2A 3OUKA 3EHAA 3I0QA 3ETAA 4C2VA 4W9WA 4EZ5A 2X7FA 4ZLYA 2C1BA 4MYGA 5JMSA 3KRJA 3G0FA 3OROA 3LFNA 2JDRA 4PPCA 4XS2A 5JT2A 3D0EA 3HV7A 4FK3A 4UYNA 1YI3A 2PVRA 4LL5A 4MXCA 3ZM4A 3FMDA 5F9EA 4APPA 1A06A 5J9YA 2VO0A 4W4YA 2OIQA 3FLZA 3IO7A 5FP6A 2XS0A 5FWKK 1ZRZA 4W8EA 1KOAA 1V1KA 2E9NA 2GPHA 4RRVA 5CI6A 4B6LA 3D4QA 4H1JA 4S30A 3UOKA 4FT7A 5KNJA 3DNEA 5JH6A 4IDTA 1OM1A 3NNUA 5DT4A 1Y57A 1PXOA 2VTOA 2PU8A 2QOCA 4JNWA 4FKRA 3ZUVA 5A6OA 3GU6A 3JXWA 4QMOA 5FBOA 3ZO2A 3FMHA 4ZSLA 4CYJA 2GMXA 4IE9A 2BDJA 4IZYA 2YM4A 2R3MA 4RVMA 4HJOA 5KBRA 2FGIA 1TKIA 4OTFA 4OUCA 5C03A 4ZK5A 4MD7E 4BYJA 4AE6A 4HYSA 4MK0A 3V5LA 4BCHA 2J0KA 2VTPA 5ANKA 2C30A 3EQPA 3ZRMA 4N4SA 5EHYA 4F08A 3SG9A 3PVBA 3OG7A 5FGKA 1QPCA 4XOYA 5E8UA 5EKOA 2OH4A 4C2WA 2Z02A 4S2ZA 3ET7A 4IAZA 3U9CA 5C4KA 4KS7A 3MFRA 3VBVA 5LMBA 4NYEA 5EOLA 4C59A 2UW4A 2JC6A 3HV5A 5AV1A 5I9ZA 2Z7QA 3R83A 3RK5A 4I93A 4IX5A 1UNLA 4MXYA 4RIWB 4K1BA 4L52A 2V5QA 3GGFA 2X4FA 4RJ5A 4O86A 5HE0A 2KULA 5L2WA 4C4FA 4FSUA 5C01A 4GKIA 3CS9A 4TWOA 2I0HA 1R0EA 4MXZA 2J5FA 4BBFA 4G3CA 3QC4A 2X6DA 2Y4PA 2YEXA 3H30A 3W10A 5JK3A 5E8VA 2BIKB 3SW7A 4I1ZA 4JLCA 2Z8CA 3QA0A 2PZ5A 2WTVA 2XVDA 2YAKA 4C3RA 5HCXA 4EL9A 5AP3A 4E5BA 3FYKX 2UZEA 3RPSA 5C8NA 1XQZA 4W4WA 4M69B 4NZWB 5A4CA 3DY7A 2XRWA 3MI9A 3FDNA 3ZYAA 5A6NA 2ITQA 4BDFA 4JQ8A 4DYMA 4DBXA 5F4NA 2PHKA 3OWKA 3AC4A 3P7AA 5EG3A 3R02A 5HIEA 4DEBA 2XIXA 2EU9A 4TXCA 2BHHA 4RX5A 4GFMA 4BZDA 2WD1A 4LGDA 5ETIA 2WIHA 5DR6A 3ZO4A 1Y6AA 3PSBA 2VWYA 4ANSA 3RGFA 1K9AA 4IB1A 2HCKA 2IPXA 3BEAA 3G5DA 3MA6A 2XNBA 3ZFMA 1YRPA 3F9NA 3DA6A 5CU4A 2VU3A 3PXQA 3F2NA 2GNFA 2JDTA 2W17A 1YWRA 4IANA 4CKJA 3NUXA 2J0JA 3SG8A 1HOWA 3OHTA 1MRVA 4DEEA 1BLXA 1OL2A 1ZY5A 2WTWA 3IG7A 3PXFA 2WMUA 3ORMA 3Q9YA 3VQUA 4USFA 3U6JA 2R3JA 2Z7LA 5IEYA 3RBWA 3AGLA 4ZTMA 4DINA 4K9YA 5E8ZA 4X3FA 4DG3E 4CMTA 4AFJA 4ZLOA 1V0OA 2BRNA 4XCUA 4ASZA 1ZZ2A 3UP2A 4FTTA 1JKLA 5IDNA 5EQYA 4QMPA 3COIA 3TEIA 3P7BA 5L2IA 4K2RA 1KE5A 2CLQA 3R8MA 4RIOA 3OMVA 3RKBA 2V55A 5EYCA 4EUTA 2DUVA 4HNIA 3ZSGA 5GZAA 2QO7A 2BTSA 4NKSA 4YHFA 3EQRA 2ZMCA 4IWQA 4QTEA 5A54A 5FTGA 2C6OA 4IWDA 4HCTA 4AZEA 2UZWE 5DR2A 5IMXA 3FMKA 5AUTA 3LQ3A 5I9XA 2XIYA 1ZMVA 2P0CA 4M14A 4DT8A 1NVRA 2PMIA 1K2PA 3EN9A 3F66A 1Z9XA 2XF0A 5ANJA 3DKOA 1JSVA 4NW5A 4H39A 4I24A 2WOUA 1UU3A 4H3QA 4C4HA 1NXKA 4E5AX 3NUYA 1J91A 3W2SA 4KIOA 3EQCA 4DA5A 1OUYA 5B2MA 4F9AA 1FPUA 4CFFA 3FMEA 1UU7A 4QMVA 2AYPA 2CHLA 3QWKA 4XV2A 1JSUA 1ZOEA 4I4FA 3UOHA 5C1QB 2W9ZB 4MAOA 1YXXA 4G3DA 4C02A 4EK5A 4MWIA 1STCE 3BLRA 5CSPA 3E5AA 3Q5IA 3DQXA 4EBWA 1OI9A 3E87A 5JZNA 3TZ9A 3OW3A 4QTCA 4PPAA 3LZBA 4U0IA 4AWIA 1DI8A 1BI8A 2O5KA 2W1CA 4FKLA 3T8OA 4P5ZA 3IDPA 4FBXA 4F70A 3NUSA 1NY3A 3FQHA 4FTNA 3UMXA 3EL8A 4S34A 5CY3A 1FMOE 4RX9A 3A4OX 3QKLA 4UYAA 3TKUA 4G6LA 3ZOSA 4CFUA 3DCVA 4LMUA 5D10A 4X2FA 5CXZA 3OFMA 3LXLA 3GC7A 3BLQA 4TPTA 4IAYA 3N4UA 1KE9A 3UZRA 2PTKA 3A61A 1B39A 3O7LB 3EMGA 3RPRA 3TNQB 5LWMA 3NUUA 3ULIA 2FA2A 5FEEA 5DH3A 3GC9A 4DLIA 2G2HA 2Y6MA 4U81A 5HCZA 3R8LA 4AOTA 3QUDA 4KSPA 4EHEA 3EQBA 4U79A 1E1XA 3HX4A 3MBLA 3OW4A 4X2GA 3TTJA 4I20A 3RK9A 3LFDA 3QQJA 2YIRA 4N0SA 3SV0A 2W4KA 3A62A 2B9IA 3ZZWA 4EH9A 4NEUA 2W99B 3CPBA 3HRBA 2ITZA 2YIWA 5AUXA 5FRIA 4IM0A 4U45A 4KABA 5AWMA 4CZTA 2BZJA 2XH5A 3MJ2A 3VS5A 4TNBA 4BKZA 2I0VA 3FMJA 3DJ5A 4L3LA 3LKMA 3IW8A 4FG8A 5HX8A 3F61A 4A9TA 1QMZA 2HZ4A 3KC3A 4BYIA 3VUTA 1KUTA 5ANIA 3RI1A 4EZ7A 4V04A 4J99A 4B7TA 3RZFA 2A4LA 3KGAA 2J5EA 5CT0A 4MNEB 5L3AA 2FYSA 1JLUE 3E88A 2EB2A 4RBLA 4E93A 3ZS5A 4XLVA 3I79A 4C61A 1AD5A 4FKTA 2PSQA 3T9IA 3HDMA 4LRJA 5JEBA 2OU7A 3ATTA 4AGCA 2I0YA 1M7QA 3BZ3A 3NNVA 3EFKA 1YWNA 2HZNA 4DCEA 4FX3A 2CN8A 4EJ7A 4IB5A 4BRXA 5BUJA 1M52A 3EN7A 3LW0A 4L68A 5AM6A 4C37A 1I44A 4IFGA 4MXOA 3WZUA 2JIVA 4HVDA 3ORPA 2WGJA 2OXYA 4FOBA 4E73A 4RA5A 3THBA 5K5NA 3C7QA 3KRRA 4YZ9A 3RINA 4FA2A 1IRKA 3FL5A 4ZY4A 3TACA 4PP7A 3I7CA 1FVRA 1GJOA 5HTCA 2PZRA 2XK9A 4HW7A 1XH4A 2GQRA 4Z55A 2GFSA 4GVAA 5HD7A 4C57A 4BDBA 4JBPA 1Q99A 4XUFA 4O7RA 5ACBC 1UU9A 4D28A 3GCQA 4FIHA 4O84A 1FGIA 3TM0A 1M14A 2YCFA 2PVMA 4UWBA 5AX3A 4DFBA 3C5UA 2A2AA 2XUUA 3TTIA 3Q60A 3QALE 1GIJA 5A9UA 5EDPA 1XKKA 4CT2A 1OKWA 5AUZA 1RDQE 3ODYX 1PJKA 4QP7A 3PLAE 3UOJA 2C5OA 3AXWA 5GZ8A 4IX6A 5DEWA 4MBIA 3CC6A 5CVGA 2RG5A 2ZV7A 2BILB 4JT3A 5IEVA 1W0XC 3G15A 2OJGA 5DI1A 4AA5A 3BX5A 2QOIA 4QP1A 4FVRA 2RKUA 4CLJA 3WF5A 5HNGA 2PVNA 4NW6A 3VRYA 2B55A 5BYLA 3M2WA 1PHKA 3FKOA 2C0OA 3NSZA 5CF6A 3GOKA 2VWWA 4RPVA 4OBPA 1KV1A 5AEPA 2Z2WA 3Q2JA 2ETKA 3TIYA 4GJ3A 4F7LA 4QNAA 3E3PA 4DFNA 5HE3A 2O2UA 3FJQE 3ENMA 5CALA 1NVSA 2J4ZA 2R4BA 5CEOA 4F7SA 4FV0A 4ANNA 4GK3A 3UG1A 4DTAA 4EOSA 2XK4A 3D2IA 2Y7JA 4GRBA 5L4QA 1DS5A 1H0WA 4RX8A 4UZDA 4IJPA 3V6RA 4XRJA 2VTAA 4FSZA 3WILA 3O0GA 1M2RA 5GIOE 2FSOX 2BZHB 1U46A 3MY5A 3KVXA 1UA2A 3HMPA 4U44A 4E4LA 2ZV8A 3FI4A 2G1TA 1R39A 4D55A 5M06A 1OKZA 3QTXA 4NU1A 4YJTA 5AIRA 4DLJA 3BCEA 4D4SA 4NIFB 3O2MA 4ZTRA 1G3NA 3C4WA 2WQEA 3O71A 5M51A 5IH4A 2OJIA 2PWLA 4R78A 2OXDA 2XMYA 4FKIA 1Y6BA 1QPJA 4XV9A 4XOZA 2VGPA 2W5BA 1IA8A 4UXQA 2VTNA 3P23A 3ZLWA 5IQGA 1FINA 5H9BA 5CSXA 3D15A 4CSVA 4QP2A 3IONA 4DGGA 4HCUA 3D83A 4Y95A 3S4QA 3U8WA 3NYOA 3DB8A 5ETCA 5K4IA 4U80A 4YR8A 4DFYA 4JG8A 3R7IA 3PJ8A 3CCNA 3NRMA 1TQMA 3NCGA 4BGHA 2ZV2A 4LUDA 4GU9A 2XNNA 2CKQA 2BR1A 1ERKA 2X1NA 4AW1A 4ANQA 5EM6A 1Q3DA 4FTOA 3Q9XA 3PRFA 2BVAA 2BKKA 3KQ7A 4M84A 2WMWA 4JRNA 5TOZA 3RAHA 4AS0A 4EH2A 4JS8A 1PXIA 3O23A 3N51A 4HNFA 3FPQA 4IZ7A 5LMKA 4QD6A 3R1YA 4AOIA 5HLNA 4R7IA 1OPJA 3NS9A 4RJ8A 2BCJA 2WMBA 3O8TA 4FSNA 4BIBA 5C8KA 4EBVA 3F5XA 4HZSA 4YURA 3ORKA 2Q0NA 3Q6WA 4RA4A 3HAMA 4TZRA 5J8IA 3COKA 3HP2A 4R1YA 2ITOA 3DXNA 2O3PA 3ACJA 3D5UA 3KXMA 1Y8GA 2HXQA 4I5MA 4FSYA 4C4IA 3QD3A 5EHOA 1XR1A 2OH0E 3COHA 2BUJA 3NYNA 2C69A 4FZDB 5AUVA 5HTIA 2C5YA 2W1FA 4HGEA 3FL4A 5L8LA 1O9UA 4M12A 5CU2A 4RVLA 4EOMA 2HW7A 5J9ZA 5BQ0A 4O2PA 3ITZA 5M55A 3V6SA 5HU3A 4IC8A 4R77A 3VNTA 5G1XA 4EOJA 1ZY4A 4YPSA 4A7CA 3PZHA 3OUNB 4CCUA 4DBNA 4HPUE 2J0IA 3NNWA 2B9FA 4CFXA 1LR4A 2BFYA 3DAKA 3NIEA 4NSTA 3V3VA 1VZOA 2DS1A 3DBQA 2AC3A 4O6EA 4R3PA 4YO4A 3ZRKA 1Q3WA 2UZLA 1PMUA 2HY0A 2YM3A 4FZ6A 4G3EA 1UU8A 5F1ZA 2QONA 3VF9A 5CVHA 3I7BA 4B0GA 4K18A 4L9IA 1JKSA 4H1MA 5FEQA 1T45A 4E20A 1FBNA 4FEVA 3D7TA 4O0WA 4YTFA 4FSRA 4TT7A 2VNWA 4RVKA 3BV2A 2J50A 3E8EA 3PJCA 2WEVA 1MP8A 3O17A 4K6ZA 5E91A 2GNIA 4L7SA 2BFXA 4BDJA 4D0WA 3W2RA 2J6MA 5IA3A 4OTPA 3TL8A 3EN6A 3A99A 4WT6A 4DGOA 5KMNA 4IQ6A 2JFLA 1P5EA 2X2KA 5LOHA 3R7VA 4CFVA 5IQCA 3HMOA 4ZMEA 3WIGA 1UKIA 4M66A 5IA2A 5JFXA 2R3QA 3LHJA 3KREA 4JBQA 4FEUA 4ZIMA 2XIZA 2UZBA 2GNHA 3FXXA 3II5A 4L8MA 1GOLA 3ZBFA 4Q9ZA 3LMIA 4CRSA 4AP7A 1PW2A 2YWVA 4QMLA 4FKWA 2QO2A 4TW9A 1PXNA 3ZZEA 4QMSA 1CKJA 3R1NA 5DNRA 4O82A 5A3XA 1J7LA 4P2KA 2C3LA 3R8ZA 4PNKA 2UV2A 3IW6A 5K0KA 4L00A 3FZRA 4KIPA 2BDWA 3DNDA 4R1VA 4RIWA 3F82A 3TUBA 3EQDA 3WOWA 4JVGA 4Q9SA 5DRDA 1WMKA 2XRUA 5IQBA 4E4XA 2E9PA 4OBQA 5CEIA 4BIDA 4HCVA 4FIJA 4MNFA 2AC5A 4U41A 4OTDA 3VS7A 4RQKA 3P1AA 3LCOA 4L44A 1M2PA 3VBQA 4ACMA 3CP9A 5IF1A 3L8SA 2ACXA 2BAQA 5L2SA 5DHJA 3HZTA 5H8GA 3PSCA 4WRGA 3KN5A 5LQFA 2JD5A 3U51A 5CU0A 4M69A 2XP2A 4HYUA 4KWPA 3KB7A 4GUBA 4I0RA 5AA9A 5JRQA 3OOGA 5EHLA 3E7VA 4DH8A 3TDWA 3AMBA 4YZMA 5AP4A 5HICA 4FTKA 4NWMA 3BHUA 4EHZA 4LOOA 1CSNA 1ZWSA 2V62A 4CCBA 2BRMA 2Y4IB 2XYNA 2P2HA 3QTWA 3H0ZA 2B7AA 5LMAA 1FVTA 2PL0A 2XB7A 4CT1A 4G3GA 4U6RA 3ZDUA 1ND4A 1SMHA 3VHKA 4QP3A 1H27A 4G3FA 2YCRA 5GJFA 3CEKA 3UO4A 4BGQA 3EFLA 3OBGA 4TKSA 2J7TA 2OJFE 5HORA 2Q83A 3C4XA 3LJ1A 4ITJA 4O0VA 2RSVA 4DFUA 3VBTA 4FL3A 3RHXA 1XBAA 1B38A 4EUUA 2W96B 5CZHA 4A4XA 2J0LA 3L8VA 4WNOA 3A8WA 5IZFA 2X9FA 4AT3A 1RJBA 2HWOA 2IW9A 3R9DA 1PMEA 4IX4A 3FY2A 4U3YA 3FZPA 3SW4A 4O27B 4I21A 4ZY6A 4YSMA 5TKDA 5ICPA 3KN6A 5D7AA 3I5ZA 3CY2A 2F4JA 1O6YA 2WXVA 4EH4A 1Q4LA 3JVRA 5FP5A 3G33A 2CCHA 4F7JA 3UQCA 3BYMA 4BF2A 4RJ4A 4K77A 4KKHA 3E62A 2OIDA 5AR8A 1YXUA 3O8PA 3NW7A 4C33A 3FBVA 5CLPA 3EN4A 3V5WA 4CTBA 3ZTXA 1PXMA 1BMKA 2WB8A 2GNGA 3AT3A 4FIEA 4LGGA 4FL2A 4O7VA 4I0SA 4QYGA 4ZS4A 2CGXA 3AMAA 2I0EA 4MHAA 3RPVA 3VW6A 1M17A 3PUPA 5HIBA 4QTBA 4O81A 2QG7A 4B8LA 2PYWA 2CNUA 4FICA 5IQEA 3C0HA 3DFAA 3HECA 5IDPA 4CNHA 2ZB1A 3KEXA 1UVRA 4JRVA 2BDFA 3B2TA 4L53A 1ZXEA 3R01A 3C1XA 3M1SA 4RJ6A 2QC6A 3QQHA 5EI8A 3SXFA 4F6WA 5LJJA 4DH7A 4R5YA 4FIFA 5F95A 4XG2A 4D2WA 2WTKB 4CQEA 3ROCA 4YU2A 2ZMDA 4Y5QA 4XBUA 3P9JA 4F99A 5K9IA 2CN5A 2X9EA 4D4YA 1XHAA 3KK8A 3HP5A 3QCXA 4PL3A 5D11A 4BI1A 4ZS0A 3MPMA 5E8XA 5DT3A 3DT1A 4CV9A 3OWJA 3PG1A 3QX4A 1S9JA 3VIDA 2F57A 4BCQA 4FKOA 5ANGA 3SXSA 1KE6A 4WRSA 5CU6A 3PE2A 4XV3A 3QAME 2JKKA 5C9CA 3FI2A 3RCDA 3V5JA 3KF7A 3UZTA 1PRYA 4BTMA 3R8PA 1ZYDA 4ANBA 5BVWA 3I4BA 4IIRA 1VYZA 3HA8A 3QGWA 4RIYB 2VTJA 5EYKA 2CKEA 4B99A 5AP1A 4BI0A 4FV9A 4XLIA 4YJSA 3ZO3A 5I4NA 2XYUA 3DK6A 2RIOA 4E4MA 3OOMA 2W05A 3F2RA 4JI9A 4YSJA 4RC4A 4UMPA 3MDYA 2B4SB 4WG5A 2GS6A 3EL7A 3KMWA 1G5SA 5CQWA 5EW9A 4LOPA 3ZDIA 2F9GA 4FR4A 3MY1A 4R3CA 4TWCA 4CKIA 5BNJA 1GZKA 4WSYA 3O96A 3R04A 1J7IA 1WBPA 4A06A 3GCVA 4FV3A 3KRWA 4L6QA 4F4PA 3KULA 3D7TB 2WAJA 3KFAA 2G2IA 2H96A 2VTIA 4IM2A 4P5QA 4ENYA 2W4JA 4QMQA 2VX1A 1E1VA 4YHTA 3HAVA 3RNYA 4H05A 3ORXA 1ZMUA 1JAMA 2XNEA 3CR0A 2QKWB 3OCGA 3FMNA 3R73A 2VX3A 3CXWA 4J53A 2FSMX 3DGKA 5FD2A 4BWXA 2OLCA 4GUEA 4DFLA 3QF9A 2FSLX 5CEMA 3E8NA 4PDOA 4MNEA 1REJA 4FGRA 2JDSA 4O7LA 3I5NA 4JX7A 5IG1A 4FF8A 2ETMA 1OKVA 2W5AA 2VWVA 3EZRA 4L42A 2UVXA 3MV5A 5E90A 3QD2B 4X3FC 3TNIA 3E63A 3JPVA 4AQCA 1H4LA 1JPAA 4K8AA 4EH3A 3ENHA 3QD0A 4YZBA 3O7LD 4YLJA 5BVDA 4BTFA 2VWIA 2IW6A 3VQHA 1FGKA 3BQCA 3MS9A 5T6KA 5L2QA 3TCPA 1NA7A 3L9MA 3ZXZA 3QX2A 3L1SA 1OBGA 3HEGA 2PE2A 3UIBA 4CG8A 3LCDA 3JY9A 5F94A 3QUEA 5CEKA 3QCSA 3NVMB 3NMUF 3GBZA 3FSFA 2QHMA 3LFCA 4NTSA 1KE7A 4N6YA 3TV7A 5JKGA 2CGVA 3SOAA 3GQLA 3H10A 4DTBA 3VBWA 3I81A 2GHLA 2XJ1A 3CQWA 4X7QA 4FE2A 4DEIA 1A9UA 4O7TA 4BZOA 1BX6A 3F5PA 3KL8A 4IZ5A 4YJPA 2PUNA 3QRUA 4HYIA 3LFEA 2FVDA 1WBSA 4G6OA 4J71A 4RLKA 4QMTA 4ZTSA 4E6QA 3R7UA 3WZJA 4BKJA 5EH0A 3MPTA 2GTMA 2JGZA 3OY3A 4QYEA 1PMNA 4UN0C 4YMJA 4DH5A 3RJCA 3A7FA 5DWRA 3OEFX 4GJ2A 3EKKA 3RK7A 3RNIA 4AFEA 4YJRA 2UZUE 4U3ZA 4YTHA 4FNZA 3A7HA 1O6LA 4G5JA 2QNJA 3AGMA 3I6UA 3WBLA 3ZEWA 3FLNC 3OS3A 4AX8A 5LVNA 3KXGA 2G9XA 2PK9A 4IM3A 4ZTLA 4O7ZA 5E4HA 3VS2A 1PXKA 5KO1A 1AQ1A 3JYAA 2QG5A 3PWYA 4BCJA 2WTCA 2CKPA 3MVHA 4U8ZA 4LRMA 1H1WA 4RSSA 1G8AA 5T68A 1JWHA 4YLKA 5BX0A 2CGWA 4QYFA 3ZC5A 5EQPA 3IQ7A 3QRTA 4F1MA 3ZMMA 3EN5A 3ERKA 3FHIA 1H00A 4J8MA 3FLQA 4KRDA 4KS8A 4EI4A 3P4KA 2GHMA 3FWQA 2V7AA 5D9HA 3DK3A 2X0GA 4FZAB 2ZVAA 4NIFA 5D1JA 1ZMWA 2HAKA 4FYNA 3N4VA 4IC7A 5M08A 2UW7A 4NCTA 1CKIA 5AR3A 3BU3A 4YP8A 3TJCA 4D2PA 3R9NA 1REKA 2BRHA 4C8BA 4C7TA 2WMTA 5A4QA 1OZ1A 2XK6A 5LVLA 3PY3A 5AAEA 3QRIA 2X8IA 2RFNA 4CMUA 5HKMA 3FKLA 3IGOA 2CNVA 4EQCA 5AM7A 4Y5HA 5EM8A 3BHVA 1V0PA 2UW9A 4FEQA 5M56A 2GSFA 3LM0A 1KOBA 1OECA 4YBKA 5DPVA 4FTIA 5HVJA 5L6PA 4PL5A 2JDOA 4AE9A 3HMNA 5B7VA 4NTTA 3MB6A 5T3QA 2R3KA 3EYGA 2UZNA 2YJRA 3QQFA 4V0GB 4CQGA 1OIYA 3LJ0A 3R2YA 5DEYA 2GQSA 4Y46A 3R9HA 2XBAA 3ZFXA 2UUEA 2YZAA 1ZLTA 2X39A 4C4JA 1H1QA 3NVKI 1E9HA 3G6HA 3ORTA 3L8PA 2CCIA 2ZM1A 3D9VA 5HOAA 4EOQA 4IVBA 5JFSA 2C6MA 4E8AA 3HVCA 5FLFA 4LFIA 4U40A 2Q0BA 3NNXA 1Y8YA 4QQCA 5CENA 3R9RA 4FOCA 2I1MA 2X4ZA 4Z7GA 4N57A 3CGOA 3G2FA 3DOGA 3BRBA 2QOOA 3BI6A 2WTDA 1SVHA 4QQJA 3ZHPC 4YJUA 1U54A 4FTAA 2YWPA 2VO7A 2XK7A 4EOIA 2XK3A 3HRFA 3VS0A 5J1WA 4F0FA 2DWBA 2VNYA 3LCTA 3ROYA 2VUWA 2PVFA 5B2LA 3OCSA 2ITYA 1DAYA 3MN3A 5TO8A 3V5QA 2ZDTA 4XG3A 3DTCA 3GB2A 3OWLA 4GL9A 4I6BA 3AD4A 4WD5A 1MRYA 3OWPA 3QTSA 5J79A 5FTOA 5EK7A 1H1SA 3H4JA 3DLSA 3MH1A 3UP7A 3QZGA 4HGSA 4LGHA 4M3QA 4BCKA 1YWVA 4GK4A 2OZAA 4Q5EA 2UZOA 2W1EA 5DR9A 5KHXA 3T9TA 4LM5A 3HGKA 3BGQA 3FE3A 3KULB 3OXZA 4EH7A 2I6LA 2R0IA 3HV4A 4YJOA 1Q97A 1VYWA 4ERKA 5IU2A 1IR3A 4FSWA 3VAPA 4E26A 5ANOA 2YM7A 4ZXTA 5I0BA 3DB6A 5CEQA 4O7NA 1WBNA 5L2TA 2O0UA 2FUMA 4FT0A 5HCYA 2V7OA 5H3QA 2ZM4A 3IOKA 3HKOA 3QRJA 1WCCA 4DG2E 4UWYA 5CF8A 2NP8A 3UDBA 4PTGA 5E1SA 2QODA 3Q32A 3RPOA 4IVDA 2EVAA 1H8FA 3Q4TA 4TNDA 3AG9A 4FG7A 4MD9E 4PDPA 4ZOGA 3UNJA 4BHNA 2PUPA 2ZM3A 2WFYA 2O64A 5CXHA 2JBOA 4AN9A 5EDQA 4PF4A 1WFCA 2IVVA 1OPKA 1Y91A 3JS2A 1SZMA 4BB4A 4O96A 4JDIA 2A1AB 1H1RA 2R3RA 2JKOA 4YO6A 5CZIA 4F9WA 5CU3A 5GIPE 4CG9A 3FMMA 3V5PA 4HYHA 4UMQA 4DG0E 4BZNA 1BYGA 4A4OA 2B54A 2IVTA 2ZJWA 5CNNA 3G9LX 3NYXA 4CZYB 4ANLA 3QCYA 3NAXA 2PE0A 4ACGA 4EH6A 3QQKA 2GTNA 4KBKA 3NW6A 2UW8A 4ACCA 4D1SA 3CKWA 4KIKA 4DGLC 2WEIA 1CMKE 3RHKA 4MXXA 3UNZA 3MTFA 4W4VA 3NCZA 1QCFA 4DITA 4G5PA 4IBMA 2ITUA 2WMVA 4FNXA 3E8DA 1CTPE 4AA4A 3E8CA 4XG9A 3F5GA 4KNBA 4MTAA 4D5HA 1BI7A 3C9WA 2C3JA 2A19B 4OTIA 4H3BA 4Z9LA 4E1ZA 3UG2A 1XH5A 3LFQA 4ERWA 5M4CA 4DT9A 3FI8A 3IDCA 4Z7HA 5HEZA 4EOOA 5D41A 3PG3A 4ZJJA 4JDJA 3W18A 1YOMA 4IVCA 3QGYA 3NLBA 4NH1A 4I5PA 1CDKA 2XCHA 4XJ0A 4C58A 4CD0A 3VC4A 2YCQA 3BIZA 3F2AA 3GI3A 4MBLA 5LMKC 2G01A 2WPAA 4JJRA 4P4CA 3LIJA 4WNMA 2IO6A 5H8BA 4ALUA 4BDIA 3EQGA 3ZSIA
chains in the Genus database with same CATH superfamily
4QMMA 4DGMA 5CWZA 2JDVA 3SXRA 1OITA 3UYTA 5ITAA 3EQFA 5LVOA 1NVQA 2XZSA 4BDKA 3BHHA 4I3ZA 4QOXA 4DH3A 1H01A 2PMNX 1OPLA 2QOFA 4YZCA 4YZDA 5KE0A 3P0MA 4P90A 2X2MA 3KF4A 2WHBA 3POOA 4GW8A 5HZNA 2DYLA 4LOQA 4EHVA 5IH5A 2PZYA 4FVQA 4TYHA 3U4UA 5CSHA 4ASEA 3QTRA 3DJ7A 4YUQA 3PP1A 2QU5A 1ZARA 2UW6A 2XNGA 4RGJA 2CJMA 3BBWA 5CI7A 5GNKA 4AN2A 4DEGA 4JQEA 1MUOA 1FQ1B 2BALA 3R30A 4XEYA 3C0IA 4GK2A 4EK4A 5IQAA 1RE8A 2I7QA 3BLAA 4TTHB 4G17A 3WI6A 3P5KA 3UZPA 3QRKA 5C26A 5AP0A 1WBVA 1LEWA 5AUYA 3VS1A 5DRBA 3WF8A 2E9VA 2ITPA 5KHWA 4JDHA 1OL1A 4FL1A 3DS6A 3GENA 1JKKA 2O8YA 2QHNA 3R1SA 1KSWA 5HI2A 5KMIA 5DGZA 4I23A 1ZYLA 1UKHA 4IACA 2YA9A 5K0XA 5IA5A 3TJDA 3QYWA 1TVOA 1FVVA 3PFQA 2ZDUA 3LXNA 4MH7A 2OZOA 4EK8A 3B2WA 4ZTNA 4FVPA 3ZRLA 4DTKA 5IA1A 5FQDC 4I92A 3AKKA 2R3LA 2E9UA 3BQRA 5CYIA 3ZEPA 2R64A 1ST4A 3LCSA 5EYMA 5L6OA 3OP5A 2H9VA 4APCA 4C38A 3SAYA 3W0NA 3PXYA 3Q9ZA 4X2KA 2H34A 3T3UA 5KMMA 2GNLA 3GUBA 4U7ZA 4Z16A 4MWHA 2VTLA 1Q8YA 4JOAA 3KMMA 1MQ4A 4FIGA 3N4TA 2V0DA 4MXAA 3HV3A 1P4OA 3MH3A 2B9HA 1OGUA 3CJGA 3HNGA 2ERKA 4AU8A 4NFNA 4M8TA 3QHRA 3RZBA 4WIHA 3WF7A 1SVEA 3EYHA 4PDYA 3C50A 5DG5A 1H26A 2F2UA 4RZVA 4QQ5A 5IQDA 3RM6A 3DBCA 3DQWA 2VX0A 4MCVA 2OG8A 5FDXA 5J7HA 3K3IA 3F88A 1J1BA 3CTQA 1M7NA 4NT4A 4XH6A 1U54B 4RT7A 3ORIA 5ACKA 4AGWA 5E9EA 4FV8A 3Q9WA 3CKXA 3ALNA 5I3OA 3LFFA 4ZSEA 5IUHA 4NM0A 4RZWA 2AEGA 1YKRA 4IB0A 5JSMA 5JZJA 2QOKA 2P2IA 3PXRA 4QQTA 3ZLSA 3CLYA 1TQPA 4J96A 1YVJA 2UVYA 2W1DA 3CD3A 4RIYA 2BAKA 4EC9A 1OB3A 5LCKA 4AW0A 1PY5A 2REIA 4EOLA 3P86A 5D12A 4JXFA 3AT2A 2C3IB 4LQMA 3WE4A 4ONAA 2OZAB 3BU6A 3W8QA 3P78A 3V04A 2CMWA 4IJ9A 2R3GA 3EH9A 4AGDA 3KRLA 3BE2A 3PVWA 3VO3A 3OEZA 4BBMA 4FNYA 4AZSA 5CTPA 5CSWA 2W06A 5HE2A 3WYYA 3VHEA 4F64A 3LJ2A 5M57A 5J9LA 4MX9A 4L01A 4QP8A 2QU6A 4RWJA 4OBOA 4QTAA 4QMUA 2PZPA 2VTRA 4H3PA 4OTHA 3H9OA 3LCKA 4R7HA 1YOLA 2YDIA 1JKTA 4FODA 2HOGA 4QT1A 5E1EA 4EZ3A 5L8KA 4U42A 4HGLA 5BPYA 1JQHA 4FTUA 5E8TA 1H25A 4F0GA 5LXMA 1UWHA 5C8MA 2R5TA 3F5UA 5AR2A 3SD0A 3KKVA 3DAEA 4EC8A 4QPAA 3QA8A 2OKRA 4XP2A 4OT5A 5AV2A 4IADA 2X8DA 3VUKA 3TXOA 2W1GA 2NRUA 4GMYA 1GIHA 3VUDA 2VTQA 4F9YA 5BYYA 2YZLA 3DU8A 2C3KA 3BWFA 5KCVA 4EH5A 5TT7A 3Q3BA 3BGZA 3OF0A 4XG4A 5AUUA 1Q24A 2UW3A 1KWPA 4UY9A 2YISA 4AG8A 3FYJX 3I0OA 3R2BA 2ONLA 3QQLA 3W0MA 1GZNA 3PIXA 4AW2A 4Y72A 4NJDA 3ZH8A 3LLAA 3F6XA 4M0YA 5ANEA 1YI6A 2F2CB 3UIMA 3PXZA 1XH8A 1ZYCA 2GS2A 3EZVA 3QKMA 3IK3A 3OY1A 4GS6A 4O21A 3MESA 5TE0A 1KE8A 2A0CX 3R71A 1W98A 3S2PA 4ORKA 5EKNA 4JMQA 2VTMA 3PJ2A 2G2FA 5IKWA 3PA3A 4JBOA 3UVRA 4A9SA 3NZ0A 4AZFA 1XH7A 4KIKB 5HNIX 2ETRA 2NPQA 4AGUA 4RC2A 1YQJA 3MIYA 3I1AA 4L3PA 1PYEA 3DTWA 1XBCA 3E93A 4O0XA 4OW8A 4GH2A 5HIDA 2F7EE 4CKRA 4ARKA 5GINE 3FY0A 5EQEA 2P55A 1XO2B 4FV1A 5F20A 4GYIA 5LCJA 4F6UA 4ALWA 4K0YA 5AADA 4FC0A 4F09A 4GU6A 4BY9E 3FQSA 4WOVA 1QL6A 4O7SA 4UALA 5KZ0A 4ASXA 2QQ7A 3D7ZA 5E8SA 1O6KA 2J51A 3LM5A 4IFCA 3UGCA 3AKJA 3IW7A 4RWKA 4PMPA 3C4EA 1ZAOA 1UNGA 5GZ9A 2WIPA 4BCGA 4OGRA 2QOLA 2C6TA 4PX6A 3HA6A 3NW5A 1X8BA 4BTJA 4WHZA 4DFZE 3DKGA 4FTQA 1PXJA 4M0ZA 4X2NA 4BWPA 1RQQA 3HMIA 4X0MA 4A9UA 5EW3A 3OTUA 4ZZMA 3U54A 2XEYA 1R1WA 2BPMA 4D2SA 5A4TA 5HLWA 3VRZA 3TNHA 2JKMA 2QD9A 4YJVA 4Q2AA 2WQBA 3IPHA 3UMWA 3KK9A 4C0TA 2WU7A 4Y8DA 4D9UA 4HVHA 1OVEA 4DEHA 1GZ8A 1H1PA 5L8JA 2WOTA 2YM8A 4I94A 4TYHB 5CX9A 4FT9A 2XKFA 4I5CA 3ZSHA 3RALA 4H58A 3QXPA 4KUJA 4A07A 5AR4A 4F65A 3AC1A 3Q2MA 3OT8A 4EK6A 2ZYBA 1PXLA 3OXIA 1LUFA 3QQGA 1JSTA 2CPKE 2ITNA 4BCFA 4QYHA 2F7ZE 2JIUA 3F3UA 3D94A 1GY3A 3KCKA 3ORZA 1W82A 3GQIA 4YZNA 1BL6A 4FRFA 4GEOA 3ULZA 5IISA 3QKKA 1U5RA 5EOBA 4O83A 2WTJA 3PRIA 3CE3A 3FLSA 4PDSA 3DDQA 4OAVB 4GT4A 5B0XA 3H9RA 5JQ5A 1XH6A 2H8HA 2IG7A 4FUYA 2IZUA 3KXNA 4F63A 4KKGA 2BRBA 2R2PA 4R6VA 4AA0A 3CTJA 3SRVA 4FTLA 3NUAA 3QZFA 1QPEA 3F7ZA 3PXKA 5JFVA 1YXVA 4BDDA 3R8VA 5IA0A 2G15A 2X2LA 2YHVA 3HUCA 3MSSA 3VUIA 4OT6A 3JVSA 3GEQA 3DK7A 4QMWA 1AGWA 4W4XA 3OBJA 4TY1A 4O7YA 2XM9A 4PWNA 4D4RA 5FBNC 5HTBA 2YCSA 5A4EA 4IZAA 4I6HA 3PWDA 3NDMA 3Q4CA 2IZTA 4IAAA 4YHJA 3SVVA 2YDJA 5EW8A 4PTCA 4CFMA 3TZ8A 3FV8A 4FV2A 2XNMA 4V0GA 3PA4A 2R3HA 4PL4A 4G34A 3QYZA 1Q8ZA 4ZMFA 2QO9A 3EJ1A 3A2CA 4YNOA 4D2RA 2JEDA 4OTGA 3U4WA 3VUMA 2XKCA 3TI1A 4C34A 3G9NA 3BPRA 5IMEA 3NR9A 2OFVA 4ZP5A 5AR5A 2XALA 4CGAA 4QP9A 3FXWA 4M7IA 4QPMA 5HLPA 2OW3A 2Y8OA 5EM5A 1HCLA 5CAOA 1H0VA 3KU2A 2YABA 5ETAA 3M42A 3FLYA 2WMAA 3L9LA 5HG9A 2WU6A 3I6WA 5CNOA 3NEWA 3LPBA 3W0OA 2DQ7X 4CTCA 1P14A 4CRLA 3AQVA 3MTLA 2PMOX 4JL9A 4NJ3A 3FC2A 4D2TA 4TL0A 4XG6A 3QC9A 3GVUA 5I9UA 5BVKA 1WVYA 3F3ZA 4FI1A 5I9YA 3BYOA 1YW2A 3QL8A 4XMOA 4OTQA 3UVQA 4I22A 3V5TA 4DN5A 4ZTHA 4RWLA 4R7BA 4IH8A 3VS6A 4IXPA 2VD5A 5DLSA 3FAAA 3FZ1A 5CASA 4AACA 4MUQA 5EI2A 3GC0A 3H0YA 4DAWA 2YFXA 3KCFA 3PSDA 3ZBXA 3DFCB 2WQOA 1YHSA 4DEAA 4HGTA 4MVFA 3V8TA 2YIYA 4G31A 4EKLA 4ZLZA 4W9XA 4MF0A 5AR7A 4PTEA 3NAYA 4CZUA 1Q8TA 3GFWA 2XKEA 2YJSA 5HQ0A 4J7BA 3W32A 2VN9A 2XCKA 1U59A 2YAAA 4FJVA 2B52A 3Q4ZA 5E8WA 3ALOA 3WE8A 4ZZNA 3RVGA 3MYGA 4GFGA 3GC8A 3NGAA 3OTVA 3UIXA 3WF9A 4YTCA 4D1XA 3DZQA 5BVEA 2WELA 4JBVA 3PYYA 4LRKA 5ANDA 3UC3A 4I6QA 4FK6A 5J95A 3UO5A 5IQFA 2PPQA 3MFSA 3R8UA 3CGFA 3W2OA 4UBAA 3TNWA 4M13A 4C3FA 2HELA 2C5XA 5AIKA 3D5XA 4WSQA 2PZIA 5CQUA 4BVUA 1NW1A 1OGYA 3C5IA 3F3TA 2JITA 3F7WA 1OIQA 3QQUA 4R8QA 3O8UA 3LE6A 3U9NA 4IAKA 3KIOC 4BDHA 3A60A 3NFFB 3VS3A 5IEXA 4OTRA 2E2BA 2UW0A 4MQ1A 3TV6A 4BCMA 1CKPA 3HRCA 1F5QA 4NL0A 2W7XA 3GCPA 4II5A 4IMYA 4KSQA 5AP5A 1P2AA 2RL5A 3UPXA 3R28A 3WZDA 5FG8A 3NWWA 5BVNA 4IEBA 4ZAUA 4X6RA 4P7EA 3OT3A 4WUNA 1H08A 4GT3A 5IUGA 1U5QA 3UC4A 3OCBA 1U4DA 4KRCA 1URCA 4LYNA 3CSVA 4EJNA 2J2IB 4A9RA 4NCTC 1YHVA 3PIYA 5A4LA 3GOPA 4LV5A 3CD8A 4ITHA 4O2ZA 5CS6A 2C0TA 4TYGA 5AV3A 4FNWA 2JFMA 2R3PA 2VWZA 3IECA 4UX9A 2X81A 4QMZA 5HO8A 3V8SA 3ZUUA 3CIKA 3ORNA 4FYOA 4PMTA 4I41A 4V05A 2IZRA 2XNOA 5EM7A 3SQQA 3AT4A 1WBOA 2XA4A 3RCJA 3K3JA 4PPBA 4ASDA 2BRGA 3F3VA 3OXTA 4FKJA 1OIRA 3OCTA 4JAJA 4EH8A 2W1HA 3IKAA 3O51A 4WKQA 5LVMA 4AZVA 2PE1A 3TNPC 1Q61A 1WBTA 5KMOA 2R3NA 3DJ6A 3QU0A 3PFYA 2PY3A 3POZA 4IX3A 2EXMA 2XM8A 1LEZA 4J95A 5DBXA 4ZEGA 4M97A 5LWNA 4I4EA 3ZLXA 5M4UA 1Z5MA 4GV1A 1XWSA 2B0QA 1APME 4CVAA 4XNEA 1XJDA 1ZYSA 4YLLA 2BHEA 4BWKA 3GU5A 3R0TA 4E5WA 2OK1A 3KY2A 1RW8A 1Q5KA 1OL6A 2OJJA 2WKMA 3A7JA 3BU5A 4QP4A 3DLZA 5FXRA 3QHWA 4A4LA 4AZWA 5IUIA 3FC1X 2VAGA 3FUPA 3Q04A 4NM5A 4XBRA 4CV8A 3ZC6A 4S33A 2RFSA 4PRJA 4BFMA 3G51A 3DXPA 4EEVA 4EYMA 4EHGA 3LXKA 2VWXA 1M2QA 1R3CA 4ITIA 2VTHA 3ZONA 5DN3A 3ANRA 4NFMA 3R9OA 4FV4A 4UWCA 4ZY5A 2IZSA 3EWHA 4MF1A 2XBJA 5ETFA 2NRYA 1F0QA 3UBDA 1Q41A 4QDEA 3C0GA 1YOJA 2ZAZA 2IN6A 2VTTA 3GU7A 2OSCA 3OVVA 4TWPA 5IPJA 3VW8A 4FKSA 2B9JA 3DBFA 3Q5ZA 2PVHA 4EOKA 4FIIA 4FV7A 5KX8A 3SRVB 2BMCA 2QVSE 3GNIB 4FMQA 1OUKA 4CFWA 3FMLA 3GP0A 4HVIA 2UW5A 2ZV9A 3ZUTA 4J97A 4XP3A 4AUAA 4K33A 1DAWA 4X6QC 2YDKA 5E8YA 5K5XA 4BR3A 4O0SA 1MQBA 5EYDA 3P08A 4LG4A 5M4IA 2HIWA 4UMTA 3W33A 3W2PA 2C6DA 2WMXA 1H24A 3BEGA 5DA3A 2YACA 2RGPA 3AMYA 4RFMA 5BVFA 3BHYA 4L43A 3UIUA 2NNWB 3V51A 2UZDA 2YIXA 3ZU7A 4BCNA 2C0IA 4QNYA 5B2KA 4KBCA 3VUGA 4FZ7A 3QUPA 2Z60A 5HE1A 2HYYA 4N70A 4FTJA 2OF2A 3BYVA 3S0OA 4JG6A 5C27A 5K3YA 4S32A 4QTDA 4FGBA 3TKIA 2QI8A 3BKBA 3QTQA 4JDKA 2UZVA 4YC3A 4YC6A 3RAWA 1UNHA 3WZKA 3TMOA 2QLQA 4GG5A 4O1PA 5HHWA 4BTKA 5AAGA 2IVSA 4EK3A 4CEGA 2HZ0A 2WMSA 4C4EA 3UDTA 3TV4A 3VUHA 2PVJA 2BZKB 3IDBA 3LXPA 1OMWA 4D5KA 3Q96A 4L7FA 4YJQA 4GYGA 4HZRA 4EWHA 2VWBA 2IEWA 3PE1A 2OWBA 1VLRA 5JRSA 2JIIA 1YDTE 3UJGA 2VRXA 4GKHA 2V22A 5JGDA 2C6EA 2XIKA 1IA9A 3D5WA 3ZCLA 1G8SA 3CPCA 1Q8WA 5CEPA 4ZSGA 1MRUA 3SDJA 3DDPA 3LLTA 3SOCA 4DF3A 4OAUC 2EUFB 1W84A 2P4IA 2QOBA 4J98A 3IOPA 4LL0A 5DYJA 5DE2A 4CLIA 5IA4A 2BTRA 3QFVA 4YPDA 5CAPA 3U6IA 5J1VA 3CQEA 3PLSA 4LI5A 5HGIA 5CANA 1XMMA 4FT5A 4O0YA 3FXZA 5HG8A 2P3GX 2IW8A 3KRXA 3K2LA 3MA3A 3E3BX 4RFYA 3UOLA 1IAHA 3JR1A 3V01A 1YXSA 3WIKA 3C13A 3A8XA 4PQNA 5AAFA 5K4JA 4YC8A 4LUEA 3FZSA 3QCQA 3U87A 3BWJA 3MVMA 2QKRA 4NM7A 2GHGA 3W2CA 2WNTA 5AP7A 3HUBA 4C3PA 2XK8A 4UV0A 3W8LA 2PVKA 2Z7SA 5H8EA 3QWJA 3ZXTA 2OBJA 4NM3A 2I40A 2VO3A 2IVUA 3M11A 2Y4IC 3D5VA 5JGAA 2ITVA 3FZTA 3K5VA 2W0JA 4TYEA 4EWQA 3Q52A 2CDZA 3P79A 4YTIA 4QMXA 3VJOA 1OBDA 3LMGA 3GFEA 2FSTX 2QURA 5DIAA 3RP9A 4BN1A 3BELA 3MW1A 3RMFA 3DKFA 4BDCA 2J90A 3TUCA 3AC3A 2W4OA 3P7CA 3UE4A 5J7BA 1PYXA 5JN2A 4FSQA 3UODA 1TFFA 5IH6A 3F69A 3CY3A 4RMZA 4UMUA 1HCKA 3E7OA 1IEPA 3W0PA 1YDRE 2C6LA 4JQ7A 3IS5A 3PJ3A 3RWQA 1ATPE 2BAJA 5HBJA 5GJGA 5D7VA 4F0IA 4PMSA 3W55A 3IW5A 4XG8A 2UVZA 5HVYA 3FZOA 4PY1A 4HOKA 4RJ3A 4RC3A 5FXQA 4EONA 4QO9A 4I6FA 3PA5A 5HBHA 3RTPA 1PKDA 3DZOA 3H9FA 5DT0A 4RX7A 3R7OA 3VBXA 5BVOA 4BHZA 4LMNA 3CTHA 4Y85A 1FOTA 4R3RA 2EXCX 2HK5A 4CMOA 4G9CA 3G0EA 4GIHA 3BE9A 3V8WA 2X6EA 1W8CA 4PMMA 3ATSA 5JQ8A 5E7RA 4JG7A 2ITXA 2C4GA 2ITTA 3QTZA 4Y73A 4EQUA 4I0TA 1ST0A 5KKRB 4IAFA 3QLGA 3W2QA 4G16A 3ZLYA 3ELJA 2QOQA 3CJFA 4F1TA 5I3RA 5HESA 2NO3A 5CF4A 4G6NA 3W0RA 4KD1A 3SGCA 3OC1A 3E92A 3O50A 4BC6A 3HYHA 3TN8A 2EWAA 4ENXA 3EB0A 5KUPA 5E92A 1IASA 1SYKA 2W5HA 4IHPA 4DC2A 2YITA 2XJ0A 4GVJA 3C4CA 4RIXA 4EORA 4PNIA 2ITWA 4UB7A 2VWUA 4IB3A 4UXLA 4WNPA 2WTKC 2XNPA 4X2JA 2X7GA 5HO7A 4QP6A 3UTOA 3LAUA 2GS7A 3BV3A 4OR5A 1SM2A 2H6DA 2B53A 2FO0A 3DV3A 4HPTE 4RFZA 2OIBA 3PJ1A 2QOHA 3BLHA 2C68A 3UVPA 3NX8A 3HV6A 3R7EA 3UO6A 3AC5A 4D9TA 4D0XA 4X21A 3R00A 4ZSJA 5I5ZA 2XANA 3TDVA 3A4PA 4D58A 2GU8A 3DPKA 3QTIA 4IW0A 1TQIA 2LAVA 2P33A 5BMMA 4KB8A 1DI9A 4KIQA 2PVYA 2VV9A 1VJYA 4WO5A 1YXTA 3D14A 5EDRA 2EXEA 1BUHA 1J1CA 1H07A 4RLLA 4AZTA 3LOKA 1YI4A 1JNKA 2OO8X 2OXXA 4QYYA 4W8DA 4FSMA 4K11A 4KINA 1PMVA 4EYJA 3AD5A 3MH0A 3FHRA 4DCAA 3K5UA 4RJ7A 3K54A 1ZZLA 4O0RA 1XH9A 4TN6A 5FXSA 2O63A 4F7NA 4XG7A 5FTQA 4X3FB 1T46A 3WARA 1FMKA 3ID6C 3DAJA 2A98A 4XV1A 5M44A 2VTSA 4KBAA 3WYXA 1VEBA 4AT4A 1JVPP 3LFBA 4B8MA 4ID7A 3PPZA 4C36A 1IAJA 2R3OA 5G6VA 2SRCA 3FLWA 5CSVA 1KV2A 4ZTQA 1R78A 3MJ1A 2KTYA 4QMNA 4USEA 3IGGA 1XBBA 4UEUA 3EQIA 5KZIA 4H36A 2C5NA 2R7IA 4ALVA 4DHFA 5M07A 2QR7A 2A27A 1W7HA 5I9WA 3EIDA 3TWJA 4ACHA 4LDTA 3ORLA 4GIIA 5DMZA 4FG9A 5AA8A 1R0PA 3VF8A 3Q53A 3G90X 4FEWA 5BUIA 1URWA 2OFUA 3I60A 4GG7A 3OD6X 2YLEA 4FUXA 4M67A 4DFXE 3HMMA 1L8TA 3GU8A 4PV0A 2IJMA 2BZIB 4C4GA 5I9VA 4JX3A 1GZOA 1WAKA 3S1HA 3RPYA 2HW6A 4C62A 2J9MA 4J52A 4AF3A 3FEGA 2ONLC 5AP2A 4CXAA 2Z7RA 4L3JA 4WG3A 3RWPA 3H3CA 5HBEA 3FKNA 3NUPA 4IAIA 4JR3A 2W1IA 4TYIA 3FQEA 4XP0A 3SX9A 3LVPA 1SNUA 2BROA 4Y83A 2CSNA 3MPAA 4FTMA 4AOJA 5GJDA 2YERA 2C5VA 4WA9A 4D4VA 4BDGA 4GT5A 4BDAA 2ZB0A 5A46A 2ZFYA 4QMYA 4JIKA 3S95A 2Y9QA 4MEDA 3B8QA 3NYVA 4BJJA 5H2UA 3KVWA 5J87A 5BUEA 5DOSA 4G2FA 5FDPA 2PULA 4EQMA 1OIUA 3T3VA 1UV5A 3SA0A 4XX9A 5FUTA 4UZHA 4L67A 4O0UA 2CKOA 4ZJVA 3OZ6A 1ZOGA 5DFPA 4DEDA 5KMJA 2LGCA 1ZOHA 4V01A 2GCDA 4FZFB 1UWJA 3PY0A 3LFSA 2Y6OA 2WZJA 2O65A 3BYSA 2AUHA 3C4FA 4KKEA 2R0UA 4HVSA 5HVKA 4OLIA 4YBJA 4YJNA 1NT2A 3MH2A 3P5JC 3ODZX 4IWPA 4DGNA 3VS4A 3KXHA 4ACDA 3QTUA 5FM2A 2HY81 5IQHA 5LARA 2R3FA 1GIIA 2CGUA 3GCSA 2F49A 2R7BA 4JAIA 2B1PA 4R5SA 3ZFYA 4FSTA 4EOPA 4ZSAA 4ANMA 1Q62A 2X8EA 1JOWB 4G9RA 2JAVA 3C51A 3MFTA 3UYSA 1IG1A 3SKCA 2FB8A 4B4LA 5HU9A 5EI6A 3FSKA 4AXEA 3A7IA 4BL1A 4G1WA 3S3IA 1EH4A 2ERZE 4XHKB 4GFOA 2GDOA 4X3JA 2OJ9A 2QCSA 3PVGA 4AAAA 4AXCA 5GHVA 4O4BB 1ZYJA 4BCPA 4F1OA 3BL9A 5CF5A 1LP4A 1WBWA 4J1RA 4AT5A 5LVPA 5M53A 5HD4A 3KMUA 1PXPA 3LQ8A 3PP0A 4E6DA 3SLSA 3BGPA 5KBQA 3IW4A 4E3CA 2CNQA 2BIYA 2C1AA 4GCJA 1Q8UA 2QR8A 2JKQA 4M68A 3TT0A 2W9FB 4U97A 5HG7A 3RAKA 2PUIA 2E9OA 3EKNA 4FKQA 4HVGA 4DH1A 3QZHA 2ESMA 3AC8A 3PVUA 4MD8E 5TF9A 4BICA 1OL7A 3HDNA 2J0MB 3FI3A 1CM8A 3R7GA 2FH9A 3C4ZA 3TZ7A 5FEDA 4WG4A 3VBYA 1QPDA 4D1ZA 2C6IA 4RVTA 4AW5A 5AV4A 4FKGA 1A48A 3PPKA 2YM6A 3W16A 3DKCA 5DVRA 1VR2A 3RAIA 1PF8A 4U43A 3EOCA 1GNGA 1P4FA 3CBLA 4ZJIA 1GAGA 5HG5A 3VJNA 3B8RA 4BCOA 5JFWA 2GNJA 4M15A 4RG0A 4Z3VA 5HX6A 4QPSA 2WO6A 4XRLA 5TR6A 4FKPA 2YLFA 5M09A 4BKYA 3UNKA 4RIXB 3U55A 4AN3A 3MVJA 4F9BA 1F3MC 5J5SA 3PDTA 2EB3A 2GFCA 2HXLA 5AUWA 1W83A 3TG1A 3KXZA 4LV8A 4I5HA 2C47A 3BBTB 4BDEA 3COMA 2X0OA 3EQHA 3GCUA 4O91A 2YIQA 2WMRA 4AXAA 1K3AA 4FV5A 5CVFA 2HENA 2WQMA 4S31A 2Y0AA 4GSBA 3FPMA 4FT3A 5BYZA 4TYJA 1J7UA 1YHWA 4MKCA 5L6WL 4KA3A 4L45A 4WNKA 1V0BA 2IWIA 2YM5A 2RF9A 5AP6A 3QBNA 4NKAA 5CT7A 3WZEA 2OI4X 3LMHA 2RG6A 4MQ2A 3HL7A 5AMNA 4F6SA 5M4FA 5IQIA 1WVXA 4TRLA 4FV6A 5KMKA 3GT8A 3AOXA 3JY0A 4RWIA 5FM3A 1SVGA 2F7XE 1JBPE 3F3WA 4IVAA 2R9SA 4CYIA 5J5TA 3PPJA 5HO6A 2OICA 3W0SA 3VN9A 3KXXA 1L3RE 2VGOA 4O4CA 2VZ6A 4EKKA 4DE4A 3GXLA 3TUDA 3QD4A 4Q5HA 5AJQA 3A7GA 4PP9A 3VVHA 2QLUA 4D2VA 4F9CA 4YGAA 4PUZA 4FKVA 4NUSA 4JIAA 4WBOA 4WUAA 2UZTA 3G6GA 3TZMA 4TWNA 3ZO1A 1BL7A 4BGGA 3S00A 4ANOA 2VO6A 3ACKA 2RFDA 3MFUA 4ZZOA 4IWOA 2PMLX 5JGBA 3R6XA 3NPCA 5CAVA 3N9XA 3MGYA 1SNXA 2WMQA 2XIRA 4E7WA 3R22A 3MVLA 4O1OA 1WVWA 2HZIA 1OKYA 3D2KA 3BYUA 3UQGA 3ZM9A 2WQNA 3KA0A 1LPUA 4JR7A 4WBBB 2OGVA 3Q6UA 1J3HA 3TIZA 3JUHA 3WF6A 1BKXA 2XEZA 1YDSE 4B9DA 2R3IA 2PVLA 3PY1A 3Q4UA 3QZIA 5HNBA 1H28A 4E6AA 3NIZA 2CLXA 5C4LA 4BI2A 3QXOA 3EFJA 3R7YA 3L9NA 3REPA 3L8XA 3DBEA 2JLDA 2X7OA 2XKDA 3HLLA 3VWAA 5BMSA 3MB7A 3MIAA 3EFWA 1I09A 4U5JA 1Z57A 2PUUA 4QRCA 2JAMA 4O38A 3LQ5A 4C35A 4J8NA 2GQGA 3AC2A 4USDA 4N6ZA 4BBEA 4BJJB 4BIEA 2HWPA 1DM2A 3CQUA 3ML1A 5BV3A 3MWUA 3BHTA 3PTGA 3VULA 4BCIA 4L46A 3UQFA 4E4NA 3AD6A 4RQVA 4FEXA 3E64A 4FKUA 5AX9A 5EFQA 4E6CA 3MY0A 2ZOQA 3LFAA 3PIZA 4NK9A 3DBDA 4A9YA 2BKZA 4CFNA 3L9PA 5CAQA 4IDVA 2RFEA 3DXQA 4O7WA 2OF4A 3GU4A 3NUNA 4FTRA 3RM7A 2C6KA 2YN8A 1B6CB 3R1QA 4O22A 3ANQA 5KKRC 5A14A 4MBJA 1OL5A 5AFVA 5AV0A 1S9IA 3SHEA 3UPZA 2W1ZA 4FTCA 4OTWA 4YNEA 3W1FA 4LV7A 2JBPA 3PZEA 3R63A 4KAOA 4U9AA 4XYFA 3QLFA 3TKHA 3SC1A 4O6LA 4UMRA 1PKGA