1ZOEA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase CK2, alpha Subunit
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
total genus 103
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zoeA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zoeA02
2OSCA 5C9CA 3HV7A 5AP1A 4GUEA 4W4VA 4CMTA 3DV3A 3KULB 4D4SA 2P55A 3FMDA 4U3YA 5HNBA 3R04A 2QU6A 4GG5A 4LYNA 4NTSA 3MA6A 4TY1A 3V5QA 3FKOA 3UOJA 2G01A 4JR7A 5L3AA 1XBAA 4AGCA 3QWJA 1YHWA 1WBSA 2YM6A 4AFJA 4YTFA 4YBJA 5CAOA 5GIOE 3S00A 4C61A 3KXZA 3LMGA 1Z5MA 3AOXA 4LUEA 5EHLA 5EDRA 3QLFA 1UKIA 5IQFA 4LOQA 3PSBA 3MVLA 2OG8A 5EHYA 5IH6A 4DGOA 4QTAA 3LMIA 2OO8X 2I0YA 3GC9A 5H9BA 3TNQB 4Y5HA 3AXWA 3SA0A 3ZO2A 5J9LA 3MW1A 3TV4A 4ACMA 2R0IA 3QTZA 4EOIA 5D9HA 3LCTA 4JRNA 4MEDA 1WBTA 1XQZA 3AGMA 3JUHA 3UOKA 4BVUA 3MPTA 5LMBA 4I22A 4AGUA 4B8MA 3TXOA 2J0LA 3RAIA 4O2ZA 5J1WA 4IAZA 5LOHA 4YHFA 3S1HA 3OBGA 2YCFA 1Q61A 2W17A 3NCZA 2Y6OA 4CTBA 3FXZA 2B55A 3I60A 3CJGA 3WI6A 4ZLZA 3DKGA 4FODA 3HYHA 4EWHA 3ORIA 3PPJA 1OECA 4LM5A 4GV1A 3QQHA 2RF9A 3ZO1A 3DTCA 5JQ8A 2UUEA 4UWCA 5ETCA 4JOAA 3C51A 4RC2A 4HNFA 4BR3A 2Y4PA 1LP4A 2G2HA 3SOAA 3QCXA 3ZCLA 5CEPA 4K6ZA 1U4DA 4EH2A 4A4XA 4FG8A 3UOHA 4C58A 2QVSE 4JIAA 5AV1A 3VUIA 4FIEA 4NFMA 1NVQA 4UXLA 4WHZA 4TRLA 2Z02A 3BHTA 4H3QA 2B1PA 4D2TA 2GCDA 4E5WA 1LEWA 1Q41A 4ACGA 3COIA 3LE6A 5CTPA 5HE1A 2HIWA 4WT6A 5FXQA 4O0VA 3MFTA 2BPMA 2XK7A 1ZOGA 2R4BA 5CT7A 4BI1A 5J5TA 2BDJA 3ANQA 3GCQA 4FTTA 2WELA 1PXNA 3W2RA 3Q5ZA 4YO4A 4IW0A 4HW7A 4TYHA 5EM7A 4GIHA 5IKWA 5K5NA 3CC6A 4DLJA 4E4MA 4FKWA 3ORNA 4F70A 4AGDA 4J1RA 3PWDA 3WZJA 3PY3A 4YJQA 5GJGA 5IA4A 2WO6A 3QLGA 3D7ZA 3DLZA 4YJVA 3ODZX 2YABA 4I4FA 1MRYA 2B9FA 3RCDA 3RP9A 4ANNA 3LFCA 3TIYA 4B9DA 3UTOA 3MTLA 4OT5A 3ZHPC 3IOPA 4KABA 4EJNA 3K3JA 3EQPA 4QNYA 4IAYA 3EHAA 4PDOA 3HGKA 4KRCA 3EYGA 1NY3A 3BQRA 4E3CA 2Y8OA 3A8XA 4IB1A 4DG2E 4FSTA 4KIKB 5TO8A 3B8QA 3OT3A 3BU6A 5JK3A 3VIDA 3IG7A 4FIJA 4IM3A 5DHJA 3RKBA 3AMAA 3D4QA 5HE0A 3HUCA 5M4IA 1FMOE 1KSWA 5DR2A 2XZSA 1SYKA 2F4JA 2BAKA 5GZ9A 1H01A 3BI6A 3L8VA 5BMSA 3ZYAA 1WBOA 2UVYA 2E9NA 1GIJA 1R3CA 3NYVA 1ZY4A 4AGWA 4LOOA 4BF2A 1FVVA 4GUBA 4RRVA 2B0QA 3W2SA 2XNPA 3PXYA 4X2FA 4PF4A 3R7YA 4EOPA 4DG0E 2YZLA 3NR9A 4TYIA 1PXJA 2BRMA 3AQVA 3EQHA 4GT3A 3A7IA 2UW0A 1Y6BA 2BIKB 2ETKA 4FTNA 4NH1A 2QOQA 4QMZA 4U97A 4WNOA 4O21A 2YDKA 1IRKA 4MNEB 2JKQA 5FTGA 3ZLYA 3GFEA 4PP9A 2X7OA 3LLTA 1H0WA 4IH8A 4H05A 4C3FA 3RHKA 2IO6A 5D7AA 4G16A 4R3RA 4CQEA 4IZAA 4IXPA 4FTCA 4PP7A 4O7ZA 2IVTA 3Q9WA 5ANGA 3MSSA 3BE2A 4IZYA 5EG3A 1A06A 2Y9QA 3G6GA 4M69A 4E4NA 5HVJA 1BI8A 3DK3A 4BCKA 2JDSA 5CSXA 4MAOA 2YCRA 5HIDA 2ERKA 2C6OA 3RK5A 3CQUA 4A9TA 1PXIA 5AUUA 4FSRA 4LUDA 1HCKA 4FSMA 1CSNA 2G2IA 3BBWA 1WMKA 1YDSE 2O0UA 4USFA 4F7JA 2BRHA 2PZIA 4MH7A 3DBDA 4L7SA 2YDJA 3FAAA 2EWAA 3TZ8A 4RJ4A 3ZDUA 4BY9E 4EOQA 4TKSA 5M06A 5GZAA 2HWPA 1XHAA 3TZ9A 3AGLA 4GW8A 4YTCA 1GAGA 4MXZA 3TNWA 3VS7A 4X2KA 4WNMA 3LHJA 2DWBA 3GEQA 3LFNA 4DF3A 5EQEA 4MXYA 5TOZA 2F49A 2NP8A 2W4JA 3D0EA 4AOIA 1YWVA 2PL0A 1Y57A 3QHRA 3R71A 1QCFA 1WVYA 3MDYA 4LI5A 5DEYA 2QQ7A 4RC4A 3DJ5A 3GQIA 4PL3A 1CM8A 4PX6A 3UIUA 5BUJA 4CKJA 3SOCA 2PY3A 3OTVA 4X3FC 2Z7SA 5E1EA 1UV5A 2JBOA 3MFUA 4E6QA 4ZAUA 2QI8A 2V0DA 4WKQA 4FZ7A 2YM5A 3OWJA 4IANA 4UZDA 5A46A 4XV9A 1MP8A 3UVPA 2QHNA 4CRLA 4ID7A 4YHJA 2BAQA 1PKDA 3I7CA 3VS3A 5EDQA 4MXOA 3R7IA 4IIRA 2HZ4A 2CHLA 3NWWA 2J0JA 4RX8A 3ZZEA 4ERKA 3SG9A 2ZYBA 3G51A 3PP1A 4ASEA 2QG7A 5AP5A 4K1BA 5EW8A 4ALUA 3NEWA 4JG6A 4C4FA 3QTQA 3HP2A 4E8AA 3V5LA 2XS0A 5CZHA 2V7AA 3VS2A 4ACHA 3MIYA 1S9IA 5AP3A 5HIBA 4TL0A 5HO7A 3OXTA 5ETAA 5J7HA 2R3LA 4M12A 1XR1A 4HYIA 5DA3A 4BB4A 3F6XA 1UNLA 2X39A 3AD5A 4V05A 4NIFB 4AG8A 4XV3A 3V5JA 4OTPA 4F7SA 2PMOX 1ZXEA 4JLCA 4OUCA 4QP6A 5IISA 3GENA 1G8AA 5LVNA 4MYGA 4D55A 1WVWA 1PW2A 1P4OA 4GFOA 4J96A 5EHOA 3WF5A 4BBMA 2HZ0A 3OCGA 1CDKA 4C4IA 5A14A 5IF1A 4CT1A 3VQHA 5KE0A 4F1TA 3OY1A 4J97A 3M42A 4X2GA 1OUYA 4DT8A 1Q8UA 3OC1A 4QPSA 4DC2A 3Q60A 2YIQA 4RWLA 2WTKB 4JI9A 5EYCA 5L8JA 4L8MA 4F6UA 4EL9A 4QTEA 4EZ7A 2PPQA 3HMOA 5IQDA 4MWIA 4BIBA 3FSFA 4LV8A 3ETAA 3P7AA 4U6RA 5EM5A 2XEZA 3C0HA 1VEBA 2NNWB 3FMMA 2W1GA 4G3EA 5DEWA 4S31A 4AUAA 3CP9A 3TT0A 2BUJA 3NW5A 4HNIA 4CQGA 4C37A 4YBKA 5LXMA 4R5YA 2W99B 3BHUA 3NVMB 3BHYA 2JD5A 5M4UA 3R0TA 3ZO4A 4KIPA 4PTGA 1XJDA 2JC6A 2W1EA 3FC2A 2J51A 2VTIA 4FKOA 4L3PA 2NPQA 3F7ZA 4FZDB 4MF0A 4XG9A 4DEIA 3QZHA 4FKIA 4EK8A 4AP7A 3FPQA 3E64A 1APME 1H24A 1BL7A 3D83A 3WZUA 5KKRC 4KIQA 3KF4A 3MA3A 3EQGA 3ZLWA 1PKGA 4EK6A 3QQFA 3UVQA 4IWQA 5EI6A 5HIEA 4BDHA 3QZGA 2NO3A 3JPVA 4FIIA 3Q96A 5CAVA 2C4GA 5EI8A 4TYJA 5CVFA 5FEEA 5AV3A 4RVLA 4FUYA 4I3ZA 4QMPA 4YSJA 3UBDA 2GHGA 2CNVA 5AEPA 3IONA 5HTBA 1O6LA 3AC8A 3OWPA 4A4OA 4C35A 5CALA 5AAGA 4ZIMA 4IVCA 3UC3A 5EQYA 3O7LB 3CPCA 3JR1A 1SVGA 4W4XA 4BCQA 2YISA 5KHWA 5LVOA 2PVFA 3BEGA 2XK6A 4FNWA 3SC1A 3WBLA 3ZONA 4B99A 4FF8A 3IW6A 2GS7A 5CSVA 5H8GA 4JT3A 3DB8A 2P33A 3HDNA 4KBAA 5AAFA 2JKMA 4EK3A 2UZVA 5M09A 3QKMA 4CV8A 3FHRA 1BL6A 1JSTA 4Y83A 4AXAA 3TKHA 2HELA 3GC7A 4BN1A 1KOAA 1Q99A 2XUUA 4WO5A 1Q97A 2C6IA 1E9HA 4PDYA 1MQ4A 3HA6A 5ACKA 3POZA 4ACCA 3EL7A 4YLJA 3UQGA 4U45A 2R3NA 2WOUA 4H1JA 3QRJA 5JFSA 4G3DA 3E8CA 3VUTA 4EWQA 4FKLA 1W84A 3SQQA 3OG7A 4IVDA 5JH6A 4F64A 4F6WA 2ITXA 2Y7JA 3LVPA 4E1ZA 3I4BA 5BVKA 1R1WA 3F5UA 3RJCA 3TACA 3F3VA 1U5QA 5CAQA 5HX6A 2VTNA 2WMXA 4HVGA 4EUUA 5IDNA 4IWDA 3R7OA 2I7QA 1Y6AA 4P4CA 1M7NA 3PWYA 4QMVA 5J87A 4JIKA 4FUXA 3DZOA 1J1BA 2JDVA 3E3PA 4KSPA 5HX8A 3U4UA 4YU2A 4RWKA 3A60A 3D2KA 3HX4A 2GNGA 4RIWA 2P0CA 4UWBA 5DN3A 3FLNC 4A07A 2O64A 2R3PA 2OK1A 3ULZA 3FKLA 1GOLA 2HENA 2E9VA 2YIXA 3E8DA 3MPAA 3OD6X 4I20A 1PMEA 3LXKA 4BBFA 2J5EA 3UYTA 5HLWA 2YM3A 2JLDA 1SVHA 3DBQA 3ODYX 4O84A 5CU3A 1LPUA 2PVYA 2PVNA 4ONAA 4DGNA 5I9ZA 3COHA 1ND4A 3CTJA 4ITIA 2SRCA 4IB0A 4IJPA 5AV2A 4ERWA 5HBHA 3ZOSA 3VHEA 1G5SA 2WTWA 3FE3A 3FLQA 4XP3A 3RPSA 5FBNC 1RJBA 1XH9A 3MY5A 3PSCA 5M55A 2EXMA 2QNJA 1J91A 4BRXA 2X4ZA 4D2VA 5LCJA 2JIVA 5CQWA 5HKMA 4UMQA 2OJ9A 4FG9A 2AC3A 3MV5A 2R3HA 1JQHA 3I79A 3F7WA 4K18A 4I6FA 3FUPA 3OWKA 3SDJA 4GKHA 2BCJA 4EI4A 3LZBA 5LCKA 2C68A 2IG7A 1PMNA 2OFUA 4O0TA 2ZM1A 3P1AA 4KIOA 4YPSA 4O2PA 5FP5A 4FC0A 3C4XA 3UO5A 5CSHA 3E62A 4KSQA 3SVVA 1UWJA 2F9GA 4J7BA 4YZNA 4EBVA 1YI3A 2YCSA 3A99A 4I1ZA 3DFAA 4FEWA 1W0XC 4G5PA 4LRMA 1V1KA 4E20A 2UZLA 5T68A 4UY9A 4NUSA 1B38A 4O0XA 4APCA 2BRGA 4QP7A 4EHGA 2C47A 4RJ3A 4R6VA 4KBCA 4PDPA 4O7RA 1MRVA 2IZUA 3KN5A 3IGOA 2PVRA 3LFAA 4FSUA 1M2RA 5AR5A 1IAJA 1YXUA 2HWOA 5HBJA 4HVHA 3VN9A 4BCHA 4LG4A 5F94A 2YN8A 2WTJA 2JDRA 4YC3A 2GS6A 4IVBA 3W32A 2ITNA 4GJ2A 3B2WA 2XKCA 4L43A 3V01A 2PE1A 2JKOA 3TWJA 5K0XA 3NIEA 5IUGA 4EOOA 3P86A 4OBPA 2GTMA 4GU6A 2QOFA 4BDAA 4O7TA 3U6HA 2JFLA 2PHKA 4PMPA 2ZB1A 3BKBA 3HVCA 3LXNA 3PVUA 5AA9A 2VO0A 4QOXA 3GCUA 2WTKC 3O96A 2C0OA 2WMVA 4MD7E 4V04A 5CEQA 1NW1A 4RVTA 2RFNA 3EQIA 1H07A 3K5UA 4RQKA 3KRLA 4FKRA 4V0GA 2A1AB 4CTCA 2X8EA 4RX7A 5ANDA 2IW8A 1H00A 3EQDA 4PRJA 2OW3A 4ZLYA 4NCTA 5EK7A 2ITTA 2PUUA 3K3IA 4TNBA 3EQFA 4IDVA 2UW6A 2BVAA 3GCPA 2DYLA 3OCTA 4HZSA 5E1SA 4I5PA 1H28A 4LFIA 5AAEA 4CG8A 4QQ5A 3Q5IA 2QKRA 2JEDA 3QWKA 4S32A 4H1MA 4YUQA 3PLAE 4P7EA 4K77A 1W7HA 2GSFA 2VV9A 3FLYA 2JGZA 3OW4A 4LMUA 2B7AA 2F57A 3FHIA 5ANOA 3FI4A 3L9MA 4RVMA 3FMEA 5B2KA 1DI9A 4CFFA 4B0GA 3QTIA 2J50A 2X7FA 1REKA 5I3OA 5DGZA 4IAKA 3VNTA 4WRSA 4BBEA 3A62A 2R3JA 4FK3A 5AR4A 4EOSA 4MVFA 4FICA 2WHBA 2XNEA 3VUGA 1B39A 3FQHA 3OXZA 4GJ3A 5B0XA 2JKKA 5BVWA 3E7VA 5EDPA 1OPLA 4UZHA 4EHZA 2XNOA 3FJQE 3GVUA 3ROYA 4UYNA 2G2FA 2OXXA 4FI1A 4W4YA 1J7LA 4IAAA 4UEUA 3HECA 5IZFA 5KMKA 4OW8A 1ZYLA 5CI7A 3W10A 4EC9A 3TV6A 5H8BA 4M13A 4OGRA 1DS5A 3SRVB 3ALOA 3O7LD 4I21A 5AWMA 2HYYA 3DAJA 4IC7A 3UVRA 2ZM3A 4FTLA 5JZNA 2HW7A 3RPYA 2UZNA 2UW4A 4U3ZA 4WRGA 2UW9A 4I41A 2GTNA 3QA8A 1KUTA 2WAJA 4JDJA 4PL4A 3RVGA 5HU3A 4LL5A 4AOTA 3QD0A 2ZOQA 2VO3A 2BIYA 3HRFA 4WG4A 4Y85A 1JNKA 3FZPA 2YEXA 1ZMUA 4NTTA 3PA4A 3CS9A 3L9PA 4G6LA 2IZSA 1CTPE 3Q9YA 4YHTA 4DH8A 4YO6A 4ITJA 4IWPA 4X3FA 1PF8A 3DNEA 3KULA 4NT4A 3U55A 5HG8A 5AUWA 3FMJA 3ZUTA 4A06A 4P90A 4ZZOA 2OXDA 5E8SA 3Q6UA 5EYDA 2QOCA 3ZRKA 4BICA 4BDGA 3MVMA 3LKMA 4EOJA 4RG0A 2ZVAA 3F61A 2A4LA 3UO6A 4I0TA 5CSWA 4P2KA 4GVJA 4ZSLA 3FDNA 3RPRA 4IAFA 4BWPA 4DFNA 4Z55A 5BVNA 4DYMA 1TKIA 4OTGA 1IR3A 3LFSA 3ZO3A 5HVYA 2AYPA 5GJDA 5HNIX 4RZWA 4JS8A 2IZTA 3AC4A 3PJ3A 3QUPA 2PUIA 4KKGA 4FIFA 2W06A 2XYNA 3O50A 4C33A 2W4OA 3SW4A 1NXKA 1G8SA 2XM9A 5A4EA 1QPJA 2I0EA 2OZAB 5AJQA 3G5DA 4I0SA 5M57A 5L6WL 3LCSA 4ASZA 1PXOA 4FA2A 1OITA 4ANLA 4EORA 1OL2A 4EH5A 4R8QA 4BIEA 4O0SA 5HG9A 2XH5A 4F7LA 2YERA 4BDIA 3PSDA 4AT5A 1KWPA 4JX7A 4ZSJA 1IA8A 3BYUA 1GIIA 4ZY5A 3CD8A 2C6LA 3PXQA 1PXPA 3IDCA 3KL8A 2JIIA 3R8UA 4DGGA 1JKKA 3DK7A 3O0GA 2XIRA 2BRBA 4BHZA 4UYAA 5C4LA 5L6OA 4LQMA 4DAWA 2WQOA 3ZBXA 4IC8A 2X2LA 3UZRA 3RCJA 4EQUA 1M52A 5HZNA 5IQCA 4LL0A 3FMKA 4JBPA 2A2AA 2Z7RA 5BYYA 2GNHA 3VUHA 4QMOA 4FV5A 4LGDA 2VX0A 4TT7A 5JFXA 4JAJA 5HCYA 3VBQA 2CNQA 4CT2A 4AW0A 3NUXA 5A6NA 2EB2A 3D5UA 1UU8A 1A9UA 3NUNA 3QXPA 3P4KA 4IZ5A 4ZK5A 4NKSA 4S2ZA 2WMTA 3SD0A 5EOLA 4G5JA 1Q8ZA 4N6ZA 4PL5A 1P5EA 2OXYA 2IN6A 4FK6A 2RSVA 1TVOA 4FTRA 2OJIA 3BWFA 2Y6MA 5CAPA 4G2FA 4ZXTA 1CKPA 1Y91A 3R30A 1JOWB 2EB3A 4RIOA 5FGKA 5H3QA 4D0WA 4CFVA 1XH5A 2C5NA 3PPZA 3QUEA 4FZFB 3DFCB 4I94A 4RA4A 4F1MA 5JKGA 5L4QA 1M17A 4NU1A 2A19B 5BNJA 3NNWA 2FVDA 3NCGA 3TTJA 4OR5A 1OBGA 1ZLTA 3PE1A 3UNJA 4RJ8A 4NM0A 4K33A 2LAVA 1ZARA 2UW7A 3DB6A 4ACDA 3WE4A 4KIKA 4W9XA 3HMMA 4XRJA 2YA9A 4L67A 2XJ2A 3OTUA 2UZEA 1LEZA 4JDHA 4X21A 1UNGA 4D2RA 3Q3BA 5E90A 4FYNA 4NK9A 4WA9A 4X2NA 4L44A 5AR8A 3VS6A 1W83A 1XBBA 3QQLA 4ZS0A 3PIXA 5FXSA 4S33A 4FVQA 4ANSA 1J7UA 4AN2A 3ZM9A 2F7EE 4FV4A 5HD4A 4G9CA 3BZ3A 1QL6A 2C6KA 1WBWA 4OAUC 1QMZA 1U54A 3CQEA 2QHMA 2XBAA 4FV6A 2WMQA 4YJUA 5AP2A 3RTPA 2C5XA 3ZEPA 1UKHA 1Q4LA 1VR2A 4F4PA 4JDKA 2PVHA 5M07A 4BDJA 2F2CB 2J4ZA 2PMIA 2XIKA 3FL5A 4APPA 3R01A 4U44A 4MNEA 3ITZA 3N9XA 4AN3A 4ZZNA 1WZYA 4R1VA 2W7XA 3Q9ZA 4I24A 4OBQA 3FY0A 3ORXA 4EKKA 4I6HA 2QG5A 3COKA 3QGWA 3R2YA 1ZRZA 3ZXTA 1U5RA 3BELA 4YMJA 2WB8A 2WOTA 2QONA 4U0IA 1OMWA 2X2KA 2OIDA 3QC4A 2PZRA 3KMWA 3LAUA 3KK9A 3PA3A 4W8DA 4AACA 3KCFA 3PJ8A 3FYJX 3RM6A 3W1FA 2C0TA 3VJOA 4EH6A 1JLUE 3LMHA 2OJJA 3GBZA 5J7BA 2ITWA 3BYOA 3HNGA 3L8XA 3R02A 5CF6A 4L6QA 4C3PA 3UG1A 4EHEA 3FKNA 5BYZA 3MBLA 4IE9A 3WF6A 3Q6WA 4FT0A 4PTEA 3RAWA 4YC6A 3OY3A 2C3LA 2P2HA 1HOWA 4ZEGA 1R39A 2VWBA 4PUZA 4BCIA 3IK3A 5F1ZA 3DXPA 4FKUA 3N4UA 3AC1A 3BYVA 4BKJA 4GRBA 3MIAA 4YJRA 5IEVA 3PRFA 1Q62A 3QRKA 4IAIA 1H27A 4O38A 3R8MA 5CXZA 5BX0A 4JBOA 1J1CA 3LCOA 4O27B 3G90X 4ZSEA 2QURA 2QC6A 4CFWA 5C27A 3EFJA 3N4TA 3F3ZA 2Z2WA 3FMHA 2BRNA 3Q4UA 4RVKA 4E5BA 3WZDA 3R9RA 2OIQA 4MF1A 3EN6A 4BCGA 3JY9A 3RBWA 3NUPA 1NT2A 3FI2A 3K54A 2HXLA 3L9NA 4YZMA 5CEOA 1ZZLA 4G1WA 4QMXA 1KE5A 2GNLA 1O6YA 3UIMA 4D5HA 4NCTC 3QU0A 3DAKA 4IFCA 1WBNA 4IJ9A 3SKCA 2C6DA 4CKRA 3NPCA 1Q8TA 4GK2A 1FPUA 4V01A 5HO8A 2R9SA 4F63A 4O7NA 5CU4A 5KUPA 3W2CA 4DBXA 4AU8A 4CFUA 3GU4A 4RJ6A 3RAKA 4R7HA 4C02A 4D2WA 4FV9A 4HGSA 4ZJJA 3CGFA 1UU3A 4O7YA 3IO7A 2UVXA 3TL8A 2BKZA 2WQBA 3F3TA 3ZC6A 2ZM4A 3W55A 2GMXA 3RGFA 3GNIB 4UXQA 1YDTE 1YXTA 3I0OA 3OEZA 3QQKA 2CCHA 4IMYA 4QMTA 2Q83A 2YM8A 4J98A 4TW9A 4IM2A 3RHXA 5IA3A 4PPAA 3WF9A 3QYZA 1H1QA 4IX6A 5GHVA 3VBVA 3LFEA 1SVEA 3TCPA 3C5IA 3HKOA 3ZSIA 4CFMA 3PJ1A 2GDOA 3UNKA 4RLKA 3TV7A 5KBQA 2E9PA 2QO7A 4XCUA 5AMNA 1JKLA 4G6OA 3FLZA 3TNPC 1WBPA 4PTCA 3R7EA 4ZSAA 1OIQA 3KRJA 5DBXA 2I40A 4TYEA 3RI1A 4AQCA 5JGAA 4FBXA 4D9UA 2WTCA 1XH7A 3MTFA 2R3GA 3VULA 1V0PA 3UODA 2ZMDA 4L7FA 5HE2A 4QQCA 2I0VA 4BTMA 2PVMA 3EKKA 3QQUA 2XJ0A 3CLYA 1NVRA 3HUBA 3UPZA 1TQMA 3QKKA 4YLKA 1T46A 4DHFA 3C4WA 4FTQA 5C4KA 2CLXA 3LM0A 5EOBA 4ANOA 4ZS4A 3G15A 5AR2A 5E8WA 4EK4A 3NYNA 4C62A 2YLEA 5HCXA 3K5VA 2BFXA 3I81A 1OL7A 3WIGA 3U51A 4CYJA 2GQGA 5BVDA 5HHWA 5LWNA 3ZSGA 2Y4IC 5AP6A 4M97A 4DFXE 2QO2A 4I6QA 3UNZA 2ITUA 2X9EA 2PZYA 2Q0BA 3KVWA 4FKGA 4YSMA 5AIRA 4I0RA 4ZOGA 2F7XE 2X0GA 4ZJIA 4L01A 2VTSA 3NUAA 3UZTA 3OW3A 4WG5A 4GMYA 1KV1A 5FM2A 4F6SA 3GI3A 4D28A 4BWXA 5K4JA 4JJRA 4QYYA 4C8BA 3ZU7A 5J5SA 1ZMWA 3DU8A 3BGPA 2OI4X 5CWZA 4EYJA 2BZIB 5I9UA 3KA0A 4EZ5A 3DGKA 4ZY6A 3R83A 4CV9A 1VYZA 5A4CA 3RNIA 5L2WA 3RWQA 4BYJA 5JSMA 1JPAA 2GFCA 5CENA 4DG3E 4O6LA 3ZLSA 4CYIA 4QMYA 4ZTQA 3LJ2A 4M66A 3FQEA 4MKCA 5IUIA 5JZJA 3CJFA 3G9LX 3R7GA 3C7QA 5CY3A 4A9YA 4PPCA 5J79A 5JRQA 5KMOA 4DE4A 1PXMA 4KKHA 1JBPE 2I0HA 4NJ3A 3VW8A 3IW8A 4AW2A 3FLWA 4N70A 4EK5A 5I9WA 4W8EA 3EOCA 4WUAA 4C2WA 5EQPA 4BTJA 1Z9XA 2X2MA 4XG6A 1M14A 3EQBA 3CQWA 3I6WA 5FBOA 4A9RA 2QR7A 3C50A 2OH4A 3DQXA 3F2NA 4H3BA 4K8AA 3QXOA 3DY7A 4J53A 5GINE 2XP2A 4MBLA 3N4VA 1YOJA 1IEPA 2E9UA 2WNTA 3CIKA 2WTDA 3D14A 2WIHA 4M15A 2RFDA 4FVPA 3OEFX 1UNHA 4U43A 3JVRA 3W8LA 5A4TA 3ET7A 3D7TB 1U46A 5ACBC 4GCJA 5ICPA 4IHPA 3W8QA 3V6SA 5IQHA 2VO7A 5TR6A 5HQ0A 5HGIA 2OBJA 4PMSA 5DMZA 2ZDUA 4OBOA 3FY2A 3QTWA 3C9WA 2QOHA 5HLNA 5ANKA 3UMXA 4KB8A 2O5KA 3AT4A 2X6EA 1Q3WA 2G15A 2YJSA 5A3XA 3VUMA 5CU6A 4RLLA 4UMRA 3F66A 5C03A 4M7IA 4M69B 4DH1A 4FTOA 2CKQA 4O83A 2VWIA 2H34A 3GCSA 4J52A 5EM8A 1LUFA 3V5PA 3IW5A 3TUDA 1PXLA 5LJJA 3HA8A 2I1MA 1OGUA 5I4NA 2UW8A 4F09A 3T9IA 1ZYJA 1JSVA 4MX9A 4BDKA 5C1QB 3A7HA 4QP4A 5FD2A 4F9WA 4I5CA 4AW5A 4NYEA 5BUEA 3U6JA 3GU7A 3DDQA 3DT1A 5LMKC 1OM1A 4EONA 2C1AA 4GH2A 4M14A 4CCBA 4JG8A 4DA5A 4O7VA 3KXGA 1S9JA 5CT0A 4FV8A 2CGWA 3ZUVA 4AN9A 3BBTB 4WUNA 3MN3A 4F9CA 2VU3A 3FZSA 3FQSA 1GZNA 3MGYA 5IA2A 4QMLA 3DBFA 2DS1A 4CMOA 1BUHA 4E4XA 3COMA 3FZRA 5BPYA 3R63A 2W1HA 2X8DA 4QYFA 4XYFA 2QLUA 2R2PA 3VWAA 3NNUA 3HP5A 4H3PA 4ARKA 5JMSA 2YITA 2WMUA 3KF7A 4AOJA 4Q2AA 2WZJA 5AX3A 3V5WA 3ZXZA 3O23A 3SXFA 2BILB 2V55A 4FTAA 2QOKA 3CTHA 4CFXA 2JDOA 2AC5A 3GCVA 4Z16A 4IM0A 1P2AA 2EU9A 2WPAA 4GVAA 2EXEA 3DJ7A 3GB2A 3HDMA 4M67A 4XV2A 3LCKA 4WD5A 4A4LA 4M0YA 4BCFA 4D4VA 1K9AA 2WXVA 4IFGA 2XIZA 4GFMA 3ATTA 3W2PA 4IX4A 4AA5A 4U79A 3PDTA 3ATSA 3V8TA 4B7TA 5JGDA 5EW9A 3QCQA 5ITAA 5M51A 5IQBA 5L2QA 1ZOEA 3QD2B 4O7LA 4LRJA 4E6CA 3PP0A 3UZPA 5E8ZA 2BZHB 5KZIA 1PY5A 4CLJA 2ERZE 4DEGA 4BCJA 3U6IA 2XRUA 3KCKA 2GNJA 3ORKA 2F2UA 5CNOA 4E7WA 1GZ8A 4FOCA 4P5QA 5E4HA 3S2PA 4MK0A 1V0OA 3ORZA 2R0UA 4RWIA 3C4CA 4Z3VA 3QD3A 3W2OA 3DCVA 5AA8A 3H30A 4DN5A 4EQMA 3NVKI 4MNFA 2OZOA 4JBQA 3A7FA 3SHEA 2IW9A 3ZS5A 2XK4A 4P5ZA 4EUTA 3PJ2A 2V7OA 3SLSA 5JN2A 5FUTA 1NA7A 1GZOA 2B9JA 1H4LA 2HOGA 3NYXA 3SAYA 5FDPA 5KMNA 3LIJA 1MRUA 3KXXA 3P78A 3GOKA 1ZYDA 3R6XA 3LM5A 5AR7A 5IQGA 5D10A 3VS5A 2YFXA 3KEXA 1R78A 3KKVA 3LPBA 5EYMA 2Z7QA 3FV8A 5IU2A 2XB7A 5LVLA 3KN6A 4DEDA 5EKNA 2C0IA 3HMPA 4H39A 2R5TA 4TN6A 3E5AA 3IKAA 4YGAA 3FI8A 5TE0A 3UP2A 5CVGA 4FSYA 1ZZ2A 2ZV9A 5AP0A 4CGAA 1WBVA 2ZAZA 5G1XA 4C57A 2W1ZA 3R00A 4QP9A 5AUTA 5A9UA 3GU8A 2FA2A 3V04A 4N57A 4EH3A 4QRCA 4OT6A 4BGGA 3Q4ZA 3BLQA 3DA6A 3GT8A 3TEIA 3TNIA 5HG7A 4C36A 3EN7A 2Z60A 5L2IA 1BI7A 1F5QA 4RJ5A 3HV6A 2GQRA 4H36A 4U42A 4G34A 2BDWA 3QA0A 5DT4A 4QO9A 5IEXA 2C5OA 2Q0NA 4QTCA 4BC6A 2DQ7X 4FNZA 4KBKA 4CFNA 4O0YA 3THBA 5FTOA 3U54A 2PE0A 2YHVA 1FGKA 3ROCA 3R9OA 3R7UA 1BYGA 4JL9A 4PMMA 3KVXA 3VBTA 2B9HA 5DRBA 4F08A 3RK9A 3PA5A 5CQUA 4YP8A 4YNEA 2PTKA 3TTIA 3TM0A 2JAMA 2WFYA 2C3KA 4OTWA 3R22A 5HCZA 3KRWA 5JQ5A 4IWOA 4RFMA 2H8HA 4HGEA 1SZMA 3C13A 4ZZMA 1ATPE 3GU6A 5K9IA 3D94A 5E9EA 5I5ZA 4W4WA 3MI9A 3PPKA 4DH3A 2FH9A 4Y46A 3ZTXA 4FEVA 4F0FA 2XIYA 2VWVA 4GG7A 4G31A 3EZRA 2J2IB 3NUYA 2RFEA 2VGOA 5IH4A 5AR3A 2CLQA 3DBEA 1FVTA 1IG1A 3QC9A 2GFSA 2J9MA 2GHLA 4YC8A 1P4FA 3CKWA 3V8WA 4EC8A 2C6EA 3PE2A 3UO4A 5IQIA 2XNBA 4BTFA 1JAMA 5CU2A 4RIXA 3A4OX 3BV3A 5D7VA 5I9VA 5KX8A 4ANMA 3G6HA 5CVHA 2XNNA 3EFKA 3MVJA 3F5GA 4GFGA 1H8FA 3L1SA 4OTRA 4BZOA 4UB7A 4BCOA 3PG1A 4GS6A 2BTSA 4CVAA 4DEAA 2A27A 3HRCA 3FC1X 2WTVA 4J71A 4CRSA 4NL0A 2ZV8A 3NUSA 4FZ6A 3II5A 4TWPA 5H8EA 4GSBA 3I1AA 1OL6A 3ZSHA 5CAUA 4CEGA 3TZMA 2OH0E 3DJ6A 4FV0A 3V3VA 1E1VA 5L8KA 2C6MA 3E63A 4RIWB 2IPXA 3TDWA 5CASA 1ZYSA 2FSMX 3EH9A 1OL1A 1W82A 4FZAB 2VWZA 2ITZA 4DTKA 3KRRA 4XJ0A 4CXAA 3R8VA 5K3YA 3U9CA 4XX9A 2XIXA 2JITA 2RG5A 2VZ6A 4RIYB 3IQ7A 4DFLA 4FTJA 2XBJA 3ORPA 5M53A 2XJ1A 4FVRA 4Y95A 3R73A 2WIPA 4PNKA 3RM7A 3NIZA 5IA5A 1KE9A 4FTKA 4BDBA 2OU7A 5J1VA 4UMPA 4K2RA 2ZV7A 4JVGA 4DINA 1SNUA 2R7BA 3ZZWA 1UU7A 1XBCA 4NW6A 3IW7A 2VTOA 2XKEA 3KXMA 4ALWA 1Z57A 3OROA 1DI8A 4UV0A 3VO3A 3DPKA 3GQLA 4RC3A 4ZTRA 3KRXA 1YXVA 4M68A 4N6YA 4YLLA 3VBXA 4ALVA 4XLVA 1Q5KA 2CJMA 2VUWA 5AM7A 4DLIA 4XG4A 5DH3A 2X8IA 3OMVA 3V6RA 4ZJVA 3FZTA 1E1XA 3NAXA 4FGBA 1OL5A 4USEA 3UYSA 4PV0A 4W9WA 3KXNA 1ZOHA 3LLAA 4XBRA 4QYEA 4FSNA 4QP1A 1REJA 3KU2A 1Q3DA 3R9HA 3TIZA 2W5AA 4FT5A 4DTAA 2V62A 5HNGA 3VHKA 5DVRA 4ZTHA 2HY0A 4CNHA 4ZY4A 4X6RA 3NUUA 5E8TA 3WZKA 5DIAA 3WYXA 4Z7HA 2BDFA 1OUKA 2ITOA 3MFSA 4HVIA 4RX5A 2W5BA 4AE9A 3OOMA 1JKSA 4FG7A 4XOZA 2ITPA 5E8XA 3R9DA 2CN8A 3JY0A 4RT7A 4M84A 3VS4A 2XYUA 2B54A 4LMNA 3I6UA 3OOGA 4C4JA 5A6OA 3AC5A 2WMBA 4AZFA 3F5XA 3H0ZA 4B8LA 4FEUA 2R3RA 4GK4A 2P3GX 4RX9A 3BPRA 3ZRLA 5IUHA 3EJ1A 2C1BA 3D15A 3QQGA 5I9XA 3D5VA 5L8LA 3F5PA 4I93A 4GK3A 4F9AA 4D5KA 2CKOA 4O91A 2W9FB 4XLIA 1KE8A 4J8NA 2O2UA 4BFMA 3C4ZA 4X0MA 2BKKA 1XKKA 5M44A 2OJFE 4BDCA 1GZKA 3PIYA 5DE2A 5DT3A 5BQ0A 5JFVA 4X2JA 3SW7A 1YVJA 4AX8A 2FSTX 3PJCA 3CKXA 4DEEA 2CMWA 2W9ZB 4LGGA 3A7JA 3Q32A 3R1QA 4RPVA 2ONLA 4MBJA 1VZOA 2CDZA 3ZUUA 3QX2A 2UZOA 4U9AA 2HCKA 3F3WA 4KAOA 1JWHA 2R64A 2PUPA 4BDDA 5KNJA 2REIA 3H9OA 3KK8A 5GIPE 3A2CA 4CCUA 2VN9A 3QAME 4FX3A 3VW6A 3KY2A 5GJFA 3A4PA 4M0ZA 2PVKA 3ANRA 2B52A 3I5NA 4DGMA 5BVOA 2OLCA 2A0CX 3ZDIA 4D2SA 1FQ1B 4EEVA 4FT7A 1YOMA 1K2PA 4H58A 4FL1A 4D1ZA 4D4YA 3TUBA 1O9UA 3QBNA 4EH4A 1IASA 2ITQA 3RALA 3RZBA 5KMMA 2QOLA 4WBBB 2IVVA 3EKNA 2CN5A 3E8EA 4XG2A 2GHMA 2J7TA 3W2QA 4RA5A 1XH4A 4GU9A 3EN5A 2XF0A 3FXXA 2F7ZE 2JAVA 4KINA 4XS2A 3R7VA 3AD6A 3UJGA 4WOVA 4C4GA 3CGOA 1R0EA 3CY3A 4AFEA 5DR6A 4BGQA 4CLIA 2EXCX 2CGUA 5T3QA 3DNDA 4JDIA 3LCDA 4XG8A 3DKFA 2ZMCA 2UV2A 3ID6C 1TQIA 4BHNA 4XP0A 1GJOA 2FSLX 5E8VA 3PXZA 1T45A 2VWYA 5IDPA 3B8RA 4R3PA 3R2BA 4FKJA 5LMKA 3NDMA 5HU9A 4FR4A 1BKXA 3HV3A 4WSQA 2QR8A 4AT3A 4G3CA 3T9TA 2QOOA 3GC0A 3AC2A 4PQNA 3LQ8A 5BVFA 4FL3A 2G1TA 3F69A 3P0MA 1Q8YA 4L53A 4U41A 1UVRA 2XCKA 3CD3A 3Q4TA 2QOBA 4WG3A 3RWPA 2V22A 1AGWA 3MY1A 4UMTA 4E6DA 4RWJA 4NWMA 4UMUA 4NM5A 1P14A 3BLHA 4ZLOA 4JQ7A 2OJGA 4X3FB 4EZ3A 4JG7A 4AAAA 2UZTA 5TT7A 3TDVA 5A4QA 1OPKA 2VRXA 2XKDA 4HCUA 1I44A 3POOA 3FEGA 5EKOA 3EMGA 5G6VA 3OBJA 4DFBA 3ORTA 4TNDA 2ITVA 4ENYA 3SV0A 3EN4A 4DGLC 3JS2A 3DAEA 4ENXA 4O82A 3OUKA 2OFVA 4QMSA 3T8OA 2P2IA 2B9IA 4HYHA 2CGVA 4OTHA 2PVJA 3DKOA 3E88A 3S4QA 3ZFXA 3HV4A 4EQCA 4ANBA 2BZKB 4C3RA 2XK8A 2HY81 2FYSA 2UZDA 3FXWA 3L8PA 5FTQA 5IEYA 1YXSA 1ZY5A 4Y72A 4PWNA 4RQVA 3L9LA 3PXFA 5J9YA 4FEXA 2YM4A 3PXKA 2E2BA 2EVAA 4JX3A 3REPA 1UU9A 4ASDA 3PVGA 4KWPA 2FSOX 2WU6A 2YWPA 3KXHA 4YJNA 3DBCA 5HO6A 3H4JA 3MB7A 4Q5HA 2O65A 4ZTMA 5DLSA 3HLLA 2R3OA 1H1RA 1URCA 2VTAA 4R1YA 5KCVA 5IQAA 4FKQA 4QMMA 4FT3A 5HG5A 3MH2A 5J9ZA 1U59A 2C30A 2XM8A 3R9NA 4EH7A 1XH6A 2C5VA 5HTCA 5JT2A 5L6PA 4TZRA 1FGIA 2YAKA 4C2VA 1PYXA 3DDPA 2J5FA 2VGPA 3FZOA 3UC4A 2YWVA 2JIUA 4K11A 1WFCA 2KULA 4LOPA 2WD1A 5DNRA 3UP7A 5C8NA 4GL9A 4AA4A 4AS0A 2W05A 4KS8A 3QCYA 3CE3A 5EH0A 1IAHA 4F65A 3PRIA 4FMQA 3UDBA 2WEIA 2W5HA 5CI6A 2ITYA 2GQSA 4FV2A 4OTFA 2YLFA 5CS6A 4BCNA 4XG3A 1H1WA 2VAGA 3D5WA 3FMNA 3V51A 2PULA 4PDSA 1YI4A 2VTQA 2RIOA 2X9FA 5EM6A 5H2UA 4UN0C 1L8TA 3SXRA 4HCVA 4D58A 4ZMEA 4RGJA 3E8NA 4AZVA 2HAKA 5CU0A 4XOYA 4QP2A 5DT0A 2VWXA 3CR0A 2X81A 4HCTA 1OIYA 4IACA 4BI2A 1MUOA 3E87A 4Q9SA 2PVLA 2XK9A 1JSUA 4HGLA 3ALNA 4XUFA 5KMJA 4FKSA 3W33A 4IB3A 5KKRB 3DXQA 4DT9A 4O0WA 2WMSA 2AUHA 4FE2A 3BU5A 4YTHA 4DH5A 4KD1A 4QNAA 1F0QA 3RNYA 1KV2A 2GNIA 2QD9A 4RFYA 4FIGA 3TKIA 3F82A 3AT2A 1CKIA 2PSQA 1PJKA 2X1NA 2Z7LA 3G2FA 3NSZA 4JNWA 3VQUA 4BIDA 5LWMA 1I09A 2VTHA 4R7IA 3QZFA 2WKMA 3OT8A 3ENMA 4XHKB 3H9FA 3NRMA 1PMVA 4YZBA 1K3AA 3QL8A 3E3BX 4MD9E 3NNXA 3RINA 2OKRA 2NRYA 3WF7A 2RL5A 4N4SA 4WBOA 2XK3A 4G17A 3BYSA 2X6DA 5HD7A 5JFWA 3U9NA 5LMAA 2PU8A 3DLSA 3MVHA 3HEGA 3PZEA 1RW8A 1M2QA 4MQ1A 4OAVB 4NEUA 4U8ZA 3TKUA 3R28A 4AZTA 3TZ7A 1KOBA 3ENHA 4M3QA 2H6DA 1NVSA 5CEIA 4DFUA 4NIFA 1JKTA 5CSPA 1H25A 4XH6A 2WQMA 3MB6A 2VNWA 5FEDA 3C4FA 4IEBA 5HBEA 4FNYA 1U54B 4YZ9A 4IDTA 5I9YA 3K2LA 5AX9A 3VUKA 4KUJA 1YRPA 1OIRA 3PVBA 2VTMA 4E26A 3IPHA 5AFVA 4J95A 4CKIA 5JRSA 4PMTA 1M7QA 4C4HA 3CY2A 2G9XA 4X3JA 5M08A 5C01A 3MH0A 3W16A 3D7TA 4L46A 4D4RA 4KKEA 1JVPP 5J95A 3GFWA 2WMRA 3NW7A 1HCLA 3KB7A 4BCMA 1PRYA 4EBWA 4QQTA 1FINA 3VRZA 4O6EA 4DBNA 3R8LA 2O3PA 5HE3A 2UVZA 3F9NA 1SMHA 3FLSA 2YIYA 2PMNX 4O22A 3BEAA 1CKJA 5FQDC 1VYWA 3PLSA 2W1CA 4UX9A 1L3RE 4IADA 3EZVA 4TYHB 1ERKA 5CEKA 5KMIA 4U7ZA 4NJDA 5M56A 4MXCA 1YI6A 5IA0A 5DR9A 4TXCA 3BX5A 5CZIA 2OICA 4BGHA 1YHSA 2YM7A 3IOKA 5DOSA 4TTHB 5BUIA 3KFAA 4HVSA 4FEQA 4IX5A 1BX6A 4DCEA 4TPTA 1YOLA 3RPOA 2BHEA 4EKLA 2CKEA 5I0BA 2W0JA 4FV3A 5CLPA 3Q04A 3KQ7A 3AMBA 4HOKA 5AUVA 3RK7A 3ZBFA 4BI0A 3P5KA 4JR3A 4R3CA 3B2TA 3AMYA 5FM3A 2UW5A 1Y8YA 3FBVA 4AF3A 2GS2A 3FWQA 4DEBA 4BYIA 1LR4A 5D12A 2ONLC 4BCPA 3OHTA 4RBLA 1TQPA 5EI2A 3LXLA 4DTBA 5IG1A 3IGGA 3TJCA 4F9BA 1SM2A 3IW4A 4ORKA 5M4FA 4MWHA 1GIHA 4FKTA 2UZWE 2VTTA 3FPMA 4OTQA 4N0SA 1G3NA 3H3CA 4YTIA 3P79A 3TNHA 1Y8GA 2R3MA 1WAKA 4G6NA 3S3IA 3FMLA 3MPMA 5IMXA 3BHHA 3I0QA 4O1OA 4OLIA 2OGVA 2PE2A 4HYSA 5L2SA 4QP3A 2Z8CA 3DOGA 4PNIA 1KE6A 3NLBA 5LVMA 3G33A 2BHHA 3NX8A 4C0TA 4U5JA 3O8TA 5JEBA 4USDA 5EW3A 1GY3A 3HAVA 4FSZA 3QUDA 4J99A 3AG9A 3OCBA 4L68A 2RKUA 3UMWA 3QTRA 3Q2JA 1O6KA 3BHVA 2VWUA 3CPBA 5DYJA 5E8UA 4UWYA 5AP4A 3CBLA 5KBRA 4GT4A 2NRUA 3UGCA 3KREA 1J3HA 3EWHA 3N51A 4L3LA 3FYKX 2IJMA 4LRKA 5DG5A 2C3IB 3LFBA 2B53A 3C4EA 2I6LA 4HPUE 4FKPA 4UBAA 3ZC5A 2R3IA 4I23A 4GKIA 4II5A 1YWRA 5EFQA 2YACA 2KTYA 3C5UA 3D5XA 3UIBA 3MYGA 3ZFYA 4EYMA 1W8CA 3F88A 2W1IA 3O8PA 4IQ6A 1M2PA 5AP7A 3PUPA 4WSYA 4YZDA 1SNXA 4K0YA 5F9EA 4XRLA 2C6TA 5M4CA 1H26A 3O71A 5AUXA 1YW2A 2VWWA 3QZIA 2R7IA 5KHXA 2WQEA 5E92A 4G3GA 3OZ6A 4QTDA 3T3VA 5CF5A 4AA0A 4HVDA 2B4SB 5F20A 2IZRA 4FYOA 2QO9A 4JQEA 4MXAA 4K9YA 2YIWA 2PMLX 5AV0A 4C7TA 3O8UA 1FMKA 2PWLA 2H96A 4D9TA 2QODA 4CZYB 4NSTA 3PG3A 3CTQA 3SXSA 2J90A 4AT4A 3H0YA 3TN8A 4ANQA 1CMKE 2H9VA 3GGFA 3MJ2A 4O7SA 4I6BA 2VTPA 1AQ1A 2ZB0A 4XP2A 4EOKA 3AT3A 4M8TA 4HGTA 1H08A 3LW0A 4FV1A 3WILA 5ETFA 5CYIA 2OF2A 3PZHA 5B2LA 4OTDA 4PY1A 5JGBA 4B6LA 3HV5A 3ACKA 1H1SA 2IW6A 4FL2A 4R78A 3DTWA 2QLQA 2WU7A 5BVEA 4EOLA 2YJRA 4RMZA 3VF8A 3RPVA 2UZBA 3OCSA 2PUNA 3PY0A 4I4EA 1XO2B 3UOLA 1OKYA 4JBVA 4EH9A 2BROA 4FSQA 2ESMA 5K4IA 3KGAA 2R3KA 4OTIA 3O2MA 2C69A 2CGXA 1RQQA 2GPHA 3VVHA 4DFZE 2VD5A 5ANIA 4FNXA 4MQ2A 4L9IA 2FB8A 3UPXA 3OVVA 3JYAA 4IX3A 5EYKA 5K5XA 3KMUA 1FOTA 1ZWSA 4L3JA 4ZTLA 1DM2A 2VX3A 2JBPA 3LOKA 3QRTA 4L00A 3QKLA 3BIZA 5ETIA 3PYYA 1XH8A 5I3RA 2GU8A 1QPDA 2V5QA 4NKAA 2W4KA 3U87A 3SG8A 4O7WA 3F2AA 3UG2A 2J0KA 4AZSA 4QQJA 2OWBA 5DI1A 2ZJWA 4XG7A 3QF9A 4U40A 3MH1A 3H10A 3WOWA 3SGCA 2IVSA 3IDPA 4QMNA 3U4WA 3E7OA 3NS9A 4Y73A 3WZEA 5FLFA 3BGZA 3FI3A 4AZEA 5L2TA 3EIDA 3E92A 3AC3A 4O81A 5IPJA 4O96A 3R1YA 3Q4CA 1H0VA 4D2PA 4C38A 2YAAA 4D1XA 5B7VA 1OKZA 1Q24A 3KC3A 4YNOA 4ZSGA 3VUDA 5D1JA 3EQCA 2E9OA 3ULIA 2WQNA 4CZTA 4YR8A 3P08A 5ANEA 2C5YA 4J8MA 3OF0A 4F1OA 1YXXA 3P9JA 4LV5A 4QP8A 3ZMMA 2YCQA 3LFDA 4HZRA 3T3UA 2CNUA 2XRWA 4D1SA 3ORLA 4RIYA 4BZNA 4O0UA 3NAYA 5B2MA 4ZTNA 2CSNA 3QALE 3D9VA 4E73A 3O17A 1YKRA 4HPTE 3QRUA 1OBDA 2CPKE 3VS1A 4F0GA 2BMCA 4FTIA 3OS3A 4DFYA 4DEHA 4HYUA 2X4FA 5F4NA 3WARA 5IMEA 3NZ0A 2Y0AA 3G0EA 5CX9A 4IZ7A 3VS0A 3ZH8A 3V5TA 4RZVA 3ACJA 5FWKK 3ZEWA 4E5AX 3Q53A 3EFLA 4QT1A 4B4LA 5IA1A 3BYMA 2IVUA 3JXWA 4U80A 4BTKA 3VAPA 3NYOA 4BDFA 4F0IA 4RJ7A 4FTMA 1URWA 5DRDA 3EQRA 3LXPA 3MWUA 3WE8A 4A7CA 3ZLXA 2J0MB 3LQ5A 1OPJA 4RFZA 5CNNA 3WIKA 3CSVA 4C34A 4X7QA 3QTSA 2XNMA 4I5HA 2PYWA 1ZMVA 3ORMA 5HLPA 3I5ZA 4ZP5A 4R7BA 3BE9A 5CF4A 3Q2MA 3W18A 3EL8A 4YJTA 4YJOA 5AIKA 3SRVA 4Y5QA 5BYLA 4EH8A 3M1SA 5FG8A 2FO0A 1H1PA 2IWIA 1OI9A 4JAIA 4DH7A 1XWSA 5AUYA 3F3UA 3C0GA 1STCE 5C8KA 5IH5A 2QKWB 4IVAA 5FDXA 1W98A 4D0XA 3QHWA 4Q9ZA 3IDBA 1DAYA 1YDRE 4BL1A 4GIIA 4G9RA 3TG1A 4C4EA 4F7NA 4YURA 5E8YA 2W96B 3GUBA 1OKVA 3P7CA 4KRDA 3VJNA 3CEKA 5CXHA 3TI1A 5AADA 1ZAOA 3H9RA 1UA2A 4MXXA 5T6KA 5A54A 4AE6A 3QTUA 3UE4A 3LJ1A 2HZIA 4PPBA 3NW6A 3MESA 4QTBA 2VTLA 3PVWA 3QCSA 5HI2A 2WTIA 3DZQA 3RMFA 4NFNA 5HESA 4QMUA 2QCSA 2QU5A 5HICA 2WMWA 3LFQA 5J8IA 4QYHA 4BKZA 4EJ7A 2JFMA 3MY0A 4UALA 3FL4A 3OXIA 3C1XA 3Q9XA 3UQCA 4CMUA 2O8YA 4MTAA 2UW3A 5AV4A 1IA9A 4ITHA 4YJSA 1YQJA 3CXWA 3HL7A 2RFSA 2EUFB 3QTXA 4CZUA 4YJPA 2ZDTA 4NZWB 3HMNA 5HVKA 4TWCA 5ANJA 4WIHA 3S0OA 2BAJA 4WNPA 3LFFA 3UQFA 4TWNA 3JVSA 3PTGA 2J0IA 4QYGA 3A8WA 1BMKA 4GT5A 3DKCA 4FIHA 2XA4A 3ELJA 1QPEA 2R3FA 4QPAA 4JXFA 4E6AA 4CG9A 1YWNA 3VRYA 3C0IA 3CCNA 3KMMA 3VF9A 3ZRMA 3WYYA 2OZAA 3BV2A 3BU3A 3ZFMA 3HZTA 5AM6A 3OP5A 3DXNA 3FZ1A 5DPVA 4EOMA 3QD4A 3RAHA 3GP0A 4GYIA 4Z9LA 3BRBA 3Q52A 4A9UA 4IBMA 3GU5A 4Y8DA 4E4LA 2R3QA 2LGCA 4Z7GA 2X7GA 5CEMA 4X6QC 4KNBA 3M11A 5CANA 3QFVA 2VX1A 3A61A 3BWJA 2HK5A 2OIBA 3PFQA 4O86A 1RDQE 4KA3A 3NMUF 4TYGA 4YZCA 3LJ0A 3LQ3A 5DWRA 1GNGA 1WVXA 4IB5A 3NGAA 2ETMA 2XCHA 3OFMA 5FXRA 4G3FA 3QX4A 2J6MA 5KMLA 1PYEA 2BALA 2FUMA 3IS5A 4L52A 4S34A 4QD6A 3I7BA 2JDTA 2XVDA 5BMMA 2VTRA 4DITA 5C8MA 2CCIA 4ZMFA 5E91A 3WF8A 4I92A 3ERKA 3RZFA 1J7IA 4E93A 3DK6A 2UZUE 1BLXA 4MHAA 4QMWA 5C26A 2C3JA 3OWLA 1OB3A 2FGIA 4BDEA 3MS9A 5TKDA 3QRIA 2PZPA 3EYHA 5HORA 3GC8A 2ACXA 5K0KA 4FOBA 4NW5A 2DUVA 1A48A 5GZ8A 1UWHA 1F3MC 2O63A 4FSWA 4O0RA 4RIXB 3M2WA 4AZWA 2WEVA 4MBIA 2BZJA 3DQWA 4FKVA 3EFWA 4S30A 1OKWA 4F99A 3A7GA 4NM3A 3L8SA 4L45A 1KE7A 3QGYA 5D11A 5TF9A 3TUCA 3MH3A 5D41A 3QYWA 2XMYA 4JRVA 2XNGA 3HMIA 5KZ0A 5AUZA 4CD0A 2BR1A 4V0GB 3PXRA 5LQFA 2RGPA 3FSKA 2XEYA 3IECA 5HTIA 4WNKA 2PK9A 5E7RA 1QPCA 5CF8A 1ZYCA 1OZ1A 5HEZA 5LVPA 3VC4A 1MQBA 3E93A 5FEQA 1FBNA 1R0PA 4DCAA 1X8BA 2CKPA 1VJYA 4XNEA 2YIRA 3MJ1A 3U8WA 4KS7A 2BTRA 3F2RA 1DAWA 2OF4A 2PZ5A 3G9NA 4ZTSA 2W1DA 1PMUA 4A9SA 1V0BA 5DFPA 3UIXA 1PHKA 4FGRA 3SX9A 4CSVA 3R8ZA 3HRBA 2VO6A 1Q8WA 2YDIA 3VBYA 3TJDA 2GNFA 5HOAA 4MCVA 3R1SA 3VBWA 5GNKA 3ZM4A 1PXKA 2P4IA 4NM7A 3R8PA 5FP6A 4L42A 3P7BA 3G0FA 1WCCA 3O51A 1AD5A 4BKYA 2HXQA 4FT9A 4YPDA 1YHVA 1RE8A 3GOPA 3MFRA 3PIZA 4C59A 3DS6A 4R77A 3S95A 2VTJA 3GXLA 4U81A 3R21A 3HAMA 2HZNA 3NNVA 2VNYA 4GYGA 5IQEA 4FV7A 1EH4A 3EN9A 3R1NA 4R5SA 4LGHA 3BQCA 3OUNB 4AW1A 5F95A 1B6CB 3PY1A 2BFYA 1FVRA 3V8SA 4XBUA 3D2IA 4BZDA 2HW6A 2QOIA 2YZAA 4XV1A 3BGQA 4I5MA 5A4LA 5KO1A 2ZV2A 4Q5EA 4ASXA 4MD8E 4BWKA 3BLRA 4F9YA 4RSSA 4AWIA 3QQJA 1OVEA 2RG6A 5FRIA 2XKFA 3P23A 3BCEA 1OIUA 3EB0A 4QPMA 4JQ8A 4HJOA 4FTUA 4GEOA 5LARA 2ETRA 4O1PA 4XEYA 2Y4IB 4TWOA 2WGJA 4XMOA 3AD4A 4QMQA 4EHVA 2WMAA 2W1FA
chains in the Genus database with same CATH superfamily
2OSCA 5C9CA 3HV7A 5AP1A 4GUEA 4W4VA 4CMTA 3DV3A 3KULB 4D4SA 4MUQA 2P55A 3FMDA 4U3YA 5HNBA 3R04A 2QU6A 4GG5A 4LYNA 4NTSA 3MA6A 4TY1A 3V5QA 3FKOA 3UOJA 2G01A 4JR7A 5L3AA 1XBAA 4AGCA 3QWJA 1YHWA 1WBSA 2YM6A 4AFJA 4YTFA 4YBJA 5CAOA 5GIOE 3S00A 4C61A 3KXZA 3LMGA 1Z5MA 3AOXA 4LUEA 5EHLA 5EDRA 3QLFA 1UKIA 5IQFA 4LOQA 3PSBA 3MVLA 2OG8A 5EHYA 5IH6A 4DGOA 4QTAA 3LMIA 2OO8X 2I0YA 3GC9A 5H9BA 3TNQB 4Y5HA 3AXWA 3SA0A 3ZO2A 5J9LA 3MW1A 3TV4A 4ACMA 2R0IA 3QTZA 4EOIA 5D9HA 3LCTA 4JRNA 4MEDA 1WBTA 1XQZA 3AGMA 3JUHA 3UOKA 4BVUA 3MPTA 5LMBA 4I22A 4AGUA 4B8MA 3TXOA 2J0LA 3RAIA 4O2ZA 5J1WA 4IAZA 5LOHA 4YHFA 3S1HA 3OBGA 2YCFA 1Q61A 2W17A 3NCZA 2Y6OA 4CTBA 3FXZA 2B55A 3I60A 3CJGA 3WI6A 4ZLZA 3DKGA 4FODA 3HYHA 4EWHA 3ORIA 3PPJA 1OECA 4LM5A 4GV1A 3QQHA 2RF9A 3ZO1A 3DTCA 5JQ8A 2UUEA 4UWCA 5ETCA 4JOAA 3C51A 4RC2A 4HNFA 4BR3A 2Y4PA 1LP4A 2G2HA 3SOAA 3QCXA 3ZCLA 5CEPA 4K6ZA 1U4DA 4EH2A 4A4XA 4FG8A 3UOHA 4C58A 2QVSE 4JIAA 5AV1A 3VUIA 4FIEA 4NFMA 1NVQA 4UXLA 4WHZA 3PFYA 4TRLA 2Z02A 3BHTA 4H3QA 2B1PA 4D2TA 2GCDA 4E5WA 1LEWA 1Q41A 4ACGA 3COIA 3LE6A 5CTPA 5HE1A 2HIWA 4WT6A 5FXQA 4O0VA 3MFTA 2BPMA 2XK7A 1ZOGA 2R4BA 5CT7A 4BI1A 5J5TA 2BDJA 3ANQA 3GCQA 4FTTA 2WELA 1PXNA 3W2RA 3Q5ZA 4YO4A 4IW0A 4HW7A 4TYHA 5EM7A 4GIHA 5IKWA 5K5NA 3CC6A 4DLJA 4E4MA 4FKWA 3ORNA 4F70A 4AGDA 4J1RA 3PWDA 3WZJA 3PY3A 4YJQA 5GJGA 5IA4A 2WO6A 3QLGA 3D7ZA 3DLZA 4YJVA 3ODZX 2YABA 4I4FA 1MRYA 2B9FA 3RCDA 3RP9A 4ANNA 3LFCA 3TIYA 4B9DA 3UTOA 3MTLA 4OT5A 3ZHPC 3IOPA 4KABA 4EJNA 3K3JA 3EQPA 4QNYA 4IAYA 3EHAA 4PDOA 3HGKA 4KRCA 3EYGA 1NY3A 3BQRA 4E3CA 2Y8OA 3A8XA 4IB1A 4DG2E 4FSTA 4KIKB 5TO8A 3B8QA 3OT3A 3BU6A 5JK3A 3VIDA 3IG7A 4FIJA 4IM3A 5DHJA 3RKBA 3AMAA 3D4QA 5HE0A 3HUCA 5M4IA 1FMOE 1KSWA 5DR2A 2XZSA 1SYKA 2F4JA 2BAKA 5GZ9A 1H01A 3BI6A 3L8VA 5BMSA 3ZYAA 1WBOA 2UVYA 2E9NA 1GIJA 1R3CA 3NYVA 1ZY4A 4AGWA 4LOOA 4BF2A 1FVVA 4GUBA 4RRVA 2B0QA 3W2SA 2XNPA 3PXYA 4X2FA 4PF4A 3R7YA 4EOPA 4DG0E 2YZLA 3NR9A 4TYIA 1PXJA 2BRMA 1TZDA 3AQVA 3EQHA 3A7IA 2UW0A 1Y6BA 2BIKB 2ETKA 4FTNA 4GT3A 2QOQA 4NH1A 4QMZA 4U97A 4WNOA 4O21A 2YDKA 1IRKA 4MNEB 2JKQA 5FTGA 3ZLYA 3GFEA 4PP9A 2X7OA 3LLTA 1H0WA 4IH8A 4H05A 4C3FA 3RHKA 2IO6A 5D7AA 4G16A 4R3RA 4CQEA 4IZAA 4IXPA 4FTCA 4PP7A 4DHZA 4O7ZA 2IVTA 3Q9WA 5ANGA 3MSSA 3BE2A 4IZYA 5EG3A 1A06A 2Y9QA 3G6GA 4M69A 4E4NA 5HVJA 1BI8A 3DK3A 4BCKA 2JDSA 5CSXA 4MAOA 2YCRA 5HIDA 2ERKA 2C6OA 3RK5A 3CQUA 4A9TA 1PXIA 5AUUA 4FSRA 4LUDA 1HCKA 4FSMA 1CSNA 2G2IA 3BBWA 1WMKA 1YDSE 2O0UA 4USFA 4F7JA 2BRHA 2PZIA 4MH7A 3DBDA 4L7SA 2YDJA 3FAAA 2EWAA 3TZ8A 4RJ4A 3ZDUA 4BY9E 4EOQA 4TKSA 5M06A 5GZAA 2HWPA 1XHAA 3TZ9A 3AGLA 4GW8A 4YTCA 1GAGA 4MXZA 3TNWA 3VS7A 4X2KA 4WNMA 3LHJA 2DWBA 3GEQA 3LFNA 4DF3A 5EQEA 4MXYA 5TOZA 2F49A 2NP8A 2W4JA 3D0EA 4AOIA 1YWVA 2PL0A 1Y57A 3QHRA 3R71A 1QCFA 1WVYA 3MDYA 4LI5A 5DEYA 2QQ7A 4RC4A 3DJ5A 3GQIA 4PL3A 1CM8A 4PX6A 3UIUA 5BUJA 4CKJA 3SOCA 2PY3A 3OTVA 4X3FC 2Z7SA 5E1EA 1UV5A 2JBOA 3MFUA 4E6QA 4ZAUA 2QI8A 2V0DA 4WKQA 4FZ7A 2YM5A 3OWJA 4IANA 4UZDA 5A46A 4XV9A 1MP8A 3UVPA 2QHNA 4CRLA 4ID7A 4YHJA 2BAQA 1PKDA 3I7CA 3VS3A 5EDQA 4MXOA 3R7IA 4IIRA 2HZ4A 2CHLA 3NWWA 2J0JA 4RX8A 3ZZEA 4ERKA 3SG9A 2ZYBA 3G51A 3PP1A 4ASEA 2QG7A 5AP5A 4K1BA 5EW8A 4ALUA 3NEWA 4JG6A 4C4FA 2XARA 3QTQA 3HP2A 4E8AA 3V5LA 2XS0A 5CZHA 2V7AA 3VS2A 4ACHA 3MIYA 1S9IA 5AP3A 5HIBA 4TL0A 5HO7A 3OXTA 5ETAA 5J7HA 2R3LA 4M12A 1XR1A 4HYIA 5DA3A 4BB4A 3F6XA 1UNLA 2X39A 3AD5A 4V05A 4NIFB 4AG8A 4XV3A 3V5JA 4OTPA 4F7SA 2PMOX 1ZXEA 4JLCA 4OUCA 4QP6A 5IISA 3GENA 1G8AA 5LVNA 4MYGA 4D55A 3W0RA 1WVWA 1PW2A 1P4OA 4GFOA 4J96A 5EHOA 3WF5A 4BBMA 2HZ0A 3OCGA 1CDKA 4C4IA 5A14A 5IF1A 4CT1A 3VQHA 5KE0A 4F1TA 3OY1A 4J97A 3M42A 4X2GA 1OUYA 4DT8A 1Q8UA 3OC1A 4QPSA 4DC2A 3Q60A 2YIQA 4RWLA 2WTKB 4JI9A 5EYCA 5L8JA 4L8MA 4F6UA 4EL9A 4QTEA 4EZ7A 2PPQA 3HMOA 5IQDA 4MWIA 4BIBA 3FSFA 4LV8A 3ETAA 3P7AA 4U6RA 5EM5A 2XEZA 3C0HA 1VEBA 2NNWB 3FMMA 2W1GA 4G3EA 5DEWA 4S31A 4AUAA 3CP9A 3TT0A 2BUJA 3NW5A 4HNIA 4CQGA 4C37A 4YBKA 3O5AA 5LXMA 4R5YA 2W99B 3BHUA 3NVMB 3BHYA 2JD5A 5M4UA 3R0TA 3ZO4A 4KIPA 4PTGA 1XJDA 2JC6A 2W1EA 3FC2A 2J51A 2VTIA 4FKOA 4L3PA 2NPQA 3F7ZA 4FZDB 4MF0A 4XG9A 4DEIA 3QZHA 4FKIA 4EK8A 4AP7A 3FPQA 3E64A 1APME 1H24A 1BL7A 3D83A 3WZUA 5KKRC 4KIQA 1W2CA 3KF4A 3EQGA 3MA3A 1PKGA 3ZLWA 4EK6A 3QQFA 3UVQA 4IWQA 5EI6A 5HIEA 4BDHA 3QZGA 2NO3A 3JPVA 4FIIA 3Q96A 5CAVA 2C4GA 5EI8A 4TYJA 5CVFA 5FEEA 5AV3A 4RVLA 4FUYA 4I3ZA 4QMPA 4YSJA 3UBDA 2GHGA 2CNVA 5AEPA 3BL7A 3IONA 5HTBA 1O6LA 3AC8A 3OWPA 4A4OA 4C35A 5CALA 5AAGA 4ZIMA 4IVCA 3UC3A 5EQYA 3O7LB 3CPCA 3JR1A 1SVGA 4W4XA 4BCQA 2YISA 5KHWA 5LVOA 2PVFA 3BEGA 2XK6A 4FNWA 3SC1A 3WBLA 3ZONA 4B99A 4FF8A 3IW6A 2GS7A 5CSVA 5H8GA 4JT3A 3DB8A 2P33A 3HDNA 4KBAA 5AAFA 2JKMA 4EK3A 2UZVA 5M09A 3QKMA 4CV8A 3FHRA 1BL6A 1JSTA 4Y83A 4AXAA 3TKHA 2HELA 3GC7A 4BN1A 1KOAA 1Q99A 2XUUA 4WO5A 1Q97A 2C6IA 1E9HA 4PDYA 1MQ4A 3HA6A 5ACKA 3POZA 4ACCA 3EL7A 4YLJA 3UQGA 4U45A 2R3NA 2WOUA 5BV3A 4H1JA 3QRJA 5JFSA 4G3DA 3E8CA 3VUTA 4EWQA 4FKLA 1W84A 3SQQA 3OG7A 4IVDA 5JH6A 4F64A 4F6WA 2ITXA 2Y7JA 3LVPA 4E1ZA 3I4BA 5BVKA 1R1WA 3F5UA 3RJCA 3TACA 3F3VA 1U5QA 4O4FA 5CAQA 5HX6A 2VTNA 2WMXA 4HVGA 4EUUA 5IDNA 4IWDA 3R7OA 2I7QA 1Y6AA 4P4CA 1M7NA 3PWYA 4QMVA 5J87A 1ST4A 4JIKA 4FUXA 3DZOA 1J1BA 2JDVA 3E3PA 4KSPA 5HX8A 3U4UA 4YU2A 4RWKA 3A60A 3D2KA 3HX4A 2GNGA 4RIWA 2P0CA 4UWBA 5DN3A 3FLNC 4A07A 2O64A 2R3PA 2OK1A 3ULZA 3FKLA 1GOLA 2HENA 2E9VA 2YIXA 3E8DA 3MPAA 3OD6X 4I20A 1PMEA 3LXKA 4BBFA 2J5EA 3UYTA 5HLWA 2YM3A 2JLDA 1SVHA 3DBQA 3ODYX 4O84A 5CU3A 1LPUA 2PVYA 2PVNA 4ONAA 4DGNA 5I9ZA 3COHA 1ND4A 3CTJA 4ITIA 2SRCA 4IB0A 4IJPA 5AV2A 4ERWA 5HBHA 3ZOSA 3VHEA 1G5SA 2WTWA 3FE3A 3FLQA 4XP3A 3RPSA 5FBNC 1RJBA 1XH9A 3MY5A 3PSCA 5M55A 2EXMA 2QNJA 1J91A 4BRXA 2X4ZA 4D2VA 5LCJA 2JIVA 5CQWA 5HKMA 4UMQA 2IEWA 2OJ9A 4FG9A 2AC3A 3MV5A 2R3HA 1JQHA 3I79A 3F7WA 4K18A 4I6FA 3FUPA 3OWKA 3SDJA 4GKHA 2BCJA 4EI4A 3LZBA 5LCKA 2C68A 2IG7A 1PMNA 2OFUA 4O0TA 2ZM1A 3P1AA 4KIOA 4YPSA 4O2PA 5FP5A 4FC0A 3C4XA 3UO5A 5CSHA 3E62A 4KSQA 3SVVA 1UWJA 2F9GA 4J7BA 4YZNA 4EBVA 4DDIA 1YI3A 2YCSA 3A99A 4I1ZA 3DFAA 4FEWA 1W0XC 4G5PA 4LRMA 1V1KA 4E20A 2UZLA 5T68A 4UY9A 4NUSA 1B38A 4O0XA 4APCA 2BRGA 4QP7A 4EHGA 4DHIB 2C47A 4RJ3A 4R6VA 4KBCA 4PDPA 4O7RA 1MRVA 2IZUA 3KN5A 3IGOA 2PVRA 3LFAA 4FSUA 1M2RA 5AR5A 1IAJA 1YXUA 2HWOA 5HBJA 4HVHA 1XMLA 3VN9A 4BCHA 4LG4A 5F94A 2YN8A 4BJJB 2WTJA 2JDRA 4YC3A 2GS6A 4IVBA 3W32A 2ITNA 4GJ2A 3B2WA 2XKCA 4L43A 3V01A 2PE1A 2JKOA 3TWJA 5K0XA 3NIEA 5IUGA 4EOOA 3P86A 4OBPA 2GTMA 4GU6A 2QOFA 4BDAA 4O7TA 3U6HA 2JFLA 2PHKA 4PMPA 2ZB1A 3BKBA 3HVCA 3LXNA 3PVUA 1G8JA 4QEBA 5AA9A 2VO0A 4QOXA 3GCUA 2WTKC 3VONA 3O96A 2C0OA 2WMVA 4MD7E 4V04A 5CEQA 1NW1A 4RVTA 2RFNA 3EQIA 1H07A 3K5UA 4RQKA 3KRLA 4FKRA 4V0GA 2A1AB 4CTCA 2X8EA 4RX7A 5ANDA 2IW8A 1H00A 3EQDA 4PRJA 2OW3A 4ZLYA 4NCTA 5EK7A 2ITTA 2PUUA 3K3IA 4TNBA 3EQFA 4IDVA 2UW6A 2BVAA 3GCPA 2DYLA 3OCTA 4HZSA 5E1SA 4I5PA 1H28A 4LFIA 5AAEA 1TFFA 4QQ5A 4AXDA 3Q5IA 2QKRA 4CG8A 2JEDA 3QWKA 4S32A 4H1MA 4YUQA 3PLAE 4P7EA 4K77A 1W7HA 2GSFA 2VV9A 3FLYA 2JGZA 3OW4A 4LMUA 2B7AA 2F57A 3FHIA 5ANOA 3FI4A 3L9MA 4RVMA 3FMEA 5B2KA 1DI9A 4CFFA 4B0GA 3QTIA 2J50A 2X7FA 1REKA 5I3OA 5DGZA 4IAKA 3VNTA 4WRSA 4BBEA 3A62A 2R3JA 4FK3A 5AR4A 4EOSA 4MVFA 4FICA 2WHBA 2XNEA 3VUGA 1B39A 3FQHA 3OXZA 4GJ3A 5B0XA 2JKKA 5BVWA 3E7VA 5EDPA 1OPLA 4UZHA 4EHZA 2XNOA 3FJQE 3GVUA 3ROYA 4UYNA 2G2FA 2OXXA 4FI1A 4W4YA 1J7LA 4IAAA 4UEUA 3HECA 5IZFA 5KMKA 4OW8A 1ZYLA 5CI7A 3W10A 4EC9A 3TV6A 5H8BA 4M13A 4OGRA 1DS5A 3SRVB 3ALOA 3O7LD 4I21A 5AWMA 2HYYA 3DAJA 4IC7A 3UVRA 2ZM3A 4FTLA 5JZNA 2HW7A 3RPYA 2UZNA 2UW4A 4U3ZA 4WRGA 2UW9A 4I41A 2GTNA 3QA8A 1KUTA 2WAJA 4JDJA 4PL4A 3RVGA 5HU3A 4LL5A 4AOTA 3QD0A 2ZOQA 2VO3A 2BIYA 3HRFA 4WG4A 4Y85A 1JNKA 3FZPA 2YEXA 1ZMUA 4NTTA 3PA4A 3CS9A 3L9PA 4G6LA 2IZSA 1CTPE 3Q9YA 4YHTA 4FRFA 4YO6A 4DH8A 4ITJA 4IWPA 4X3FA 3AKJA 1PF8A 3DNEA 3KULA 4NT4A 3U55A 5HG8A 5AUWA 3FMJA 3ZUTA 4A06A 4P90A 4ZZOA 2OXDA 5E8SA 3Q6UA 5EYDA 2QOCA 3ZRKA 4BICA 4BDGA 3MVMA 3LKMA 4EOJA 4RG0A 2ZVAA 3F61A 2A4LA 3UO6A 4I0TA 5CSWA 4P2KA 4GVJA 4ZSLA 3FDNA 3RPRA 4IAFA 4BWPA 4DFNA 4Z55A 5BVNA 4DYMA 1TKIA 4OTGA 1IR3A 3LFSA 3ZO3A 5HVYA 2AYPA 5GJDA 5HNIX 4RZWA 4JS8A 2IZTA 3AC4A 3PJ3A 3QUPA 2PUIA 4KKGA 4FIFA 2W06A 2XYNA 3O50A 4C33A 2W4OA 3SW4A 1NXKA 1G8SA 2XM9A 5A4EA 1QPJA 2I0EA 2OZAB 5AJQA 3G5DA 4I0SA 5M57A 5L6WL 3LCSA 4ASZA 1PXOA 4FA2A 1OITA 4ANLA 4EORA 1OL2A 4EH5A 4R8QA 4BIEA 4O0SA 5HG9A 2XH5A 4F7LA 2YERA 4BDIA 3PSDA 4AT5A 1KWPA 4JX7A 4ZSJA 1IA8A 3BYUA 1GIIA 4ZY5A 3CD8A 2C6LA 3PXQA 1PXPA 3IDCA 3KL8A 2JIIA 3R8UA 4DGGA 1JKKA 3DK7A 3O0GA 2XIRA 2BRBA 4BHZA 4UYAA 3UDSA 5C4LA 5L6OA 4LQMA 4DAWA 2WQOA 3ZBXA 4IC8A 2X2LA 3UZRA 3RCJA 4EQUA 1M52A 5HZNA 5IQCA 4LL0A 3FMKA 4JBPA 2A2AA 2Z7RA 5BYYA 2GNHA 3VUHA 4QMOA 4FV5A 2X0PA 4LGDA 2VX0A 4TT7A 5JFXA 4JAJA 5HCYA 3VBQA 2CNQA 4CT2A 4AW0A 3NUXA 5A6NA 2EB2A 3D5UA 1UU8A 1A9UA 3NUNA 3QXPA 3P4KA 4IZ5A 4ZK5A 4NKSA 4S2ZA 2WMTA 3SD0A 5EOLA 4G5JA 1Q8ZA 4N6ZA 4PL5A 1P5EA 2OXYA 2IN6A 4FK6A 2RSVA 1TVOA 4FTRA 2OJIA 3BWFA 2Y6MA 5CAPA 4G2FA 4ZXTA 1CKPA 1ST0A 1Y91A 3R30A 1JOWB 2EB3A 4RIOA 5FGKA 5H3QA 4D0WA 4CFVA 1XH5A 2C5NA 3PPZA 3QUEA 4FZFB 3DFCB 4I94A 4RA4A 4F1MA 5JKGA 5L4QA 1M17A 4NU1A 2A19B 5BNJA 3NNWA 2FVDA 3NCGA 3TTJA 4OR5A 1OBGA 1ZLTA 3PE1A 3UNJA 4RJ8A 4NM0A 4O4EA 4K33A 3TYKA 2LAVA 1ZARA 2UW7A 3DB6A 4ACDA 3WE4A 4KIKA 4W9XA 3HMMA 4XRJA 2YA9A 4L67A 2XJ2A 3OTUA 2UZEA 1LEZA 4JDHA 4X21A 1UNGA 4D2RA 3Q3BA 5E90A 4FYNA 4NK9A 4WA9A 4X2NA 4L44A 5AR8A 3VS6A 1W83A 1XBBA 3QQLA 4ZS0A 3PIXA 5FXSA 4S33A 4FVQA 4ANSA 1J7UA 4AN2A 3ZM9A 2F7EE 4FV4A 5HD4A 4G9CA 3BZ3A 1QL6A 2C6KA 1WBWA 4OAUC 1QMZA 1U54A 3CQEA 2QHMA 2XBAA 4FV6A 2WMQA 4YJUA 5AP2A 3RTPA 2C5XA 3ZEPA 1UKHA 1Q4LA 1VR2A 4F4PA 4JDKA 2PVHA 5M07A 4BDJA 2F2CB 2J4ZA 2PMIA 2XIKA 3FL5A 4APPA 3R01A 4U44A 4MNEA 3ITZA 3N9XA 4AN3A 4ZZNA 1WZYA 4R1VA 2W7XA 3Q9ZA 4I24A 4OBQA 3FY0A 3ORXA 4EKKA 4I6HA 2QG5A 3COKA 3QGWA 3R2YA 1ZRZA 3ZXTA 1U5RA 3BELA 4YMJA 2WB8A 2WOTA 2QONA 4U0IA 1OMWA 2X2KA 2OIDA 3QC4A 2PZRA 3KMWA 3LAUA 3KK9A 3PA3A 4W8DA 4AACA 3KCFA 3PJ8A 3FYJX 3RM6A 3W1FA 2C0TA 3VJOA 4EH6A 1JLUE 3LMHA 2OJJA 3GBZA 5J7BA 2ITWA 3BYOA 3HNGA 3L8XA 3R02A 5CF6A 3W0SA 4L6QA 4C3PA 3UG1A 4EHEA 3FKNA 5BYZA 3MBLA 4IE9A 3WF6A 3Q6WA 4FT0A 4PTEA 3RAWA 4YC6A 3OY3A 2C3LA 2P2HA 1HOWA 4ZEGA 1R39A 2VWBA 4PUZA 4BCIA 3IK3A 5F1ZA 3DXPA 4FKUA 3N4UA 3AC1A 3BYVA 4BKJA 4GRBA 3MIAA 4YJRA 5IEVA 3PRFA 1Q62A 3QRKA 4IAIA 1H27A 4O38A 3R8MA 5CXZA 5BX0A 4JBOA 1J1CA 3LCOA 4O27B 3G90X 4ZSEA 2QURA 2QC6A 4CFWA 5C27A 2XANA 3EFJA 3N4TA 3F3ZA 2Z2WA 3FMHA 4AXCA 2BRNA 3Q4UA 4RVKA 4E5BA 3WZDA 3R9RA 3ML1A 2OIQA 4MF1A 3EN6A 4BCGA 3KIOC 3JY9A 3RBWA 3NUPA 1NT2A 3FI2A 3K54A 2HXLA 3L9NA 4YZMA 5CEOA 1ZZLA 4G1WA 4QMXA 1KE5A 2GNLA 1O6YA 3UIMA 4D5HA 4NCTC 3QU0A 3DAKA 4IFCA 1WBNA 4IJ9A 3SKCA 2C6DA 4CKRA 3NPCA 1Q8TA 4GK2A 1FPUA 4V01A 5HO8A 2R9SA 4F63A 4O7NA 5CU4A 5KUPA 3W2CA 4DBXA 4AU8A 4CFUA 3GU4A 4RJ6A 3RAKA 4R7HA 4C02A 4D2WA 4FV9A 4HGSA 4ZJJA 3CGFA 1UU3A 4O7YA 3IO7A 2UVXA 3TL8A 2BKZA 2WQBA 3F3TA 3ZC6A 2ZM4A 3W55A 2GMXA 3RGFA 3GNIB 4UXQA 4FJVA 1YDTE 1YXTA 3I0OA 3OEZA 3QQKA 2CCHA 4IMYA 4QMTA 2Q83A 2YM8A 4J98A 4TW9A 4IM2A 3RHXA 5IA3A 4PPAA 3WF9A 3QYZA 1H1QA 4IX6A 5GHVA 3VBVA 3LFEA 1SVEA 3TCPA 3C5IA 3HKOA 3ZSIA 4CFMA 3PJ1A 2GDOA 3UNKA 4RLKA 3TV7A 5KBQA 2E9PA 2QO7A 4XCUA 5AMNA 1JKLA 4G6OA 3FLZA 3TNPC 1WBPA 4PTCA 3R7EA 4ZSAA 1OIQA 3KRJA 5DBXA 2I40A 4TYEA 3RI1A 4AQCA 5JGAA 4FBXA 4D9UA 2WTCA 1XH7A 3MTFA 2R3GA 3VULA 1V0PA 3UODA 2ZMDA 4L7FA 5HE2A 4QQCA 2I0VA 4BTMA 2PVMA 3EKKA 3QQUA 2XJ0A 3CLYA 1NVRA 3HUBA 3UPZA 1TQMA 3QKKA 4YLKA 1T46A 4DHFA 3C4WA 4FTQA 5C4KA 2CLXA 3LM0A 5EOBA 4ANOA 4ZS4A 3G15A 5AR2A 5E8WA 4EK4A 3NYNA 4C62A 2YLEA 5HCXA 3K5VA 2BFXA 3I81A 1OL7A 3WIGA 3U51A 4CYJA 2GQGA 5BVDA 5HHWA 5LWNA 3ZSGA 2Y4IC 5AP6A 4M97A 4DFXE 2QO2A 4I6QA 3UNZA 2ITUA 2X9EA 2PZYA 2Q0BA 3KVWA 4FKGA 4YSMA 5AIRA 4I0RA 4ZOGA 2F7XE 2X0GA 4ZJIA 4L01A 2VTSA 3NUAA 3UZTA 3OW3A 4WG5A 4GMYA 1KV1A 5FM2A 4F6SA 3GI3A 4D28A 4BWXA 5K4JA 4JJRA 4QYYA 4C8BA 3ZU7A 5J5SA 1ZMWA 3DU8A 3BGPA 2OI4X 5CWZA 4EYJA 2BZIB 5I9UA 3KA0A 4EZ5A 3DGKA 4ZY6A 3R83A 4CV9A 1VYZA 5A4CA 3RNIA 5L2WA 3RWQA 4BYJA 5JSMA 1JPAA 2GFCA 5CENA 4DG3E 4O6LA 3ZLSA 4CYIA 4QMYA 4ZTQA 3LJ2A 4M66A 3FQEA 4MKCA 5IUIA 5JZJA 3CJFA 3G9LX 3R7GA 3C7QA 5CY3A 4A9YA 4PPCA 5J79A 5JRQA 5KMOA 3W0OA 1PXMA 4DE4A 4KKHA 1JBPE 2I0HA 4NJ3A 3VW8A 3IW8A 4AW2A 3FLWA 4N70A 4EK5A 5I9WA 4W8EA 3EOCA 4WUAA 4C2WA 5EQPA 4BTJA 1Z9XA 2X2MA 4XG6A 1M14A 3EQBA 3CQWA 3I6WA 5FBOA 4A9RA 2QR7A 3C50A 2OH4A 2X0QA 3DQXA 3F2NA 4H3BA 4K8AA 3QXOA 3DY7A 4J53A 5GINE 2XP2A 4MBLA 3N4VA 1YOJA 1IEPA 2E9UA 2WNTA 3CIKA 2WTDA 3D14A 2WIHA 4M15A 2RFDA 4FVPA 3OEFX 1UNHA 4O4DA 4U43A 3JVRA 3W8LA 5A4TA 3ET7A 3D7TB 1U46A 5ACBC 4GCJA 5ICPA 4IHPA 3W8QA 3V6SA 5IQHA 2VO7A 5TR6A 5HQ0A 5HGIA 2OBJA 4PMSA 5DMZA 4LDTA 2ZDUA 4OBOA 3FY2A 3QTWA 3C9WA 2QOHA 5HLNA 5ANKA 3UMXA 4KB8A 2O5KA 3AT4A 2X6EA 1Q3WA 2G15A 2YJSA 5A3XA 3VUMA 5CU6A 4RLLA 4UMRA 3F66A 5C03A 4M7IA 4M69B 4DH1A 4FTOA 2CKQA 4O83A 2VWIA 2H34A 3GCSA 4J52A 5EM8A 1LUFA 3V5PA 3IW5A 3TUDA 1PXLA 5LJJA 3HA8A 2I1MA 1OGUA 5I4NA 2UW8A 4F09A 3T9IA 1ZYJA 1JSVA 4MX9A 4BDKA 5C1QB 3A7HA 4QP4A 5FD2A 4F9WA 4I5CA 4AW5A 4NYEA 5BUEA 3U6JA 3GU7A 3DDQA 3AKKA 3DT1A 5LMKC 1OM1A 4EONA 2C1AA 4GH2A 4M14A 4CCBA 4JG8A 4DA5A 4O7VA 3KXGA 1S9JA 5CT0A 4FV8A 2CGWA 3ZUVA 4AN9A 3BBTB 4WUNA 3MN3A 4F9CA 2VU3A 3FZSA 3FQSA 1GZNA 3MGYA 5IA2A 4QMLA 3DBFA 2DS1A 4CMOA 1BUHA 4E4XA 3COMA 3FZRA 5BPYA 3R63A 2W1HA 2X8DA 4QYFA 4XYFA 2QLUA 2R2PA 3VWAA 3NNUA 3HP5A 4H3PA 4ARKA 5JMSA 2YITA 2WMUA 3KF7A 4AOJA 4Q2AA 2WZJA 5AX3A 3V5WA 3ZXZA 3O23A 3SXFA 2BILB 2V55A 4FTAA 2QOKA 3CTHA 4CFXA 2JDOA 3AKLA 2AC5A 3GCVA 4Z16A 4IM0A