3MDYA

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
320
Chain Sequence
ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFIPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/isomerase
molecule keywords Bone morphogenetic protein receptor type-1B
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
total genus 107
structure length 320
sequence length 329
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
A PF08515 TGF_beta_GS Transforming growth factor beta type I GS-motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mdyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mdyA01
3EQBA 5E92A 4ENXA 3QTQA 4QYHA 4CKJA 2VWWA 2F57A 4TWPA 1U4DA 2J0JA 3PVGA 3PWYA 4IEBA 2B53A 3N4UA 1NW1A 3AQVA 2IW9A 3ZDIA 2JKMA 4IVAA 2FSLX 3KCKA 3JUHA 5E8XA 5EI2A 5AUWA 4CCBA 4CNHA 3UNKA 1RW8A 3R7EA 4TYIA 4W4WA 4C2VA 5C8NA 1OKYA 5HBHA 4WRSA 2PUPA 4O81A 4XP0A 3VBQA 4DEIA 2BILB 3PJ2A 3UIBA 3RPYA 4PNIA 1P5EA 3EQRA 3A7IA 2PY3A 4U6RA 4CZYB 5C1QB 3MVJA 2GNGA 4XCUA 3V5JA 3V5WA 3BWFA 4CLIA 4F0IA 2JDOA 2X4ZA 4Z7HA 2VN9A 3Q96A 3QHWA 3ZDUA 1GIIA 1KE5A 2UZEA 2HZIA 4AU8A 4OTQA 3F6XA 4U45A 1H27A 5L2QA 4I4EA 3CJGA 4E3CA 3NSZA 4GT3A 5HD7A 4XG2A 3RAWA 5HCYA 3JVSA 3W16A 1JPAA 5F94A 3WILA 4XNEA 2B1PA 4EWHA 4LFIA 3KU2A 4D2PA 1IAJA 2QLQA 3LCOA 4IDVA 4XG9A 4AZVA 5J5TA 2BHHA 4NM0A 4LG4A 4EWQA 4F4PA 4JAIA 4X2KA 4F9WA 3FMNA 4LUEA 4YSJA 4Z7GA 3QCSA 3TNQB 1AQ1A 2QOHA 1OUKA 2QI8A 2G1TA 2WAJA 4G9RA 3EZRA 4QP7A 4FIIA 3V51A 3ZONA 3LCKA 2HXLA 2YEXA 3PXZA 4RWLA 2BROA 3C9WA 3ZRKA 5C4LA 2HELA 4FOCA 5DT0A 5GIOE 5HNBA 3GXLA 3E62A 4R77A 5M44A 4HJOA 4V05A 4E4NA 4RLLA 2CNUA 3RNIA 2XCHA 1OBDA 1K9AA 4MD8E 4JG8A 2P0CA 4FIHA 1O6LA 5AA8A 2OG8A 3FZRA 5JH6A 5J1WA 3HP2A 1JBPE 3E5AA 3TV7A 4DH8A 4Q9SA 5H9BA 2Z8CA 4YC8A 4K77A 1G8AA 4DT8A 3DAJA 4JVGA 3TDWA 4JIKA 5ANKA 4F1MA 4U8ZA 3D9VA 3MVMA 3NPCA 2R3RA 3P9JA 3R71A 4XV3A 5I9ZA 4RVMA 4YO4A 3QD2B 2JBPA 5EKOA 2XIXA 4X3FC 3UIXA 3II5A 1JSUA 3HV5A 3G0EA 3MB7A 3MTFA 3FC2A 3H9OA 4DA5A 2VTNA 2ZMCA 4D1XA 4OTPA 5CEOA 3F2RA 1PXLA 2VTTA 3R63A 4JNWA 1PF8A 4BDGA 3A4PA 1XH5A 4EOSA 4RC2A 4OBQA 4IAFA 5H2UA 2R3NA 4BYJA 3GU8A 5F20A 5FGKA 4Z3VA 3VJNA 3SLSA 5BVEA 2UW7A 4FV8A 2QOOA 4O7WA 3BGZA 3V8TA 4W4VA 5AJQA 2IZRA 5BQ0A 5DMZA 1KUTA 1V0PA 3DLZA 4K0YA 3ROYA 2GDOA 4A06A 1QPEA 1YHWA 5LWMA 4R7HA 2UZLA 1W7HA 3GU5A 3FZSA 2ITYA 3VNTA 5KE0A 2W5BA 2CGWA 2OZAB 2VWBA 3QTSA 5AX9A 5H8EA 4RZVA 5K3YA 4QQCA 2HXQA 4EH4A 4EI4A 4YU2A 4IZAA 3WE4A 4BDEA 4ZLYA 5IH4A 3EWHA 4O0UA 3G15A 1M2QA 2WGJA 2ZJWA 4L68A 4NEUA 4ASEA 4FSNA 5CVFA 4F63A 4L42A 4O86A 2GCDA 3VBYA 4F1TA 2WTWA 2EVAA 3FKNA 4BCMA 1J7UA 1OPLA 5E90A 5CQUA 5AP2A 4E73A 4F08A 3EFJA 3G33A 1JOWB 2OIQA 4BWKA 3FWQA 3G0FA 5CY3A 3TZ7A 1YWNA 2YM4A 1R39A 4FTRA 3QF9A 4WNMA 3SW7A 2XKCA 4RIXA 3U6JA 4BGQA 1SVEA 3WF6A 3GNIB 3DGKA 4NK9A 3PVUA 4JQ7A 2YIRA 4O6EA 3UZPA 2CN5A 5IQEA 4JJRA 2WQBA 3ENHA 4W4YA 4DFLA 5GJFA 2C5OA 4UMUA 4G34A 3OXIA 2VWUA 1QL6A 3QX4A 3RBWA 3AC5A 3UIMA 3CTQA 3CXWA 3CS9A 4FVQA 4AZEA 4CCUA 2CCHA 1XH4A 1OPKA 3VBWA 1QPJA 4XG6A 3OUKA 1Q97A 4FV9A 4ZTRA 4ZJIA 5I4NA 3I0QA 4HPTE 4XOZA 4ZIMA 5FBOA 2VNWA 2E9NA 3W8LA 4AA0A 4DTKA 3PJ8A 2YIXA 4QYFA 4YLJA 3I4BA 3DK6A 3BQCA 1BL7A 5FXQA 2UW9A 1YDRE 1YI4A 1UU7A 1YDSE 2CN8A 3QGYA 1YOJA 2WTKB 5LVMA 5JQ8A 5DWRA 5EYCA 1Q3DA 4PMMA 3HRCA 5C03A 5BVFA 2YCQA 5HESA 3NWWA 2QURA 4IAAA 4EK3A 2W5AA 3NYVA 4RIOA 2R3IA 5DEYA 1H25A 2WMAA 2H96A 2QOKA 3QGWA 4RIWA 4XP2A 2HZ4A 4C58A 1JKLA 2E9VA 5EQEA 1PYXA 2IVUA 1J1BA 4FIGA 5DT4A 4B6LA 4HPUE 4MYGA 5CNOA 2O64A 4ALWA 5HU9A 4OTWA 3Q4CA 4JOAA 4LRKA 3F2AA 3MH0A 4W8DA 1W8CA 2IVTA 2WZJA 3LCTA 4FKUA 3TNWA 3CBLA 4O6LA 1PKGA 2B7AA 4RQVA 4AZFA 3Q52A 4RRVA 3BKBA 1WCCA 1Q99A 2XZSA 5C01A 3QD0A 5B7VA 3VS7A 2YAAA 3E87A 5BYZA 4QMUA 4YUQA 3ELJA 4PV0A 4FIJA 4UEUA 3VUIA 3G2FA 3DBFA 3MIYA 1UWHA 2YM7A 5BUIA 2DUVA 4P7EA 3NUUA 1KOAA 4ITIA 4IX6A 2PYWA 4NIFA 3LOKA 5M06A 4GG7A 3Q9YA 1YWVA 3P86A 4IJPA 1M7NA 3P78A 5DT3A 5JK3A 2A1AB 5M4IA 3CGOA 5D11A 5EQYA 3QA8A 1ZOEA 1FVVA 4FTLA 1M17A 4B99A 5L2WA 1ZARA 2R0UA 3NW6A 3PP1A 3EL8A 3RMFA 3U9NA 3F7WA 3QC4A 4IW0A 4ASDA 2RL5A 3IDCA 4LRMA 5K4IA 3CY2A 5ICPA 4FT7A 4E6AA 1OKZA 5EW8A 4JRVA 2Z02A 4LOQA 4KABA 4KBKA 2PVRA 5CYIA 1OZ1A 2R64A 4RIXB 1IAHA 4WRGA 3UO5A 3FMDA 5DVRA 4B9DA 5KMLA 2XUUA 4TWOA 4XOYA 1F5QA 3ZHPC 5M4UA 4CD0A 1B38A 2OXDA 2REIA 4S30A 1WBWA 1ZYCA 1OBGA 3MFRA 4D2WA 3SQQA 2BTSA 1KV1A 3FMJA 4R3RA 4X3FB 2XNOA 3HV6A 3N4VA 2QKWB 3JY9A 3UOKA 3T8OA 3ZSIA 2OJGA 3WIKA 3PSBA 1ZMVA 2O3PA 2QO2A 3ETAA 4QTCA 4G3CA 4AP7A 1V1KA 4C36A 3NYOA 3PUPA 4ZY4A 1OKWA 3H3CA 2XP2A 3OTVA 3W33A 1YXTA 4CFVA 2Z7LA 2VTPA 5TT7A 4FSUA 4BKYA 4OTDA 5IEXA 4U97A 3TV6A 2Q0NA 2WB8A 3VS0A 4QP2A 3CTHA 4EOPA 1YI3A 5IUGA 5IQFA 4AN2A 4F9BA 3EN6A 2HZ0A 2X2LA 4RIWB 4H39A 3UJGA 3H0YA 3Q60A 4AT4A 4FV4A 5HG5A 2XVDA 4GRBA 4ZZMA 4BKZA 4X2FA 4E5BA 2BDFA 3FE3A 4BDJA 2CSNA 2F9GA 3LMGA 4G3DA 3NNXA 4GJ2A 4J71A 3TZ8A 3NR9A 3RWPA 4WA9A 3GB2A 1J3HA 2VU3A 4LL5A 3BBWA 3MDYA 2PU8A 2J4ZA 4WNOA 3MPAA 3FI2A 3FI4A 1W82A 1XQZA 2BDJA 5J7HA 4FE2A 2WTVA 3SD0A 3W2SA 3T3UA 5CANA 5IA4A 2GFSA 1F3MC 1P2AA 4OTHA 5CTPA 3QQKA 4JL9A 1REKA 1IG1A 4O7NA 4O27B 4FC0A 4GYGA 4FVRA 5M4CA 3LPBA 2Q83A 4MXZA 4QP6A 4FIFA 5EH0A 4PL4A 5HBEA 2WO6A 3LFAA 1OVEA 4FZ7A 3VS4A 4FV2A 4P5ZA 1A06A 2BUJA 3SC1A 5H3QA 4AW5A 4FEXA 2GQGA 3EL7A 3S4QA 5HIEA 3WF8A 3VHKA 4QP4A 3FSKA 3FZPA 2XNBA 4ZS0A 3O8TA 3PXYA 3D5WA 5IQAA 1XWSA 3D15A 2BTRA 2DQ7X 1PXJA 3IW8A 4YR8A 2ITWA 3TTJA 3FKLA 4FK3A 4IFGA 4PTGA 4H58A 3VHEA 4A9RA 2X9EA 3PZHA 3A7GA 1Q8UA 1KV2A 5KO1A 4F64A 4NKSA 4TYHB 1S9IA 1XR1A 3BELA 3OP5A 3LQ8A 1T45A 3R73A 1YOMA 1B6CB 5FM3A 4RJ8A 3TN8A 4C2WA 3OWLA 3HV3A 4D1SA 4RFZA 3A8WA 4ANQA 3RM7A 5CAPA 2W1FA 3W32A 1JWHA 4U43A 2GNJA 4DAWA 1Q61A 5HCXA 4YNEA 4M67A 2C5NA 2VTQA 4O0RA 4TT7A 5H8GA 5CSPA 2BZIB 3R22A 4M69A 4CYJA 1WVXA 4AQCA 4KRCA 3RCDA 3QQGA 2W5HA 4BDFA 4E6QA 3C7QA 3DXNA 4HNIA 3A2CA 1IRKA 5EM6A 3KK8A 4XLIA 1H4LA 4GW8A 4USDA 2BIKB 4YJPA 3V5TA 2ITXA 3HMNA 3UP7A 3EN5A 5CXZA 3MA3A 3DLSA 3BWJA 3CE3A 2HK5A 1H24A 2PSQA 5AP6A 3H9RA 4O0VA 5EOBA 2PZIA 3F9NA 3PLSA 1S9JA 3BCEA 1LR4A 4ZSGA 3GP0A 4PRJA 1Q24A 5HTIA 3ZFXA 4PQNA 4ACGA 4CRLA 3VWAA 3R00A 3VUMA 4PNKA 4YBJA 2WELA 2YIQA 4RIYA 5AR8A 3KN5A 2O0UA 4UMQA 4QMNA 3HV7A 4OAVB 4NT4A 2F7EE 2QO7A 2PZRA 5FTOA 3OT3A 3ZXTA 4EOLA 5GIPE 3VRZA 3KMWA 5JN2A 1UU8A 3ANQA 4AW1A 5GINE 2UW4A 3PY3A 2CNVA 3LFFA 3LJ2A 3MSSA 3CPBA 5M51A 2C0IA 3LM5A 3WARA 4I23A 3GI3A 4CFMA 2X8DA 2X2MA 3S00A 4FGRA 5AAEA 5M57A 3UBDA 3DAKA 2KULA 4ASZA 1OIQA 4MWIA 2BHEA 3U55A 3FLNC 3QYZA 5AM7A 3N51A 3R8PA 5I3RA 3QRUA 3VULA 3W18A 1K2PA 3AD4A 3FPMA 5IH5A 2PVYA 1FBNA 3QZFA 4APPA 3C0GA 5EM8A 2G01A 5ANIA 3NCGA 3PE1A 4TTHB 5B0XA 3ORLA 5EFQA 2OW3A 3OTUA 5AM6A 4FV6A 1Y57A 4RBLA 1LEWA 5T3QA 3S1HA 2Y8OA 2PMNX 5BVKA 3F5GA 3QTXA 3NVMB 3F3UA 4YJRA 2C3KA 2O8YA 4U40A 4D4VA 3GC0A 4EOIA 5D1JA 3UZRA 2I7QA 4M15A 2R7BA 5EM7A 4ZOGA 3HUBA 5C8MA 2UVYA 4KA3A 4FEWA 3KRXA 2XKDA 3FYKX 3Q04A 4FL3A 4ZTQA 4TWCA 3QKLA 3Q4ZA 3B2WA 3ID6C 3AOXA 2XK6A 4ZZNA 1ZYLA 3NW5A 3UOJA 4HZRA 5AP4A 3R2BA 3PJCA 2W1ZA 3CP9A 3MIAA 4D5KA 4X2JA 4E6CA 2YZAA 1PXNA 2OF4A 2VTRA 4O1PA 5BX0A 3L9LA 4FTQA 2JD5A 3FXZA 3W55A 4BB4A 1ATPE 1V0BA 3CTJA 2EXCX 1A48A 3HECA 3TUBA 3CGFA 3R1YA 4BI2A 3COMA 3ODYX 3EQCA 4FZAB 4G31A 4QMTA 4D4YA 4C4JA 2ETKA 4YJQA 3DBCA 4IANA 3IO7A 2FYSA 5L6WL 3MFUA 3R2YA 5LMBA 4KAOA 4WKQA 4HOKA 3CIKA 2VWZA 3K5UA 4JAJA 5HEZA 4DTAA 3CC6A 2YDIA 3OBJA 1AGWA 4PL3A 4AW2A 4O7VA 4O0TA 2WIHA 4P2KA 4DH3A 2RFEA 1URWA 5AV3A 2J6MA 3R9OA 3V8WA 4K1BA 2Y7JA 4V0GA 1UA2A 4YPSA 5G1XA 3I0OA 4BWPA 4RLKA 4APCA 5HVYA 4M66A 5AAFA 3AC1A 4DGMA 4AE9A 5KHWA 4IZYA 4HCUA 3K3IA 2BRMA 1OITA 4I5HA 2X6EA 4RA5A 2R3FA 2YM8A 4ACMA 5BMSA 4CFNA 1W84A 3VO3A 3JS2A 2UZVA 5A14A 3CY3A 3MWUA 3BHUA 3SV0A 4IAZA 3ATTA 5AR7A 1J7IA 2I0YA 2OXXA 3C4CA 5HX8A 3QUPA 3E92A 4GG5A 1OM1A 2B9FA 3ROCA 4BTFA 5LVNA 4BVUA 1UU3A 3E88A 4TN6A 1H07A 4I4FA 5EG3A 2XNMA 4DGGA 4KKGA 2OI4X 5CALA 1LUFA 3ACKA 5AV2A 4AUAA 3L8VA 2G2IA 4FV3A 3BZ3A 3BHTA 4I94A 5L6PA 4H3BA 2PPQA 2GPHA 4XH6A 4EBVA 3P1AA 3E8NA 2H9VA 2WMSA 3TTIA 2ITZA 3V6SA 1H1RA 2YCRA 4O2PA 4F0FA 3FMMA 2X7GA 2NO3A 2OKRA 2YCSA 4EL9A 2OU7A 1PMNA 4XX9A 3UOHA 2I1MA 2JKOA 2ITOA 4D4SA 2F2CB 3QCYA 4H1MA 1SYKA 4L67A 4IM0A 5J8IA 3RAHA 1YWRA 2V5QA 2JLDA 4NYEA 2XKFA 2OGVA 1YDTE 1H8FA 4HYHA 5IUIA 2ESMA 2GHLA 4NH1A 5HI2A 3GOKA 1XH7A 2ITUA 2HZNA 2VO6A 2H8HA 4Y72A 4BI1A 3NUSA 3LFEA 4RSSA 4RX8A 5AR5A 4PMPA 3TWJA 3FV8A 5ANJA 5AFVA 1WBOA 2Y6MA 1VJYA 2PMLX 2WTDA 4OTIA 5E9EA 3IONA 3QHRA 1Q4LA 4J97A 3LFCA 3HDMA 3S95A 4XG8A 3QQJA 3NNWA 4WSYA 2WMRA 3ET7A 4U7ZA 3I6WA 3JYAA 5A9UA 3NUAA 5D9HA 5E7RA 3PA5A 2OBJA 5AUYA 5HLNA 2W1EA 3D5XA 4FT9A 3OZ6A 4ZAUA 1KOBA 4Y95A 3OUNB 4IACA 4EZ5A 3R7VA 4MTAA 3UVQA 2WXVA 4L7SA 3UO4A 3DCVA 2YFXA 3ZO3A 5LJJA 3KCFA 5GNKA 5EK7A 2PVKA 3ZZEA 3IGOA 3LJ0A 3QXPA 2BMCA 3ZO2A 3ZU7A 4C0TA 4AOTA 4E5WA 5BNJA 3MFTA 4ANLA 2C3IB 4MK0A 4RC3A 3ZLXA 3NZ0A 3RCJA 2DS1A 1ZYDA 4GUBA 2JEDA 4GCJA 4I5CA 4QQJA 3KVWA 4NTSA 4AA4A 4IWPA 4TPTA 4BDHA 4CMOA 4CV9A 4I22A 4KIKB 3I5ZA 1RE8A 2VZ6A 3DJ6A 3ORIA 1XKKA 3Q4UA 4M68A 4R1VA 2X9FA 4V0GB 2PZ5A 4CTCA 2R5TA 1UNGA 4BZOA 2CHLA 4HVGA 1PHKA 4FV5A 2C68A 4J7BA 2QONA 3IW7A 3PIXA 5IQDA 4C4IA 4FKJA 1ZZLA 5CQWA 5A3XA 3CSVA 4LI5A 5FEEA 4CFFA 3U9CA 5AUXA 2UZUE 2UW6A 4UWBA 3LCDA 5DPVA 2C0OA 3MV5A 4UZHA 1PY5A 5E4HA 5HTCA 1ZAOA 2OJJA 4FNZA 4MF0A 4Y46A 5CU2A 1CKJA 3P79A 4EH8A 2YDJA 3SOCA 3DJ7A 2YLFA 3EKKA 3RNYA 3ZUTA 4QMWA 4GFMA 1ZMWA 4UXQA 4FF8A 5IA0A 1Y6BA 1OUYA 4IWQA 5AAGA 3U8WA 4E26A 3KF4A 3QCXA 4XG4A 4ACDA 4EZ3A 3Q2JA 4JBQA 2XCKA 2XEYA 4O96A 5LCKA 4L8MA 2RFSA 5LWNA 4WBOA 4X6RA 4AS0A 1ZXEA 4F70A 2YJRA 3ANRA 4Z55A 2AUHA 3DXPA 2OIBA 5J79A 3K2LA 1WVYA 3E93A 4D28A 4FKLA 3NNVA 3ZTXA 2XRWA 3IOKA 2J5FA 4IX5A 1JLUE 2W7XA 4JBVA 3BPRA 3RJCA 5JSMA 3SXRA 2QR7A 2OICA 4E7WA 3FEGA 5J9ZA 1O9UA 2BZKB 4M3QA 1LEZA 3ZSGA 5J5SA 4EK8A 3MH1A 1WBNA 1OMWA 2XJ2A 1JSTA 3PRFA 3B2TA 5A6NA 1F0QA 5C8KA 5AV4A 1GIJA 2EU9A 4NZWB 3QTIA 4QP1A 4AGCA 2W05A 2P4IA 2Y0AA 5D41A 4IE9A 4YZNA 4FL1A 4M14A 4M0YA 3Q5IA 4MQ2A 1SNUA 1R0EA 4AAAA 4C62A 4LMUA 4KRDA 5F95A 4HCTA 5KZ0A 5HNIX 1OIUA 1IASA 4G9CA 4CGAA 1Q41A 3I79A 5EKNA 3C1XA 3BGQA 2RG6A 2QD9A 4EH6A 3KY2A 4BBEA 3Q9XA 3BEGA 3RPSA 4J1RA 2ETMA 3FLQA 2W1DA 2Z7SA 4CFWA 4N57A 2OK1A 1T46A 3ULIA 4ITHA 4FT3A 2QCSA 4X6QC 2C5XA 3F3ZA 1OL1A 4RVTA 4IIRA 5BMMA 3K54A 4YTCA 3SVVA 3LKMA 4DFXE 3LLTA 1R0PA 3KC3A 4GL9A 4NFNA 1E1XA 4I92A 3TV4A 4AGDA 1P4OA 4E8AA 1JKKA 5FDPA 3EQFA 3R7IA 3P08A 4CG9A 4WG5A 4O0YA 4AW0A 3DU8A 4FUXA 3IGGA 2J0KA 5ANEA 3TZMA 4MNEA 2ZDTA 5AUTA 3DKOA 3BIZA 4S33A 4AWIA 4D55A 2ZV9A 5EM5A 5KX8A 2UZDA 4YJUA 3SG8A 2R3JA 4J96A 4M97A 5AR2A 5E8UA 1YQJA 4DG0E 3PRIA 5CVGA 4FTUA 4LGGA 3PXQA 5HIDA 5JMSA 4IZ5A 4ANOA 2UZNA 3DKGA 3AMAA 3O0GA 4ONAA 2RG5A 5BUEA 4QTEA 4G6LA 1U59A 1YXSA 2YIYA 4W4XA 4ZY6A 1M7QA 3FC1X 3FSFA 3GCQA 3RPOA 4ZZOA 3EQPA 1DM2A 3OMVA 4TNDA 3UGCA 2IO6A 3MVHA 3O7LB 4U9AA 3QWKA 4FKSA 3FXWA 4EOOA 1PKDA 3NYXA 5DRDA 4PDYA 4B0GA 4DG3E 4XUFA 4FL2A 4O7ZA 3BE2A 4FIEA 4IX3A 4C02A 4CKRA 2QLUA 4PF4A 5DFPA 2EWAA 2RFNA 4L46A 3ZLSA 4D9UA 1H1WA 3WZEA 3SG9A 3QFVA 4QMVA 3M11A 1Q62A 4WIHA 4F09A 1OKVA 5ANDA 4L01A 4E4LA 3C13A 3NAXA 4MD7E 4BDBA 4D2SA 4FI1A 2OWBA 4CG8A 2CKEA 1JSVA 2WU6A 3GCVA 2B9JA 3NIZA 4R3CA 4CZTA 4EH2A 4JXFA 1P14A 3KRJA 3M42A 3R8MA 4RA4A 5L8JA 2YDKA 2R3HA 4EH9A 4Y5HA 4AGWA 1OPJA 4U79A 4U80A 3ULZA 4GVAA 5ACBC 1Q5KA 5EI6A 1YHSA 2YJSA 5E8YA 4QPMA 5HVJA 1H01A 4F7NA 5I9VA 3UP2A 3MESA 2R2PA 5IA1A 4ZTNA 1BYGA 3MH3A 2J90A 2J9MA 3LXLA 4FG7A 2F7ZE 3QZHA 3OEZA 4FT5A 3KVXA 4FT0A 4K9YA 2C47A 2BZJA 4QP9A 3TNHA 3MN3A 1WBSA 2XM9A 1MQ4A 1GZ8A 2WTJA 2I0HA 3CQEA 3PJ3A 3CQWA 4L3LA 4LOPA 2PTKA 2Y9QA 3GQLA 3I7BA 3ORXA 1ZY5A 4FZDB 3QUDA 3HZTA 5C9CA 4XG7A 1ZMUA 2VO7A 2I0VA 4EH5A 5AP0A 4N0SA 3UMXA 2VO3A 1TKIA 3THBA 5CEMA 3UO6A 3V04A 3Q9ZA 3R01A 4L00A 1GNGA 3ZFMA 2F2UA 2BAQA 3OXTA 5K0KA 5L2TA 2XJ0A 5FQDC 3FXXA 2J2IB 2W1CA 2IZSA 3HMOA 2YLEA 3ZRMA 2PVJA 4O82A 1OL7A 4PP7A 1O6KA 2WIPA 2QOBA 4EQUA 3OBGA 2PMOX 4KIOA 4FG9A 5ETIA 2Z7QA 3D5VA 4BBMA 4MNFA 2QOIA 3KRRA 3R1QA 4CYIA 3WZUA 2C6IA 4O7RA 2BAKA 3RAKA 2YM3A 4MNEB 3LLAA 2QOCA 5K5NA 5E8VA 5JQ5A 3MGYA 4A9TA 3ZUUA 3DT1A 3VUKA 4FEUA 3FKOA 4JDKA 2XK9A 5HO7A 3ALNA 4K18A 1KSWA 5IQHA 4FKPA 5IMXA 3EQIA 4RQKA 3QZGA 5LVLA 2QKRA 4E93A 2PULA 3FPQA 3R7OA 4F65A 4FV0A 3OWPA 4MBIA 3VBXA 4HVHA 2WQOA 2C30A 3L9PA 4IAKA 5GHVA 3C4ZA 4EHVA 3DAEA 3VN9A 2UVXA 4BCHA 5HQ0A 3WBLA 5AV1A 2R3PA 3RALA 3CD3A 5HX6A 4ALVA 3B8QA 4DT9A 5AX3A 2I40A 4HGLA 5FM2A 4RMZA 3W2RA 3ZH8A 4LM5A 4EC9A 4RJ6A 4ZY5A 1KE8A 1MRUA 2ZAZA 3BYOA 4NW6A 3ORNA 1PXOA 4MWHA 1QMZA 2JDVA 3LAUA 1URCA 3E7VA 3L9MA 4WG3A 5HG8A 3H30A 3VS1A 4PUZA 3ZRLA 2QOQA 4RJ4A 1YXXA 3AC4A 4WHZA 4FKOA 4FODA 4EOQA 4FTJA 2UW8A 3KQ7A 2IZUA 3GCUA 3DPKA 4BF2A 1GZKA 2HOGA 3E8EA 4Y5QA 5CZIA 4YTFA 3OD6X 3QTRA 2XYNA 2ZB1A 4U3ZA 4YPDA 4ZLOA 2PMIA 5BYLA 2VTJA 1ND4A 2FGIA 5TE0A 2WQEA 3EN7A 4C4EA 5EYDA 3EFLA 4EQCA 4IM2A 4XLVA 1XBAA 4C4HA 3R83A 4IFCA 3E63A 3HP5A 1TVOA 4I0TA 3PIYA 4NM5A 4BIBA 5CSXA 2Z7RA 4A4LA 3KF7A 3QA0A 4M8TA 1NVRA 2WD1A 3DJ5A 5IUHA 5DYJA 2X1NA 3OW3A 4XMOA 5E8WA 3TG1A 3DZQA 5LOHA 4F9AA 4XS2A 5HU3A 4PTCA 3KXNA 4C4GA 1H08A 1CMKE 2C6DA 5CAUA 3N9XA 4IBMA 5CU0A 2VX3A 4KKEA 4K6ZA 5FG8A 4F99A 2VTHA 2J0LA 4MBJA 2J5EA 3PY0A 2QHNA 5IA3A 2CCIA 3JPVA 5CSHA 2OJIA 3F5PA 3QZIA 4KSPA 5CXHA 2CPKE 5ANGA 4QYGA 3SOAA 4ZLZA 3IQ7A 5AIKA 4CTBA 4FR4A 1E9HA 3GOPA 4MHAA 1MUOA 4ID7A 2C5VA 4O38A 3C4FA 3R7UA 2CKOA 5ACKA 4H36A 5FTGA 1X8BA 4AF3A 4UMPA 2W4OA 1DAYA 5CI6A 4ZMEA 2PVFA 4II5A 5D7VA 2WTIA 4K33A 4FSTA 2OIDA 5K4JA 3Q3BA 3ZM4A 2WOTA 5HE1A 2C6EA 1U54A 5DHJA 3GU4A 3I7CA 3QQUA 4RT7A 3TI1A 3MB6A 4BCGA 4D1ZA 4UMRA 1ZRZA 2P3GX 5I9XA 5IZFA 1FPUA 1FMKA 4U81A 5D7AA 3LM0A 4W9XA 4TZRA 5FLFA 3KRLA 4GIIA 2BKKA 3TACA 4FZ6A 3ITZA 3I81A 4BFMA 2V55A 4RWJA 4YP8A 5LQFA 4KBCA 3AT4A 3DS6A 4BICA 5KMIA 4OBOA 2O63A 5CI7A 4BCKA 4BCJA 3ZS5A 4EBWA 2ZM4A 4X0MA 4DEDA 5IH6A 3ZUVA 4I3ZA 1UU9A 3BHHA 5JFWA 3C4EA 1V0OA 4DBXA 4AN3A 2XIYA 4NIFB 5FDXA 5IDPA 3TDVA 3V3VA 1ZY4A 3FUPA 2RF9A 4EH7A 2P55A 2R3OA 2QC6A 3OG7A 3PG1A 3TL8A 4ACCA 1CKIA 4MBLA 5KMKA 3RINA 3LIJA 2W9ZB 2FO0A 4BDIA 3GGFA 2UZOA 5I0BA 2JIVA 5LXMA 3JXWA 3LFNA 1PMUA 3R8UA 2AC3A 4M13A 4EKLA 5CEPA 2ZV8A 5EDRA 3ALOA 3DTWA 3KXXA 3FI8A 1BL6A 4FTTA 4FBXA 4QPSA 3S2PA 3CLYA 4F9CA 1E1VA 1FINA 2B52A 3DK7A 5AR3A 2XIRA 2GFCA 4UYNA 2C6OA 3BGPA 4GK4A 3FLSA 3U51A 4BZNA 5IQBA 4CT1A 3SA0A 3HEGA 4B8LA 5BUJA 2NP8A 4TNBA 2ERZE 4FKQA 4YTIA 4R7BA 3W2OA 5DA3A 2Q0BA 4AACA 2XA4A 5CS6A 3CQUA 2WPAA 4FICA 4RG0A 4FEQA 3A8XA 4PX6A 1YHVA 5DI1A 3V6RA 1GY3A 4TY1A 4V01A 3QU0A 4BCOA 4V04A 4U5JA 2FB8A 4UXLA 5AR4A 4A9UA 4OT5A 5JT2A 1XBCA 3VF9A 4QMQA 1GAGA 1BMKA 4Y8DA 4IAYA 4AZTA 2V7OA 4LGHA 1PRYA 2X2KA 4L53A 4GKHA 3RPRA 5GZ8A 3OHTA 3UTOA 2JBOA 3L8PA 4NCTA 5JFXA 3EFWA 3KGAA 2W1IA 1CDKA 1TQMA 4ORKA 2GHGA 4OTGA 1H0WA 4EOMA 4DCAA 1BI8A 2PUIA 3PG3A 1IA8A 5I9YA 3HDNA 3JY0A 3V5LA 3S0OA 3ZM9A 5CENA 3C50A 3CKWA 3VS2A 1WBPA 3BLQA 4TYGA 3ZLYA 1APME 3AC8A 4XP3A 3HYHA 3REPA 3ATSA 4G5JA 2VO0A 3EQHA 3Q6UA 4RX9A 4XV9A 2XK8A 5IA2A 4O0WA 4EJ7A 3DK3A 3EKNA 4BDDA 2EXEA 2C4GA 3DKFA 1PJKA 4TXCA 4U41A 4EQMA 3DZOA 5DOSA 3R8ZA 4EK4A 4HVDA 4FSWA 5CT7A 4IWDA 1OL5A 3A7HA 4I1ZA 3HRFA 3IECA 4USFA 3C5UA 4NFMA 2O5KA 3L9NA 4FTCA 1U54B 3M2WA 2XIZA 4R78A 5CU4A 4GK3A 4I41A 2ZMDA 5IQCA 1WVWA 4YLLA 1QPDA 1VYWA 2UV2A 2UUEA 4FK6A 2WNTA 5FEQA 1GOLA 3Q32A 4QMMA 4PDPA 5E8ZA 5KMMA 4OGRA 4RJ3A 2AYPA 3CD8A 4QT1A 3KKVA 4LOOA 4YNOA 3QKKA 4WBBB 3SRVA 2BRGA 3U6HA 1M2RA 2QNJA 1H28A 4FEVA 2W9FB 4E1ZA 3FMKA 3AGMA 3FZTA 3RKBA 2A0CX 1U46A 4F7LA 4DH5A 2W1HA 3WIGA 2PHKA 5ANOA 1ZYJA 3PXKA 4IJ9A 3JR1A 2OZOA 2CGUA 4X3JA 4YJTA 3GEQA 4IB0A 5FP6A 2VTAA 2C6TA 4AGUA 4USEA 4BDAA 4BYIA 5DG5A 3FL4A 1PMVA 2WOUA 1CKPA 2BR1A 4OW8A 2VWIA 5C4KA 4MCVA 3KFAA 2E9OA 1WZYA 2VWXA 2VX1A 3KXZA 5KUPA 2CNQA 4JQEA 4XG3A 3Q2MA 4NWMA 4FNXA 4UWYA 3GVUA 2B4SB 3NCZA 1XH9A 1IA9A 4BDKA 1FOTA 4KSQA 2QOFA 2PVLA 3COHA 5TR6A 3PXFA 2YERA 5FTQA 2JKKA 4GU9A 4ZMFA 2RKUA 5HOAA 3GU7A 2A27A 2C1AA 2W4JA 3BLRA 4IDTA 5J1VA 3ORTA 1LP4A 1JAMA 4M69B 3RVGA 1VYZA 1RDQE 3BQRA 4I5PA 3UG1A 4IMYA 3GENA 5LVPA 3QYWA 2LGCA 4U0IA 3TJCA 5IEVA 2V62A 2OSCA 5CU6A 4FTAA 4YGAA 4B7TA 4UN0C 5JGAA 3T9TA 4DEEA 3A4OX 3IKAA 4HW7A 1L8TA 5F1ZA 4CKIA 1CTPE 3JVRA 3ZEPA 1ERKA 1OL6A 1M52A 2VRXA 3QL8A 2JGZA 4GFGA 4TWNA 5BVNA 4MKCA 1R3CA 3C51A 2V22A 3OW4A 4G5PA 4GT5A 1QPCA 2ACXA 3FZ1A 4PPBA 5TKDA 2B9IA 5M07A 4C3FA 2HIWA 3RHXA 4DGNA 2GTMA 3O51A 4Y83A 4RFYA 1SMHA 3MBLA 3PVBA 3LXNA 4KIQA 2GQRA 2GS7A 4KKHA 3BYSA 4RIYB 4RVKA 3VS3A 1XJDA 3GC7A 3L1SA 4OUCA 4RVLA 3VBVA 4ZXTA 5FRIA 3O50A 4LRJA 3KULA 3PPZA 3QC9A 3ZZWA 1A9UA 2O2UA 4BTKA 2NPQA 2PVNA 3I5NA 5CF6A 4MEDA 4M12A 3ACJA 3AD5A 3DBDA 4CV8A 4UX9A 2J50A 2W96B 2H6DA 3Q5ZA 3WZDA 3LFBA 4QMSA 2YZLA 4I21A 3AT2A 4BCPA 3LFQA 4ZJVA 4BTJA 3AG9A 5JRQA 3MJ1A 1SM2A 2C5YA 2UW3A 2VAGA 2YN8A 3PZEA 3DFCB 4FGBA 3ORKA 4L6QA 4FOBA 4TRLA 3FAAA 4D0WA 5AV0A 3EB0A 4HCVA 4NKAA 2UZWE 4BY9E 3FY0A 3WF7A 1WBVA 2B55A 2BFXA 4IQ6A 5EI8A 2QR8A 2C69A 4FZFB 4DEBA 2YM5A 3BHYA 4L43A 2PWLA 4KNBA 3GQIA 2P33A 4EYJA 2CKPA 3P7BA 5H8BA 2NRYA 3POOA 4X7QA 4LUDA 5AMNA 4ZTHA 4BCFA 4C33A 4NTTA 5CU3A 5HZNA 2IW6A 4L45A 2OH4A 4AN9A 2UW0A 3FY2A 2RIOA 4DFBA 3PLAE 3HLLA 4GV1A 3DXQA 4ZJJA 5L2IA 2GQSA 2OFVA 4FKRA 5CF4A 4IB1A 5B2LA 5JGBA 4LL0A 1UNHA 4C3RA 4ENYA 2WU7A 3R8VA 5ETCA 1FGIA 4C4FA 4EOJA 5EDPA 3V8SA 3EZVA 4E5AX 2ITPA 4KS8A 2BRHA 3T9IA 3UODA 4DFNA 4DCEA 2BFYA 2QVSE 4BCIA 3OVVA 4G1WA 1VEBA 3RHKA 3TUDA 4QMPA 1OB3A 5E8TA 4EHZA 2HW7A 3PYYA 1UV5A 2I6LA 2RFDA 4RC4A 3VC4A 4F1OA 1NVSA 3FYJX 4CLJA 3PA4A 3RK9A 3VS5A 1AD5A 3H9FA 2WEIA 3QRIA 5DH3A 3EQDA 5CSWA 5EOLA 5IKWA 3G6HA 3SDJA 3EJ1A 2BKZA 3R04A 1UWJA 5FD2A 2PUUA 1W98A 3I1AA 3QRKA 4YZBA 2Z2WA 5I9UA 5BPYA 4O83A 1JVPP 4QOXA 2IPXA 2C3LA 3C5IA 2J0IA 3A7FA 3PY1A 4IVBA 4WSQA 2RGPA 4UB7A 2OLCA 1PXMA 2WMTA 1PMEA 4JI9A 4BIDA 4BWXA 3UZTA 3KL8A 4FYNA 3TJDA 3C0HA 4L3PA 2E9UA 4AZWA 5LCJA 3A60A 1UKHA 3UOLA 4O7YA 1ZOGA 3OY1A 3LMHA 3R30A 2WTCA 1KE7A 4QP8A 5HO8A 3DNEA 3LE6A 3QUEA 1YVJA 3UNZA 5JGDA 4DE4A 4YHFA 2EXMA 2VX0A 3O7LD 5AUZA 4ASXA 5LMKC 2G9XA 4YSMA 1XBBA 2XYUA 4KINA 1Z9XA 2ONLC 4ZSAA 5KBRA 5L4QA 4F6WA 3IDPA 5JEBA 2UZBA 5LARA 2EUFB 2VGPA 2OH0E 4OAUC 4ZSLA 3F3TA 3QRTA 3IK3A 4AT3A 3ZYAA 3L8XA 4HNFA 3WYXA 5L2SA 4KUJA 4EUTA 3WF5A 3C4WA 4L52A 4DFUA 5KMNA 3EYGA 2W06A 3KRWA 3RGFA 5T6KA 3D7TA 3UVPA 2HW6A 1REJA 3NIEA 3R0TA 2QO9A 2F4JA 3ZBFA 3QQFA 1JKTA 4M84A 1ZZ2A 1G3NA 4OR5A 1PXKA 3DB8A 3Q53A 3RPVA 4JR3A 1H00A 2HY81 5HGIA 3QX2A 3N4TA 4A7CA 1YRPA 3A7JA 3R02A 5KCVA 4AFEA 3UC3A 1Q8ZA 4R6VA 4EK6A 3PPJA 1SZMA 2OZAA 3VIDA 3LMIA 2FA2A 3W8QA 4TW9A 5EHOA 4FA2A 3IG7A 3WOWA 1QCFA 3G5DA 5HG9A 4TKSA 5HTBA 3MFSA 4O91A 4MQ1A 3BX5A 3A61A 3BYUA 2HWOA 3KREA 4C7TA 3D0EA 2UW5A 3F61A 3NMUF 3OCBA 2ZB0A 2IW8A 3MPTA 5IG1A 4PTEA 2BALA 3R9HA 3O8PA 1NT2A 1KWPA 5ETFA 5IISA 3HAMA 3WZJA 2A19B 5LVOA 3RI1A 4S31A 4JBPA 4BKJA 2ZM1A 3F88A 3AMBA 2GU8A 3AT3A 3P0MA 4FV1A 3IS5A 4GMYA 4LMNA 4DLIA 4WOVA 3FMEA 2C6KA 3L8SA 3OC1A 4MXXA 2XNPA 4G16A 5ITAA 3VS6A 1GZNA 3QKMA 5LMKA 3KB7A 3D4QA 2XS0A 2ONLA 5AEPA 5CASA 1H26A 2GS6A 3BV2A 5HICA 4G2FA 2W4KA 3MY0A 1YXUA 3P5KA 3ZOSA 4BDCA 2XKEA 3R21A 5EQPA 4IC7A 4H3QA 2EB3A 3ODZX 3EN9A 3UYSA 4BGGA 5AWMA 1SNXA 5AP3A 2IWIA 4UBAA 3VRYA 4FSQA 3E7OA 3GCSA 5DRBA 5AP5A 5KZIA 3VJOA 3PP0A 4O84A 3D14A 3FLZA 4LGDA 5JFVA 5CVHA 3ORMA 2R3MA 4A4XA 4NUSA 4O7SA 5EYKA 3ZLWA 4DN5A 2ITVA 3D2KA 4L7FA 3PDTA 2ITQA 5F4NA 2WQNA 5HIBA 4D5HA 4DEHA 4WUAA 3SXSA 3BI6A 3HNGA 4CRSA 2XBJA 3IDBA 4C3PA 4PPCA 4JT3A 3BU5A 3WYYA 3DBQA 2XBAA 3GC8A 4PMTA 4DTBA 2JFMA 3FLYA 4FKVA 4H1JA 4MXCA 4RWIA 4ITJA 4IB3A 4J8MA 1YI6A 5GZ9A 3RTPA 4EH3A 4OT6A 2VTOA 4C35A 3PTGA 5A4TA 3TZ9A 3QRJA 5JKGA 4FX3A 1KE9A 1BLXA 2OJ9A 2Y6OA 3FQEA 4GH2A 3AMYA 3P4KA 4XV2A 3FQSA 3ZC6A 4C61A 4CEGA 3COIA 5A4QA 4H3PA 3D7TB 4OTRA 4MXOA 5M53A 5HE0A 4IXPA 4PMSA 4NSTA 3UYTA 1DAWA 3R6XA 2YISA 4XHKB 2X8IA 4JDIA 5AA9A 1FVRA 1KE6A 4X2NA 4BTMA 3F82A 2HYYA 4BRXA 4YZ9A 3UE4A 4O0SA 3OROA 3OWJA 3MTLA 4PY1A 4ZTLA 3QQHA 4G6NA 3WF9A 4A9YA 4GEOA 4JS8A 2QU5A 3RZFA 2NNWB 3DV3A 4MAOA 3CPCA 4I0RA 3LVPA 4LV8A 4EKKA 5CAOA 2P2IA 3MH2A 3F2NA 4MD9E 3NGAA 1FGKA 4PDSA 4ANNA 4IAIA 5TOZA 1OGUA 2VNYA 4NL0A 3EOCA 3MJ2A 1PW2A 2XF0A 5EYMA 4R3PA 2E9PA 2PK9A 4IB5A 2PUNA 2JAMA 3BYMA 1O6YA 1ZOHA 4HGTA 3ERKA 4WD5A 4YBKA 4YC6A 4D9TA 5L3AA 5L6OA 3COKA 4UY9A 4QMXA 1PYEA 2UZTA 2XEZA 2RSVA 2GNHA 4GU6A 4R8QA 3FMHA 3I60A 5G6VA 3KXHA 4F9YA 3F3WA 3NS9A 3OCTA 4UYAA 3VAPA 4TL0A 5D12A 2XM8A 3HUCA 4N6YA 1Y8YA 3ZBXA 1YXVA 1JNKA 5A54A 2X6DA 4F0GA 3O23A 4JX7A 2OFUA 5AP1A 3FMLA 2HCKA 1UKIA 3G9NA 1DS5A 4X3FA 5HBJA 3LZBA 5AIRA 4AOJA 5DE2A 2WHBA 3OCSA 4FG8A 4K8AA 4UZDA 3UQCA 2WMUA 2HENA 5JRSA 3M1SA 3G6GA 3RK5A 4IHPA 3FZOA 3R7YA 2C6MA 4KIPA 3QD3A 5EW3A 3DDQA 2VTMA 3DB6A 4ERWA 3TNPC 4DYMA 5HD4A 4AOIA 4E20A 2NRUA 3SAYA 1W83A 4JBOA 2GMXA 5IEYA 3EYHA 5EDQA 4KD1A 3TUCA 5AADA 3VW8A 3QTZA 2HAKA 3AC3A 4L9IA 5J7BA 3QWJA 4LYNA 3R9NA 4NU1A 4EK5A 2WEVA 2JAVA 2X7OA 3TNIA 2ZM3A 5HLWA 5A4LA 3DQXA 4YO6A 4AT5A 3MY1A 2ITNA 3NRMA 4NM3A 5I3OA 2G2HA 3DQWA 4JX3A 3ZO4A 2I0EA 3GBZA 4N70A 5DN3A 4G3GA 3LXKA 3QQLA 3KXGA 2QOLA 1NY3A 4OTFA 3F5XA 4FVPA 4R1YA 3PE2A 4RZWA 4BGHA 4DGLC 2X39A 2X81A 3TCPA 2ETRA 3GCPA 5EW9A 2PVMA 4WUNA 4DH7A 4R7IA 4QQTA 3UQGA 5FBNC 5E1SA 3UMWA 4BCNA 4BHNA 4RX7A 2DYLA 4DINA 3ORZA 1YOLA 3LW0A 4CMTA 5GJGA 2QODA 2YABA 3P23A 2PVHA 3CCNA 3PVWA 4JQ8A 5C27A 4C59A 4H05A 3FLWA 4P90A 1J91A 4WNPA 5M4FA 3TIYA 3QLGA 1OI9A 4PWNA 3TKHA 5K0XA 3W10A 2JIIA 2VUWA 4D0XA 4I6FA 4F6UA 4O7LA 4E6DA 2CMWA 2FVDA 4FSMA 4J95A 5CWZA 3P7AA 3D83A 4MH7A 3FL5A 4I0SA 5CNNA 4R5YA 3RM6A 3HMMA 2ZVAA 3GC9A 3EMGA 4N6ZA 5J9YA 3UQFA 4HYIA 3RAIA 3LFSA 5GJDA 4AX8A 4BN1A 3TT0A 4Y73A 3HL7A 5I9WA 1J7LA 3G90X 5K9IA 3IOPA 4J99A 5JZNA 4DGOA 2FH9A 3R9DA 2KTYA 3O96A 5FWKK 3LQ5A 1BKXA 5HCZA 4B8MA 4Z9LA 3B8RA 2W1GA 5DLSA 4D58A 5ETAA 4AZSA 3LCSA 4QRCA 3V5PA 4XV1A 3GFEA 3AXWA 2QU6A 4M0ZA 3VQHA 3POZA 2BRBA 3HMIA 4TYHA 2E2BA 1ZYSA 4G6OA 2W17A 5DEWA 4GT4A 4DFZE 2SRCA 4ANSA 3D94A 4YJOA 3VW6A 5KNJA 4EEVA 3OXZA 4YHTA 3RP9A 3EIDA 4GJ3A 4JR7A 4KS7A 4FTOA 3P7CA 4I6HA 3H4JA 2IG7A 3MA6A 3D5UA 3UDBA 3VVHA 4FSYA 3TKUA 1JQHA 2Z60A 3K5VA 2XRUA 3LHJA 3VBTA 3PJ1A 1WMKA 4Q9ZA 1PXIA 3NX8A 5KMOA 2BIYA 2WKMA 2IN6A 4KB8A 2IZTA 2JITA 5J9LA 3OFMA 2IVVA 2F49A 2OO8X 1U5RA 3A62A 4CFUA 4ZTSA 4D2TA 5IDNA 4DH1A 4ZTMA 3NDMA 4L3JA 2O65A 1HCLA 3PSDA 3DNDA 4QNYA 3O2MA 5IQGA 4YZMA 3ZFYA 1MP8A 1XH6A 3QLFA 1UNLA 3EN4A 4RJ5A 1H1PA 4UMTA 5HORA 3U87A 4ZS4A 4YHJA 3VQUA 4PDOA 3SGCA 2A2AA 1VZOA 3U54A 5BVDA 2J7TA 3NVKI 3ZC5A 4PL5A 3EH9A 4FTIA 4XBRA 2R0IA 1BI7A 2AC5A 3E3BX 3HVCA 3OS3A 4NCTC 2WQMA 4DEAA 3KMUA 5BVWA 4DC2A 5KHXA 1Z57A 3A99A 3EFKA 4CVAA 5M08A 3PFQA 2PL0A 3LXPA 4GK2A 3Q4TA 4J52A 3QBNA 4PP9A 1WBTA 4AE6A 1U5QA 3F5UA 2GTNA 1CM8A 4ZEGA 4HZSA 3OEFX 4R5SA 4YLKA 3NAYA 3DTCA 4B4LA 5CF5A 4ZSEA 3TM0A 3BU3A 4BZDA 1XH8A 2JFLA 2R3GA 5HNGA 4FMQA 3AGLA 2B0QA 1Y8GA 3IW5A 3E3PA 4U42A 2C6LA 4W9WA 5LMAA 4C34A 4FTNA 4ERKA 1TQIA 4QMYA 2DWBA 3W2QA 1EH4A 4HYSA 4QNAA 1G8SA 2OF2A 4I5MA 5CZHA 3T3VA 4A07A 3G9LX 4JIAA 2JIUA 1Q8WA 3U4UA 4BIEA 3WE8A 3CJFA 3UG2A 2VV9A 2QG7A 5CAVA 5E1EA 1OL2A 3NEWA 3DY7A 4Y85A 5HO6A 4Q2AA 4QP3A 3RWQA 1DI9A 1LPUA 1YW2A 2C1BA 2CDZA 4G3FA 3H0ZA 4JDHA 2JDSA 5B2MA 3DKCA 1I44A 3BV3A 3MS9A 4EOKA 2QQ7A 3E8CA 5I5ZA 2ITTA 2C0TA 2BPMA 2IJMA 4JRNA 4WNKA 3NLBA 3RK7A 2YWVA 3FJQE 3BEAA 5HLPA 2JKQA 3IW6A 4XYFA 4RFMA 1STCE 5IQIA 5IMEA 5A46A 4JG6A 4AFJA 3OOGA 1IEPA 4YTHA 4AXAA 3FHRA 2CLXA 2BRNA 5HVKA 1BX6A 4BL1A 3DFAA 4FTMA 4JDJA 3BE9A 5A6OA 4TYEA 2ZV7A 2CLQA 2OJFE 5IPJA 5DR9A 3HV4A 1MQBA 4FKGA 4FNYA 4DG2E 2UVZA 4PPAA 3F69A 4EC8A 3TKIA 4CXAA 3NUPA 2P2HA 3KXMA 4MXYA 4DFYA 4RJ7A 2CGXA 4CQGA 4FKTA 2R3LA 3KMMA 2B9HA 1G5SA 5L8KA 4MXAA 3DA6A 1M14A 1H0VA 2PZPA 1J1CA 3Q6WA 3TIZA 2FUMA 3HKOA 4UALA 2YACA 4E4XA 4QTDA 3BRBA 1MRVA 2ERKA 2YITA 3NNUA 5CX9A 4BHZA 3UNJA 4ARKA 1NXKA 2VWVA 4YURA 5CF8A 3G51A 4ANBA 2OXYA 4HVSA 3D7ZA 3UIUA 1ZLTA 2BVAA 4S2ZA 2YM6A 2ZDUA 3GT8A 3VUDA 5IA5A 4DITA 3OY3A 4FUYA 3O17A 1R1WA 1GJOA 2IVSA 2QG5A 4FKIA 4FV7A 2VGOA 3CR0A 5A4EA 4MX9A 3R8LA 3R1NA 5BYYA 2YCFA 4I20A 3QCQA 5D10A 2HY0A 2FSTX 2Y4IC 4BC6A 3MYGA 4D2RA 3W2PA 2VTIA 4Q5EA 3ZSHA 4I24A 4DLJA 2WFYA 4ZSJA 3NUYA 5F9EA 4N4SA 1OECA 1XHAA 3FQHA 3R28A 3ZEWA 2PE1A 2XK4A 3FDNA 4UWCA 4NW5A 5KKRC 5CSVA 2GNFA 4LV5A 3KEXA 4J98A 2VTSA 2FSOX 4GS6A 1K3AA 3NUXA 2BAJA 3ZMMA 4CT2A 2XNNA 3HX4A 4Q5HA 4KWPA 3PA3A 4YJVA 4WG4A 5DR6A 5AP7A 4F6SA 4TYJA 1SVHA 5FXSA 4I6BA 4C8BA 4GKIA 2EB2A 4RWKA 4FKWA 2GHMA 4QO9A 4XRLA 5CLPA 4S34A 2R3QA 2XIKA 4G3EA 4A4OA 2WMXA 1UVRA 5CEIA 4QMOA 4NJDA 3SXFA 4O22A 3OOMA 3UC4A 3DDPA 3SX9A 4RX5A 2C3JA 4CZUA 1Q3WA 4XRJA 3QTWA 4LQMA 5J87A 2W99B 4AA5A 1HCKA 3FBVA 5FP5A 2JDTA 3ZXZA 4JG7A 4MVFA 4RGJA 3KN6A 3C4XA 1BUHA 2X0GA 4IVDA 4J53A 2H34A 3ORPA 2A4LA 5DNRA 5DR2A 5M55A 3VUGA 1HOWA 4EJNA 4C37A 3ZCLA 4O21A 3ZO1A 4QTBA 1RQQA 5E8SA 1WFCA 4GSBA 4IH8A 3UPXA 5FEDA 3HGKA 4J8NA 2Y4PA 1GZOA 1W0XC 3QALE 1Q8TA 5AUVA 5HE2A 2G15A 4D2VA 2XK7A 4C38A 4FSRA 3OWKA 4Z16A 3DBEA 2XK3A 4I6QA 4F7SA 3HA8A 3LJ1A 4QQ5A 2R9SA 4KIKA 2YIWA 3TEIA 4EHEA 4IM3A 1I09A 5FXRA 4O1OA 3K3JA 2XH5A 4IC8A 1JKSA 1WAKA 1XO2B 3MY5A 4O0XA 3V5QA 3VUHA 3QAME 4FTKA 4JLCA 4YC3A 2XNEA 3RZBA 3R7GA 3HA6A 4FSZA 4YZCA 4ALUA 3SRVB 2ZYBA 3QXOA 2ZV2A 3KA0A 4QTAA 2GNLA 2VWYA 3SHEA 3SW4A 2VD5A 4AG8A 5DBXA 5TO8A 4YMJA 1Y91A 4S32A 2BDWA 4QPAA 5M09A 2QHMA 3AD6A 3OF0A 4K11A 5A4CA 3SKCA 4M7IA 4X2GA 4ANMA 2R3KA 4WT6A 3MI9A 3PXRA 4HYUA 5B2KA 4GFOA 4BBFA 4IADA 3PSCA 4WO5A 1ZWSA 2F7XE 2G2FA 4QYEA 2LAVA 4DF3A 3E64A 4QYYA 3NYNA 4GYIA 3VUTA 5KBQA 3U6IA 3NUNA 5IU2A 3LQ3A 4D4RA 3BLHA 3F66A 3IW4A 1FVTA 3QTUA 4IVCA 3R9RA 2V0DA 5HE3A 5CEQA 5JFSA 1OIYA 4O7TA 3AC2A 5JZJA 3MVLA 4CMUA 4L44A 4HVIA 4ZK5A 1B39A 3OCGA 3OT8A 4QMZA 3WI6A 2YAKA 3ENMA 3MW1A 3NW7A 3UVRA 3BHVA 3CEKA 3BBTB 3QD4A 4G17A 4O2ZA 2JDRA 2CGVA 4YZDA 1OIRA 3EHAA 3E8DA 4BI0A 2GNIA 4NJ3A 4CFXA 3GUBA 3W1FA 1R78A 4P4CA 4RPVA 3IPHA 4GUEA 3Q9WA 2VTLA 5EHLA 5HKMA 2X8EA 3GFWA 4DBNA 2BZHB 5J95A 5HHWA 4CSVA 4EORA 2HWPA 3PIZA 4IZ7A 1P4FA 3KK9A 3O8UA 3DOGA 4K2RA 2X7FA 3I6UA 4CQEA 2WMBA 4IWOA 2J0MB 3LFDA 1FQ1B 4XEYA 4YJNA 3F3VA 5AUUA 4I93A 1Z5MA 3HMPA 2WMVA 4W8EA 1IR3A 1DI8A 3GU6A 4OBPA 4U44A 4X21A 4E4MA 4EZ7A 5IF1A 2YA9A 4A9SA 2XB7A 2XJ1A 5DIAA 3D2IA 2WMQA 5GZAA 5TF9A 2XNGA 2X4FA 5K5XA 3MPMA 1CSNA 1H1QA 2B54A 4F7JA 1NA7A 2XMYA 1YKRA 2FSMX 3V01A 4XJ0A 5HG7A 4EUUA 4DHFA 2PZYA 1TQPA 3R1SA 4FNWA 4HGEA 2YHVA 3FI3A 4UV0A 3S3IA 4EHGA 4EONA 1GIHA 3HRBA 4QMLA 4BR3A 3TXOA 5C26A 4XBUA 3UPZA 5CEKA 4YJSA 2Y4IB 5DGZA 1L3RE 2ZOQA 3BYVA 3KULB 4U3YA 3PWDA 4GVJA 4BCQA 4ACHA 4HGSA 2R4BA 1FMOE 1M2PA 1Q8YA 4KBAA 2BCJA 4IX4A 5KKRB 2YWPA 5KMJA 1VR2A 4GIHA 4C57A 5T68A 3O71A 4MF1A 2W0JA 2JC6A 3U4WA 3CKXA 2R7IA 4FYOA 2PE2A 2V7AA 4ZP5A 3BU6A 3EQGA 4EYMA 2J51A 1MRYA 4P5QA 5E91A 3H10A 5EHYA 5BVOA 1RJBA 1H1SA 3VF8A 3FHIA 3PPKA 3C0IA 4OLIA 5FUTA 5CT0A 4DEGA 1NVQA 5M56A 2CKQA 1SVGA 2GS2A 5L8LA 2GSFA 1Y6AA 3W2CA 2WMWA 3WZKA 4QD6A 2CJMA 2WTKC 4NM7A 5CAQA 3HAVA 3F7ZA 2PE0A 1PXPA
chains in the Genus database with same CATH superfamily
3EQBA 5E92A 4ENXA 3QTQA 4QYHA 4CKJA 2VWWA 2F57A 4TWPA 1U4DA 2J0JA 3PVGA 3PWYA 4IEBA 2B53A 3N4UA 1NW1A 3AQVA 2IW9A 3ZDIA 2JKMA 4IVAA 2FSLX 3KCKA 3JUHA 5E8XA 5EI2A 5AUWA 4CCBA 4CNHA 3UNKA 1RW8A 3R7EA 4TYIA 4W4WA 4C2VA 5C8NA 1OKYA 5HBHA 4WRSA 2PUPA 4O81A 4XP0A 3VBQA 4DEIA 2BILB 3PJ2A 3UIBA 3RPYA 4PNIA 1P5EA 3EQRA 3A7IA 2PY3A 4U6RA 4CZYB 5C1QB 3MVJA 2GNGA 4XCUA 3V5JA 3V5WA 3BWFA 4CLIA 4F0IA 2JDOA 2X4ZA 4Z7HA 2VN9A 3Q96A 3QHWA 3ZDUA 1GIIA 1KE5A 2UZEA 2HZIA 4AU8A 4OTQA 3F6XA 4U45A 1H27A 5L2QA 4I4EA 3CJGA 4E3CA 3NSZA 4GT3A 5HD7A 4XG2A 3RAWA 5HCYA 3JVSA 3W16A 1JPAA 5F94A 3WILA 4XNEA 2B1PA 4EWHA 4LFIA 3KU2A 4D2PA 1IAJA 2QLQA 3LCOA 4IDVA 4XG9A 4AZVA 5J5TA 2BHHA 4NM0A 4LG4A 4EWQA 4F4PA 4JAIA 4X2KA 4F9WA 3FMNA 4LUEA 4YSJA 4Z7GA 3QCSA 3TNQB 1AQ1A 2QOHA 1OUKA 2QI8A 2G1TA 2WAJA 4G9RA 3EZRA 4QP7A 4FIIA 3V51A 3ZONA 3LCKA 2HXLA 2YEXA 3PXZA 4RWLA 2BROA 3C9WA 3ZRKA 5C4LA 2HELA 4FOCA 5DT0A 5GIOE 5HNBA 3GXLA 3E62A 4R77A 5M44A 4HJOA 4V05A 4E4NA 4RLLA 2CNUA 3RNIA 2XCHA 1OBDA 1K9AA 4MD8E 4JG8A 2P0CA 4FIHA 1O6LA 5AA8A 2OG8A 3FZRA 5JH6A 5J1WA 3HP2A 1JBPE 3E5AA 3TV7A 4DH8A 4Q9SA 5H9BA 1TZDA 2Z8CA 4YC8A 4K77A 1G8AA 4DT8A 3DAJA 4JVGA 3TDWA 4JIKA 5ANKA 4F1MA 4U8ZA 3D9VA 3MVMA 3NPCA 2R3RA 3P9JA 3R71A 4XV3A 5I9ZA 4RVMA 4YO4A 3QD2B 2JBPA 5EKOA 2XIXA 4X3FC 3UIXA 3II5A 1JSUA 3HV5A 3G0EA 3MB7A 3MTFA 3FC2A 3H9OA 4DA5A 2VTNA 2ZMCA 4D1XA 4OTPA 5CEOA 3F2RA 1PXLA 2VTTA 3R63A 4JNWA 1PF8A 4BDGA 3A4PA 1XH5A 4EOSA 4RC2A 4OBQA 4IAFA 5H2UA 2R3NA 4BYJA 3GU8A 5F20A 5FGKA 4Z3VA 3VJNA 3SLSA 5BVEA 2UW7A 4FV8A 2QOOA 4O7WA 3BGZA 3V8TA 4W4VA 5AJQA 2IZRA 5BQ0A 5DMZA 1KUTA 1V0PA 3DLZA 4K0YA 3ROYA 2GDOA 4A06A 1QPEA 1YHWA 5LWMA 4R7HA 2UZLA 1W7HA 3GU5A 3FZSA 2ITYA 3VNTA 5KE0A 2W5BA 2CGWA 2OZAB 2VWBA 3QTSA 5AX9A 5H8EA 4RZVA 5K3YA 4QQCA 2HXQA 4EH4A 4EI4A 4YU2A 4IZAA 3WE4A 4BDEA 4ZLYA 5IH4A 3EWHA 4O0UA 3G15A 1M2QA 2WGJA 2ZJWA 4L68A 4NEUA 4ASEA 4FSNA 5CVFA 4F63A 4L42A 4O86A 2GCDA 3VBYA 4F1TA 2WTWA 2EVAA 3FKNA 4BCMA 1J7UA 1OPLA 5E90A 5CQUA 4DDIA 5AP2A 4E73A 4F08A 3EFJA 3G33A 1JOWB 2OIQA 4BWKA 3FWQA 3G0FA 5CY3A 3TZ7A 1YWNA 2YM4A 1R39A 4FTRA 3QF9A 4WNMA 3SW7A 2XKCA 4RIXA 3U6JA 4BGQA 1SVEA 3WF6A 3GNIB 3DGKA 4NK9A 3PVUA 4JQ7A 2YIRA 4O6EA 3UZPA 2CN5A 5IQEA 4JJRA 2WQBA 3ENHA 4W4YA 4DFLA 5GJFA 2C5OA 4UMUA 4G34A 3OXIA 2VWUA 1QL6A 3QX4A 3RBWA 3AC5A 3UIMA 3CTQA 3CXWA 3CS9A 4FVQA 4AZEA 4CCUA 2CCHA 1XH4A 1OPKA 3VBWA 1QPJA 4XG6A 3OUKA 1Q97A 4FV9A 4ZTRA 4ZJIA 1G8KA 5I4NA 3I0QA 4HPTE 4XOZA 4ZIMA 5FBOA 2VNWA 2E9NA 3W8LA 4AA0A 4DTKA 3PJ8A 2YIXA 4QYFA 4YLJA 3I4BA 3DK6A 3BQCA 1BL7A 5FXQA 2UW9A 1YDRE 1YI4A 1UU7A 1YDSE 2CN8A 3QGYA 1YOJA 2WTKB 5LVMA 5JQ8A 5DWRA 5EYCA 1Q3DA 4PMMA 3HRCA 5C03A 5BVFA 2YCQA 5HESA 3NWWA 2QURA 4IAAA 4EK3A 2W5AA 3NYVA 4RIOA 2R3IA 5DEYA 1H25A 2WMAA 2X0QA 2H96A 2QOKA 3QGWA 4RIWA 4XP2A 2HZ4A 4C58A 1JKLA 2E9VA 5EQEA 1PYXA 2IVUA 1J1BA 4FIGA 5DT4A 4B6LA 4HPUE 4MYGA 5CNOA 3TMOA 2O64A 4ALWA 5HU9A 4OTWA 3Q4CA 4JOAA 4LRKA 3F2AA 3MH0A 4W8DA 1W8CA 2IVTA 2WZJA 2AEGA 3LCTA 4FKUA 3TNWA 3CBLA 4O6LA 1PKGA 2B7AA 4RQVA 4AZFA 3Q52A 4RRVA 3BKBA 1WCCA 1Q99A 2XZSA 5C01A 3QD0A 5B7VA 3VS7A 2YAAA 3E87A 5BYZA 4QMUA 4YUQA 3ELJA 4PV0A 4FIJA 4UEUA 3VUIA 3G2FA 3DBFA 3MIYA 1UWHA 2YM7A 5BUIA 2DUVA 4P7EA 3NUUA 1KOAA 4ITIA 4IX6A 2PYWA 4NIFA 3LOKA 5M06A 4GG7A 3Q9YA 1YWVA 3P86A 4IJPA 1M7NA 3P78A 5DT3A 5JK3A 2A1AB 5M4IA 3CGOA 5D11A 5EQYA 3QA8A 1ZOEA 1FVVA 4FTLA 1M17A 4B99A 5L2WA 1ZARA 2R0UA 3NW6A 3PP1A 3EL8A 3RMFA 3U9NA 3F7WA 3QC4A 4IW0A 4ASDA 2RL5A 3IDCA 4LRMA 5K4IA 3CY2A 5ICPA 4FT7A 4E6AA 1OKZA 5EW8A 4JRVA 2Z02A 4LOQA 4KABA 4KBKA 2PVRA 3W0RA 5CYIA 1OZ1A 2R64A 4RIXB 1IAHA 4WRGA 3UO5A 3FMDA 5DVRA 4B9DA 5KMLA 2XUUA 4TWOA 4XOYA 1F5QA 3ZHPC 5M4UA 4CD0A 1B38A 2OXDA 2REIA 4S30A 1WBWA 1ZYCA 1OBGA 3MFRA 4D2WA 3SQQA 2BTSA 1KV1A 3FMJA 4R3RA 4X3FB 2XNOA 3HV6A 3N4VA 2QKWB 3JY9A 3UOKA 3T8OA 3ZSIA 2OJGA 3WIKA 4DHJA 3PSBA 1ZMVA 2O3PA 2QO2A 3ETAA 4QTCA 4G3CA 4AP7A 1V1KA 4C36A 3NYOA 3PUPA 4ZY4A 1OKWA 3H3CA 2XP2A 3OTVA 3W33A 1YXTA 4CFVA 2Z7LA 2VTPA 5TT7A 4FSUA 4BKYA 4OTDA 4QDEA 5IEXA 4U97A 3TV6A 2Q0NA 2WB8A 3VS0A 4QP2A 3CTHA 4EOPA 1YI3A 5IUGA 5IQFA 4AN2A 4F9BA 3EN6A 2HZ0A 2X2LA 4RIWB 4H39A 3UJGA 3H0YA 3Q60A 4AT4A 4FV4A 5HG5A 2XVDA 4GRBA 4ZZMA 2XAOA 4BKZA 4X2FA 4E5BA 2BDFA 3FE3A 4BDJA 2CSNA 2F9GA 3LMGA 4G3DA 3NNXA 4GJ2A 4J71A 3TZ8A 3NR9A 3RWPA 4WA9A 3GB2A 1J3HA 2VU3A 4LL5A 3BBWA 3MDYA 2PU8A 2J4ZA 4WNOA 2AQXA 3MPAA 3FI2A 3FI4A 1W82A 1XQZA 2BDJA 5J7HA 4FE2A 2WTVA 3SD0A 3W2SA 3T3UA 5CANA 5IA4A 2GFSA 1F3MC 1P2AA 4OTHA 5CTPA 3QQKA 4JL9A 1REKA 1IG1A 4O7NA 4O27B 4FC0A 4GYGA 4FVRA 5M4CA 3LPBA 2Q83A 4MXZA 4QP6A 4FIFA 5EH0A 4PL4A 5HBEA 2WO6A 3LFAA 1OVEA 4FZ7A 3VS4A 4FV2A 4P5ZA 1A06A 2BUJA 3SC1A 5H3QA 4AW5A 4FEXA 2GQGA 3EL7A 3S4QA 5HIEA 3WF8A 3VHKA 4QP4A 3FSKA 3FZPA 2XNBA 4ZS0A 3O8TA 3PXYA 3D5WA 5IQAA 1XWSA 3D15A 2BTRA 2DQ7X 1PXJA 3IW8A 4YR8A 2ITWA 3TTJA 3FKLA 4FK3A 4IFGA 4PTGA 4H58A 3VHEA 4A9RA 2X9EA 3PZHA 3A7GA 1Q8UA 1KV2A 5KO1A 4F64A 4NKSA 4TYHB 1S9IA 1XR1A 3BELA 3OP5A 3LQ8A 1T45A 3R73A 1YOMA 1B6CB 5FM3A 4RJ8A 3TN8A 4C2WA 3OWLA 3HV3A 4D1SA 4RFZA 3A8WA 4ANQA 3RM7A 5CAPA 2W1FA 3W32A 1JWHA 4U43A 2GNJA 4DAWA 1Q61A 5HCXA 4YNEA 4M67A 2C5NA 2VTQA 4O0RA 4TT7A 5H8GA 5CSPA 2BZIB 3R22A 4M69A 4CYJA 1WVXA 4AQCA 4KRCA 3RCDA 3QQGA 2W5HA 4BDFA 4E6QA 3C7QA 3DXNA 4HNIA 3A2CA 1IRKA 5EM6A 3KK8A 4QEBA 4XLIA 1H4LA 4GW8A 2X0OA 4USDA 2BIKB 4YJPA 3V5TA 3W0NA 2ITXA 3HMNA 3UP7A 3EN5A 5CXZA 3MA3A 3DLSA 3BWJA 3CE3A 2HK5A 1H24A 2PSQA 5AP6A 3H9RA 4O0VA 5EOBA 2PZIA 3F9NA 3PLSA 1S9JA 3BCEA 1LR4A 3AKJA 4ZSGA 3GP0A 4PRJA 1Q24A 5HTIA 3ZFXA 4PQNA 4ACGA 4CRLA 3VWAA 3R00A 3VUMA 4PNKA 4YBJA 2WELA 2YIQA 4RIYA 5AR8A 1XMMA 3KN5A 2O0UA 4UMQA 4QMNA 3HV7A 4OAVB 4NT4A 2F7EE 2QO7A 2PZRA 5FTOA 3OT3A 3ZXTA 4EOLA 5GIPE 3VRZA 3KMWA 5JN2A 1UU8A 3ANQA 4AW1A 5GINE 2UW4A 3PY3A 2CNVA 3LFFA 3LJ2A 3MSSA 3CPBA 5M51A 2C0IA 3LM5A 3WARA 4I23A 3GI3A 4CFMA 2X8DA 2X2MA 3S00A 4FGRA 5AAEA 5M57A 4LV7A 3UBDA 3DAKA 2KULA 4O4CA 4ASZA 1OIQA 4MWIA 2BHEA 3U55A 3FLNC 3QYZA 5AM7A 3N51A 3R8PA 5I3RA 3QRUA 3VULA 3W18A 1K2PA 3AD4A 3FPMA 5IH5A 2PVYA 1FBNA 3QZFA 4APPA 3C0GA 5EM8A 2G01A 5ANIA 3NCGA 3PE1A 4TTHB 5B0XA 3ORLA 5EFQA 2OW3A 3OTUA 5AM6A 4FV6A 1Y57A 4RBLA 1LEWA 5T3QA 3S1HA 2Y8OA 2PMNX 5BVKA 3F5GA 3QTXA 3NVMB 3F3UA 4YJRA 2C3KA 2O8YA 4U40A 4D4VA 3GC0A 4EOIA 5D1JA 3UZRA 2I7QA 4M15A 2R7BA 5EM7A 4ZOGA 3HUBA 5C8MA 2UVYA 4KA3A 4FEWA 3KRXA 2XKDA 3FYKX 3Q04A 4FL3A 4ZTQA 4TWCA 3QKLA 3Q4ZA 3B2WA 3ID6C 3AOXA 2XK6A 4ZZNA 1ZYLA 3NW5A 3UOJA 4HZRA 5AP4A 3R2BA 3PJCA 2W1ZA 3CP9A 3MIAA 4D5KA 4X2JA 4E6CA 2YZAA 1PXNA 2OF4A 2VTRA 4O1PA 5BX0A 3L9LA 4FTQA 2JD5A 3FXZA 3W55A 4BB4A 1ATPE 1V0BA 3CTJA 2EXCX 1A48A 3HECA 3TUBA 3CGFA 3R1YA 4BI2A 3COMA 3ODYX 3EQCA 4FZAB 4G31A 4QMTA 4D4YA 4C4JA 2ETKA 4YJQA 3DBCA 4IANA 3IO7A 2FYSA 5L6WL 3MFUA 3R2YA 5LMBA 4KAOA 4WKQA 4HOKA 3CIKA 2VWZA 3K5UA 4JAJA 5HEZA 4DTAA 3CC6A 2YDIA 3OBJA 1AGWA 4PL3A 4AW2A 4O7VA 4O0TA 2WIHA 4P2KA 4DH3A 2RFEA 2NYAA 1URWA 5AV3A 2J6MA 3R9OA 3V8WA 4K1BA 2Y7JA 4V0GA 1UA2A 4YPSA 5G1XA 3I0OA 4BWPA 4RLKA 4APCA 5HVYA 4M66A 5AAFA 3AC1A 4DGMA 3W0QA 4AE9A 5KHWA 4IZYA 4HCUA 3K3IA 2BRMA 1OITA 4I5HA 2X6EA 4RA5A 2R3FA 2YM8A 3BL7A 4ACMA 5BMSA 4CFNA 1W84A 3VO3A 4JMQA 3JS2A 2UZVA 5A14A 3CY3A 3MWUA 3BHUA 3SV0A 4IAZA 3ATTA 5AR7A 1J7IA 2I0YA 2OXXA 3C4CA 5HX8A 3QUPA 3E92A 4GG5A 1OM1A 2B9FA 3ROCA 4BTFA 5LVNA 4BVUA 1UU3A 3E88A 4TN6A 1H07A 4I4FA 5EG3A 2XNMA 4DGGA 4KKGA 2OI4X 5CALA 1LUFA 3ACKA 5AV2A 4AUAA 4LDTA 3L8VA 2G2IA 4FV3A 3BZ3A 3BHTA 4I94A 5L6PA 4H3BA 2PPQA 2GPHA 4XH6A 4EBVA 3P1AA 3E8NA 2H9VA 2WMSA 3TTIA 2ITZA 3V6SA 1H1RA 2YCRA 4O2PA 4F0FA 3FMMA 2X7GA 2NO3A 2OKRA 2YCSA 4EL9A 2OU7A 1PMNA 4XX9A 3UOHA 2I1MA 2JKOA 2ITOA 4D4SA 2F2CB 3QCYA 4H1MA 1SYKA 4L67A 4IM0A 5J8IA 3RAHA 1YWRA 2V5QA 2JLDA 4NYEA 2XKFA 2OGVA 3UDZA 1YDTE 1H8FA 4HYHA 5IUIA 2ESMA 2GHLA 4NH1A 5HI2A 3GOKA 1XH7A 2ITUA 2HZNA 2VO6A 2H8HA 4Y72A 4BI1A 3NUSA 3LFEA 4RSSA 4RX8A 5AR5A 4PMPA 3TWJA 3FV8A 5ANJA 5AFVA 1WBOA 2Y6MA 1VJYA 2PMLX 2WTDA 4OTIA 5E9EA 3IONA 3QHRA 1Q4LA 4J97A 3LFCA 3HDMA 3S95A 4XG8A 3QQJA 3NNWA 4WSYA 2WMRA 3ET7A 4U7ZA 3I6WA 3JYAA 5A9UA 3NUAA 5D9HA 5E7RA 3PA5A 2OBJA 5AUYA 5HLNA 2W1EA 3D5XA 4FT9A 3OZ6A 4ZAUA 1KOBA 4Y95A 3OUNB 1W2FA 4IACA 4EZ5A 3R7VA 4MTAA 3UVQA 1W2CA 2WXVA 4L7SA 3UO4A 3DCVA 2YFXA 3ZO3A 5LJJA 3KCFA 5GNKA 5EK7A 2PVKA 3ZZEA 3IGOA 3LJ0A 3QXPA 2BMCA 3ZO2A 3ZU7A 4C0TA 4AOTA 4E5WA 5BNJA 3MFTA 4ANLA 2C3IB 4MK0A 4RC3A 3ZLXA 3NZ0A 3RCJA 2DS1A 1ZYDA 4GUBA 2JEDA 4GCJA 4I5CA 4QQJA 3KVWA 4NTSA 4AA4A 4IWPA 4TPTA 4BDHA 4CMOA 4CV9A 4I22A 4KIKB 3I5ZA 1RE8A 2VZ6A 3DJ6A 3ORIA 1XKKA 3Q4UA 4M68A 4R1VA 2X9FA 4V0GB 2PZ5A 4CTCA 2R5TA 1UNGA 4BZOA 2CHLA 4HVGA 1PHKA 4FV5A 2C68A 4J7BA 2QONA 3IW7A 3PIXA 5IQDA 4C4IA 4FKJA 1ZZLA 5CQWA 5A3XA 3CSVA 4LI5A 5FEEA 4CFFA 3U9CA 5AUXA 2UZUE 2UW6A 4UWBA 3LCDA 5DPVA 2C0OA 3MV5A 4UZHA 1PY5A 5E4HA 3P5JC 5HTCA 1ZAOA 2OJJA 4FNZA 4MF0A 4Y46A 5CU2A 1CKJA 3P79A 4EH8A 2YDJA 3SOCA 3DJ7A 2YLFA 3EKKA 3RNYA 3ZUTA 4QMWA 4GFMA 1ZMWA 4UXQA 4FF8A 5IA0A 1Y6BA 1OUYA 4IWQA 5AAGA 3U8WA 4E26A 3KF4A 3QCXA 4XG4A 4ACDA 4EZ3A 3Q2JA 4AQKA 4JBQA 2XCKA 2XEYA 4O96A 5LCKA 4L8MA 2RFSA 5LWNA 4WBOA 4X6RA 4AS0A 1ZXEA 4F70A 2YJRA 3ANRA 4Z55A 2AUHA 3DXPA 2OIBA 5J79A 3K2LA 1WVYA 3E93A 4D28A 4FKLA 3NNVA 3ZTXA 2XRWA 3IOKA 2J5FA 4IX5A 1JLUE 2W7XA 4JBVA 3BPRA 4DHIB 3RJCA 5JSMA 3SXRA 2QR7A 2OICA 4E7WA 3FEGA 5J9ZA 1O9UA 2BZKB 4M3QA 1LEZA 3ZSGA 5J5SA 4EK8A 3MH1A 1WBNA 1OMWA 2XJ2A 1JSTA 3PRFA 3B2TA 5A6NA 1F0QA 5C8KA 5AV4A 1GIJA 4AXFA 2EU9A 4NZWB 3QTIA 4QP1A 4AGCA 2W05A 2P4IA 2Y0AA 5D41A 4IE9A 4YZNA 4FL1A 4M14A 4M0YA 3Q5IA 3W0OA 4MQ2A 1SNUA 1R0EA 4AAAA 4C62A 4LMUA 4KRDA 5F95A 4HCTA 5KZ0A 5HNIX 1OIUA 1IASA 4G9CA 4CGAA 1Q41A 3I79A 5EKNA 3C1XA 3BGQA 2RG6A 2QD9A 4EH6A 3KY2A 4BBEA 3Q9XA 3BEGA 3RPSA 4J1RA 2ETMA 3FLQA 2W1DA 2Z7SA 4CFWA 4N57A 3TYKA 2OK1A 1T46A 3ULIA 4ITHA 4FT3A 2QCSA 4X6QC 2C5XA 3F3ZA 1OL1A 4RVTA 4IIRA 5BMMA 3K54A 4YTCA 3SVVA 3LKMA 4DFXE 3LLTA 1R0PA 3KC3A 4GL9A 4NFNA 1E1XA 4I92A 3TV4A 4AGDA 1P4OA 4E8AA 1JKKA 5FDPA 3EQFA 3R7IA 3P08A 4CG9A 2XALA 4WG5A 4O0YA 4AW0A 3DU8A 4FUXA 3IGGA 2J0KA 5ANEA 3TZMA 4MNEA 2ZDTA 5AUTA 3DKOA 3BIZA 4S33A 4AWIA 4D55A 2ZV9A 5EM5A 5KX8A 2UZDA 4YJUA 3SG8A 2R3JA 4J96A 4M97A 5AR2A 5E8UA 1YQJA 3W0MA 4DG0E 3PRIA 5CVGA 4FTUA 4LGGA 3PXQA 5HIDA 5JMSA 4IZ5A 4ANOA 2UZNA 3DKGA 3AMAA 3O0GA 4ONAA 2RG5A 5BUEA 4QTEA 4G6LA 1U59A 1YXSA 2YIYA 4W4XA 4ZY6A 1M7QA 3FC1X 3FSFA 3GCQA 3RPOA 4ZZOA 3EQPA 1DM2A 3OMVA 4TNDA 3UGCA 2IO6A 3MVHA 3O7LB 4U9AA 3QWKA 4FKSA 3FXWA 4EOOA 1PKDA 3NYXA 5DRDA 4PDYA 4B0GA 4DG3E 4XUFA 4FL2A 4O7ZA 3BE2A 4FIEA 4IX3A 4C02A 4CKRA 2QLUA 4PF4A 5DFPA 2EWAA 2RFNA 4L46A 3ZLSA 4D9UA 1H1WA 3WZEA 3SG9A 3QFVA 4QMVA 3M11A 1Q62A 4WIHA 4F09A 1OKVA 5ANDA 4L01A 4E4LA 3C13A 3NAXA 4MD7E 4BDBA 4D2SA 3AKLA 4FI1A 2OWBA 4CG8A 2CKEA 1JSVA 2WU6A 3GCVA 2B9JA 3NIZA 4R3CA 4CZTA 4EH2A 4JXFA 1P14A 3KRJA 3M42A 3R8MA 4RA4A 5L8JA 2YDKA 2R3HA 4EH9A 4Y5HA 4AGWA 1OPJA 4U79A 4U80A 3ULZA 4GVAA 5ACBC 1Q5KA 5EI6A 3UDTA 1YHSA 2YJSA 5E8YA 4QPMA 5HVJA 1H01A 4F7NA 5I9VA 3UP2A 3MESA 2R2PA 5IA1A 4ZTNA 1BYGA 3MH3A 2J90A 2J9MA 3LXLA 4FG7A 2F7ZE 3QZHA 3OEZA 4FT5A 3KVXA 4FT0A 4K9YA 2C47A 2BZJA 4QP9A 3TNHA 3MN3A 1WBSA 2XM9A 1MQ4A 1GZ8A 2WTJA 2I0HA 3CQEA 3PJ3A 3CQWA 4L3LA 4LOPA 2PTKA 2Y9QA 3GQLA 3I7BA 3ORXA 1ZY5A 4FZDB 3QUDA 3HZTA 5C9CA 4XG7A 1ZMUA 2VO7A 2I0VA 4EH5A 5AP0A 4N0SA 3UMXA 2VO3A 1TKIA 3THBA 5CEMA 1ST4A 3UO6A 3V04A 1XMLA 3Q9ZA 3R01A 4L00A 1GNGA 3ZFMA 2F2UA 2BAQA 3OXTA 5K0KA 5L2TA 2XJ0A 5FQDC 3FXXA 2J2IB 2W1CA 2IZSA 3HMOA 2YLEA 3ZRMA 2PVJA 4O82A 1OL7A 4PP7A 1O6KA 2WIPA 2QOBA 4EQUA 3OBGA 2PMOX 4KIOA 4FG9A 5ETIA 2Z7QA 3D5VA 4BBMA 4MNFA 2QOIA 3KRRA 3R1QA 4CYIA 3WZUA 2C6IA 4O7RA 2BAKA 3RAKA 2YM3A 4MNEB 3LLAA 2QOCA 5K5NA 5E8VA 5JQ5A 3MGYA 4A9TA 3ZUUA 3DT1A 3VUKA 4FEUA 3FKOA 4JDKA 2XK9A 5HO7A 3ALNA 4K18A 1KSWA 5IQHA 2IF8A 4FKPA 5IMXA 3EQIA 4RQKA 3QZGA 5LVLA 2QKRA 4E93A 2PULA 3FPQA 3R7OA 4F65A 4FV0A 3OWPA 4MBIA 3VBXA 4HVHA 2WQOA 2C30A 3L9PA 4IAKA 5GHVA 3C4ZA 4EHVA 3DAEA 3VN9A 2UVXA 4BCHA 5HQ0A 3WBLA 5AV1A 2R3PA 3RALA 3CD3A 5HX6A 4ALVA 3B8QA 4DT9A 3ML1A 5AX3A 2I40A 4HGLA 5FM2A 4RMZA 3W2RA 3ZH8A 4LM5A 4EC9A 4RJ6A 4ZY5A 1KE8A 1MRUA 4AXDA 2ZAZA 3BYOA 4NW6A 3ORNA 1PXOA 4MWHA 1QMZA 2JDVA 3LAUA 1URCA 3E7VA 3L9MA 4WG3A 5HG8A 3H30A 3VS1A 4PUZA 3ZRLA 2QOQA 4RJ4A 1YXXA 3AC4A 4WHZA 4FKOA 4FODA 4EOQA 4FTJA 2UW8A 3KQ7A 2IZUA 3GCUA 3DPKA 4BF2A 1GZKA 2HOGA 3E8EA 4Y5QA 5CZIA 4YTFA 3OD6X 3QTRA 2XYNA 2ZB1A 4U3ZA 4YPDA 4ZLOA 2PMIA 5BYLA 2VTJA 1ND4A 2FGIA 5TE0A 2WQEA 3EN7A 4C4EA 5EYDA 3EFLA 4EQCA 4IM2A 4XLVA 1XBAA 4C4HA 3R83A 4IFCA 3E63A 3HP5A 1TVOA 4I0TA 3PIYA 4NM5A 4BIBA 5CSXA 2Z7RA 4A4LA 3KF7A 3QA0A 4M8TA 1NVRA 2WD1A 3DJ5A 5IUHA 5DYJA 2X1NA 3OW3A 4XMOA 5E8WA 3TG1A 3DZQA 5LOHA 4F9AA 4XS2A 5HU3A 4PTCA 3KXNA 4C4GA 1H08A 1CMKE 2C6DA 5CAUA 3N9XA 4IBMA 5CU0A 2VX3A 4KKEA 4K6ZA 5FG8A 4F99A 2VTHA 2J0LA 4MBJA 2J5EA 3PY0A 2QHNA 5IA3A 2CCIA 3JPVA 5CSHA 2OJIA 3F5PA 3QZIA 4KSPA 5CXHA 2CPKE 5ANGA 4QYGA 3SOAA 4ZLZA 3IQ7A 5AIKA 4CTBA 4FR4A 1E9HA 3GOPA 4MHAA 1MUOA 4ID7A 2C5VA 4O38A 3C4FA 3R7UA 2CKOA 5ACKA 4H36A 5FTGA 1X8BA 4AF3A 4UMPA 2W4OA 1DAYA 5CI6A 4ZMEA 2PVFA 4II5A 5D7VA 2WTIA 4K33A 4FSTA 2OIDA 5K4JA 3Q3BA 3ZM4A 2WOTA 5HE1A 2C6EA 1U54A 5DHJA 3GU4A 3I7CA 3QQUA 4RT7A 3TI1A 3MB6A 4BCGA 4D1ZA 4UMRA 1ZRZA 2P3GX 5I9XA 5IZFA 1FPUA 1FMKA 4U81A 5D7AA 3LM0A 4W9XA 4TZRA 5FLFA 3KRLA 4GIIA 2BKKA 3TACA 4FZ6A 3ITZA 3I81A 4BFMA 2V55A 4RWJA 4YP8A 5LQFA 4KBCA 3AT4A 3DS6A 4BICA 5KMIA 4OBOA 2O63A 5CI7A 4BCKA 4BCJA 3ZS5A 4EBWA 2ZM4A 4X0MA 4DEDA 5IH6A 3ZUVA 4I3ZA 1UU9A 3BHHA 5JFWA 3C4EA 1V0OA 4DBXA 4AN3A 2XIYA 4NIFB 5FDXA 5IDPA 3TDVA 3V3VA 1ZY4A 3FUPA 2RF9A 4EH7A 2P55A 2R3OA 2QC6A 3OG7A