1ZOEA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase CK2, alpha Subunit
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 103
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zoeA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zoeA02
4IX4A 4BDEA 1Q62A 3C50A 4ZTRA 3G90X 3E5AA 5IU2A 3QCYA 1QPEA 3EL8A 2Z7RA 3P08A 4LGDA 5BVDA 3RWPA 1XBAA 4UMUA 3GT8A 4JBOA 5E8XA 4FV0A 3KMUA 1FMOE 1BYGA 4YSMA 3A61A 1JLUE 3CQWA 3PA4A 4ZXTA 5DE2A 1UWJA 3VF8A 2VTJA 3KRWA 1GIHA 2OIBA 2OBJA 2PVMA 4DG0E 2I0HA 3MDYA 4CZTA 4PWNA 4ITJA 2Q0BA 1OL7A 4D5HA 4FICA 4AA5A 5I4NA 1OECA 5CAUA 2R2PA 1GZ8A 2X9EA 3Q3BA 4QTDA 4FV7A 3NIZA 3NUAA 5JK3A 3LFCA 3BIZA 2G2IA 2VTNA 2W1CA 2XIKA 3DBDA 1J1CA 3QQHA 4JDHA 3TL8A 4ANNA 3V8TA 1E1XA 4RVMA 4FL3A 2YIYA 3RVGA 4ALWA 4FEWA 3FXWA 3H0ZA 4RIXB 2WFYA 3W2CA 2IZRA 5AADA 5L3AA 4BICA 3ORLA 4L45A 4EH9A 5K5NA 4C57A 4MYGA 4YHJA 1FINA 5BNJA 3FI8A 5A9UA 4JAJA 3FKNA 2W5BA 1A9UA 3IW6A 3SXFA 4TWNA 5IUGA 3EMGA 2JIVA 4BI2A 3JR1A 4LMNA 4D2SA 2FGIA 4O0SA 1WBWA 4F70A 1NVQA 3VWAA 5JGDA 4ENXA 3SG9A 2UW0A 4RIWA 2C6DA 4ZTHA 2CCHA 2H8HA 4BTKA 4CG9A 3RPRA 1YDSE 3R8UA 3DB8A 2JIIA 2OXDA 4NCTA 4E6CA 5AP5A 2X6DA 3TIZA 4OBPA 1YHSA 2V62A 5ANOA 3ZC6A 2G9XA 4XG8A 4D2PA 5FP5A 4AW0A 5AEPA 3ZBFA 5C26A 3W18A 5J79A 2VGPA 5EQYA 5IMEA 2IW6A 2VAGA 4CRSA 3OCGA 4JIAA 1IAJA 1KE8A 5I9VA 4A9SA 4ONAA 4M0ZA 4CLJA 3PJ3A 3ZRLA 4JG8A 4IX3A 3D5UA 4K0YA 5CZIA 1ZYSA 3KQ7A 4CV8A 3VULA 4B8LA 3ZSGA 3BWJA 5CSWA 4BKZA 3P1AA 4FTNA 4B0GA 3BQRA 4EL9A 3FQHA 2X2KA 3F3ZA 2GFSA 2RFEA 3QTZA 5CU6A 4EOKA 2WMUA 3BYSA 3BPRA 3CPBA 4IB5A 2ITUA 2OJFE 4LV8A 3OBGA 5EHLA 1GZKA 4YZCA 3VIDA 2CSNA 3RI1A 4KB8A 4V0GB 5TF9A 3QQUA 5JFWA 2XEZA 4B9DA 2YCQA 3COKA 3E64A 3PLAE 3NUSA 1QPCA 5FXSA 2UW5A 2BZIB 2OGVA 4JLCA 4BCHA 2GDOA 5IG1A 2IVSA 2WTDA 2OKRA 3B2TA 2XNOA 4S30A 3EQGA 1YRPA 4UYNA 1H1PA 2PUPA 3GUBA 4YJRA 1OZ1A 2J0LA 4HCUA 4TNBA 4WUAA 2B53A 2J5EA 3R7UA 3RAKA 5CEKA 3R8LA 3V8WA 3TTIA 2BIKB 4ZK5A 1OL5A 4C38A 3ALNA 3R7IA 4O7TA 1PYXA 3Q4ZA 5J9LA 4ARKA 3F3WA 3OTUA 3DAEA 4DGGA 1YDTE 4OR5A 4KUJA 5DYJA 2IG7A 3NR9A 3TV4A 4FTQA 4YZMA 2OZAB 3VNTA 2E9VA 3BE2A 3PLSA 4BBEA 5KMJA 5IA3A 4JQEA 1FVRA 3ODZX 4FYOA 5IA0A 1YI4A 1VYWA 1ZYLA 4DN5A 2GNIA 4EBVA 3NNXA 3FY2A 3POOA 4B8MA 3LKMA 1OMWA 3AMAA 1H07A 4LMUA 3ZLSA 2JAVA 3IPHA 2IWIA 5HI2A 4AGUA 4PMPA 3JS2A 4DEGA 3AD6A 1NT2A 1QCFA 4M8TA 3ZSHA 1YOLA 4E5WA 2VWXA 3BHHA 4FYNA 3QQKA 4YZNA 4J7BA 1PXMA 3R8VA 2C1AA 4YURA 5IH4A 3NCZA 2CGWA 1CKIA 5A4TA 2FSOX 5AAGA 2VGOA 3D4QA 4OTDA 4B99A 4QTCA 4I23A 2J2IB 2ZV9A 4FVQA 2HIWA 3F2AA 4OBOA 5AR3A 5TR6A 4BDAA 4EONA 2YHVA 4IWOA 3SDJA 3CD8A 3W10A 5AR8A 3TWJA 3HRFA 3TUDA 1XR1A 5JEBA 2PMOX 4OTFA 2BFXA 2VO3A 2BCJA 3G0FA 3AC1A 5FEDA 3QD3A 3FHRA 3R28A 1Q3DA 2XK7A 4EHEA 5IQGA 3KKVA 2XNMA 3E8EA 2AUHA 3PXYA 3LQ5A 4U44A 4XP0A 3WF9A 4AGCA 3EFWA 4D4RA 3D5XA 4N6YA 3R30A 4LFIA 4C62A 4BCMA 2W06A 4GH2A 3UGCA 2CNVA 4KS7A 3LQ3A 3ZYAA 5HNBA 3MVMA 4XUFA 2BDFA 3IDPA 3PSBA 2NRYA 4X3FA 5FDXA 1KV2A 3ACJA 4FVRA 2Y4IC 4X2FA 2GNGA 3VJOA 3SGCA 4UALA 3V51A 2W7XA 4C02A 3KN6A 4MQ1A 4TY1A 2QVSE 5JFXA 3PZHA 3KL8A 3TV7A 1WVWA 4FZ7A 5AUWA 5BVEA 4D4YA 3U9CA 5J95A 2XRWA 3OY1A 2HY0A 5L4QA 3SRVA 3C5IA 2QOQA 3EN4A 3CSVA 3NVKI 2HXLA 5ETFA 3FXZA 3E3PA 4BBMA 1P2AA 3G6HA 3KB7A 5EHYA 4M66A 3BI6A 3FLYA 4O91A 3UMWA 3LMHA 2JDOA 3KGAA 1JKLA 4RVKA 3POZA 3BKBA 5B2LA 4YR8A 3CD3A 4HVHA 4D1XA 5I3RA 2ONLC 4D9UA 4D2RA 1WBOA 3O51A 5L8JA 2XVDA 5AUTA 3I60A 1QMZA 3QRKA 3GC7A 4N70A 4QNAA 3CIKA 4RC2A 1JKTA 4XCUA 4XG6A 3CJFA 3QX4A 4BDDA 1STCE 3V01A 2QHNA 3KVXA 5DIAA 2VTHA 5GIPE 1ZMWA 4FEVA 3D0EA 5EI2A 3IW7A 2V22A 4R6VA 1Y91A 1XQZA 4U5JA 1JAMA 2UW9A 1R1WA 3R9HA 5FD2A 5EQPA 5DA3A 4GS6A 5ANEA 3HECA 4FSZA 4W4WA 3AT3A 3F69A 4FSRA 1AGWA 2Y0AA 4ZJVA 2PY3A 3IOKA 5KMMA 1MUOA 3HUCA 4H36A 3PA3A 4FNZA 2XYUA 1JSVA 3FLWA 5CEIA 3D5WA 4J8NA 2R3HA 3VBYA 4FIFA 5FG8A 4F6WA 3Q60A 3D5VA 4Y5HA 5HG7A 4KD1A 3EHAA 1OI9A 3KC3A 4XH6A 4YC6A 4RWKA 5DOSA 3VRYA 3W32A 2XNBA 3PY0A 3TKHA 2QO2A 2XKFA 3O2MA 4IVCA 2CGUA 2ZV8A 4YJOA 2IVTA 5IH6A 4FL1A 5L2IA 2RF9A 4LGGA 1YW2A 4FKVA 4X7QA 3TACA 4IWPA 3WIKA 5IQDA 4H1MA 2YIXA 1IA8A 3C4ZA 3HMMA 4GL9A 1IRKA 1BL6A 2HWOA 2YLEA 3QLGA 3TNWA 4KBKA 2DS1A 3GQLA 4IDTA 5HO7A 3DZQA 5M51A 3TEIA 5L2TA 1V1KA 4EYJA 2OJGA 4FNXA 3ETAA 4I1ZA 1FPUA 5J8IA 1WBSA 1ZZ2A 2W9ZB 4EORA 2NO3A 4BZOA 4I4EA 4O0VA 4L67A 3MBLA 1FVVA 3R04A 4U43A 2PVNA 4AGDA 3FZPA 4L68A 3R8PA 3QF9A 3FKLA 3LFEA 3F3UA 4QP3A 4D55A 4TL0A 2B9IA 4O86A 4IAAA 1BI8A 1ATPE 3OWJA 2XIYA 5AV1A 4DH8A 3DLZA 5CT7A 4EH6A 4IVBA 4LL0A 3BBWA 5DT3A 5M4IA 3U6IA 5IDNA 2ITVA 3TUCA 4NKSA 2OIQA 4XLIA 4R78A 4RVTA 4XBRA 3NSZA 4DFUA 1K2PA 4AACA 4BCQA 5E4HA 3ORTA 2C69A 4G3CA 3GU7A 4FKTA 3F6XA 3MB6A 3ENMA 2R64A 2C6MA 3DDQA 3LIJA 3ZC5A 4BZNA 1Q8UA 4BCKA 2XIRA 4BY9E 5AM7A 1PXIA 3V5PA 3W2OA 3ZH8A 4GKHA 4P4CA 1ZXEA 1NVRA 3QQFA 4ZS0A 4RVLA 4IADA 4NIFA 3WYYA 3DXPA 3PXKA 4IB1A 1UNHA 4EOMA 3Q5ZA 2GQGA 3DJ6A 4GUBA 1R39A 4FKLA 4LL5A 1F3MC 2J0JA 4HZRA 1VR2A 2C0TA 4AOJA 5FBOA 5BYLA 2VX3A 2PVHA 2UZVA 3IONA 5JRQA 1ND4A 2YDIA 3BHUA 4YMJA 4BN1A 5CVFA 5B2KA 2WKMA 2RGPA 4JX7A 3MA6A 3PSCA 4GJ3A 4FTRA 4II5A 2X8DA 2J0IA 2UZTA 3P5KA 4YBKA 2QKWB 3KRLA 4MNEB 3H3CA 4XV3A 4R3CA 2XM9A 2H9VA 3ZUUA 2B1PA 3ITZA 3HDMA 3QCSA 4XLVA 3ORPA 2ZM4A 1B6CB 4QTBA 2VWYA 3IS5A 3KK9A 3MGYA 2QC6A 1OPLA 4OTGA 4AAAA 4AW2A 3FYKX 4C61A 2CGXA 3UJGA 4FTOA 4EQCA 2PU8A 4FE2A 1CKPA 3UC4A 4GIIA 4FBXA 5HCZA 3DB6A 2AYPA 4MXXA 2BHEA 2ZV2A 4FG9A 3R21A 4GUEA 2R3GA 3FY0A 4IWDA 5F95A 4F7LA 2ACXA 1RW8A 3BV2A 5HX6A 3QUPA 4NM7A 5E8YA 5HO6A 4OT5A 3IGOA 4YO6A 5HIDA 1YDRE 2R3PA 4F7JA 4GCJA 3MVJA 4YJPA 3UVRA 3HMOA 4K2RA 2UZDA 3U8WA 3AC8A 1OIRA 2XK6A 4FKPA 4ACGA 3P23A 4K9YA 3MPTA 5L2WA 3OW4A 5CQWA 1PXLA 4LGHA 4APCA 4DGOA 4EUTA 5KNJA 4PQNA 3LAUA 4MXOA 5HE1A 3HNGA 4A4XA 4DA5A 2LAVA 3LCSA 1YWNA 4W4YA 5HTIA 2JKQA 2QR7A 3BE9A 2PUUA 2OG8A 4G6LA 3TKIA 5C1QB 2XUUA 4L46A 3KXXA 1BUHA 3ZXTA 4AX8A 4IB3A 4A4OA 4RLKA 4FV5A 3LE6A 4WD5A 3QGWA 3OS3A 1XWSA 4RJ7A 4PMMA 5AP6A 3WIGA 5AP4A 2YCRA 4UY9A 1F0QA 5JT2A 2GSFA 3LXNA 4FNYA 4KIKA 2XRUA 4IW0A 5HG8A 4O38A 1Q61A 3IO7A 3GBZA 4Z16A 5TKDA 4A7CA 2UW6A 4CG8A 1U46A 3QTWA 1CM8A 1FVTA 2R3NA 2ITYA 5J87A 4EOIA 5LOHA 5AP7A 4DFNA 3FI3A 5EK7A 3RM7A 5AWMA 3OXTA 3NGAA 2VTSA 5AIRA 4DAWA 2CHLA 5I9ZA 1UU9A 3BYMA 2ZM1A 2KTYA 4G5JA 4IWQA 3B8RA 3NYXA 3U87A 4XYFA 5TT7A 3TJDA 4JVGA 4BZDA 4QMYA 3PVGA 5M4UA 3UTOA 3CKXA 4MCVA 5CNOA 4G2FA 4AN2A 1NY3A 3ULZA 4E4NA 4NL0A 3BYVA 1ZYDA 2JKMA 4BDBA 2YIQA 1H24A 4EOOA 4CMOA 3Q6UA 3IGGA 2BR1A 3G51A 4ASZA 4I4FA 1H4LA 3GP0A 4IZ7A 3ZDUA 4TWPA 3R1QA 1IG1A 3FLSA 3K2LA 4IVAA 4O22A 5FTQA 4EYMA 3PXFA 2G15A 2XYNA 3HP2A 4JQ8A 5IA5A 4D2WA 3LXPA 4P90A 4YU2A 5CALA 3QUDA 3GOPA 4I21A 4YPSA 1H1RA 2CCIA 4EH3A 5CSXA 4M14A 2P0CA 3HV3A 5L6OA 1YQJA 3PP1A 3Q5IA 1QPJA 3C4XA 3DBFA 4L3JA 4TPTA 4IAKA 1TVOA 4YP8A 5KMKA 2C6IA 4USEA 5D11A 3QQGA 1H26A 4I22A 4G1WA 4H1JA 4FV9A 1DAYA 5EYKA 5HLNA 4NYEA 4G3DA 5DI1A 4FODA 5IQBA 2R3KA 4ID7A 4X3JA 5AR2A 5HU9A 4YSJA 3QHRA 2X2LA 5IH5A 3OG7A 1Y8YA 4HZSA 4CRLA 4XMOA 4EH5A 5T68A 4DT9A 3WE8A 3VRZA 3EL7A 2ZMCA 3HL7A 3QWKA 3K5VA 4JR3A 3BZ3A 1OUKA 3EKKA 2UVYA 3JPVA 4GYIA 4QMTA 3E92A 2B54A 4FZFB 5C4LA 1F5QA 2HW7A 4S2ZA 4RQKA 3OOGA 4DFBA 2GNJA 4W8DA 2YM6A 2OJ9A 3E87A 3OUKA 3ZM9A 3RPOA 4XG7A 4AQCA 5LMKA 2ZYBA 5FTGA 3W55A 2F49A 3TNIA 4C7TA 2HCKA 3TZ9A 4F0GA 5IEVA 4ZSLA 4GK2A 4BYJA 4JDJA 2E9OA 4J96A 2RL5A 4DT8A 3L8PA 4E1ZA 1B39A 4QPMA 1RE8A 2O3PA 4RG0A 5IQEA 2YA9A 3R7GA 5J5SA 3MFTA 4BHNA 5M09A 2VO7A 4JJRA 3GQIA 2NRUA 3UZPA 4Z3VA 3PXQA 3Q6WA 2EXEA 2ITPA 3FZTA 3MB7A 4FT3A 2JFMA 3HDNA 5J7HA 3FDNA 3U6JA 5CI7A 3A7IA 3S0OA 5T6KA 3FV8A 3QD0A 4F7SA 2IVUA 1H08A 2C1BA 2VTIA 3KCFA 1JWHA 4NJDA 3MPMA 4I93A 4CFXA 1ERKA 1M14A 1UU3A 4GT3A 4PNIA 3AT2A 5CEQA 4AZTA 3QD4A 4DTKA 2WTKB 4ENYA 4CKRA 4HVIA 3CJGA 5GJGA 2C0IA 2HZ4A 3PFQA 4RJ5A 2Z7SA 3B2WA 5AP0A 1UKHA 4TW9A 3AMYA 4TYJA 4FV4A 3F7ZA 3O7LD 3RK7A 5AA9A 3KRJA 3SA0A 1M7QA 5CAOA 4RIYB 2X2MA 1WVXA 2B7AA 3GC8A 3KA0A 5BVOA 3P78A 3P4KA 5HHWA 4FG7A 3V6RA 3L8VA 4CZUA 2OZOA 2UW4A 3KU2A 1HOWA 3FI4A 3EZVA 2PE0A 4J97A 4L52A 2QOLA 2O5KA 4PTCA 5HLPA 4FSQA 4L7SA 1Q8WA 4LYNA 3NPCA 4ERKA 3UODA 4BIEA 1IR3A 4IAFA 4RX7A 1PYEA 2PVLA 2PE2A 4L3PA 4V05A 4DH5A 1OPJA 3F82A 3VJNA 3ATSA 4NWMA 2CKOA 1JSUA 5IQIA 1V0BA 3KXNA 2F2UA 3Q9ZA 3KXHA 5EM6A 2WOUA 3P79A 5FRIA 3OWKA 4DGNA 2WMTA 1KWPA 4LRJA 4NCTC 5EYCA 4UZHA 3CKWA 2EXCX 2XZSA 3DAJA 2GNLA 3UIXA 1GOLA 2J9MA 1NXKA 4M13A 3DJ5A 4JBVA 3UZTA 3A7GA 1O6KA 3QZGA 4M68A 4AOIA 3MPAA 5CLPA 5AX9A 4J99A 4BVUA 3ORXA 1IASA 4P5ZA 4B7TA 4JNWA 2A27A 3VVHA 5A6OA 5D7AA 5DGZA 2FB8A 5F94A 1MRVA 4FOCA 5H8GA 4BDJA 5BYYA 3TV6A 2X39A 2W05A 5AUZA 2F9GA 2X9FA 4H3BA 3VUGA 1W8CA 4C37A 4RGJA 2C5XA 2QI8A 4YJTA 5ETIA 1L8TA 3EWHA 3GCVA 4O1PA 3SXRA 3BLRA 3W16A 3IKAA 4D2VA 3ROCA 1APME 4EQUA 5IMXA 5CXZA 1BX6A 1YVJA 3QTXA 3QRJA 3COIA 4HJOA 4IM2A 5LVLA 2C30A 2YABA 5LQFA 5K3YA 5M55A 4AE6A 4KIOA 2VUWA 4OT6A 4I5HA 3PVUA 3KULB 4F9AA 4FTCA 1I44A 3DAKA 4JI9A 4QP9A 2ZJWA 3REPA 1H0WA 3GC0A 2X0GA 2F7XE 4K77A 3UNJA 2WQNA 4EZ7A 5GZAA 4DFLA 2XNEA 4HCVA 5DMZA 3QX2A 2GQSA 1ZYCA 3LFNA 2YM4A 2QOHA 3HKOA 5HG9A 4JQ7A 4BDIA 5I9XA 4G34A 3FMNA 2QHMA 4RFZA 1IAHA 4GFGA 3CQUA 4EOLA 4R3RA 3P86A 4FMQA 2UV2A 5FGKA 5JZNA 5LVMA 3U9NA 4ASXA 2WTJA 4AT5A 5GZ8A 3H0YA 2ZV7A 3UG2A 5H8EA 3C4FA 5AP1A 3OD6X 1OL2A 2I1MA 3LJ0A 3WBLA 2I0YA 3JY0A 3NLBA 3R6XA 1Y8GA 4ZTNA 4FSWA 4ZZNA 3L9NA 4FKOA 5FBNC 3N9XA 4RC4A 5G1XA 5GJDA 4QP1A 3GGFA 2YM7A 4U3YA 4GU6A 4W9WA 3SOCA 5DPVA 5DFPA 4GYGA 3A2CA 1HCLA 4ANOA 2XJ1A 3SLSA 1T46A 2YWVA 1W84A 2J90A 3G5DA 4BCPA 4O81A 1A48A 4ZMFA 3UDBA 3WZKA 2PTKA 4F1MA 5K5XA 4PPCA 3OWPA 3PA5A 2Z8CA 5CF5A 1OPKA 4GK3A 2BTRA 4GW8A 4FKSA 4YZ9A 4U3ZA 4NW6A 4XG3A 3GI3A 3FWQA 3CGFA 2UW8A 2YLFA 3OCTA 4BGHA 2J0KA 3LFFA 2RIOA 2YITA 2B0QA 4XX9A 4PMSA 4J53A 3ZZWA 4CXAA 4ZIMA 1K9AA 4QMZA 3SV0A 5JFVA 4FKQA 2RG6A 4BC6A 4O7SA 5ACBC 4ORKA 4EEVA 2PE1A 3I6UA 2ZDUA 5EYDA 4HGEA 2X8EA 4Q5EA 4MF1A 5IQCA 2V5QA 4JT3A 2BPMA 1GNGA 4JR7A 4BHZA 5BUJA 4ZSEA 2BKKA 4MEDA 2VTTA 3HMIA 4MBIA 3NCGA 3I5ZA 4FKWA 4YNEA 1OIUA 4AW1A 5IZFA 3HP5A 2HWPA 3QC9A 2C6OA 4UWCA 5K4JA 5C8MA 2W96B 5AFVA 3G9NA 3VS1A 2UVXA 4DBNA 2HW6A 3IW5A 2BDWA 2VX1A 3PDTA 3QBNA 2EVAA 3OROA 4XRLA 4FT5A 3QTUA 2IZUA 3UMXA 4F09A 2ETKA 3NDMA 5E91A 2HAKA 5FEQA 2FYSA 2OWBA 2P3GX 1L3RE 3NNVA 2J5FA 2UZLA 2R9SA 2XKEA 3GEQA 4K6ZA 1JNKA 5FLFA 3RPSA 4CFNA 1DI9A 4X3FC 2WOTA 4RFMA 4USFA 5J1WA 2OXYA 5L2SA 3FYJX 4RRVA 2PZ5A 5IQAA 4DBXA 3CY2A 4FKRA 4EK8A 3NX8A 4XG9A 5CANA 4LRKA 4GKIA 5DT0A 3NNUA 4OTWA 2PHKA 2A4LA 4EJ7A 3IDBA 5LMAA 2WU6A 1YOMA 4QMUA 4RWJA 4DH1A 3HLLA 4CTCA 4WHZA 4YC3A 5CZHA 3L8XA 3ALOA 3OC1A 1UNLA 4ZS4A 5JMSA 4JRNA 4V0GA 2YM5A 5L8KA 3QZFA 4WT6A 4QPAA 3R1YA 3NUNA 5F4NA 3LHJA 4IX6A 4Q5HA 4TXCA 4WSYA 3RM6A 5M56A 1M2PA 3CC6A 1WBPA 2VV9A 3OXZA 3Q2MA 4AU8A 4DTBA 4Z9LA 3SG8A 5FTOA 1PHKA 3Q4UA 5HE2A 3NIEA 5GIOE 4MAOA 4H39A 4QQCA 3DDPA 1OIYA 3F3TA 4WNOA 5HE0A 1M52A 4PDSA 1U54B 3AC5A 3BHVA 3ZO1A 5BVNA 5KCVA 1XBBA 2YJRA 3SVVA 3C9WA 3G2FA 5I5ZA 3DQWA 2YACA 3HV6A 4FZ6A 5JZJA 3MY1A 3PY3A 4XP2A 2VRXA 3UP2A 4AG8A 4R7BA 4MXYA 4NM3A 4RBLA 4M69B 2CN5A 3M11A 3F5GA 3R63A 5CTPA 5ETAA 3V5JA 3RAHA 1PY5A 4ZY6A 3MS9A 3EN9A 3VBTA 3WF5A 1GZNA 3EFKA 2OZAA 1M2RA 1Y57A 4ZSAA 1XH9A 5HNIX 2CKEA 3P7BA 5BQ0A 2WELA 1NVSA 4H3QA 2R3OA 4KIPA 4QYFA 3ZEWA 2C4GA 4A9RA 2QOIA 3W8LA 5M4FA 3VC4A 3OW3A 3EZRA 4MVFA 4R5SA 1SVGA 5HCXA 4E5AX 5AA8A 4WA9A 4IZAA 3T9TA 4ANQA 4AZFA 3GCPA 5E92A 3KK8A 4TYHB 3NVMB 1GIJA 1V0PA 4GMYA 4IX5A 4UB7A 2WMXA 5AUXA 1NW1A 2XP2A 2YDKA 4O0WA 3GOKA 3FZOA 3EN6A 2CLQA 3HAMA 3BGZA 4FIGA 3EFLA 3EOCA 2PZRA 5ETCA 3LJ1A 3T8OA 2XS0A 4AA0A 4YZDA 5LWNA 3BEGA 2OIDA 4D0WA 2I7QA 3ENHA 4O6EA 2O8YA 3VS7A 2XA4A 4E6QA 4FTMA 4UWYA 2JAMA 3PSDA 2ETRA 4NFMA 4O7RA 3Q4CA 3PJ8A 3H10A 4KABA 4YJSA 1PRYA 5LVOA 2DWBA 4BBFA 5CYIA 4JL9A 2C6LA 4FTIA 4FV6A 3PIYA 4YLKA 4PX6A 3K3IA 4J71A 2WQBA 3DPKA 4TT7A 4UXQA 3R9NA 1VJYA 3UOLA 4E4XA 2PL0A 4M67A 4EHGA 3F61A 3UO5A 5EFQA 4OAVB 3VUMA 4IZ5A 1VEBA 3H9FA 5E8TA 4BFMA 4O84A 3W8QA 2PMLX 2X7GA 3RKBA 2PWLA 3RPYA 1TQMA 3ZUTA 3VUDA 2C47A 4LM5A 2YIWA 2PZPA 2C3IB 3MFSA 3OP5A 3V5WA 5HVKA 5JFSA 2A1AB 3E8NA 3DBCA 3RCJA 3FQEA 2OH4A 4DEHA 2QOFA 2YERA 4QMQA 1ZMUA 2Y7JA 4U9AA 3GU5A 4TRLA 5K9IA 3IW4A 3TZ7A 4IZYA 4O0RA 4EHZA 5CNNA 4E5BA 4F9CA 5LVNA 3EN5A 5BUEA 2HZIA 1TQIA 1Z9XA 4YNOA 1OM1A 4HYSA 3UPZA 5HLWA 1OBGA 5AIKA 4F9WA 4WBOA 2ITOA 3PRFA 5CT0A 4BDCA 2QOOA 5CQUA 3FMEA 3ZFXA 4BDKA 2CJMA 4FT7A 3DOGA 4O96A 4DFXE 4JG6A 3NYOA 3ODYX 3BU6A 3JVSA 2WU7A 5M44A 2OFUA 3NS9A 3PG3A 2P33A 2PZYA 3PY1A 4AT3A 3VS3A 4H05A 4CFVA 2FSTX 4BCFA 4CNHA 2XK8A 3TCPA 3LMIA 3LFSA 3GFWA 2YZAA 4TYGA 2BMCA 5ANGA 1T45A 3BX5A 4PDYA 4F0FA 4S33A 3HA8A 3N4VA 3CY3A 4C35A 3SW7A 4IDVA 3SKCA 5LARA 4O2ZA 1W7HA 3GENA 2R3MA 3RAWA 2WGJA 4FV8A 4YPDA 5HBEA 3D9VA 3OT3A 5DRBA 2Y4IB 4EZ5A 4UMPA 3OMVA 3PIXA 4Z55A 1CTPE 3BLHA 4FIIA 4H3PA 4O7NA 5CASA 1M17A 4NSTA 1RJBA 2R3QA 4Y72A 4DG2E 2DQ7X 3VBVA 4IAZA 3HYHA 3RAIA 4U97A 2R3IA 4IEBA 1DS5A 2JBOA 4J8MA 2WQEA 2P2IA 3ATTA 2X8IA 3Q52A 3S1HA 5I9WA 1YXSA 2GMXA 2OJJA 3HA6A 2ITWA 3PE2A 1KE7A 4BKJA 3COMA 3E7VA 3EQCA 3IECA 5JSMA 4WBBB 4FC0A 4O7ZA 1PKDA 2PVYA 3AG9A 2UZBA 2HENA 2W9FB 3KF4A 2GHMA 3TT0A 5F9EA 3OTVA 3CPCA 4EBWA 2R0UA 2X7OA 4ZJJA 5T3QA 5J1VA 3V5QA 4C3PA 4D4VA 1Q8YA 5HBJA 2WEIA 5HVJA 1H25A 5IISA 4KAOA 3MVHA 3VBQA 3HRCA 3D83A 2YZLA 3R9RA 3F88A 3HV7A 1Q41A 2WPAA 4G9RA 1M7NA 3RP9A 4AFEA 1FMKA 3VUIA 3ZLYA 3FJQE 3OEFX 4QO9A 3ZM4A 2XJ2A 4EOPA 4FSYA 4X0MA 1HCKA 4JDIA 3DQXA 3R7OA 3BCEA 3FMDA 2LGCA 4C4GA 5KX8A 5EH0A 4IM0A 4O6LA 2H34A 4FGBA 4XV1A 4U41A 5EM8A 5DN3A 4TTHB 4UBAA 5AR4A 5HD4A 3R01A 3KY2A 3ZSIA 5HNGA 4RMZA 4N57A 5C01A 3PZEA 5ITAA 1KSWA 2WMQA 4FZDB 2P4IA 5GNKA 3V04A 4UMTA 4FK3A 4X2NA 4YTHA 1GJOA 2V7OA 3VBWA 3DNEA 4FKIA 4GG7A 5CAPA 4ZP5A 3HZTA 4Z7HA 4O7YA 3MIAA 2C5YA 5ANJA 3F5XA 4FOBA 5CS6A 4I92A 3FLZA 3R1SA 3ORIA 4L7FA 3ZXZA 4CFMA 4HVSA 3D7ZA 3RK5A 2QKRA 4GU9A 4U45A 3KRRA 3M2WA 2IJMA 1QL6A 5H9BA 4Y85A 5C8NA 3ZO4A 4A9UA 1E9HA 3KFAA 3LM5A 2XKDA 4HGTA 3S2PA 2PMIA 3GB2A 4XOZA 3ZZEA 4G17A 4XOYA 4CCUA 5IF1A 1LR4A 1NA7A 3IG7A 2BTSA 1IEPA 1REKA 3E93A 4YZBA 3V5LA 3MY0A 4UN0C 5IA1A 3QZIA 3QTSA 3FEGA 4G9CA 2VX0A 1DI8A 1REJA 3AXWA 4OUCA 3Q53A 3PE1A 2UW3A 4GJ2A 4KSPA 5AP3A 5BUIA 2W1EA 3NAYA 3MY5A 2HZ0A 3R71A 1WBNA 3O71A 5DNRA 4ITHA 3M42A 4HOKA 1BMKA 5I0BA 2WTIA 2ZB1A 3LCTA 2ZOQA 4C4EA 3PJ1A 4E93A 4R77A 4BTFA 2G1TA 4IVDA 1GZOA 5C03A 2VNWA 3AQVA 4FT0A 2X6EA 3LM0A 2Y8OA 4Y73A 2CNUA 4CD0A 3DXQA 2JD5A 1JBPE 3RINA 4MNEA 4QPSA 4FUXA 3EQIA 4Y5QA 1YI6A 4DITA 5HQ0A 5HZNA 2O64A 2Z60A 3A7JA 3QUEA 2YDJA 4DLIA 4KS8A 3FI2A 4L00A 3FC2A 2WMVA 3TZ8A 4FEQA 2XCHA 3HV4A 3TN8A 5HX8A 4PPBA 4A4LA 4A9TA 4CZYB 1B38A 2RG5A 5DLSA 1H01A 3FBVA 3WARA 3VQUA 3PRIA 3P7AA 3LLAA 1Q8TA 2RKUA 4MBJA 4DE4A 5EDRA 2B9HA 1MQBA 4UV0A 4DEAA 2ZVAA 2YISA 3KN5A 4FGRA 5LMKC 3DTWA 4IFCA 3KREA 1QPDA 5H8BA 2FSLX 2WMWA 5HTBA 2JC6A 5FEEA 3IQ7A 2JDRA 4HYUA 5EKOA 1WZYA 2PVFA 4OTRA 2QLUA 4FNWA 3T9IA 4X6RA 3OFMA 5CSHA 3M1SA 3QWJA 2BHHA 4XP3A 4LOPA 3BQCA 4N0SA 4C4HA 3ID6C 1SMHA 4QNYA 5JQ8A 3QGYA 3QRIA 3U4WA 5M08A 5KHXA 4AA4A 3HRBA 4NFNA 3HMPA 4F65A 2PVKA 2QLQA 4DF3A 1SNUA 2W4OA 4RJ3A 1U5RA 4TYIA 4AZVA 4DEBA 4BB4A 3QD2B 2RSVA 2QG5A 4MXCA 4YLLA 2VTOA 4BKYA 3QFVA 3W1FA 3TNPC 4RX9A 4FX3A 1KE9A 5GJFA 2DUVA 3LJ2A 1Q8ZA 3ACKA 1G8AA 4GSBA 5DR2A 2ITNA 3D14A 2CDZA 3MFRA 5KBRA 1DM2A 4RJ4A 1O6LA 4G6OA 4QD6A 5HE3A 3ELJA 4DFZE 1Z5MA 5GZ9A 3QTRA 4EZ3A 3JUHA 4C2WA 3WE4A 3KEXA 2ITTA 4WG4A 4LG4A 3UO4A 4M15A 4O2PA 4ACHA 1XBCA 2R7BA 3DKFA 4L3LA 1W98A 1XHAA 1JKSA 1MQ4A 3T3VA 3SHEA 4C34A 3OUNB 5JH6A 5B2MA 3PTGA 4O7LA 3FMJA 4QMMA 4DG3E 4QQ5A 4Q9SA 4AE9A 1TQPA 1LP4A 2XMYA 1RQQA 1URWA 2YFXA 3LFQA 4G6NA 3SQQA 5KMOA 3C4CA 3RPVA 3QC4A 3UYSA 4LUDA 5A4LA 2R3JA 5M57A 3OF0A 3UQFA 4BWXA 4CGAA 4CCBA 3U4UA 4F64A 4X2KA 1ZY5A 2EU9A 2OF4A 4QMNA 2R5TA 2BIYA 1YWRA 3QA8A 4G5PA 1I09A 2G2HA 5K0KA 1OIQA 4I5CA 1OVEA 4I0TA 4J52A 4O0YA 4X2GA 3KMWA 3V6SA 4KKEA 4U7ZA 5E8ZA 5A6NA 3E8DA 4HPUE 2H96A 2X7FA 1YXUA 3FE3A 4PPAA 3VS4A 4MD8E 2XK4A 2G2FA 3D15A 4EWHA 4GFOA 4LV5A 3SC1A 3UIBA 4HVGA 3F5UA 4DYMA 5FXRA 4OW8A 3Q2JA 3U55A 3P7CA 3NUYA 4IACA 5HO8A 2ZAZA 3RK9A 4C8BA 2BRBA 4TWOA 2X81A 2CPKE 2W4KA 2OXXA 3EN7A 3F3VA 4AUAA 5IA2A 3NRMA 4U6RA 3TTJA 2WTVA 3E88A 3VQHA 2IN6A 4AS0A 3SOAA 4BRXA 1H1QA 1MP8A 5FP6A 2IPXA 2OH0E 2YN8A 4MF0A 4ZZMA 4RA4A 5CEOA 4P7EA 5J9ZA 5KMNA 3KXGA 5DVRA 1ZLTA 3RNYA 1U5QA 1WCCA 3RHXA 2O63A 5IQFA 4V01A 3AC3A 1P4OA 2J6MA 2QURA 3KRXA 4YTFA 1P4FA 4W9XA 4E3CA 2FUMA 2XBJA 3MTLA 4ZLZA 5KMLA 5AAEA 3NWWA 3EQPA 2QOBA 3R7EA 4WO5A 3RZBA 2YIRA 4IHPA 2YM3A 1PF8A 4ERWA 3QKMA 4F9YA 3DU8A 3DLSA 5EKNA 3A60A 3P0MA 4UX9A 2B52A 4NUSA 3L9LA 1BKXA 2XNGA 4W4VA 3QXPA 4FG8A 3CEKA 1LUFA 1AD5A 4WKQA 3F2NA 4BYIA 3H9RA 4GK4A 3K5UA 4C33A 4RC3A 4RWIA 3OEZA 1H1WA 4BCIA 3UQGA 4R3PA 2GNFA 1PW2A 3O0GA 2UZWE 4OLIA 4RWLA 5CU3A 5HOAA 4ANLA 4YO4A 3NAXA 4RJ6A 5AAFA 3CS9A 2WZJA 2GPHA 2JDVA 4L53A 4CSVA 1JSTA 4YHTA 4WOVA 5KO1A 3D7TB 4JIKA 5DH3A 2IZTA 1OKYA 1R78A 4NU1A 3I7CA 1ZOGA 5E1EA 4F08A 4NW5A 4U42A 2CMWA 3NNWA 3NZ0A 3EIDA 1U59A 3W2SA 5AV4A 1J7IA 3G6GA 4O0XA 3TZMA 2WQMA 5CU2A 4KKGA 2J50A 1K3AA 1Y6BA 5BMMA 3WF7A 3ORZA 3O8UA 4RIYA 2J4ZA 3VUKA 4LOQA 4ZLOA 3ZLXA 4FTAA 4GVJA 2YCSA 5EM5A 3WZDA 3ANQA 5M07A 2I6LA 4I6FA 4XG4A 4O1OA 5AR7A 3GXLA 2XK3A 4UYAA 4FSTA 2XNNA 4Z7GA 3K54A 2QCSA 5FXQA 2B9JA 4NT4A 5D1JA 4FSMA 5JRSA 3GU8A 4FL2A 1KOBA 5LXMA 3FL5A 1J7LA 4BDGA 2F57A 3BU5A 4BI0A 4XBUA 3JXWA 4FT9A 4V04A 3VBXA 4YJUA 4ZY4A 2Z7LA 3R2YA 2OI4X 1Q3WA 3BGPA 5EW9A 4FKGA 4RX5A 1OKWA 5G6VA 4TZRA 4FSNA 4IC8A 1SYKA 4R7IA 5C27A 3ZU7A 4DH3A 3UOJA 4MWHA 2GHLA 5AP2A 4JBQA 4PL5A 3C4EA 2W5AA 4QYEA 2XIZA 4AFJA 4S32A 1LEWA 5D10A 2Y9QA 3DZOA 4PUZA 2PMNX 4MH7A 5E8SA 1Q99A 3FHIA 3QAME 5ICPA 4EI4A 4YBJA 5HGIA 3NW5A 4CKIA 3UQCA 4IAYA 4QMLA 4IH8A 4BCJA 4O82A 3MH2A 3KXZA 4ACMA 2R3FA 4MK0A 4FEXA 4D4SA 4G3GA 3R7YA 2EB2A 2I40A 2QONA 2VTQA 3PVWA 5CEMA 3ZMMA 1UA2A 1ZOHA 2C6TA 4NZWB 5FQDC 3CGOA 2HZNA 2E9NA 2WB8A 4FV3A 3L1SA 2EXMA 5EOLA 5CU4A 3R83A 2JITA 4YTIA 3NMUF 4UEUA 3L9PA 2W1FA 3DKGA 3VHKA 2XB7A 4E4LA 3I5NA 4FVPA 3UG1A 2PUNA 3H9OA 4GVAA 4YJQA 5AM6A 5L2QA 5CAQA 1U4DA 4RIWB 4UMQA 3DK6A 3KULA 4ITIA 2VWVA 2WMRA 3FQSA 1OUYA 4BGQA 5HICA 4G3FA 4WG3A 3AGMA 4FV2A 4PDOA 4WSQA 3V3VA 2VN9A 4QMSA 5IEYA 2VD5A 2JKOA 2KULA 3COHA 1PMEA 3O96A 4BI1A 4PNKA 4AZEA 2O0UA 3FMLA 3MJ1A 2Z2WA 4AT4A 1ZOEA 5ANIA 4J98A 2O65A 3R7VA 2OICA 4NH1A 5HESA 4DEEA 2YCFA 3O8PA 3UOHA 1V0OA 4RLLA 5FM3A 4HVDA 4PTEA 3N4TA 2R3LA 2QD9A 3WZEA 1H27A 3BV3A 4XRJA 3NUUA 2OFVA 4RIXA 3EYGA 4FTTA 3FPMA 2C3JA 3LXKA 2BRNA 3MA3A 4JAIA 3DA6A 4EQMA 4YTCA 5HU3A 4RA5A 4WUNA 3AT4A 3DY7A 4F6SA 2BVAA 2ERZE 1R0PA 1YXXA 5TOZA 4PTGA 4C59A 4DEDA 2Y6MA 4EK4A 4HCTA 5BYZA 3BWFA 3PYYA 3C7QA 4P5QA 2YEXA 4RZWA 5JN2A 2W0JA 5ANKA 1H8FA 5LCJA 4ZAUA 3MESA 3CR0A 3ERKA 1VZOA 2WTWA 1OGUA 2GS2A 4LUEA 2Z02A 3ZOSA 3GVUA 3QTIA 3C5UA 5D7VA 4F0IA 3BHYA 1Q24A 3EQFA 2E9PA 3G33A 2UZOA 3PXZA 4FTUA 2QO7A 3MH1A 5CF6A 3Q9YA 3G15A 2A0CX 3ZLWA 1YXTA 4GRBA 3P9JA 2JDSA 2W4JA 3QRTA 3K3JA 1SVHA 4C4FA 2UZNA 3FSKA 1J7UA 1ZAOA 3A99A 2JKKA 4RSSA 5AJQA 4PRJA 1SZMA 3NW7A 5CI6A 3ZHPC 5EW8A 3TDVA 2CN8A 5BMSA 3GU6A 2IVVA 4XS2A 3ULIA 3RHKA 4AF3A 2RFNA 4U79A 2QODA 3AD5A 3FZSA 4J95A 4KBCA 4L44A 1H1SA 4PF4A 3TKUA 1UU8A 4XG2A 1P5EA 3MH3A 4D0XA 2OJIA 1JPAA 4I6HA 2GS7A 4CYJA 3TM0A 3QKLA 4I94A 4AWIA 1SM2A 2R0IA 3FXXA 3JY9A 4ZTLA 5KZ0A 3G0EA 3CTJA 3DBQA 3UIUA 3PXRA 3UYTA 4RT7A 5CX9A 4NM0A 4EJNA 4E6AA 1ZZLA 5FUTA 4FUYA 4IFGA 5E8WA 4XHKB 3AGLA 3O23A 4QRCA 4YHFA 2ZB0A 4EOJA 1G8SA 1PXPA 3Q04A 3UBDA 3ZRMA 5CSPA 2ZMDA 1H00A 3ZEPA 4ZY5A 4IQ6A 2XIXA 3I6WA 4IXPA 3RZFA 3A4PA 4HGSA 2QQ7A 3EKNA 2OW3A 5BVKA 5HIBA 1IA9A 3MN3A 4EKKA 3ZONA 3I0QA 4X21A 2RFSA 1XH4A 2HXQA 3QA0A 4MX9A 1PMNA 4PY1A 1J3HA 5CVHA 2BAQA 4QMOA 3LCOA 4FK6A 4AN9A 1OKVA 2GHGA 1GY3A 4I0SA 4EK6A 1TKIA 4ZOGA 5AV3A 3H4JA 4K1BA 1WAKA 2BZHB 5A3XA 5F1ZA 3EQDA 4BWPA 2QO9A 3S00A 5B7VA 4K11A 3E8CA 3CQEA 4ZEGA 3VAPA 3QCXA 4BDFA 2UZUE 1O9UA 4XJ0A 4IIRA 4ASEA 4EC8A 4E73A 5J9YA 2X4ZA 1UU7A 1PXOA 5EW3A 2XCKA 3CTQA 3KF7A 2VO6A 4L42A 4IE9A 5EDPA 4EH2A 5JKGA 3NEWA 4YJVA 3SAYA 4U8ZA 4EC9A 2VTMA 3Q4TA 3TNQB 4AXAA 3V8SA 2BRHA 3R9DA 4C3FA 1U54A 4Y95A 2J0MB 3R2BA 4X3FB 5DT4A 1J1BA 4OTIA 4CFUA 1JKKA 3W2RA 2AC5A 4MD7E 5IUIA 3D2IA 4XV9A 4I3ZA 3DXNA 4M7IA 5KMIA 4CEGA 3G9LX 3S3IA 2XF0A 3DFCB 5HORA 4M69A 4AZSA 5A54A 5LVPA 2NNWB 1WFCA 5DR9A 4EHVA 3VO3A 4QOXA 3WZUA 3EB0A 5HG5A 3SRVB 4AW5A 4PMTA 2ESMA 4G31A 4JX3A 4JOAA 1Q5KA 3PIZA 3Q9WA 4KNBA 3GNIB 5C8KA 3O50A 2XBAA 5M53A 4U80A 3Q96A 4MXAA 5AV2A 3EJ1A 4CYIA 4ZTMA 2C68A 5IQHA 4KIQA 3FMKA 3VUHA 2BALA 1YKRA 4D2TA 5DR6A 4AZWA 3FLNC 5DRDA 3ET7A 4TYHA 3DT1A 5GHVA 5GINE 5CXHA 5DEYA 4YGAA 2NPQA 4NM5A 5AUVA 4GEOA 4DEIA 1H28A 1LPUA 4FF8A 2Y4PA 5EYMA 2PPQA 4CQEA 2V7AA 4HNFA 5KHWA 4ZMEA 1W83A 2GS6A 4O27B 3ROYA 5A4EA 4APPA 3E63A 3Q32A 5LCKA 5IPJA 1SNXA 3F9NA 3S4QA 2C6KA 3LOKA 3WILA 5L6PA 3LCDA 5K4IA 2Z7QA 3DKOA 3TXOA 3ZBXA 2PUIA 2W5HA 5E90A 4QTEA 4E6DA 5CENA 4ZTSA 4ANBA 4DFYA 5CAVA 2CKQA 4DTAA 2IZSA 4IANA 3PPZA 2FVDA 4FIJA 1H0VA 1KV1A 3DCVA 3R02A 4I24A 4K18A 4X6QC 1YI3A 3C13A 5D9HA 2H6DA 2G01A 3MW1A 2GU8A 5L6WL 3TJCA 4FSUA 5CF4A 2FSMX 3U51A 2CKPA 2EUFB 2REIA 5I3OA 5M4CA 4UMRA 3R22A 2ERKA 3OVVA 2QNJA 5C9CA 3QYWA 5HBHA 3UPXA 3ZS5A 2OK1A 4BIBA 5JQ5A 2WQOA 2SRCA 3TG1A 3I7BA 3QU0A 4K8AA 3E7OA 4R8QA 4CV9A 4EUUA 5IDPA 3DTCA 2QG7A 2W17A 2P55A 3VHEA 4EH4A 5CF8A 5E8UA 5IEXA 3LFDA 1R3CA 1J91A 4FKJA 5D41A 5H3QA 4O0TA 2C5VA 1WMKA 4QP6A 4MQ2A 3QHWA 1CDKA 4L6QA 4LRMA 4A9YA 3FZRA 1YHWA 3MH0A 3AOXA 5I9YA 2QR8A 1CKJA 2WNTA 3HX4A 3LMGA 3MIYA 4KRCA 4QQJA 4Q9ZA 3D94A 3N51A 1FGKA 4BGGA 5IKWA 3B8QA 2HYYA 4F6UA 3VS0A 2JLDA 2B9FA 4C0TA 5FM2A 4FIHA 4MWIA 4ZZOA 4E20A 3D2KA 4BCGA 2C3LA 3E3BX 2YJSA 2QU5A 4HNIA 3SW4A 5IUHA 4FR4A 3C0HA 4PDPA 5BVWA 3VS2A 5EOBA 4BCNA 4C58A 2E2BA 2CGVA 3ZUVA 3ZTXA 1WBTA 2BZJA 4R7HA 5CU0A 4Q2AA 4QP2A 3VN9A 2X4FA 1CMKE 5EI8A 4O0UA 1M2QA 1RDQE 4A07A 4PL3A 3GCUA 3R9OA 4NTSA 3IOPA 4RX8A 5J7BA 3R00A 2Q0NA 4EKLA 2V0DA 1X8BA 3SD0A 3VUTA 4ZLYA 3BLQA 3E62A 1UKIA 3QKKA 4TNDA 2XNPA 4CTBA 3NYNA 4IM3A 4YC8A 3UP7A 2FO0A 3OOMA 3MTFA 4PP9A 3U6HA 1YOJA 1Q97A 3RALA 4NIFB 4JXFA 3CCNA 4CFWA 3QYZA 4M0YA 2XH5A 2VO0A 2BRGA 5AUUA 2F4JA 2GCDA 4I6QA 4EH7A 4JRVA 5CEPA 3OHTA 3F2RA 3DK3A 4YLJA 1JOWB 3C1XA 2WMSA 4QP8A 4W8EA 4DGLC 4FEUA 5DBXA 3LFBA 4BF2A 3RGFA 4XV2A 1PXKA 2BUJA 4NJ3A 4N4SA 4QMWA 4KSQA 2JGZA 4ACDA 5EDQA 1KOAA 2VTLA 1P14A 4C4IA 3V5TA 2ONLA 4BIDA 2C5OA 5HCYA 4CT2A 2NP8A 2VTPA 2PK9A 3FUPA 4KINA 4BWKA 2W99B 3I81A 2VU3A 4FTJA 3NW6A 3OZ6A 4UXLA 3ZRKA 4RQVA 2VWWA 4AGWA 5HTCA 3OBJA 3OCSA 3R0TA 4LOOA 2WAJA 4NEUA 2JBPA 2ITXA 5BVFA 1OL1A 4IMYA 3MVLA 4PV0A 3BYOA 1XH7A 3QALE 4HPTE 1XH6A 3HMNA 4MBLA 4YJNA 1CSNA 2HY81 2OF2A 2OLCA 4F9BA 4I5PA 4S31A 2VNYA 2VWZA 4ASDA 2J51A 4EWQA 2ZM3A 2JDTA 3LVPA 1W82A 1FGIA 2BRMA 3NUXA 3ORMA 2I0VA 1AQ1A 1ZY4A 3FC1X 3GCSA 4NTTA 3IW8A 5LJJA 4E26A 1XO2B 3O8TA 4C4JA 1G5SA 3F66A 3PUPA 4ZSGA 2BILB 2C3KA 3GC9A 2XKCA 4H58A 4EOSA 5E9EA 2HELA 5F20A 2HOGA 3CTHA 3HEGA 4U40A 5TE0A 4JBPA 4L01A 1LEZA 3LZBA 3DJ7A 4MXZA 4I6BA 3II5A 4XEYA 4Y83A 3QQLA 5B0XA 4ZSJA 3W33A 4ANMA 4GT5A 4QP7A 4CMUA 4DC2A 4LI5A 5CVGA 3TUBA 4DH7A 2FH9A 2UUEA 1Z57A 4KKHA 4R1YA 4Y46A 4XNEA 4O21A 5CSVA 1ZRZA 4L8MA 4E8AA 5BX0A 2XEYA 3DV3A 5HEZA 5A46A 3R73A 4OTHA 1KE5A 3VS6A 2EWAA 4E4MA 5FDPA 3GCQA 4GIHA 3PVBA 4BDHA 5E7RA 3U54A 4FI1A 4KA3A 3FL4A 3RMFA 3VS5A 3UZRA 4A06A 3BYUA 1DAWA 4F99A 3UC3A 1KE6A 4OAUC 2R3RA 4KIKB 1UNGA 3ZO3A 4D1SA 4I41A 4EK3A 2Q83A 3CXWA 2GQRA 3LXLA 1BLXA 3KXMA 3UNKA 1MRUA 3KMMA 4DCAA 4EK5A 2FA2A 5K0XA 5FWKK 3F5PA 4MTAA 4D9TA 4FTKA 3FAAA 1UWHA 3L8SA 2RFDA 3NYVA 5DEWA 5A4CA 3BELA 3PPJA 2CNQA 1Q4LA 5IA4A 5EG3A 4UWBA 4F63A 3R8MA 1S9JA 2WEVA 3UOKA 3FLQA 3ORNA 4HW7A 3TDWA 3WOWA 4GV1A 3C51A 3LPBA 4WG5A 4AP7A 5AR5A 4CLIA 4M97A 3W2PA 2QOKA 2BAKA 4GFMA 4TYEA 4WNKA 2OU7A 3PWDA 3PP0A 2IW8A 1GIIA 4QTAA 4BTJA 4USDA 2PSQA 1O6YA 4FZAB 4G16A 1PXNA 3OT8A 1JQHA 4L43A 5CWZA 3ZFMA 3UVQA 3MFUA 4ACCA 3BRBA 1OBDA 2AC3A 4F1OA 1Y6AA 3QCQA 3A7HA 1WVYA 2UVZA 4NKAA 4R1VA 1PMVA 1URCA 1GAGA 2VTAA 3I4BA 3QZHA 4QYGA 2X1NA 5ACKA 5AV0A 4ALVA 4ANSA 4F4PA 3I0OA 4D5KA 3GU4A 3LFAA 4FTLA 4IBMA 1YHVA 4WNMA 3RCDA 3HAVA 5KZIA 2EB3A 1ZMVA 1YXVA 1E1VA 4AOTA 4OBQA 3SXSA 5L8LA 3QL8A 3PPKA 4ALUA 4FA2A 3F7WA 2JFLA 2V55A 4KRDA 4J1RA 1XKKA 3SX9A 2B55A 3N4UA 3DFAA 4BTMA 5KKRC 3IK3A 3OXIA 1OB3A 3EYHA 3ZCLA 4DHFA 4NK9A 3WYXA 5A14A 3FZ1A 2WHBA 4QP4A 2JIUA 4IJPA 1BL7A 3EH9A 4FV1A 4M3QA 2ETMA 3CLYA 2WMBA 4U81A 5JGBA 2WD1A 1A06A 2BAJA 2WTCA 4HYHA 2WTKC 4WRSA 3T3UA 4B6LA 2IW9A 5HVYA 4L9IA 5EM7A 2F7ZE 3PWYA 2GFCA 2YWPA 1R0EA 3R8ZA 4B4LA 1FQ1B 3AC2A 3MV5A 3OCBA 4TKSA 3RWQA 1FOTA 5D12A 2UZEA 1OITA 4WRGA 2BZKB 4PL4A 3VF9A 1YWVA 4RZVA 5M06A 1OKZA 4ZJIA 5HKMA 4HYIA 2W1HA 2YAKA 3MYGA 2R4BA 5JGAA 4MNFA 5KBQA 2XK9A 3H30A 4BCOA 2PULA 4QMXA 1S9IA 4TN6A 2A19B 4O7WA 2GTMA 3VW6A 3RNIA 3HGKA 3GFEA 4O7VA 2P2HA 3R1NA 3EQBA 2BFYA 4CFFA 2YM8A 4RPVA 4I0RA 3BGQA 2WO6A 1PMUA 3IDCA 4G3EA 3ZFYA 4C3RA 4D28A 5LWMA 1UV5A 3KCKA 3TIYA 4DLJA 2F2CB 3DKCA 2XM8A 1FBNA 1SVEA 3FMMA 2E9UA 3Q9XA 5J5TA 3ANRA 4JDKA 4M84A 4EOQA 3LW0A 4IJ9A 2VZ6A 5EHOA 3WI6A 5HIEA 5KE0A 3QTQA 3MJ2A 4QMPA 3MI9A 5CY3A 4UZDA 2VWBA 2YAAA 2R7IA 3A8XA 3MSSA 3KVWA 2PVJA 4FKUA 3RBWA 3C0IA 3O17A 2ZDTA 4OTQA 4D1ZA 2VWUA 1ZARA 3L9MA 5AUYA 4IB0A 2C5NA 2BKZA 3CBLA 2OSCA 3DBEA 3I79A 4U0IA 4BR3A 1PKGA 3WZJA 3A4OX 3ORKA 2GTNA 4I5MA 4FIEA 2IO6A 2CLXA 2GNHA 4IC7A 5DWRA 3QXOA 1XJDA 3JVRA 1ZWSA 2VTRA 1WBVA 1MRYA 5KKRB 3A8WA 3DS6A 3W2QA 2QU6A 4GT4A 4OGRA 4W4XA 2A2AA 4AN3A 3CP9A 2Y6OA 3DNDA 4I20A 3THBA 2XJ0A 4CMTA 2VWIA 3DK7A 3A7FA 3HUBA 3EFJA 3NUPA 2OO8X 4QYHA 3AC4A 1KUTA 2JEDA 1VYZA 3WF6A 4RFYA 4RIOA 4Y8DA 4S34A 4P2KA 4ZTQA 5A4QA 2PVRA 4OTPA 2C0OA 4M12A 4GG5A 4RJ8A 5DHJA 3PJCA 3S95A 4LQMA 3ZO2A 3AD4A 3FPQA 5DG5A 4YUQA 4N6ZA 5AMNA 2PYWA 4WNPA 1OL6A 3BBTB 1BI7A 3C0GA 5E8VA 3UIMA 3EQHA 4MKCA 3DGKA 2C6EA 4QQTA 4D58A 5BPYA 4QYYA 3CE3A 2ITQA 1PXJA 2PZIA 4K33A 4KBAA 2B4SB 5H2UA 4EH8A 1PJKA 4WIHA 3OWLA 3BU3A 3QLFA 4CT1A 3O7LB 3HVCA 2BDJA 3RTPA 5EI6A 1XH8A 4TWCA 3FKOA 3MWUA 2WMAA 5LMBA 4R5YA 2W1IA 4CVAA 3PG1A 4X2JA 5AX3A 1W0XC 3C4WA 2HK5A 2WXVA 1JVPP 4QMVA 1EH4A 3EQRA 3TNHA 4IAIA 4QT1A 3AMBA 4CQGA 4F1TA 3UVPA 4C2VA 5KUPA 3WF8A 3LLTA 5I9UA 2I0EA 3D7TA 4O83A 3LCKA 4C36A 4F7NA 2QOCA 3UE4A 4MD9E 3BEAA 4DINA 3UNZA 3QQJA 2W1DA 4JG7A 4MHAA 3VW8A 3FSFA 1XH5A 4BL1A 4DGMA 2DYLA 2O2UA 2UW7A 5E1SA 3UO6A 2J7TA 3A62A 3LQ8A 4HGLA 3HV5A 5TO8A 2F7EE 3RJCA 3I1AA 4DCEA 3OY3A 5C4KA 3QRUA 1UVRA 3JYAA 3PJ2A 4E7WA 2BROA 3ZDIA 5EQEA 4PP7A 3FMHA 1G3NA 3BHTA 2W1GA 4CKJA 2ITZA 2WIPA 4KWPA 5HD7A 1ZYJA 5ANDA 3TI1A 2W1ZA 2WIHA 4JS8A
chains in the Genus database with same CATH superfamily
4IX4A 4BDEA 1Q62A 3C50A 4ZTRA 3G90X 3KIOC 3E5AA 5IU2A 3QCYA 1QPEA 3EL8A 2Z7RA 3P08A 4LGDA 5BVDA 3RWPA 1XBAA 4UMUA 3GT8A 4JBOA 5E8XA 4FV0A 3KMUA 1FMOE 1BYGA 4YSMA 3A61A 1JLUE 3CQWA 3PA4A 4ZXTA 5DE2A 1UWJA 3VF8A 2VTJA 3KRWA 1GIHA 2OIBA 2OBJA 2PVMA 4DG0E 2I0HA 3MDYA 4CZTA 4PWNA 4ITJA 2Q0BA 1OL7A 4D5HA 4FICA 4AA5A 5I4NA 1OECA 5CAUA 2R2PA 1GZ8A 2X9EA 3Q3BA 4QTDA 4FV7A 3NIZA 3NUAA 5JK3A 3LFCA 3BIZA 2G2IA 2VTNA 2W1CA 2XIKA 3DBDA 1J1CA 3QQHA 4JDHA 3TL8A 4ANNA 3V8TA 1E1XA 4RVMA 4FL3A 2YIYA 3RVGA 4ALWA 4FEWA 3FXWA 3H0ZA 4RIXB 2WFYA 3W2CA 2IZRA 5AADA 5L3AA 4AXEA 4BICA 3ORLA 4L45A 4EH9A 2XARA 5K5NA 4C57A 4MYGA 4YHJA 1FINA 5BNJA 3FI8A 5A9UA 4JAJA 3FKNA 2W5BA 1A9UA 3IW6A 3SXFA 4TWNA 5IUGA 3EMGA 2JIVA 4BI2A 3JR1A 4LMNA 4D2SA 2FGIA 4O0SA 1WBWA 4F70A 1NVQA 3VWAA 5JGDA 4ENXA 3SG9A 2UW0A 4RIWA 2C6DA 4ZTHA 2CCHA 2H8HA 4BTKA 4CG9A 3RPRA 1YDSE 3R8UA 3DB8A 2JIIA 2OXDA 4NCTA 4E6CA 5AP5A 2X6DA 3TIZA 4OBPA 1YHSA 2V62A 5ANOA 3ZC6A 2G9XA 4XG8A 4D2PA 5FP5A 4AW0A 5AEPA 3ZBFA 5C26A 3W18A 5J79A 2VGPA 5EQYA 5IMEA 2IW6A 2VAGA 4CRSA 3OCGA 4JIAA 1IAJA 1KE8A 5I9VA 4A9SA 4ONAA 4M0ZA 4CLJA 3PJ3A 3ZRLA 4JG8A 4IX3A 3D5UA 4K0YA 5CZIA 1ZYSA 3KQ7A 2IEWA 3VULA 4B8LA 4CV8A 3ZSGA 3BWJA 5CSWA 4BKZA 3P1AA 4FTNA 4B0GA 3BQRA 4EL9A 3FQHA 2X2KA 3F3ZA 2GFSA 2RFEA 3QTZA 5CU6A 4EOKA 2WMUA 3BYSA 3BPRA 3CPBA 4IB5A 2ITUA 2OJFE 4LV8A 3OBGA 5EHLA 1GZKA 4YZCA 3VIDA 2CSNA 3RI1A 4KB8A 4V0GB 5TF9A 3QQUA 5JFWA 2XEZA 4B9DA 2YCQA 3COKA 3E64A 3PLAE 3NUSA 1QPCA 5FXSA 2UW5A 2BZIB 2OGVA 4JLCA 4BCHA 2GDOA 5IG1A 2IVSA 2WTDA 2OKRA 3B2TA 2XNOA 4S30A 3EQGA 1YRPA 4UYNA 1H1PA 2PUPA 3GUBA 4YJRA 1OZ1A 2J0LA 4HCUA 4TNBA 4WUAA 2B53A 2J5EA 3R7UA 3RAKA 5CEKA 3R8LA 3V8WA 3TTIA 2BIKB 4ZK5A 1OL5A 4C38A 3ALNA 3R7IA 4O7TA 1PYXA 3Q4ZA 5J9LA 4ARKA 3F3WA 3OTUA 3DAEA 4DGGA 1YDTE 4OR5A 4KUJA 5DYJA 2IG7A 3NR9A 3TV4A 4FTQA 4YZMA 2OZAB 3VNTA 2E9VA 3BE2A 3PLSA 4BBEA 5KMJA 5IA3A 4JQEA 1FVRA 3ODZX 4FYOA 5IA0A 1YI4A 1VYWA 1ZYLA 4DN5A 2GNIA 4EBVA 3NNXA 3FY2A 3POOA 4B8MA 3LKMA 1OMWA 3AMAA 1H07A 4LMUA 3ZLSA 2JAVA 3IPHA 2IWIA 5HI2A 4AGUA 4PMPA 3JS2A 4DEGA 3AD6A 1NT2A 1QCFA 4M8TA 3ZSHA 1YOLA 4E5WA 2VWXA 3BHHA 4FYNA 3QQKA 4YZNA 4J7BA 1PXMA 3R8VA 2C1AA 4YURA 5IH4A 3NCZA 2CGWA 1CKIA 5A4TA 2FSOX 5AAGA 2VGOA 3D4QA 4OTDA 4B99A 4QTCA 4I23A 2J2IB 2ZV9A 4FVQA 2HIWA 3F2AA 4OBOA 5AR3A 5TR6A 4BDAA 4EONA 2YHVA 4IWOA 3SDJA 3CD8A 3W10A 5AR8A 3TWJA 3HRFA 3TUDA 1XR1A 5JEBA 2PMOX 4OTFA 2BFXA 2VO3A 2BCJA 3G0FA 3AC1A 5FEDA 3QD3A 3FHRA 3R28A 1Q3DA 2XK7A 4EHEA 5IQGA 3KKVA 2XNMA 3E8EA 2AUHA 3PXYA 3LQ5A 4U44A 4XP0A 3WF9A 4AGCA 3EFWA 4D4RA 3D5XA 4N6YA 3R30A 4LFIA 4C62A 4BCMA 2W06A 4GH2A 3UGCA 2CNVA 4KS7A 3LQ3A 3BLAA 3ZYAA 5HNBA 3MVMA 4XUFA 2BDFA 3IDPA 3PSBA 2NRYA 4X3FA 5FDXA 1KV2A 3ACJA 4FVRA 2Y4IC 4X2FA 2GNGA 3VJOA 3SGCA 4UALA 3V51A 2W7XA 4C02A 3KN6A 4FJVA 4MQ1A 4TY1A 2QVSE 5JFXA 3PZHA 3KL8A 3TV7A 1WVWA 4FZ7A 5AUWA 5BVEA 4D4YA 3U9CA 5J95A 2XRWA 3OY1A 2HY0A 5L4QA 3SRVA 3C5IA 2QOQA 3EN4A 3CSVA 3NVKI 2HXLA 5ETFA 3FXZA 3E3PA 4BBMA 1P2AA 3G6HA 3KB7A 5EHYA 4M66A 3BI6A 3FLYA 4O91A 3UMWA 3LMHA 2JDOA 3KGAA 1JKLA 4RVKA 3POZA 3BKBA 5B2LA 4YR8A 3CD3A 4HVHA 4D1XA 5I3RA 2ONLC 4D9UA 4D2RA 1WBOA 3O51A 5L8JA 2XVDA 5AUTA 3I60A 1QMZA 3QRKA 3GC7A 4N70A 4QNAA 3CIKA 4RC2A 1JKTA 4XCUA 4XG6A 3CJFA 3QX4A 4BDDA 1STCE 3V01A 2QHNA 3KVXA 5DIAA 2VTHA 5GIPE 1ZMWA 4FEVA 3D0EA 5EI2A 3IW7A 2V22A 4R6VA 1Y91A 1XQZA 4U5JA 1JAMA 2UW9A 1R1WA 3R9HA 5FD2A 5EQPA 5DA3A 4GS6A 5ANEA 3HECA 4FSZA 4W4WA 3AT3A 3F69A 4FSRA 1AGWA 2Y0AA 4ZJVA 2PY3A 3IOKA 5KMMA 1MUOA 3HUCA 4H36A 3PA3A 4O4BB 4FNZA 2XYUA 1JSVA 3FLWA 5CEIA 3D5WA 4J8NA 2R3HA 3VBYA 4FIFA 5FG8A 4F6WA 3Q60A 3D5VA 4Y5HA 5HG7A 4KD1A 3EHAA 1OI9A 3KC3A 4XH6A 4YC6A 4RWKA 5DOSA 3VRYA 3W32A 2XNBA 3PY0A 3TKHA 2QO2A 2XKFA 3O2MA 4IVCA 2CGUA 2ZV8A 4YJOA 2IVTA 5IH6A 4FL1A 5L2IA 2RF9A 4LGGA 1YW2A 4FKVA 4X7QA 3TACA 4IWPA 3WIKA 5IQDA 4H1MA 2YIXA 1IA8A 3C4ZA 3HMMA 4GL9A 1IRKA 1BL6A 2HWOA 2YLEA 3QLGA 3TNWA 4AXDA 4KBKA 2DS1A 3GQLA 4IDTA 5HO7A 4DHIB 3DZQA 5M51A 3TEIA 5L2TA 1V1KA 4EYJA 2OJGA 4FNXA 3ETAA 4I1ZA 1FPUA 5J8IA 1WBSA 1ZZ2A 2W9ZB 4EORA 2NO3A 4BZOA 4I4EA 4O0VA 2XALA 4L67A 3MBLA 1FVVA 3R04A 4U43A 2PVNA 4AGDA 3FZPA 4L68A 3R8PA 3QF9A 3FKLA 3LFEA 3F3UA 4QP3A 4D55A 4TL0A 2B9IA 4O86A 4IAAA 1BI8A 1ATPE 3OWJA 2XIYA 5AV1A 4DH8A 3DLZA 5CT7A 4EH6A 4IVBA 4LL0A 3BBWA 5DT3A 5M4IA 3U6IA 5IDNA 2ITVA 3TUCA 4NKSA 2OIQA 4XLIA 4LV7A 4R78A 4RVTA 4XBRA 3NSZA 4DFUA 1K2PA 4AACA 4BCQA 5E4HA 3ORTA 2C69A 4G3CA 3GU7A 4FKTA 3F6XA 3MB6A 3ENMA 2R64A 2C6MA 3DDQA 3LIJA 3ZC5A 4BZNA 1Q8UA 4BCKA 2XIRA 4BY9E 5AM7A 1PXIA 3V5PA 3W2OA 3ZH8A 4GKHA 4P4CA 1ZXEA 1NVRA 3QQFA 4ZS0A 4RVLA 4IADA 4NIFA 3WYYA 2XAMA 3DXPA 3PXKA 4IB1A 1UNHA 4EOMA 3Q5ZA 2GQGA 3DJ6A 4GUBA 1R39A 4FKLA 4LL5A 1F3MC 2J0JA 4HZRA 1VR2A 2C0TA 4AOJA 5FBOA 5BYLA 2VX3A 2PVHA 2UZVA 3IONA 5JRQA 1ND4A 2YDIA 3NFFB 3BHUA 4YMJA 4BN1A 5CVFA 5B2KA 2WKMA 2RGPA 4JX7A 3MA6A 3PSCA 4GJ3A 4FTRA 4II5A 2X8DA 2J0IA 2UZTA 3P5KA 4YBKA 2IF8A 2QKWB 3KRLA 4MNEB 3H3CA 4XV3A 4R3CA 2XM9A 2H9VA 3ZUUA 2B1PA 3ITZA 3HDMA 3QCSA 4XLVA 3ML1A 3ORPA 2ZM4A 1B6CB 4QTBA 2VWYA 3IS5A 3KK9A 3MGYA 2QC6A 4F78A 1OPLA 4OTGA 4AAAA 4AW2A 3FYKX 4C61A 2CGXA 3UJGA 4FTOA 4EQCA 2PU8A 4FE2A 1CKPA 3UC4A 4GIIA 4FBXA 5HCZA 3DB6A 2AYPA 4MXXA 2BHEA 2ZV2A 4FG9A 3R21A 4GUEA 2R3GA 3FY0A 4IWDA 5F95A 4F7LA 2ACXA 1RW8A 3BV2A 5HX6A 3QUPA 4NM7A 5E8YA 5HO6A 4OT5A 3IGOA 4YO6A 5HIDA 1YDRE 2R3PA 4F7JA 4GCJA 3MVJA 4YJPA 3UVRA 3HMOA 2AQXA 4K2RA 2UZDA 3U8WA 3AC8A 1OIRA 2XK6A 4FKPA 4ACGA 3P23A 4K9YA 3MPTA 5L2WA 3OW4A 5CQWA 1PXLA 4LGHA 4APCA 4DGOA 4EUTA 5KNJA 4PQNA 3LAUA 4MXOA 5HE1A 3HNGA 4A4XA 4DA5A 2LAVA 3LCSA 1YWNA 4W4YA 5HTIA 2JKQA 2QR7A 3BE9A 2PUUA 2OG8A 4G6LA 3TKIA 5C1QB 2XUUA 4L46A 3KXXA 1BUHA 3ZXTA 4AX8A 4IB3A 4A4OA 4RLKA 4FV5A 3LE6A 4WD5A 3QGWA 3OS3A 1XWSA 4RJ7A 4PMMA 5AP6A 3WIGA 5AP4A 2YCRA 4UY9A 1F0QA 5JT2A 2GSFA 3LXNA 4FNYA 3W0QA 4KIKA 2XRUA 4IW0A 5HG8A 4O38A 1Q61A 3IO7A 3GBZA 4Z16A 5TKDA 4A7CA 2UW6A 4CG8A 1U46A 3QTWA 1CM8A 1FVTA 2R3NA 2ITYA 5J87A 4EOIA 5LOHA 5AP7A 4DFNA 3FI3A 5EK7A 3RM7A 5AWMA 3OXTA 3NGAA 2VTSA 5AIRA 4DAWA 2CHLA 5I9ZA 1UU9A 3BYMA 2ZM1A 2KTYA 4G5JA 4IWQA 3B8RA 3NYXA 3U87A 4XYFA 5TT7A 3TJDA 4JVGA 4BZDA 4QMYA 3PVGA 5M4UA 3UTOA 3CKXA 4MCVA 5CNOA 4G2FA 4AN2A 1TFFA 1NY3A 3ULZA 4E4NA 4NL0A 3BYVA 1ZYDA 2JKMA 4BDBA 2YIQA 1H24A 4EOOA 4CMOA 3Q6UA 3IGGA 2BR1A 3O5AA 3G51A 4ASZA 4I4FA 1H4LA 3GP0A 4IZ7A 3ZDUA 4TWPA 3R1QA 1IG1A 3FLSA 3K2LA 4IVAA 4O22A 5FTQA 4EYMA 3PXFA 2G15A 2XYNA 3HP2A 4JQ8A 5IA5A 4D2WA 4BJJB 3LXPA 4P90A 4YU2A 5CALA 3QUDA 3GOPA 4I21A 4YPSA 1H1RA 2CCIA 4EH3A 3PUFC 5CSXA 4M14A 2P0CA 3HV3A 5L6OA 1YQJA 3PP1A 3Q5IA 1QPJA 3C4XA 3DBFA 4L3JA 4TPTA 4IAKA 1TVOA 4YP8A 5KMKA 2C6IA 4USEA 5D11A 3QQGA 1H26A 4I22A 4G1WA 4H1JA 4FV9A 1DAYA 5EYKA 5HLNA 4NYEA 4G3DA 5DI1A 4FODA 5IQBA 2R3KA 4ID7A 4X3JA 5AR2A 5HU9A 4YSJA 3QHRA 2X2LA 5IH5A 3OG7A 1Y8YA 4HZSA 4CRLA 4XMOA 4EH5A 5T68A 4DT9A 3WE8A 3VRZA 3EL7A 2ZMCA 3HL7A 3QWKA 3K5VA 4JR3A 3BZ3A 1OUKA 3EKKA 2UVYA 3JPVA 4GYIA 4QMTA 3E92A 2B54A 4FZFB 5C4LA 1F5QA 2HW7A 4S2ZA 4RQKA 3OOGA 4DFBA 2GNJA 3TYKA 4W8DA 2YM6A 2OJ9A 3E87A 3OUKA 3ZM9A 3RPOA 4XG7A 4AQCA 5LMKA 2ZYBA 5FTGA 3W55A 2F49A 3TNIA 4C7TA 2HCKA 3TZ9A 4F0GA 5IEVA 4ZSLA 4GK2A 4BYJA 4JDJA 2E9OA 4J96A 2RL5A 4DT8A 3L8PA 4E1ZA 3UDSA 1B39A 4QPMA 1RE8A 2O3PA 4RG0A 5IQEA 2YA9A 3R7GA 5J5SA 3MFTA 4BHNA 2NYAA 5M09A 2VO7A 4JJRA 1W2DA 2NRUA 3GQIA 3UZPA 3PXQA 4Z3VA 3Q6WA 2EXEA 2ITPA 3FZTA 3MB7A 4FT3A 2JFMA 2ZFYA 3HDNA 5J7HA 3FDNA 3U6JA 1OGYA 4AAYA 5CI7A 3A7IA 3S0OA 5T6KA 3FV8A 3QD0A 4F7SA 2IVUA 1H08A 2C1BA 2VTIA 3KCFA 1JWHA 4NJDA 3MPMA 4I93A 4CFXA 1ERKA 1M14A 1UU3A 4GT3A 4PNIA 3AT2A 5CEQA 4AZTA 3QD4A 4DTKA 2WTKB 4ENYA 4CKRA 4HVIA 3CJGA 5GJGA 2C0IA 2HZ4A 3PFQA 4RJ5A 2Z7SA 3B2WA 5AP0A 1UKHA 4TW9A 3AMYA 4TYJA 4FV4A 3F7ZA 3O7LD 3RK7A 5AA9A 3KRJA 3SA0A 1M7QA 5CAOA 4RIYB 2X2MA 1WVXA 2B7AA 3GC8A 3KA0A 5BVOA 3P78A 3P4KA 5HHWA 4FG7A 3V6RA 3L8VA 4CZUA 2OZOA 2UW4A 3KU2A 1HOWA 3FI4A 3EZVA 2PE0A 4J97A 4L52A 2QOLA 2O5KA 4PTCA 5HLPA 4FSQA 4L7SA 1Q8WA 4LYNA 3NPCA 4ERKA 3UODA 4BIEA 1IR3A 4IAFA 4RX7A 1PYEA 2PVLA 2PE2A 4L3PA 4V05A 4DH5A 1OPJA 3F82A 3VJNA 3ATSA 4NWMA 2CKOA 1JSUA 5IQIA 1V0BA 3KXNA 2F2UA 3Q9ZA 3KXHA 5EM6A 2WOUA 3P79A 5FRIA 3OWKA 4DGNA 2WMTA 1KWPA 4LRJA 4NCTC 5EYCA 4UZHA 3CKWA 2EXCX 2XZSA 3DAJA 2GNLA 3UIXA 1GOLA 2J9MA 1NXKA 4M13A 3DJ5A 4JBVA 3UZTA 3A7GA 1O6KA 3QZGA 4M68A 4AOIA 3MPAA 5CLPA 5AX9A 4J99A 4BVUA 3ORXA 1IASA 4P5ZA 4B7TA 4JNWA 2A27A 3VVHA 5A6OA 5D7AA 5DGZA 2FB8A 5F94A 1MRVA 4FOCA 5H8GA 4BDJA 5BYYA 3TV6A 2X39A 4DDGA 2W05A 5AUZA 2F9GA 2X9FA 4H3BA 3VUGA 1W8CA 4C37A 4RGJA 2C5XA 2QI8A 4YJTA 5ETIA 1L8TA 3EWHA 3GCVA 4O1PA 3SXRA 3BLRA 3W16A 3IKAA 4D2VA 3ROCA 1APME 4EQUA 5IMXA 5CXZA 1BX6A 1YVJA 3QTXA 3QRJA 3COIA 4HJOA 4IM2A 5LVLA 2C30A 2YABA 5LQFA 5K3YA 5M55A 4AE6A 4KIOA 2VUWA 4OT6A 4I5HA 3PVUA 3KULB 4F9AA 4FTCA 4QDEA 1I44A 3DAKA 4JI9A 4QP9A 2ZJWA 3REPA 1H0WA 3GC0A 2X0GA 2F7XE 4K77A 3UNJA 2WQNA 4EZ7A 5GZAA 4DFLA 2XNEA 4HCVA 5DMZA 3QX2A 2GQSA 1ZYCA 3LFNA 2YM4A 2QOHA 3HKOA 5HG9A 4JQ7A 4BDIA 5I9XA 4G34A 3FMNA 2QHMA 4RFZA 1IAHA 4GFGA 3CQUA 4EOLA 4R3RA 3P86A 4FMQA 2UV2A 5FGKA 5JZNA 5LVMA 3U9NA 4ASXA 2WTJA 4AT5A 5GZ8A 3H0YA 2ZV7A 3UG2A 5H8EA 3C4FA 5AP1A 3OD6X 1OL2A 2I1MA 3LJ0A 3WBLA 2I0YA 3JY0A 3NLBA 3R6XA 1Y8GA 4ZTNA 4FSWA 4ZZNA 3L9NA 4FKOA 5FBNC 3N9XA 4RC4A 5G1XA 5GJDA 4QP1A 3GGFA 2YM7A 4U3YA 4GU6A 4W9WA 3SOCA 5DPVA 5DFPA 4GYGA 3A2CA 1HCLA 4ANOA 2XJ1A 3SLSA 1T46A 2YWVA 1W84A 2J90A 3G5DA 4BCPA 4O81A 1A48A 4ZMFA 3UDBA 3WZKA 2PTKA 4F1MA 5K5XA 4PPCA 3OWPA 3PA5A 2Z8CA 5CF5A 1OPKA 4GK3A 2BTRA 4GW8A 4FKSA 4YZ9A 4U3ZA 4NW6A 4XG3A 3GI3A 3FWQA 3CGFA 2UW8A 2YLFA 3OCTA 4BGHA 2J0KA 3LFFA 2RIOA 2YITA 2B0QA 4XX9A 4PMSA 4J53A 3ZZWA 4CXAA 4ZIMA 1K9AA 4QMZA 3SV0A 5JFVA 4FKQA 2RG6A 4BC6A 4O7SA 5ACBC 4ORKA 4EEVA 2PE1A 3I6UA 2ZDUA 5EYDA 4HGEA 2X8EA 4Q5EA 4MF1A 5IQCA 2V5QA 4JT3A 2BPMA 1GNGA 4JR7A 4BHZA 5BUJA 4ZSEA 2BKKA 4MEDA 2VTTA 3HMIA 4MBIA 3NCGA 3I5ZA 4FKWA 4YNEA 1OIUA 4AW1A 5IZFA 3HP5A 2HWPA 3QC9A 2C6OA 4UWCA 5K4JA 5C8MA 2W96B 5AFVA 3G9NA 3VS1A 2UVXA 4DBNA 2HW6A 3IW5A 2BDWA 2VX1A 3PDTA 3QBNA 2EVAA 3OROA 4XRLA 4FT5A 3QTUA 2IZUA 3UMXA 4F09A 2ETKA 3NDMA 5E91A 2HAKA 5FEQA 2FYSA 2OWBA 2P3GX 1L3RE 3NNVA 2J5FA 2UZLA 2R9SA 2XKEA 3GEQA 4K6ZA 1JNKA 5FLFA 3RPSA 4CFNA 1DI9A 4X3FC 2WOTA 4RFMA 4USFA 5J1WA 2OXYA 5L2SA 3FYJX 4RRVA 2PZ5A 5IQAA 4DBXA 3CY2A 4FKRA 4EK8A 3NX8A 4XG9A 5CANA 3TMOA 4LRKA 4GKIA 5DT0A 3NNUA 4OTWA 2PHKA 2A4LA 4EJ7A 3IDBA 5LMAA 2WU6A 1YOMA 3VONA 4QMUA 2XANA 4RWJA 4DH1A 3HLLA 4CTCA 4WHZA 4YC3A 5CZHA 3L8XA 3ALOA 3OC1A 1UNLA 4ZS4A 5JMSA 4JRNA 4V0GA 3AKLA 2YM5A 5L8KA 3QZFA 4WT6A 4QPAA 3R1YA 3NUNA 5F4NA 3LHJA 4IX6A 4Q5HA 4TXCA 4WSYA 3RM6A 5M56A 1M2PA 3CC6A 1WBPA 2VV9A 3OXZA 3Q2MA 4AU8A 4DTBA 4Z9LA 3SG8A 5FTOA 1PHKA 3Q4UA 5HE2A 3NIEA 5GIOE 4MAOA 4H39A 4QQCA 3DDPA 1OIYA 3F3TA 4WNOA 5HE0A 1M52A 4PDSA 1U54B 3AC5A 3BHVA 3ZO1A 5BVNA 5KCVA 1ST0A 1XBBA 2YJRA 3SVVA 3C9WA 3G2FA 5I5ZA 3DQWA 2YACA 3HV6A 4FZ6A 5JZJA 3MY1A 3PY3A 4XP2A 2VRXA 3UP2A 4AG8A 4R7BA 4MXYA 4NM3A 4RBLA 4M69B 2CN5A 3M11A 3F5GA 3R63A 5CTPA 5ETAA 3V5JA 3RAHA 1PY5A 4ZY6A 3MS9A 3EN9A 3VBTA 3WF5A 1GZNA 3EFKA 2OZAA 1M2RA 1Y57A 4ZSAA 1XH9A 5HNIX 2CKEA 3P7BA 5BQ0A 2WELA 1NVSA 4H3QA 2R3OA 4KIPA 4QYFA 3ZEWA 2C4GA 4A9RA 2QOIA 3W8LA 5M4FA 3VC4A 3OW3A 3EZRA 4MVFA 4R5SA 1SVGA 5HCXA 4E5AX 5AA8A 4WA9A 4IZAA 3T9TA 4ANQA 4AZFA 3GCPA 5E92A 3KK8A 4TYHB 3NVMB 4O4CA 1GIJA 1V0PA 4GMYA 4IX5A 4UB7A 2WMXA 5AUXA 1NW1A 2XP2A 2YDKA 4O0WA 2XAOA 3GOKA 3FZOA 3EN6A 2CLQA 3HAMA 3BGZA 3PFYA 4FIGA 3EFLA 3EOCA 2PZRA 5ETCA 3LJ1A 3T8OA 2XS0A 4AA0A 4YZDA 5LWNA 3BEGA 2OIDA 4D0WA 2I7QA 3ENHA 4O6EA 2O8YA 3VS7A 2XA4A 4E6QA 4FTMA 4UWYA 2X0PA 2JAMA 3PSDA 2ETRA 4NFMA 4O7RA 3Q4CA 3PJ8A 3H10A 4KABA 4YJSA 1PRYA 5LVOA 2DWBA 4BBFA 5CYIA 4JL9A 2C6LA 4FTIA 4FV6A 3PIYA 4YLKA 4PX6A 3K3IA 4J71A 2WQBA 3DPKA 4TT7A 4UXQA 3R9NA 1VJYA 3UOLA 4E4XA 2PL0A 4M67A 4EHGA 3F61A 3UO5A 5EFQA 4OAVB 3VUMA 4IZ5A 1VEBA 3H9FA 5E8TA 4BFMA 4O84A 3W8QA 2PMLX 2X7GA 3RKBA 2PWLA 3RPYA 1TQMA 3ZUTA 3VUDA 2C47A 4LM5A 2YIWA 2PZPA 2C3IB 3MFSA 3OP5A 3V5WA 5HVKA 5JFSA 2A1AB 3E8NA 3DBCA 3RCJA 3FQEA 2OH4A 4QEBA 4DEHA 2QOFA 2YERA 4QMQA 1ZMUA 2Y7JA 4U9AA 3AKKA 3GU5A 4TRLA 5K9IA 3IW4A 3TZ7A 4IZYA 4O0RA 4EHZA 5CNNA 4E5BA 4F9CA 5LVNA 3EN5A 5BUEA 2HZIA 1TQIA 1Z9XA 4YNOA 1OM1A 4HYSA 3UPZA 5HLWA 1OBGA 5AIKA 4F9WA 4WBOA 2ITOA 3PRFA 5CT0A 4BDCA 2QOOA 5CQUA 3FMEA 3ZFXA 4BDKA 2CJMA 4FT7A 3DOGA 4O96A 4DFXE 4JG6A 3NYOA 3ODYX 3BU6A 3JVSA 2WU7A 5M44A 2OFUA 3NS9A 3PG3A 4DDIA 2P33A 2PZYA 3PY1A 4AT3A 3VS3A 4H05A 4CFVA 4AXCA 2FSTX 4BCFA 4CNHA 2XK8A 3TCPA 3LMIA 3LFSA 3GFWA 2YZAA 4TYGA 2BMCA 5ANGA 1T45A 3BX5A 4PDYA 4F0FA 4S33A 3HA8A 3N4VA 3CY3A 4C35A 3SW7A 4IDVA 3SKCA 5LARA 4O2ZA 1W7HA 3GENA 2R3MA 3RAWA 2WGJA 4FV8A 4YPDA 5HBEA 3D9VA 3OT3A 5DRBA 2Y4IB 4EZ5A 4UMPA 3OMVA 3PIXA 4Z55A 1CTPE 3BLHA 4FIIA 4H3PA 4O7NA 5CASA 1M17A 4NSTA 1RJBA 2R3QA 4Y72A 4DG2E 2DQ7X 3VBVA 4IAZA 3HYHA 3RAIA 4U97A 2R3IA 4IEBA 1DS5A 2JBOA 4J8MA 2WQEA 2P2IA 3ATTA 2X8IA 3Q52A 3S1HA 5I9WA 1YXSA 2GMXA 2OJJA 3HA6A 2ITWA 3PE2A 1KE7A 4BKJA 3COMA 3E7VA 3EQCA 3IECA 5JSMA 4WBBB 4FC0A 4O7ZA 1PKDA 2PVYA 3AG9A 2UZBA 2HENA 2W9FB 3KF4A 2GHMA 3TT0A 5F9EA 3OTVA 3CPCA 4EBWA 2R0UA 2X7OA 4ZJJA 5T3QA 5J1VA 3V5QA 4C3PA 4D4VA 1Q8YA 5HBJA 2WEIA 5HVJA 1H25A 5IISA 4KAOA 3MVHA 3VBQA 3HRCA 3D83A 2YZLA 3R9RA 3F88A 3HV7A 1Q41A 2WPAA 1G8JA 4G9RA 1M7NA 4O4EA 3RP9A 1FMKA 4AFEA 3VUIA 3ZLYA 3FJQE 3OEFX 4QO9A 3ZM4A 2XJ2A 4EOPA 4FSYA 4X0MA 1HCKA 4JDIA 3DQXA 3R7OA 3BCEA 3FMDA 2LGCA 4C4GA 5KX8A 4AXFA 5EH0A 4IM0A 4O6LA 2H34A 4FGBA 4XV1A 4U41A 5EM8A 5DN3A 4TTHB 4UBAA 5AR4A 5HD4A 3R01A 3KY2A 3ZSIA 5HNGA 4RMZA 4N57A 5C01A 3PZEA 5ITAA 1KSWA 2WMQA