3HV5A

Human p38 map kinase in complex with rl24
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Displacement assay for the detection of stabilizers of inactive kinase conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 339
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hv5A01
5HEZA 3SRVA 1PXIA 3R8PA 1OPKA 5AR3A 4DEHA 2G2FA 2PE2A 4H3BA 4NKSA 4OAUC 2GNIA 4B6LA 2IG7A 2Q0NA 2C3IB 2KTYA 3LM0A 4ANOA 4CLJA 2WU6A 4IBMA 3WI6A 2QLUA 2O5KA 4BIDA 3B2TA 2YDIA 2ZVAA 4AGCA 2YZLA 3UNKA 4FL1A 4G5PA 2W1FA 3WF7A 5JFVA 4ANBA 4DFZE 4FSWA 4YHFA 2XK6A 2XK3A 4JQ8A 2LGCA 4BDJA 5AV0A 2BVAA 5B7VA 4CFFA 5C9CA 3NW6A 4S32A 4YPDA 2H9VA 3CPBA 1MP8A 2EVAA 3FLWA 4AP7A 3M1SA 1OITA 4ITHA 2ONLA 4QTCA 2YIWA 4YZMA 5EW9A 4AOIA 4I21A 5H8BA 4I22A 5D12A 2WIHA 4H39A 3DAEA 4ENXA 1NVQA 2XB7A 4N6YA 3RTPA 4BCJA 1UA2A 4F7NA 1UWHA 4XCUA 3S2PA 4K8AA 3MH2A 3TZ8A 4YJPA 2JDRA 3TV4A 3HRBA 4GK2A 2W96B 1ND4A 4UN0C 2GS6A 2QO2A 3ORLA 5EI8A 1P4OA 4HZSA 4X2JA 5E8XA 1KV1A 4WUNA 5AP4A 1GAGA 4LGDA 4HZRA 3HZTA 4UX9A 1UU7A 5CU6A 5F20A 4EC8A 4FSYA 2HELA 1OIQA 1YXXA 5KKRB 1BL7A 1WBSA 4PQNA 2HXQA 4QP3A 5AA8A 4YZNA 3GB2A 3FXWA 4O81A 3PPJA 4QMPA 5IDPA 4OW8A 3D0EA 3ZFYA 4E26A 4ZS0A 3D5WA 4YLLA 5DFPA 4AT3A 3AMAA 5DMZA 4C4JA 3KRWA 1M7QA 4OR5A 3F5PA 4TL0A 1TQIA 4P90A 4EH8A 5E9EA 2E9OA 3P78A 2WTJA 1OZ1A 2WU7A 3R83A 5BYLA 1CMKE 4JRNA 3QHRA 4PNIA 3HV5A 3MVJA 2JDVA 4TWCA 3UODA 1FBNA 4JX7A 3TIYA 4O0UA 2GMXA 4NM3A 1ZRZA 5E8TA 2W5BA 4UWYA 5CTPA 3W8LA 2BIKB 4ZTSA 1QPCA 2BKZA 2CN8A 5IPJA 3CKXA 3PRFA 2JAMA 5EYDA 5TR6A 3FPQA 3LFSA 2PTKA 3VBQA 4GT3A 5B2LA 4D1XA 1JQHA 4TN6A 2CSNA 2VU3A 4K1BA 4A9YA 4CTBA 5CAPA 3QL8A 2WTDA 3QXOA 2YWPA 5IH4A 2JDSA 4FL2A 1LEWA 4QPMA 4BCGA 4EK6A 2RFDA 1QPDA 3NCZA 4WNOA 3O8TA 3UIXA 4C59A 2HXLA 3KVWA 4WBBB 2GCDA 2A2AA 1H25A 4G6NA 3D5XA 3QUPA 4BI0A 2XM9A 2QOIA 5M07A 5I0BA 2XCKA 4X0MA 4M67A 4AT5A 4F9WA 3RVGA 2IPXA 1REKA 4O0WA 4WG3A 2XK9A 3H9FA 1PXPA 3SKCA 4ANNA 5C4KA 4IB3A 5AA9A 4YO6A 3U4WA 4L52A 5GJFA 2FUMA 3O17A 3SGCA 1WBVA 4JBVA 5C8NA 3SXSA 3OXIA 1GIHA 4FOBA 4L7FA 4RJ7A 3ID6C 3OHTA 5IG1A 2VN9A 2WO6A 3A8WA 2PVNA 1XBAA 3PXYA 4FOCA 4GCJA 4KIQA 2IZUA 4MD7E 3U8WA 4R5YA 2B0QA 3FV8A 3S00A 3N4VA 2OJIA 4TT7A 4FEWA 4O82A 2FSLX 3FI2A 2PK9A 2JDOA 4L43A 4USFA 3ZCLA 2VRXA 4ZSGA 4G16A 4QMUA 2ZB1A 5AJQA 3ZDIA 1H24A 4XG4A 5EI2A 5HICA 3PIXA 3DKCA 3NUXA 2WB8A 4CG9A 2B9JA 2FB8A 4QP2A 4ZLOA 2QQ7A 3COIA 4E7WA 2CPKE 4TNBA 4W8DA 3V5QA 5J1VA 1H4LA 4B9DA 3GU6A 3MTFA 1OPLA 2YITA 4GH2A 5H8EA 3OBGA 5HESA 1U59A 2GNLA 2YJSA 2YM7A 3CY2A 5FXQA 1OIUA 4Z9LA 4F08A 2Q83A 3OG7A 2Y7JA 3R22A 3PXKA 4TY1A 4DYMA 4F65A 1JKSA 2QURA 2WQOA 2J51A 3P1AA 3PZHA 3SXFA 3F2NA 1WAKA 5EFQA 2EXEA 4G1WA 1PY5A 1RQQA 1XH7A 3KFAA 4BGQA 4C2WA 2WTVA 5ETCA 3VAPA 2UZNA 2EWAA 4KIOA 4QQJA 1MRYA 3R1QA 2BILB 4YC6A 3Q32A 4E93A 4FMQA 3NRMA 5KMLA 4DH5A 4M8TA 1XBCA 4I5PA 4YBJA 4QMQA 3OWPA 4AW5A 1WVWA 2CGUA 2ITNA 4CT2A 2WMUA 3R63A 2Y9QA 3MN3A 3TKUA 5K0XA 2UZWE 4ZY4A 2X9FA 3EN7A 3MFTA 4WA9A 4RLKA 5KZ0A 4ASEA 3FMJA 2Y0AA 2OIQA 4NCTC 1PXJA 5D10A 1H1SA 2J4ZA 3WOWA 3O50A 4CRSA 5HG5A 4MVFA 2YACA 2G2IA 3LLAA 3AC3A 5C27A 3EWHA 4F99A 3SW7A 1U46A 2OH4A 2CNQA 2UV2A 1RW8A 5C1QB 4CZYB 1BX6A 5EI6A 5D11A 3UVRA 4FNYA 3IDCA 5A4EA 3EQHA 3Q4ZA 2HWPA 2UZUE 2NP8A 4XS2A 1QCFA 2XIYA 4C3FA 5TOZA 5DT3A 1ZMUA 3A7JA 3PE1A 4IWOA 3Q2MA 3UO6A 2I0HA 4FK3A 4EH3A 4AU8A 4MXAA 3A61A 4UWCA 4ZJIA 3F7ZA 2BROA 2B1PA 2RF9A 4LOOA 5J7BA 3NUYA 2GQRA 3O7LD 2ITWA 4C02A 5G1XA 2BHHA 4XRJA 4G3EA 2X8IA 4KRDA 2YLEA 2W1IA 2BIYA 3JYAA 4II5A 4JS8A 3R8UA 1U54A 3VS4A 3ZHPC 3C5IA 3MY5A 3DBEA 4RWLA 5EDQA 3OT3A 1SMHA 3TTJA 4B99A 2VWVA 3DNDA 3K3JA 4MWHA 3NIEA 3DOGA 1PMVA 3BEGA 1LEZA 5JGAA 4NT4A 4GIHA 1O6KA 3QTZA 4X2FA 1KE7A 3EN6A 4W4VA 3W33A 3AD5A 2YM3A 3HV7A 3RNYA 3VRYA 2PZ5A 4ZLYA 2IW6A 3OWJA 5HORA 2CGVA 3BLRA 3G6HA 4TRLA 1Y8YA 3OY3A 3G15A 5M51A 4PTEA 4FSMA 2RSVA 1KE6A 2QOOA 2F2UA 2QG5A 1MQ4A 1GZKA 5AM6A 3AOXA 1WCCA 2WXVA 4IAAA 3ACJA 3UQFA 3QLGA 3Q6UA 4ZTLA 2OK1A 3GENA 3VRZA 3Q4UA 5CT0A 5AV2A 3HEGA 3R73A 4FKTA 2CLXA 3E92A 4PPBA 3QALE 3G33A 5CYIA 5L6WL 2BZJA 3R9HA 2FVDA 1LR4A 2GPHA 3DK6A 4BBEA 4BDEA 5B2MA 5GIOE 3NDMA 4IJ9A 1TVOA 2BZIB 2Z60A 4WIHA 4WKQA 3HAVA 3OF0A 1FVTA 4E3CA 3SD0A 1HCKA 2PE1A 4RIXB 5HNIX 3FKOA 4O1OA 4WRGA 2Y4IC 3E3PA 5AADA 3TT0A 4IX3A 4DH1A 4GK4A 3FAAA 2C0IA 5LMKC 1YDTE 4FIFA 3FLZA 3D14A 4U5JA 4AW1A 1YXTA 4NYEA 5E8YA 3HV6A 3JY0A 4IWQA 3NIZA 4CCUA 3AMBA 4TPTA 4F63A 4F4PA 3D83A 4Z7GA 2Z02A 3NNWA 5TE0A 3P23A 3DU8A 4F6SA 4ACHA 1Y6BA 3ORNA 3EKNA 1ZYLA 4LGHA 3KREA 4C7TA 2ZOQA 5KZIA 4BDHA 3Q9YA 3HX4A 3FDNA 3KA0A 1L8TA 2BZKB 4MAOA 4MXXA 3ZBXA 3U6JA 2QO7A 5HBJA 2VX3A 4IQ6A 3Q2JA 4GT4A 5AR4A 4DITA 4LUEA 1YWNA 2XNBA 3E64A 2I0VA 3IW4A 2G1TA 2ITVA 2P3GX 4R3PA 1YWVA 3O51A 4LRJA 2R3LA 5CI6A 1Q61A 1PHKA 1YOMA 4QP7A 2YM8A 4Y73A 5AUUA 4IZ5A 3MVHA 4FI1A 3UG1A 4C35A 4IAKA 5M55A 3LFQA 4HVGA 3DBDA 3DQXA 3HRCA 2QOQA 3C4WA 4FT0A 1OKYA 3HP2A 2XH5A 4QYYA 2CKEA 2A1AB 3VUTA 5L8LA 1G8SA 2QHMA 4QMSA 5CEMA 2X4FA 2P33A 3QX2A 3GQLA 3I81A 4BF2A 2VO0A 3BGQA 4EBVA 5H9BA 5IDNA 5AUZA 3ORXA 3ANRA 3MB7A 1H1WA 2R7BA 2WQNA 3FL5A 4L67A 4RZWA 4X3FB 2QU5A 2OH0E 2C5OA 4EQMA 3L9NA 4JQEA 5HD7A 3A62A 3Q53A 4FTLA 5AIRA 3TKHA 4F9YA 5CU3A 2R7IA 4S30A 4CG8A 3Q60A 1XH8A 1UU8A 4EZ7A 4PWNA 2R2PA 5HI2A 4WO5A 5IQEA 3L9MA 4J8MA 5IQIA 4ZSEA 3CS9A 5CF8A 3OT8A 1J7IA 1OIYA 4O7WA 3ORKA 1YDRE 3BYVA 1Y57A 2H96A 4RX9A 5AP6A 4DHFA 2CNVA 4L3JA 4QP9A 3ETAA 4RQKA 3F5XA 3UC3A 3R0TA 4U97A 2ZM1A 4XV3A 3NX8A 4BTMA 3GT8A 5EHOA 5ETAA 3MPMA 3FXXA 3UBDA 5KMIA 4D4SA 2O2UA 4DTBA 3ORPA 1Q8ZA 2BRBA 3HDNA 4W4XA 4FV3A 3CQUA 5CSHA 2JC6A 3FEGA 3EOCA 3LCDA 3LE6A 3FZ1A 3KXNA 3LQ3A 1APME 1WBPA 2GNHA 3KRLA 4DEBA 2VAGA 4XH6A 2DWBA 5HNBA 1CKPA 1PXLA 2IZTA 4R5SA 3IKAA 1JKKA 2JGZA 4BGGA 3MI9A 3BHTA 4N0SA 3UOLA 1GIIA 3FUPA 3DZQA 3VUMA 2XRUA 3V3VA 2RL5A 2WTKC 1U4DA 2XKCA 5BVKA 5DEYA 5GNKA 3OOGA 5EH0A 2X8DA 3IGGA 1H1QA 4LQMA 3I4BA 4C61A 1Q8YA 4GFGA 4FT9A 5CF4A 5HX6A 3MTLA 1IAJA 3JR1A 4R1YA 5KBRA 4DGOA 4IC7A 1YXVA 2CCIA 4QYFA 4U44A 1UWJA 5CSXA 3OS3A 3SOCA 4JDIA 5ACKA 2QD9A 5HCZA 3ZM9A 4FTJA 3MH1A 2WMWA 4B4LA 3AQVA 5I5ZA 4L01A 4GV1A 2Z7SA 3K5VA 5JQ5A 5KX8A 1PW2A 2P2IA 2XIRA 4IB5A 3ZEPA 3MESA 3B8RA 2YCRA 3JPVA 5EYMA 3JVRA 4MD8E 1GZ8A 3QX4A 2BFYA 5TT7A 3G51A 4AG8A 4IX5A 4U3YA 4CYJA 2FSOX 4B8MA 3PPZA 4Y85A 3PA3A 2IW8A 4BL1A 1M2QA 3L9PA 5CWZA 5AR2A 4TWOA 5FG8A 3RK7A 4L3PA 2ERKA 2VGPA 3QTIA 4J52A 2PPQA 4H3PA 2R4BA 1BI8A 4LI5A 3P86A 1Q3WA 3GQIA 1A06A 3O71A 4UMPA 2C69A 2UW8A 3FE3A 3ORZA 5KNJA 4YZCA 1Z5MA 3UIUA 1ZYSA 4I93A 4WSYA 5CLPA 3UMXA 4ACMA 4CV8A 5K5NA 4NFMA 1L3RE 3FKNA 4FT3A 2WMVA 5HGIA 4CMOA 4DGMA 5B0XA 4V01A 4EK3A 4P4CA 2B55A 2IVSA 2JIVA 1JLUE 1FGKA 2W4KA 3E62A 3HP5A 4KD1A 4NIFB 5CXHA 1VZOA 2X6EA 3A7FA 2XJ2A 5IEVA 3E8DA 5CVHA 3PE2A 2B53A 2C3LA 3GU4A 4QD6A 2W1GA 2XS0A 4RJ5A 3C0IA 1G5SA 3R9DA 4QMLA 4OTQA 5M4UA 2R3FA 3KXHA 2YIQA 4FTCA 4JRVA 4XP0A 5TF9A 4C57A 5DPVA 4FEXA 4RPVA 2VGOA 5LVOA 4E4NA 1XH5A 2BALA 4NTTA 4UV0A 2GNJA 4ZTNA 5M4FA 4L00A 1P4FA 3EQPA 4USEA 1OL1A 2IN6A 4X6RA 5CSWA 3BHHA 2XF0A 5IA2A 2AC3A 3CJFA 3ITZA 1CDKA 4C2VA 4D0WA 2E9NA 2NRUA 3E88A 4C3PA 2UW4A 3GCUA 2QCSA 4FSTA 2I0YA 2HOGA 5IMEA 4GVJA 1RE8A 2CKPA 1XKKA 2WQBA 3KRJA 1PRYA 4TTHB 4PL4A 5HE3A 3AMYA 2J0IA 4FTNA 4DLJA 3C4CA 1H27A 2JKMA 5FEDA 5CASA 3MH3A 4BDAA 4LOQA 2UZBA 2W4OA 2ZV2A 3BU6A 3G2FA 5AR7A 5FBNC 1PF8A 4XJ0A 4W4YA 4DFLA 1DS5A 3EQIA 4LV8A 4O27B 4CKJA 4ASDA 2CKQA 2IJMA 3GNIB 3NMUF 3R9NA 2WMBA 4FGRA 4CVAA 2GQGA 1PJKA 3BBWA 4XRLA 5A6OA 3GCSA 3DJ7A 4FG7A 4ZMEA 4UALA 3R7YA 4MH7A 4XP3A 2Q0BA 3ATTA 4H1JA 2GHMA 4WNPA 4L46A 5EM6A 4DEEA 4BKYA 4YJSA 1X8BA 4FTRA 4Y5QA 3RZFA 1A48A 4JLCA 4QQTA 5I9ZA 5IF1A 2YAKA 5D7VA 3BWJA 1UV5A 3OCBA 4FKQA 4G17A 5IA0A 4GMYA 3NW5A 3LLTA 3DLZA 2SRCA 3K5UA 4MBJA 1R3CA 2PHKA 3K54A 2EU9A 5BVWA 3ZC6A 4RIYA 3G0FA 4CRLA 4PTCA 5EW3A 4HYHA 4P7EA 1UNLA 2VX1A 3ACKA 5J8IA 3MV5A 4FVRA 4BB4A 3KK8A 4QTAA 2YABA 4IVAA 4KKEA 4ALUA 3M42A 1AGWA 2YA9A 4G3GA 3UOJA 3UPZA 4FT7A 2YM4A 2HIWA 3KQ7A 4K0YA 5CEQA 1IR3A 2IVTA 2WEVA 4YZDA 3W55A 4L3LA 4M3QA 3BHUA 3L8VA 4DBXA 2QR8A 3CCNA 3EB0A 3AC8A 3TDVA 4KABA 4QMYA 4FEUA 5DOSA 1VYWA 5CANA 4ZP5A 4XG8A 3EHAA 2OF4A 4FTQA 2VO3A 2XBJA 4EBWA 2PUUA 3ZMMA 4FIHA 3DXPA 4DFYA 2Z2WA 5HVKA 3N4UA 2PMOX 4YTCA 2ETKA 2XVDA 3FHRA 3BELA 3PWYA 4HYUA 3KVXA 4GS6A 4CQGA 1FOTA 2HY0A 5HIEA 1OB3A 5FEEA 2BRMA 1XH4A 1ZXEA 3S4QA 3SAYA 1XH6A 4EK8A 4ZTMA 2EB3A 1G8AA 2WEIA 1UNGA 5HTCA 4QPSA 1YDSE 3ZTXA 3TWJA 1KV2A 3T8OA 2JIUA 2XMYA 2IZSA 3VNTA 2YFXA 4IEBA 5L8KA 2W4JA 4FYOA 4S33A 3FC2A 4FYNA 2OO8X 2J2IB 4JBQA 2P55A 3QUDA 4F7LA 4FICA 3VF8A 3NR9A 3VUKA 5KKRC 1VJYA 3GCQA 3TACA 2J0MB 2UUEA 3NLBA 5AM7A 5C01A 3RINA 4FL3A 2YN8A 1GZNA 3Q04A 4CLIA 4FZ6A 2R3HA 2JKOA 4BDIA 5J9ZA 4BVUA 2HAKA 2UW3A 3A7IA 3BYMA 4PDOA 5HE1A 4AFEA 3HKOA 5FDPA 2PZPA 3VULA 2JIIA 3DKGA 2VNWA 4RC3A 4KKHA 1FVVA 4FEQA 4ZTHA 2ITZA 3O2MA 5HO8A 4BZOA 5IUGA 3PVUA 4CGAA 4L42A 5DR6A 5JFXA 3QKMA 2WIPA 3CTJA 5BYYA 5K9IA 2QOBA 3FBVA 4MQ2A 4CD0A 1ATPE 1IA9A 2OWBA 2OBJA 3FSFA 3NEWA 2RFEA 2XYNA 1PXOA 1UKIA 3BIZA 3CEKA 3F61A 5GHVA 1ZOEA 2CKOA 3DXQA 4E20A 4I0TA 3W2PA 3ULZA 4BDDA 2HYYA 3HNGA 4E5WA 4EH7A 2XCHA 4GYGA 4HYSA 5JSMA 5HX8A 3SLSA 3PG1A 3VN9A 3PPKA 2YCSA 3ZBFA 1YI3A 4E8AA 3ZONA 2JITA 4EC9A 3GU8A 4GFOA 5FGKA 3WE8A 4DEGA 4CQEA 2A27A 2XIXA 4IB1A 2ESMA 3ZXZA 5AR8A 3FY2A 3AT3A 2VTMA 2XEZA 3ZO3A 1BUHA 3OTVA 4GIIA 4JR3A 2DYLA 1ZMWA 3N9XA 3R7VA 3WZKA 1ZMVA 2BFXA 2XYUA 5AX3A 4TYJA 5JEBA 4D2TA 3QQFA 3TNHA 2X2KA 5GZ8A 3O0GA 3Q5IA 1OUKA 4QMTA 3CSVA 3OW3A 2JD5A 2W17A 3ODZX 2X4ZA 2CMWA 3W2QA 4F70A 2BKKA 3C7QA 4I0SA 4JAIA 5C8MA 3QZFA 3R1SA 3UYTA 3U87A 2UZTA 2PVJA 3KXGA 4GRBA 2NRYA 3VS5A 5I9YA 3PDTA 2XM8A 4MXZA 4EI4A 5GINE 4DCEA 5ANOA 5E8ZA 4IWPA 2PVFA 4BZNA 2C6DA 2A19B 4QTBA 4BWPA 1OL6A 2FH9A 4O83A 4IVDA 2BDWA 3ZSIA 3HYHA 3QD0A 4UXLA 1H08A 1GZOA 4KIKA 2PUNA 4Z3VA 1JPAA 5J7HA 3RPYA 5L2QA 4JNWA 1T45A 2UVYA 3FMNA 4O1PA 1FMKA 5H3QA 3TL8A 5ANJA 5LMBA 1VR2A 5KMNA 2YJRA 3ZLYA 2C1AA 2ACXA 5JK3A 3OZ6A 4TYIA 2BAKA 4EZ5A 3FZPA 5EW8A 3HL7A 1OMWA 3UVQA 1Q99A 4N6ZA 4WRSA 4WNKA 3WARA 2F4JA 2JBOA 3Q3BA 2H6DA 1FPUA 2JLDA 2ZM4A 4IM0A 3RPVA 3RJCA 2Y4PA 4F9CA 4O86A 4EOOA 2WKMA 4O2PA 4NFNA 4XV1A 3C1XA 5CEKA 4F9AA 5LCJA 3I6UA 4YJUA 2YIYA 2J90A 4GK3A 1ERKA 4XMOA 4A9RA 4D9TA 3ZFXA 3AXWA 4DH7A 4JG7A 4ZOGA 3NGAA 3D15A 3HRFA 1UU3A 2WMXA 2BRHA 2C3KA 4FKSA 4L6QA 3D7TB 1YOJA 3LXNA 5DH3A 3COMA 2C1BA 2HWOA 1WMKA 2WOUA 4WSQA 4AXAA 1OM1A 3BQRA 5CVGA 4CFMA 5A14A 1XO2B 3JS2A 3V51A 5FUTA 3V8WA 3F3WA 3R7UA 2OXXA 4MNEB 4F09A 4EKKA 2ZJWA 2W06A 4NW6A 3I5NA 5J5TA 1BMKA 4IJPA 3D94A 4EOJA 2PVHA 4MD9E 3WF9A 2XEYA 3O7LB 1E1XA 4D4YA 4MTAA 3NYVA 5CU4A 4AA0A 1CM8A 2RFSA 2B9HA 1YHSA 3UTOA 4HJOA 4M69B 5HD4A 3IG7A 3KULB 5ANEA 3THBA 4AGWA 3KF4A 4BR3A 3DK3A 4PY1A 3TUDA 1JWHA 1TQPA 5JZJA 4H58A 4CYIA 4KBKA 3QD4A 4CFVA 4KKGA 4ONAA 4PRJA 3EMGA 1I44A 2V22A 1PYEA 2XNPA 4MYGA 2JDTA 4BDGA 1O6YA 2V7AA 4XBRA 4MQ1A 4FNWA 3IK3A 2QR7A 1R1WA 3Q96A 4D2VA 3FZSA 4BIBA 3NUUA 4G9CA 5AV4A 5BNJA 4Z7HA 4HGSA 2BRGA 2CHLA 5EG3A 4NCTA 1IA8A 4RIWB 3DZOA 4OGRA 4OTIA 5F4NA 2EUFB 2YZAA 4FKLA 4AUAA 4ZS4A 4HCTA 3RM7A 1WVXA 4PMMA 5AV3A 5BYZA 1GOLA 2C5VA 2YM6A 4ZZOA 2C6TA 3FLQA 3EJ1A 4QMZA 1W98A 4ERWA 1TKIA 3VUDA 1M52A 1ZLTA 3PA4A 3MFRA 4YZBA 3C4EA 4F1TA 3VQUA 1FINA 3CPCA 2BDFA 3VUHA 5E8UA 3II5A 4TW9A 1NXKA 4QNYA 3PXQA 2OG8A 2QKWB 1PYXA 2XIZA 3FWQA 3EN9A 1O9UA 2OLCA 3BLQA 5A3XA 1MUOA 4Y83A 3H0YA 5B2KA 5BVDA 3JUHA 2FSTX 4RMZA 3LFBA 4IMYA 3G0EA 3OVVA 4ANQA 1KE5A 3PJ3A 5AAEA 5L2SA 3ALOA 4Y95A 4OBPA 3ZRKA 4ZJVA 2ITXA 4IB0A 5M4IA 4JL9A 3UO4A 2ETMA 4M84A 3IO7A 3QQHA 3BU3A 3FMDA 2F49A 4MXYA 3R1NA 4ZY6A 5E92A 4C38A 3CP9A 3UYSA 2H8HA 3RAHA 3KMUA 1RDQE 2PSQA 3QU0A 4YZ9A 4Z16A 2OIBA 3FLYA 3CGFA 4LRKA 4RVLA 3RK9A 5F95A 4IW0A 4F0IA 3SRVB 1OGUA 2PVLA 5TKDA 4IDTA 2O63A 4UYNA 3FLSA 2Y8OA 3G5DA 5L6PA 3JY9A 5T6KA 4TKSA 3R9RA 2WFYA 4EOSA 1E1VA 4AZTA 3VS2A 4BDFA 3H3CA 3R28A 5CU0A 5F9EA 4USDA 4I41A 5AR5A 4RSSA 5IQAA 4IFGA 2KULA 2UVXA 3VHEA 2WD1A 3OP5A 4QOXA 1SNXA 4EHGA 2I6LA 2WMSA 3QQKA 4GG5A 1MQBA 4LOPA 3IPHA 4YUQA 5LMKA 4U43A 4CFWA 4C34A 3QTQA 3IONA 4TYEA 3HMOA 4QP8A 4G9RA 5AP5A 3C0GA 3EFJA 5EM7A 3VS1A 4WOVA 5CS6A 2NNWB 1DAYA 3E7OA 1Z9XA 1ZARA 2H34A 2IO6A 2ZDTA 2X81A 2XNGA 2O64A 4W8EA 4TNDA 1H07A 4DEAA 3MFSA 4MEDA 3KF7A 3V6RA 4E4XA 2CLQA 2VWUA 3F5GA 3CR0A 3RNIA 4OTPA 1J7UA 3ERKA 3U51A 5ETFA 2RIOA 3LCKA 2E9PA 3ZXTA 3GI3A 4PV0A 3LM5A 1YOLA 2OICA 3VS3A 4DCAA 1OKWA 2F7ZE 1XH9A 4FKGA 4U79A 4LYNA 3RGFA 2R3PA 3TV6A 3U9CA 4EQCA 3Q5ZA 4RRVA 5C26A 4F0FA 5JRQA 4JOAA 5D1JA 4BICA 3QYWA 3OEFX 3H10A 5GZ9A 4FTIA 2PZIA 2P4IA 4CNHA 1OIRA 5E91A 4AX8A 3D4QA 5CEIA 5ANKA 3LVPA 3IQ7A 4RC4A 1TQMA 2NPQA 3BGPA 4QYEA 3AT2A 2QI8A 3BCEA 3C13A 4RJ8A 3DNEA 3D2KA 3C0HA 1JAMA 4I6QA 3LXPA 4IWDA 4A06A 4JIAA 2OZAA 3GCVA 3C4ZA 3BBTB 3JXWA 3OCTA 1H00A 4NWMA 5EDPA 4HVSA 3HDMA 2C6KA 3AD6A 4AQCA 5L6OA 3VS6A 5AEPA 4TXCA 2A4LA 4O21A 4C3RA 3DXNA 5BMSA 4L7SA 4YTHA 3VC4A 1PKDA 2XJ1A 3R00A 5HCYA 4O7SA 1YI6A 3EQGA 2R3MA 1Q41A 2PVMA 4FZAB 4ACGA 1H1PA 2IVVA 5FTQA 3PJ2A 2WPAA 4FKIA 3PFQA 4AACA 2QU6A 2R3IA 3GC9A 4YSJA 5EHYA 4QTDA 2FO0A 2VTQA 3VO3A 2QVSE 4BY9E 3REPA 3WYYA 4E6QA 5AP3A 4O0XA 3DKOA 5KMJA 4JX3A 4PMTA 2F57A 4W9WA 3EFLA 4NUSA 1QMZA 2B9FA 2IW9A 3P0MA 4CMTA 5A4LA 3RAWA 2C0TA 5CAVA 2PZRA 4CFXA 2YIXA 4O0TA 4XG7A 5J79A 2HY81 4FG8A 5K4JA 4E5AX 4GVAA 3DDPA 2UVZA 2W5AA 3DGKA 3TUBA 3LMIA 5JZNA 4TWNA 4MKCA 4I20A 3FZTA 4IZ7A 3DBQA 4CMUA 3QQUA 2Z8CA 4NH1A 4J1RA 3QZHA 4FKJA 4OBOA 3BPRA 4FSNA 1CTPE 2R64A 2P0CA 4DH8A 5LCKA 5M08A 4IAFA 4ACCA 4YTFA 2BCJA 4K9YA 4AN9A 3G6GA 4JVGA 4O38A 3UJGA 4I5CA 2X8EA 4MXCA 4RC2A 4QTEA 3DTCA 3HECA 2VWIA 3IDBA 5KUPA 2J0KA 4PDYA 4K11A 4BN1A 3A4OX 2O8YA 3FSKA 1KE9A 1P5EA 3TNQB 4ORKA 1BL6A 4RJ4A 3QC4A 2VWYA 4O91A 2ZV8A 3PSBA 3LFEA 1PMEA 4XBUA 5ANGA 3UP2A 2Y6OA 4BDCA 1H8FA 2R3RA 3P4KA 3PIZA 2VUWA 5CQUA 2OXYA 5I3RA 3QTRA 3FQHA 1EH4A 3QGWA 1YWRA 3POOA 4FTMA 4FZFB 4NEUA 3TI1A 4B7TA 5BVOA 3V8TA 4O7RA 2WMQA 3LIJA 3Q4TA 3QZGA 4ZAUA 2BRNA 3AT4A 3U6IA 1WBOA 4KIPA 3OTUA 4JDKA 5KMKA 2PVRA 2CGWA 1KE8A 4BCNA 4AOJA 3HAMA 3SC1A 2XIKA 3VJNA 3R71A 5K5XA 1H1RA 1SVGA 1NT2A 3W2SA 4OT6A 2VTIA 4BCOA 3MPTA 4CEGA 5E1SA 3H30A 1GNGA 1ZAOA 2W99B 2QONA 4DA5A 3PA5A 3R7IA 4D4RA 4FF8A 5JRSA 2VTSA 3CBLA 4X6QC 4G5JA 4D2SA 3PIYA 4AWIA 4U45A 4NZWB 5FM2A 4IAIA 3GVUA 3WZUA 4JDJA 5M57A 4WD5A 3PJ1A 2QLQA 4O7VA 4J95A 2OJ9A 3BE9A 4CZTA 5LVNA 5CI7A 1MRVA 3FI3A 2W5HA 3DAJA 4D9UA 2G9XA 2QODA 3SHEA 3VQHA 3AG9A 2GTMA 4KA3A 4NL0A 5JKGA 5CX9A 2VTJA 4FUYA 5DRDA 2JAVA 3GC8A 3LQ5A 3EN4A 4DEIA 5T68A 3O8UA 3PJ8A 4U42A 4YSMA 4YP8A 2VTTA 5GJGA 3EL7A 3I6WA 1WBWA 3CQEA 4EWQA 2B9IA 2Z7RA 2WHBA 2WMTA 3D5UA 4RX8A 3WZJA 4D5HA 2OU7A 5DN3A 5LQFA 2OXDA 1DM2A 2E2BA 3PXRA 4AT4A 4YO4A 3S1HA 3OXZA 3TNWA 3DB8A 4JBPA 4F64A 2PZYA 4ZEGA 4NTSA 2VO7A 4WBOA 4DN5A 2EXMA 4FC0A 5CF5A 1OBDA 1JKLA 3NVKI 1IAHA 5HTBA 2BTRA 2XRWA 1U54B 1OBGA 4I6FA 5AWMA 3SV0A 4UEUA 4EH5A 3R2YA 3RMFA 3TKIA 1W84A 3IOKA 4BI2A 4O7TA 5HG8A 3FI4A 3MJ1A 4OAVB 5CSVA 3MYGA 3O8PA 5E8SA 2OF2A 5LOHA 5AUTA 4U80A 4AN2A 4YJOA 5CNOA 4A9TA 3TJCA 4V0GA 2UW0A 3P7AA 3QFVA 4HCUA 5EKOA 4AGDA 3BKBA 4PPCA 4PUZA 3BWFA 4APPA 4F6WA 4I4FA 4BYIA 1YQJA 3Q4CA 3R8ZA 2B54A 4YJRA 4C4IA 3L8SA 1W82A 2F7EE 1JBPE 2ERZE 3DK7A 4Q9SA 4QP4A 1V0PA 3CIKA 4K33A 2YEXA 4DTKA 4TYHA 3EYHA 4CTCA 3ULIA 2F7XE 4XV2A 4RX7A 5ANIA 2EXCX 3RAKA 4ALWA 3A99A 3WBLA 5HO6A 2VWWA 4OUCA 5I9UA 5AP1A 5E8VA 1YHWA 3ORTA 4RFZA 2ZDUA 4N70A 1W83A 3DCVA 2GFCA 1DAWA 3E8EA 3FL4A 3QWJA 4JQ7A 4FSUA 4EOLA 4R8QA 4EOMA 5KO1A 3PJCA 5CZHA 3DFCB 5DE2A 4E4LA 5L2WA 1QPEA 2VWXA 4JJRA 3F3VA 3UQGA 4F0GA 4O84A 2YISA 3WF5A 3BZ3A 3ZSHA 4E6DA 3TV7A 3EYGA 3GP0A 3RI1A 4FV9A 3TNPC 3HVCA 3UPXA 3ZLWA 4DGGA 4I5MA 4FNXA 4UXQA 2A0CX 4FE2A 3HA6A 3GOKA 3PSDA 3A7GA 1PXNA 2AUHA 2VNYA 2W05A 3QYZA 5ETIA 3F69A 3QBNA 5KHXA 4I0RA 2X39A 3GCPA 4NJDA 5EM8A 5ICPA 3QTXA 5AMNA 5IUIA 3UIBA 4AZVA 3WYXA 4O0RA 3ZUVA 4EUUA 1AQ1A 1M2PA 3A2CA 5I3OA 5DGZA 4R6VA 2WQEA 1CKIA 2VTNA 5HG7A 4LG4A 4HGTA 5L8JA 4AN3A 5M53A 4P2KA 2RG6A 3VF9A 1URCA 4IDVA 1G3NA 3AGMA 4FT5A 4UMRA 2XBAA 3POZA 4QMMA 2ZV9A 3W2CA 3DB6A 4H3QA 2YHVA 4RJ6A 3RPSA 2JBPA 3L9LA 4YJQA 3RAIA 3NNVA 3D2IA 1J7LA 1YXUA 3KN5A 4EQUA 2FA2A 3I0QA 3U54A 2PVYA 1ZOGA 3ORMA 4GUEA 2BDJA 3I1AA 3CY3A 5J9LA 4G6OA 1KSWA 1H01A 4ZZNA 4WNMA 3P7CA 4AZEA 3F2RA 3MW1A 4CFNA 3OBJA 2XNEA 1ZYJA 4EYJA 3NSZA 2YIRA 1WFCA 2WMAA 2J0JA 3W16A 2X7FA 2WNTA 4D2PA 3PY3A 3OWLA 3SVVA 4H05A 1H0VA 5H2UA 3ELJA 4FBXA 3FHIA 4PL3A 4PNKA 5A6NA 4IVCA 3C4FA 1YW2A 5LVLA 5D9HA 2VX0A 4O0VA 4EH2A 2UZEA 3NUPA 4OLIA 4UY9A 4E73A 3Q9XA 5L2IA 3F66A 4M7IA 4Q2AA 1PMUA 3UP7A 4AFJA 2OFUA 3CTQA 3OC1A 4TZRA 4UB7A 4BCPA 4FTAA 4BTFA 5EKNA 1V0OA 2VV9A 3TEIA 2VTPA 4EK4A 3T9IA 3EKKA 2QC6A 4ASZA 3NW7A 2XNOA 5CU2A 5DBXA 3TCPA 1Z57A 2R3KA 2WMRA 1IG1A 2J5EA 3ENHA 4O7ZA 4OTWA 3BX5A 2V7OA 5EK7A 5H8GA 3SW4A 5C4LA 2F9GA 1KWPA 1WVYA 1FVRA 3C5UA 3I7BA 1KOAA 3ZEWA 4EHZA 4U40A 4D4VA 5M09A 5J1WA 1Q5KA 3P08A 4GL9A 4FV2A 4QNAA 4QYHA 4J7BA 4PP9A 3F2AA 4UYAA 3FPMA 2WZJA 4EZ3A 3VUGA 5BUEA 3PY1A 5M44A 4JT3A 5HHWA 1WZYA 2HZIA 4QQCA 3DS6A 5JH6A 4RQVA 4DFBA 3QHWA 4G3FA 3N4TA 3V5WA 4A07A 2XKDA 1W8CA 3NYXA 3P9JA 5K0KA 2HCKA 4CXAA 4YJTA 1IEPA 1B38A 1J3HA 1M2RA 3KMMA 4KB8A 3EN5A 2FYSA 4NSTA 3ZU7A 5FQDC 2QOKA 2WQMA 4YU2A 5JMSA 4D2WA 3RP9A 2PYWA 4OT5A 2PVKA 3F6XA 4D1SA 3W32A 4JDHA 3GC0A 2OSCA 3ET7A 4ZIMA 4D1ZA 2E9UA 4IX4A 4DGNA 3I79A 3VBVA 4XYFA 3EFKA 2OKRA 5CXZA 5ACBC 4RLLA 4DFNA 2VTAA 4OTGA 4ARKA 4O0YA 4JR7A 4F7JA 4EONA 2ZM3A 5GIPE 3FMHA 5DG5A 3AD4A 4RFMA 2UW5A 4BTJA 1SVHA 4IXPA 4J71A 3R9OA 3MSSA 1ZYDA 4R3RA 5M06A 5JFSA 4A9SA 5CEOA 4WG5A 2BAQA 3M11A 4ITIA 4KAOA 4XP2A 5L3AA 3HMPA 5IA4A 2HK5A 4K18A 4H1MA 3NUSA 4O7NA 4J98A 3FKLA 4L45A 2ZB0A 4XG9A 3UOHA 4GT5A 3KL8A 4EH6A 3NYOA 4FV7A 5EQEA 3E3BX 3IW5A 3K2LA 3G90X 1OECA 3LFCA 1OUYA 4AE6A 3TN8A 2BTSA 3AC1A 4R7HA 5BMMA 4FKUA 3DAKA 3BHVA 3UVPA 3G9NA 3V04A 2GU8A 4UBAA 4C4EA 3A4PA 4NK9A 4X2KA 3HV4A 5DWRA 4I23A 1OI9A 3QCYA 4RWKA 5AX9A 3SQQA 3QZIA 4FA2A 4D0XA 2CN5A 5FD2A 5AAGA 1PKGA 1H26A 1J1CA 5K4IA 3JVSA 4M13A 4YR8A 5BPYA 2PULA 3ATSA 2W1HA 1QPJA 4YLJA 4YJNA 2UW7A 3RHXA 3I60A 1R78A 2XJ0A 3FLNC 4YMJA 2C0OA 4LUDA 5M56A 4YJVA 3R8VA 4Y5HA 3AC5A 2PE0A 3BE2A 4GUBA 5KMOA 5HIBA 3GC7A 4YNEA 3V5JA 4DGLC 3R7EA 5IKWA 1Q8WA 4R78A 4I3ZA 4FKVA 3UDBA 1GIJA 4FZDB 2X9EA 3ROCA 2X6DA 4C33A 4GG7A 3QRJA 3BQCA 4HYIA 3MH0A 4ID7A 3VW6A 4ZJJA 3E5AA 1R0PA 4C4HA 3QWKA 5CAUA 4RBLA 3TZ7A 3DFAA 4AZSA 4Z55A 4V05A 3RWQA 2WTIA 4HVHA 3TZ9A 3QF9A 5FM3A 2BZHB 2ETRA 3GUBA 5IQGA 3BEAA 3ZFMA 4LL5A 3H0ZA 4GW8A 4L9IA 1JSVA 4LV5A 3R30A 3RWPA 5AIKA 2HZ0A 2R3NA 4X2NA 3ZZEA 4BZDA 3FQEA 4IACA 3ZUUA 4FX3A 5A4QA 3SXRA 1S9IA 3SDJA 4C8BA 3RCJA 2JFLA 3EQDA 2VTHA 5DRBA 1ZY5A 3LJ0A 2BR1A 5JQ8A 4NW5A 1DI9A 2I7QA 3DPKA 3IGOA 2XKFA 5BVFA 4KUJA 5IQBA 1WBNA 1V1KA 4BGHA 4DBNA 3E63A 1YVJA 4XOYA 2GSFA 3MBLA 3UGCA 3V6SA 4EHEA 4F7SA 3PZEA 1YRPA 1ZOHA 4GJ2A 4YTIA 4A9UA 2R9SA 4EJ7A 3EH9A 4G31A 3C4XA 3H4JA 5LXMA 2BHEA 4RIYB 3P5KA 1XWSA 4A4OA 5HBHA 3RPOA 4FIJA 2C5YA 2GNGA 2UZVA 1DI8A 3Q9ZA 2OW3A 1FMOE 2ITUA 2YAAA 1R39A 2XKEA 3CC6A 4D58A 3SG9A 1I09A 4S34A 3T3UA 2PUPA 1FQ1B 3FY0A 3LCOA 4J96A 4OTFA 2XNMA 5IU2A 2R3GA 3MA3A 2J7TA 2JKKA 5I4NA 3KXZA 1JOWB 3CGOA 3MS9A 4ZK5A 3A7HA 4DLIA 4RIXA 2ITYA 3NPCA 2ZYBA 3R21A 3DA6A 3IS5A 5AUXA 4B8LA 2PMIA 5A4CA 5FTGA 3OUNB 1RJBA 3BYSA 2AC5A 4FVPA 4QMVA 4RWIA 5EM5A 4AW0A 1HCLA 5HU3A 1REJA 3VVHA 1WBTA 5LARA 3PLAE 4DC2A 4MK0A 2ONLC 3I7CA 3LMGA 4I24A 4EKLA 5HE2A 3ZYAA 4Y46A 3E7VA 4HNFA 1Q8TA 3NAXA 3D9VA 3F9NA 3MVLA 2ZMDA 1JSUA 1F3MC 4FZ7A 2GS7A 5GJDA 3KN6A 3EFWA 3F7WA 1VEBA 3B8QA 5IZFA 4ERKA 3EL8A 1FGIA 3LCSA 3KCKA 3MB6A 4FODA 4RFYA 4XLIA 4HW7A 2YWVA 1U5QA 4BI1A 4QPAA 2OFVA 1Q8UA 2WAJA 3GEQA 4KRCA 5EOBA 3COKA 3LMHA 4U9AA 5DYJA 4C58A 2ZAZA 3PTGA 1XQZA 4O2ZA 4KBCA 3TUCA 1F0QA 2ITOA 2E9VA 3RKBA 3QKLA 5FBOA 5CZIA 4BKJA 3I5ZA 2G01A 3GFEA 3W10A 5A4TA 4DT8A 3W8QA 3V5PA 3DBCA 1O6LA 5FLFA 3DT1A 3ANQA 3F82A 1OVEA 3OW4A 4F1MA 2QOLA 3QA0A 4X3FA 1QL6A 2C47A 4IAZA 3DJ6A 3HV3A 4DH3A 1KOBA 4BC6A 3A8XA 3FMKA 3PVBA 3NYNA 3FQSA 3BGZA 4OTRA 3ORIA 3NCGA 3ZLSA 4RA5A 4LL0A 3ZDUA 4C4GA 2WTWA 4RJ3A 3G9LX 2X7GA 4M97A 2WOTA 4YC8A 4CSVA 1J91A 4D28A 2JEDA 5CEPA 4RX5A 3LFDA 1JVPP 4L8MA 3KXMA 3IECA 1YKRA 2CNUA 4MXOA 2FSMX 4EK5A 2OJJA 3F5UA 4EEVA 1U5RA 4WT6A 5DA3A 3LJ2A 4IM2A 3TZMA 1S9JA 2PWLA 2V55A 2R0UA 3CD3A 5HNGA 2PU8A 2VWBA 4BBFA 4PMPA 3FYJX 5LJJA 4I6HA 4G3CA 3NVMB 4GYIA 5IQCA 4J8NA 4OTHA 5ITAA 3CLYA 2QOHA 3QTWA 3PLSA 3S95A 4CCBA 5IA1A 1Y91A 3HGKA 2PUIA 4QQ5A 1CSNA 4GU6A 2PL0A 1VYZA 2I0EA 5AUVA 4R1VA 4W4WA 3EZVA 2OJGA 4RG0A 5EOLA 3R7OA 1MRUA 3CQWA 2ZMCA 4FIGA 3LXLA 5J87A 2C68A 1GY3A 2W1EA 4PL5A 4KIKB 4HOKA 3RHKA 3RK5A 3FXZA 5IA5A 4BIEA 5HLNA 3QCQA 1Q97A 3ZZWA 3PUPA 5IMXA 1BLXA 2YCQA 3PP0A 5DIAA 2VTOA 2G15A 5EYCA 4E6AA 5CF6A 3RBWA 4RVTA 3TXOA 3ZS5A 1SYKA 4EORA 4M12A 4N4SA 4BYJA 2PMNX 4Y72A 4X3FC 4YHTA 3OCGA 5DT4A 5DT0A 3QXPA 3FI8A 4QP1A 4O7YA 5JGDA 5CNNA 5FRIA 2QO9A 3PRIA 4MBLA 3ZM4A 5FDXA 3RALA 5IH6A 3DQWA 4APCA 2QHNA 4BCQA 3OXTA 4O22A 3R01A 5DR9A 5LWNA 1P14A 4U81A 1HOWA 4QO9A 4YHJA 4NJ3A 4O0SA 4BTKA 4S2ZA 4X2GA 4EJNA 4YURA 5KE0A 2QG7A 1OKVA 4XG3A 4Y8DA 2R3QA 2ITPA 3UE4A 2HENA 4EWHA 5IEXA 3LCTA 4E4MA 2OIDA 3D5VA 2C4GA 3V5TA 3ZOSA 3MGYA 3P7BA 2X2MA 4KBAA 3U9NA 4CFUA 4I1ZA 3GGFA 2I40A 1Y8GA 2IWIA 3C9WA 4JG6A 4PF4A 4BDBA 4BCIA 4FK6A 4JXFA 2JKQA 2GTNA 3BRBA 3I0OA 4MNFA 3RZBA 3QKKA 3S0OA 4DE4A 4QMWA 2GHGA 3OCSA 3VS7A 1URWA 4AZWA 3QA8A 4IADA 2C6EA 1Q24A 3F3UA 2RGPA 4DEDA 4HGLA 5E4HA 4QP6A 1SZMA 3LFNA 3QCSA 4EH4A 1SVEA 2V0DA 4RWJA 3WIKA 5CENA 1JKTA 2B4SB 4Q5HA 3F3ZA 4UWBA 4NIFA 5IUHA 2I1MA 4DG2E 4NKAA 2YDKA 4DFXE 3UO5A 3AGLA 3ZSGA 3W1FA 4BDKA 4D5KA 2NO3A 4MF0A 4E5BA 4ZMFA 4FV5A 4QMXA 4IAYA 5E7RA 3TNIA 4M0YA 3L8XA 5HU9A 3R7GA 4CV9A 5A54A 3MVMA 4O96A 5ANDA 3UNJA 3WILA 2X2LA 3MA6A 5DVRA 4MBIA 2YDJA 5KHWA 3PY0A 3QAME 1SNUA 2C5NA 4AE9A 5M4CA 3AC4A 4A4LA 5C8KA 3HMNA 1K3AA 2J5FA 4PPAA 3UZTA 5L4QA 5DR2A 2HZNA 3T3VA 4O6EA 4GEOA 5HTIA 3R04A 4XLVA 5KCVA 4TYGA 5CQWA 3VHKA 3UIMA 3BYUA 4DG0E 1B39A 1GJOA 3ZO1A 3SA0A 1OL5A 4C62A 4QMNA 5I9XA 3Q6WA 3LFAA 4YLKA 5BVNA 5HZNA 4ALVA 3QRUA 3KY2A 4ANLA 3CD8A 4P5ZA 4G34A 3UG2A 3N51A 3RPRA 3BV2A 3EQCA 1M7NA 2JFMA 4GFMA 4IX6A 4L53A 1NW1A 5BQ0A 5BUIA 2YERA 4PMSA 3VBTA 2X1NA 4K6ZA 4AS0A 3VS0A 5KMMA 3U4UA 2XP2A 4J97A 5AFVA 3LW0A 3QQLA 3PXZA 4AA5A 5EHLA 3U6HA 4ZTRA 3OOMA 4UZDA 2W7XA 4J99A 4ANSA 4G6LA 2HW6A 5CT7A 5A9UA 5KBQA 1BI7A 4GSBA 5FEQA 4U6RA 2V62A 5CAQA 1W7HA 2VTRA 3W2OA 4MWIA 2F2CB 2O3PA 3PWDA 1CKJA 4C37A 4FTOA 4BCKA 2W9FB 4JAJA 4XG2A 1Q62A 4K2RA 2C3JA 3WF6A 4YBKA 3QQGA 2GHLA 3Q9WA 5BX0A 2WELA 4ZSJA 4F1OA 3KU2A 4CT1A 1PXMA 3HMMA 5DEWA 2Z7LA 2XA4A 3EZRA 3FZRA 4FVQA 5EDRA 2UW6A 2XK4A 3QD2B 2XZSA 3V5LA 3ZO2A 2C30A 3WF8A 4JI9A 4AOTA 2X7OA 4EOPA 2P2HA 5FP5A 4R77A 2VWZA 2UZOA 4ZY5A 3HLLA 4DF3A 4LMUA 1OPJA 3KXXA 5HE0A 4ENYA 4MHAA 2CJMA 2C6MA 3VBXA 3BU5A 4M66A 5HLWA 2VZ6A 3ZUTA 4I6BA 2HZ4A 4O7LA 1XBBA 4MX9A 4AA4A 4E6CA 5D41A 5IQDA 4FTKA 2EB2A 3CJGA 4NM0A 5HBEA 3Q52A 2FGIA 4AF3A 1JSTA 4KSQA 2LAVA 4ASXA 4AZFA 3DJ5A 3OMVA 1K9AA 1B6CB 5HO7A 3KGAA 2QKRA 3PSCA 4QT1A 2BUJA 3DKFA 2Y4IB 4RT7A 3MIYA 4I4EA 4MCVA 3PYYA 2W1ZA 3FYKX 3ZH8A 4CKIA 2R5TA 5A46A 4O6LA 5HLPA 1KUTA 4WG4A 3IDPA 1H0WA 4HNIA 5AP0A 4RGJA 1LP4A 4I5HA 3OD6X 4A4XA 4CZUA 4AAAA 3OROA 4N57A 3EIDA 3QRTA 5FP6A 3ODYX 1M14A 2GDOA 1J1BA 3PVGA 4GJ3A 5IH5A 4K77A 5AV1A 3UQCA 4FKPA 3H9RA 4LGGA 3KK9A 5DHJA 3VBWA 5TO8A 4Q5EA 3WZEA 3NNXA 2DQ7X 4C0TA 1P2AA 4V04A 4LRMA 4IE9A 1Q4LA 3MY1A 4YPSA 4BBMA 4DFUA 2W9ZB 4M68A 5AUYA 3TM0A 4IH8A 2VTLA 2BMCA 4U8ZA 3QTUA 4EOKA 5HCXA 2AYPA 3GFWA 4PTGA 2HW7A 2OGVA 4BKZA 2WTCA 1OKZA 4PP7A 3ZRLA 3GXLA 4ZZMA 3OFMA 4M15A 3P79A 2V5QA 5D7AA 4FIEA 2ITQA 1M17A 3KB7A 3QGYA 3DY7A 1K2PA 4IANA 4I94A 3LHJA 3QTSA 5J95A 3QC9A 3KMWA 3FMLA 1W0XC 5E8WA 5CY3A 3QLFA 3O96A 3S3IA 4FKWA 3ZO4A 2CDZA 4FV1A 4KNBA 2BAJA 3H9OA 3LFFA 4MF1A 4PX6A 1V0BA 2B7AA 2OZAB 2OZOA 2IZRA 3ALNA 4RA4A 4FUXA 3OY1A 2C6LA 4RZVA 3VWAA 4BCFA 4DT9A 4J53A 2GQSA 3RM6A 3MFUA 5HVYA 3W2RA 1XR1A 3NS9A 3VUIA 2DUVA 4BHNA 1PXKA 3LKMA 3SG8A 4RIOA 1UKHA 3D7ZA 5IEYA 3R1YA 3CKWA 3GU7A 2R3OA 3WZDA 2OI4X 3IW6A 3FZOA 5J9YA 4FSRA 1YXSA 4BWXA 2R3JA 4D2RA 5FXSA 5F94A 3MJ2A 1NY3A 1LPUA 3ZRMA 4BRXA 4XHKB 3PVWA 1UU9A 5T3QA 4RVKA 4GU9A 4UMTA 5HVJA 4QMOA 1UVRA 4DINA 1NVSA 4AGUA 5GZAA 1ZWSA 2CGXA 3DV3A 4C36A 5LVMA 1ZY4A 2VD5A 5LMAA 3HUCA 3TTIA 5CAOA 4XUFA 3QCXA 4RVMA 2W0JA 5L2TA 1F5QA 3R2BA 4XG6A 5AP2A 4BCHA 2R0IA 3B2WA 5LWMA 1XJDA 1ZZ2A 3T9TA 2UZLA 3GBZA 2O65A 5HIDA 4M0ZA 3M2WA 2XK8A 3BYOA 5E90A 5G6VA 4ZXTA 2GFSA 2PMLX 4ANMA 3VBYA 1T46A 3UZRA 4U0IA 5EQYA 2VO6A 1IASA 3KRRA 4CKRA 2WTKB 3NUAA 4BHZA 4IZYA 4PDSA 4EOQA 4XX9A 3ENMA 5CSPA 1Y6AA 3F88A 2Z7QA 4LFIA 5CVFA 1R0EA 2C5XA 3AC2A 3TG1A 3R8LA 2CCHA 3DLSA 4XOZA 4ACDA 3LOKA 3R02A 2G2HA 3IW7A 4IFCA 5E1EA 3WE4A 4FTTA 3O23A 5CALA 4L68A 4DAWA 1BKXA 5FXRA 3TJDA 3HA8A 3UOKA 1PMNA 1OL2A 4R7BA 2UZDA 3NNUA 4QYGA 5IISA 3LZBA 3LJ1A 4I92A 5HOAA 3UMWA 4HVIA 5HG9A 1XHAA 4HGEA 4IM3A 2ITTA 3F3TA 4P5QA 5IQFA 1IRKA 5HKMA 1STCE 4WUAA 5LVPA 3LPBA 4GKHA 2J6MA 2OJFE 1H28A 3BI6A 3PXFA 5FTOA 3KEXA 3D7TA 4YNOA 4LMNA 2QOFA 4HCVA 3C51A 3PP1A 3FMEA 4ITJA 4IHPA 2UW9A 2O0UA 3GOPA 3R8MA 4XV9A 3UC4A 3RCDA 3UZPA 4B0GA 3ZLXA 3MPAA 4MNEA 3EQFA 3EQBA 2DS1A 4FG9A 4LM5A 4U7ZA 4FSQA 4TWPA 4X21A 4XNEA 3IOPA 5DI1A 3MY0A 5DNRA 2W1DA 2YM5A 4FTUA 4W9XA 3ZC5A 2QNJA 5FWKK 5AAFA 5JGBA 2QOCA 3NWWA 4IZAA 4KINA 4M14A 3DTWA 4D55A 3NUNA 4FEVA 4GKIA 4BWKA 4KS8A 3FMMA 3HUBA 4FKRA 5AP7A 3KKVA 4IVBA 4X3JA 4NM7A 5F1ZA 4M69A 2IVUA 4X7QA 4KWPA 3BLHA 4BFMA 3KULA 1Q3DA 3E8CA 4R7IA 3UNZA 4FNZA 4ZSLA 4F6UA 5EQPA 3MWUA 4YGAA 3QD3A 2XK7A 1JNKA 3E87A 3LQ8A 4HPUE 5JT2A 1NA7A 2X0GA 4EUTA 2WGJA 4L44A 5IQHA 2YCFA 3KC3A 4IIRA 3A60A 3LXKA 4EHVA 4EOIA 3E93A 1A9UA 4QRCA 4NU1A 3DBFA 1NVRA 5EYKA 4WHZA 4FV4A 3ROYA 2B52A 2PY3A 4E1ZA 3OEZA 3R6XA 4FSZA 4U3ZA 4A7CA 3KCFA 4F9BA 3NAYA 3QQJA 3VJOA 4FIIA 2RG5A 4RIWA 3QRKA 1SM2A 2ZV7A 4JIKA 3FJQE 3TIZA 5DLSA 1AD5A 2J0LA 2BPMA 2GS2A 5IA3A 4FV6A 2C6OA 5HQ0A 1YHVA 3COHA 4OTDA 5BUJA 1ZYCA 4U41A 3WIGA 4EL9A 1UNHA 5AUWA 4V0GB 1E9HA 3FC1X 3L1SA 5K3YA 2W1CA 4UZHA 5C03A 4FKOA 4C4FA 4ZSAA 4Q9ZA 5BVEA 3C50A 3MIAA 3BV3A 2Y6MA 4EH9A 5J5SA 5JN2A 5I9WA 4DTAA 3L8PA 2REIA 3VW8A 3QRIA 2XUUA 4XEYA 3MDYA 2RFNA 4FV0A 4G2FA 3OUKA 4TYHB 3CTHA 4G3DA 3DDQA 4DG3E 4HVDA 5I9VA 3IW8A 4JG8A 3K3IA 3LAUA 3EQRA 3BHYA 4NM5A 5JFWA 1BYGA 4AW2A 1LUFA 2GNFA 3KRXA 4FV8A 2YLFA 4YC3A 2J50A 3GU5A 3NZ0A 2XNNA 2J9MA 4FGBA 1ZZLA 3W18A 4FR4A 4UMUA 3PG3A 3TDWA 3CXWA 3QUEA 4JBOA 1OL7A 4PDPA 4KS7A 3SOAA 4UMQA 3SX9A 4BCMA 3E8NA 2C6IA 2RKUA 3V01A 4KSPA 4ZTQA 1YI4A 3CE3A 4H36A 3V8SA 4EYMA 3U55A 3HMIA 3VIDA 4HPTE 3OWKA 4S31A 4OBQA 4ZLZA 4IC8A 4R3CA
chains in the Genus database with same CATH superfamily
5HEZA 3SRVA 1PXIA 3R8PA 1OPKA 5AR3A 4DEHA 2G2FA 2PE2A 4H3BA 4NKSA 4OAUC 2GNIA 4B6LA 2IG7A 2Q0NA 2C3IB 2KTYA 3LM0A 4ANOA 4CLJA 2WU6A 4IBMA 3WI6A 2QLUA 2O5KA 4BIDA 3B2TA 2YDIA 2ZVAA 4AGCA 2YZLA 3UNKA 4FL1A 4G5PA 2W1FA 3WF7A 5JFVA 4ANBA 4DFZE 4FSWA 4YHFA 2XK6A 2XK3A 4JQ8A 2LGCA 4BDJA 5AV0A 2BVAA 5B7VA 4O7RA 4CFFA 5C9CA 3NW6A 4S32A 4YPDA 2H9VA 3CPBA 1MP8A 2EVAA 3FLWA 4AP7A 3M1SA 1OITA 4ITHA 2ONLA 4QTCA 2YIWA 4YZMA 5EW9A 4AOIA 4I21A 5H8BA 4I22A 5D12A 2WIHA 4H39A 3DAEA 4ENXA 1NVQA 2XB7A 4N6YA 3RTPA 4BCJA 1UA2A 4F7NA 1UWHA 4XCUA 3S2PA 4K8AA 3MH2A 3TZ8A 4YJPA 2JDRA 3TV4A 3HRBA 4GK2A 2W96B 1ND4A 4UN0C 2GS6A 2QO2A 3ORLA 5EI8A 1P4OA 4HZSA 4X2JA 5E8XA 1KV1A 4WUNA 5AP4A 1GAGA 4LGDA 4HZRA 3HZTA 4UX9A 1UU7A 5CU6A 5F20A 4EC8A 4FSYA 2HELA 1OIQA 1YXXA 5KKRB 1BL7A 1WBSA 4PQNA 2HXQA 2X0OA 4QP3A 5AA8A 4F78A 4YZNA 3GB2A 3FXWA 4O81A 3PPJA 4QMPA 5IDPA 4OW8A 3D0EA 3ZFYA 4E26A 4ZS0A 3D5WA 4YLLA 5DFPA 4AT3A 3AMAA 5DMZA 4C4JA 3KRWA 1M7QA 4OR5A 3F5PA 4TL0A 1TQIA 4P90A 4EH8A 5E9EA 2E9OA 2IF8A 2WTJA 3P78A 1OZ1A 2WU7A 3R83A 5BYLA 1CMKE 4JRNA 3QHRA 4PNIA 3HV5A 3MVJA 2JDVA 4TWCA 3UODA 1FBNA 4JX7A 3TIYA 4O0UA 2GMXA 4NM3A 1ZRZA 5E8TA 2W5BA 4UWYA 5CTPA 3W8LA 2BIKB 4ZTSA 1QPCA 2BKZA 2CN8A 5IPJA 3CKXA 3PRFA 2JAMA 5EYDA 5TR6A 3FPQA 3LFSA 2PTKA 3VBQA 4GT3A 5B2LA 4D1XA 1JQHA 4TN6A 2CSNA 2VU3A 4K1BA 4A9YA 4CTBA 5CAPA 3QL8A 2WTDA 3QXOA 2YWPA 5IH4A 2JDSA 4FL2A 1LEWA 4QPMA 4BCGA 4EK6A 2RFDA 1QPDA 3NCZA 4WNOA 3O8TA 3UIXA 4C59A 2HXLA 3W0NA 3KVWA 4WBBB 2GCDA 2A2AA 1H25A 4G6NA 3D5XA 3QUPA 4BI0A 2XM9A 2QOIA 1G8JA 5I0BA 5M07A 2XCKA 4X0MA 4M67A 4AT5A 4F9WA 3RVGA 2IPXA 1REKA 4O0WA 4WG3A 2XK9A 3H9FA 1PXPA 3SKCA 4ANNA 5C4KA 4IB3A 5AA9A 4YO6A 3U4WA 4L52A 5GJFA 2FUMA 3O17A 3SGCA 1WBVA 4JBVA 5C8NA 3SXSA 3OXIA 1GIHA 4FOBA 4L7FA 4RJ7A 3ID6C 3OHTA 5IG1A 2VN9A 2WO6A 3A8WA 2PVNA 1XBAA 3TMOA 3PXYA 4FOCA 4GCJA 4KIQA 2IZUA 4MD7E 3U8WA 4R5YA 2B0QA 3FV8A 3S00A 3N4VA 2OJIA 4TT7A 4FEWA 4O82A 2FSLX 3FI2A 2PK9A 2JDOA 4L43A 4USFA 3ZCLA 4QDVA 2VRXA 4ZSGA 4G16A 4QMUA 2ZB1A 5AJQA 3ZDIA 1H24A 4XG4A 5EI2A 5HICA 3PIXA 3DKCA 3NUXA 2WB8A 4CG9A 2B9JA 2FB8A 4QP2A 4ZLOA 2QQ7A 3COIA 4E7WA 2CPKE 4TNBA 4W8DA 3V5QA 5J1VA 1H4LA 4B9DA 3GU6A 3MTFA 1OPLA 2YITA 4GH2A 5H8EA 3OBGA 5HESA 1U59A 2GNLA 2YJSA 2YM7A 3CY2A 5FXQA 4DHZA 1OIUA 4Z9LA 4F08A 2Q83A 3OG7A 2Y7JA 3R22A 3PXKA 4TY1A 4DYMA 4F65A 1JKSA 2QURA 2WQOA 2J51A 3P1AA 3PZHA 3SXFA 3F2NA 1WAKA 5EFQA 2EXEA 4G1WA 1PY5A 1RQQA 1XH7A 3KFAA 4BGQA 4C2WA 2WTVA 5ETCA 3VAPA 2UZNA 2EWAA 4KIOA 4QQJA 1MRYA 3R1QA 2BILB 4YC6A 3Q32A 4E93A 4FMQA 3NRMA 5KMLA 4DH5A 4M8TA 1XBCA 4I5PA 4YBJA 4QMQA 3OWPA 4AW5A 1WVWA 2CGUA 2ITNA 4CT2A 2WMUA 3R63A 2Y9QA 3MN3A 3TKUA 5K0XA 2UZWE 4ZY4A 2X9FA 3EN7A 3MFTA 4WA9A 4RLKA 5KZ0A 4ASEA 3FMJA 2Y0AA 2OIQA 4NCTC 1PXJA 5D10A 1H1SA 2J4ZA 3WOWA 3O50A 4CRSA 5HG5A 4MVFA 2YACA 2G2IA 3LLAA 3AC3A 5C27A 3EWHA 4F99A 3SW7A 1U46A 2OH4A 2CNQA 2UV2A 1RW8A 5C1QB 4CZYB 1BX6A 5EI6A 5D11A 3UVRA 4FNYA 3IDCA 5A4EA 3EQHA 3Q4ZA 2HWPA 2UZUE 2NP8A 4XS2A 1QCFA 2XIYA 4C3FA 5TOZA 5DT3A 1ZMUA 3A7JA 3PE1A 4IWOA 3Q2MA 3UO6A 2I0HA 4FK3A 4EH3A 4AU8A 4MXAA 3A61A 4UWCA 4ZJIA 3F7ZA 2BROA 2B1PA 2RF9A 4LOOA 5J7BA 3NUYA 2GQRA 3O7LD 2ITWA 4C02A 5G1XA 2BHHA 4XRJA 4G3EA 2X8IA 4KRDA 2YLEA 2W1IA 2BIYA 3JYAA 4II5A 4JS8A 3R8UA 1U54A 3VS4A 3ZHPC 3C5IA 3MY5A 3DBEA 4RWLA 5EDQA 3OT3A 1SMHA 3TTJA 4B99A 2VWVA 3DNDA 3K3JA 4MWHA 3NIEA 3DOGA 1PMVA 3BEGA 1LEZA 5JGAA 4NT4A 4GIHA 1O6KA 3QTZA 4X2FA 1KE7A 3EN6A 4W4VA 3W33A 3AD5A 2YM3A 3HV7A 3RNYA 3VRYA 2PZ5A 4ZLYA 2IW6A 3OWJA 5HORA 2CGVA 3BLRA 3G6HA 4TRLA 1Y8YA 3OY3A 3G15A 5M51A 4PTEA 4FSMA 2RSVA 1KE6A 2QOOA 2F2UA 2QG5A 4O4DA 1MQ4A 1GZKA 5AM6A 3AOXA 1WCCA 2WXVA 4IAAA 3ACJA 3UQFA 3QLGA 3Q6UA 4ZTLA 2OK1A 3GENA 3VRZA 3Q4UA 5CT0A 5AV2A 3HEGA 3R73A 4FKTA 2CLXA 3E92A 4PPBA 3QALE 3G33A 5CYIA 5L6WL 2BZJA 3R9HA 2FVDA 1LR4A 2GPHA 3DK6A 4BBEA 4BDEA 5B2MA 5GIOE 3NDMA 4IJ9A 1TVOA 2BZIB 2Z60A 4WIHA 4WKQA 3HAVA 3OF0A 1FVTA 4E3CA 3SD0A 1HCKA 2PE1A 4RIXB 5HNIX 3FKOA 4O1OA 2XAOA 4WRGA 2Y4IC 3E3PA 5AADA 3TT0A 4IX3A 4DH1A 4GK4A 3FAAA 2C0IA 5LMKC 1YDTE 4FIFA 3FLZA 3D14A 4U5JA 4AW1A 1YXTA 3AKKA 5E8YA 3HV6A 4NYEA 3JY0A 4IWQA 3NIZA 4CCUA 3AMBA 4TPTA 4F63A 4F4PA 3D83A 4Z7GA 2Z02A 3NNWA 5TE0A 3P23A 3DU8A 4F6SA 4ACHA 1Y6BA 3ORNA 3EKNA 3UDZA 1ZYLA 4LGHA 3KREA 4C7TA 2ZOQA 5KZIA 4BDHA 3Q9YA 3HX4A 3FDNA 3KA0A 1L8TA 2BZKB 4MAOA 4MXXA 3ZBXA 3U6JA 2QO7A 5HBJA 2VX3A 4IQ6A 3Q2JA 4GT4A 5AR4A 4DITA 4LUEA 1YWNA 2XNBA 3E64A 2I0VA 3IW4A 2G1TA 2ITVA 2P3GX 4QDEA 4R3PA 1YWVA 3O51A 4LRJA 2R3LA 5CI6A 1Q61A 1PHKA 1YOMA 4QP7A 2YM8A 4Y73A 5AUUA 4IZ5A 3MVHA 4FI1A 3UG1A 4C35A 4IAKA 5M55A 3LFQA 4HVGA 3DBDA 3DQXA 3HRCA 2QOQA 3C4WA 4FT0A 1OKYA 3HP2A 2XH5A 4QYYA 2CKEA 2A1AB 3VUTA 5L8LA 1G8SA 2QHMA 4QMSA 5CEMA 2X4FA 2P33A 3QX2A 3GQLA 3AKLA 3I81A 4BF2A 2VO0A 3BGQA 4EBVA 5H9BA 5IDNA 5AUZA 3ORXA 3ANRA 3MB7A 1H1WA 2R7BA 2WQNA 3FL5A 4L67A 4RZWA 4X3FB 2QU5A 2OH0E 2C5OA 4EQMA 3L9NA 4JQEA 5HD7A 3A62A 3Q53A 4FTLA 5AIRA 3TKHA 4F9YA 5CU3A 2R7IA 4S30A 4CG8A 3Q60A 1XH8A 1UU8A 4EZ7A 4PWNA 2R2PA 5HI2A 4WO5A 5IQEA 3L9MA 4J8MA 5IQIA 4ZSEA 3CS9A 5CF8A 3OT8A 1J7IA 1OIYA 4O7WA 3ORKA 1YDRE 3BYVA 1Y57A 2H96A 4RX9A 5AP6A 4DHFA 2CNVA 4L3JA 4QP9A 3ETAA 4RQKA 3F5XA 3UC3A 3R0TA 4U97A 2ZM1A 4XV3A 3NX8A 4BTMA 3GT8A 5EHOA 5ETAA 3MPMA 3FXXA 3UBDA 5KMIA 4D4SA 2O2UA 4DTBA 3ORPA 1Q8ZA 2BRBA 3HDNA 4W4XA 4FV3A 3CQUA 5CSHA 2JC6A 3FEGA 3EOCA 3LCDA 3LE6A 3FZ1A 3KXNA 3LQ3A 1APME 1WBPA 2GNHA 3KRLA 4DEBA 2VAGA 4XH6A 2DWBA 5HNBA 1CKPA 1PXLA 2IZTA 4R5SA 3IKAA 1JKKA 2JGZA 4BGGA 3MI9A 3BHTA 4N0SA 3UOLA 1GIIA 3FUPA 3DZQA 3VUMA 2XRUA 3V3VA 2RL5A 2WTKC 1U4DA 2XKCA 5BVKA 5DEYA 5GNKA 3OOGA 5EH0A 2X8DA 3IGGA 1H1QA 4LQMA 3I4BA 4C61A 1Q8YA 4GFGA 4FT9A 5CF4A 5HX6A 3MTLA 1IAJA 3BL7A 3JR1A 4R1YA 5KBRA 4DGOA 4IC7A 1YXVA 2CCIA 4QYFA 4U44A 1UWJA 5CSXA 3OS3A 3SOCA 4JDIA 5ACKA 2QD9A 5HCZA 3ZM9A 4FTJA 3MH1A 2WMWA 4B4LA 3AQVA 5I5ZA 4L01A 4GV1A 2Z7SA 3K5VA 5JQ5A 5KX8A 1PW2A 2P2IA 2XIRA 4IB5A 3ZEPA 3MESA 3B8RA 2YCRA 3JPVA 5EYMA 3JVRA 4MD8E 1GZ8A 3QX4A 2BFYA 5TT7A 3G51A 4AG8A 4IX5A 4U3YA 4CYJA 2FSOX 4B8MA 3PPZA 4Y85A 3PA3A 2IW8A 4BL1A 1M2QA 3L9PA 5CWZA 5AR2A 4TWOA 5FG8A 3RK7A 4L3PA 2ERKA 2VGPA 3QTIA 4J52A 2PPQA 4H3PA 2R4BA 1BI8A 4LI5A 3P86A 1Q3WA 3GQIA 1A06A 3O71A 4UMPA 2C69A 2UW8A 3FE3A 3ORZA 5KNJA 4YZCA 1Z5MA 3UIUA 1ZYSA 4I93A 4WSYA 5CLPA 3UMXA 4ACMA 4CV8A 5K5NA 4NFMA 1L3RE 3FKNA 4FT3A 2WMVA 5HGIA 4CMOA 4DGMA 5B0XA 4V01A 4EK3A 4P4CA 2B55A 2IVSA 2JIVA 1JLUE 1FGKA 2W4KA 3E62A 3HP5A 4KD1A 4NIFB 5CXHA 2X0QA 1VZOA 2X6EA 3A7FA 2XJ2A 5IEVA 4QEBA 3E8DA 5CVHA 3PE2A 2B53A 2C3LA 3GU4A 4QD6A 2W1GA 2XS0A 4RJ5A 3C0IA 1G5SA 3R9DA 4QMLA 4OTQA 5M4UA 2R3FA 3KXHA 2YIQA 4FTCA 4JRVA 4XP0A 5TF9A 4C57A 5DPVA 4FEXA 4RPVA 2VGOA 5LVOA 4E4NA 1XH5A 2BALA 4NTTA 4UV0A 2GNJA 4ZTNA 5M4FA 4L00A 1P4FA 3EQPA 4USEA 1OL1A 2IN6A 4X6RA 5CSWA 3BHHA 3BLAA 2XF0A 5IA2A 2AC3A 3CJFA 3ITZA 4MUQA 1CDKA 4C2VA 4D0WA 2E9NA 2NRUA 3E88A 4C3PA 2UW4A 3GCUA 2QCSA 4FSTA 2I0YA 2HOGA 5IMEA 4GVJA 1RE8A 2CKPA 1XKKA 2WQBA 3KRJA 1PRYA 4TTHB 4PL4A 1TZDA 3AMYA 5HE3A 2J0IA 4FTNA 4DLJA 3C4CA 1H27A 2JKMA 5FEDA 5CASA 3MH3A 4BDAA 4LOQA 2UZBA 2W4OA 2ZV2A 3BU6A 3G2FA 5AR7A 5FBNC 1PF8A 4XJ0A 4W4YA 3O5AA 4DFLA 2XANA 1DS5A 3EQIA 4LV8A 4O27B 4CKJA 4ASDA 2CKQA 2IJMA 3GNIB 3NMUF 3R9NA 2WMBA 4FGRA 4CVAA 2GQGA 1PJKA 3BBWA 4XRLA 5A6OA 3GCSA 3DJ7A 4FG7A 4ZMEA 4UALA 3R7YA 4MH7A 4XP3A 2Q0BA 3ATTA 4H1JA 2GHMA 4WNPA 4L46A 5EM6A 4DEEA 4BKYA 4YJSA 1X8BA 4FTRA 4Y5QA 3RZFA 1A48A 4JLCA 4QQTA 5I9ZA 5IF1A 2YAKA 5D7VA 3BWJA 1UV5A 3OCBA 4FKQA 4G17A 5IA0A 4GMYA 3NW5A 3LLTA 3DLZA 2SRCA 3K5UA 4MBJA 1R3CA 2PHKA 3K54A 2EU9A 5BVWA 3ZC6A 4RIYA 3G0FA 4CRLA 4PTCA 5EW3A 4HYHA 4P7EA 1UNLA 2VX1A 3ACKA 5J8IA 4AXDA 3MV5A 4FVRA 4BB4A 3KK8A 4QTAA 2YABA 4IVAA 4KKEA 4ALUA 3M42A 1AGWA 2YA9A 4G3GA 3UOJA 3UPZA 4FT7A 2YM4A 2HIWA 3KQ7A 4K0YA 5CEQA 4LV7A 1IR3A 2IVTA 2WEVA 4YZDA 3W55A 4L3LA 2A98A 4M3QA 3BHUA 3L8VA 4DBXA 2QR8A 3CCNA 3EB0A 3AC8A 3TDVA 4KABA 4QMYA 4FEUA 5DOSA 1VYWA 5CANA 4ZP5A 4XG8A 3EHAA 2OF4A 4FTQA 2VO3A 2XBJA 4EBWA 2PUUA 3ZMMA 4FIHA 3DXPA 3BL9A 4DFYA 2Z2WA 5HVKA 3N4UA 2PMOX 4YTCA 2ETKA 2XVDA 3FHRA 3BELA 3PWYA 4HYUA 3KVXA 4GS6A 4CQGA 1FOTA 2HY0A 5HIEA 1OB3A 5FEEA 2BRMA 1XH4A 1ZXEA 3S4QA 3SAYA 1XH6A 4EK8A 4ZTMA 2EB3A 1G8AA 2WEIA 1UNGA 5HTCA 4QPSA 1YDSE 3ZTXA 3TWJA 1KV2A 3T8OA 2JIUA 2XMYA 2IZSA 3VNTA 2YFXA 4IEBA 5L8KA 2W4JA 4FYOA 4S33A 3FC2A 4FYNA 2OO8X 2J2IB 4JBQA 2P55A 3QUDA 4F7LA 4FICA 3VF8A 3NR9A 3VUKA 5KKRC 1VJYA 3GCQA 3TACA 2J0MB 2UUEA 3NLBA 5AM7A 5C01A 3RINA 4FL3A 2YN8A 1GZNA 3Q04A 4CLIA 4FZ6A 2R3HA 2JKOA 4BDIA 5J9ZA 4BVUA 2HAKA 2UW3A 3A7IA 3BYMA 4PDOA 5HE1A 4AFEA 3HKOA 5FDPA 2PZPA 3VULA 3UDSA 2JIIA 3DKGA 2VNWA 4RC3A 4KKHA 1FVVA 4FEQA 4ZTHA 2ITZA 3O2MA 5HO8A 4BZOA 2AQXA 3PVUA 5IUGA 4CGAA 4L42A 5DR6A 5JFXA 3QKMA 2WIPA 3CTJA 5BYYA 5K9IA 2QOBA 3FBVA 4MQ2A 4CD0A 1ATPE 1IA9A 2OWBA 2OBJA 3FSFA 3NEWA 2RFEA 2XYNA 1PXOA 1UKIA 3BIZA 3CEKA 3F61A 5GHVA 1ZOEA 2CKOA 3DXQA 4E20A 4I0TA 3W2PA 3ULZA 4BDDA 2HYYA 3HNGA 4E5WA 4EH7A 2XCHA 4GYGA 4HYSA 5JSMA 4DDIA 5HX8A 3SLSA 3PG1A 3VN9A 3PPKA 2YCSA 3ZBFA 1YI3A 4E8AA 3ZONA 2JITA 4EC9A 4I6LA 3GU8A 4GFOA 5FGKA 3WE8A 4DEGA 4CQEA 2A27A 2XIXA 4IB1A 2ESMA 3ZXZA 5AR8A 3FY2A 3AT3A 2VTMA 2XEZA 3ZO3A 1BUHA 3OTVA 4GIIA 4JR3A 2DYLA 1ZMWA 3N9XA 3R7VA 3WZKA 1ZMVA 2BFXA 2XYUA 5AX3A 4TYJA 5JEBA 4D2TA 3QQFA 3TNHA 2X2KA 5GZ8A 3O0GA 3Q5IA 1OUKA 4QMTA 3CSVA 3OW3A 2JD5A 2W17A 3ODZX 2X4ZA 2CMWA 3W2QA 4F70A 2BKKA 3C7QA 4I0SA 4JAIA 5C8MA 3QZFA 3R1SA 3UYTA 3U87A 2UZTA 2PVJA 3KXGA 4GRBA 2NRYA 3VS5A 5I9YA 3PDTA 2XM8A 4MXZA 4EI4A 5GINE 3NFGB 4DCEA 5ANOA 5E8ZA 4IWPA 2PVFA 4BZNA 2C6DA 2A19B 4QTBA 4BWPA 1OL6A 2FH9A 4O83A 4IVDA 2BDWA 3ZSIA 3HYHA 3QD0A 4UXLA 1H08A 1GZOA 4KIKA 2PUNA 4Z3VA 1JPAA 5J7HA 3RPYA 5L2QA 3W0OA 4JNWA 1T45A 2UVYA 3FMNA 4O1PA 1FMKA 5H3QA 3TL8A 5ANJA 5LMBA 1VR2A 5KMNA 2YJRA 3ZLYA 2C1AA 2ACXA 5JK3A 3OZ6A 5BV3A 4TYIA 2BAKA 4EZ5A 3FZPA 5EW8A 3HL7A 1OMWA 3UVQA 1Q99A 4N6ZA 4WRSA 4WNKA 3WARA 2F4JA 2JBOA 3Q3BA 2H6DA 1FPUA 2JLDA 2ZM4A 4IM0A 3RPVA 3RJCA 2Y4PA 4F9CA 4O86A 4EOOA 2WKMA 4O2PA 4NFNA 4XV1A 3C1XA 5CEKA 4F9AA 5LCJA 3I6UA 4YJUA 2YIYA 2J90A 4GK3A 1ERKA 4XMOA 4A9RA 4D9TA 3ZFXA 3AXWA 4DH7A 4JG7A 4ZOGA 3NGAA 3D15A 3HRFA 1UU3A 2WMXA 2BRHA 2C3KA 4FKSA 4L6QA 3D7TB 1YOJA 3LXNA 5DH3A 3COMA 2C1BA 2HWOA 1WMKA 2WOUA 4WSQA 4AXAA 1OM1A 3BQRA 5CVGA 4CFMA 5A14A 1XO2B 3JS2A 3V51A 5FUTA 3V8WA 3F3WA 3R7UA 2OXXA 4MNEB 4F09A 4EKKA 2ZJWA 2W06A 4NW6A 3I5NA 5J5TA 1BMKA 4IJPA 3D94A 4EOJA 2PVHA 4MD9E 3WF9A 2XEYA 3O7LB 1E1XA 4D4YA 4MTAA 3NYVA 5CU4A 4AA0A 1CM8A 2RFSA 2B9HA 1YHSA 3UTOA 4HJOA 4M69B 5HD4A 3IG7A 3KULB 5ANEA 3THBA 4AGWA 3KF4A 4BR3A 3DK3A 4PY1A 3TUDA 1JWHA 1TQPA 3PFYA 5JZJA 4H58A 4CYIA 4KBKA 3QD4A 4CFVA 4KKGA 4ONAA 4PRJA 3EMGA 1I44A 2V22A 1PYEA 2XNPA 4MYGA 2JDTA 4BDGA 1O6YA 2V7AA 1OGYA 4XBRA 4MQ1A 4FNWA 3IK3A 2QR7A 1R1WA 3Q96A 4D2VA 3FZSA 4BIBA 3NUUA 4G9CA 5AV4A 5BNJA 3KIOC 4Z7HA 4HGSA 2BRGA 2CHLA 5EG3A 4NCTA 1IA8A 4RIWB 3DZOA 4OGRA 4OTIA 5F4NA 2EUFB 2YZAA 4FKLA 4AUAA 4ZS4A 4HCTA 3RM7A 1WVXA 4PMMA 5AV3A 5BYZA 1GOLA 2C5VA 2YM6A 4ZZOA 2C6TA 3FLQA 3EJ1A 4QMZA 1W98A 4ERWA 1TKIA 3VUDA 1M52A 1ZLTA 3PA4A 3MFRA 4YZBA 3C4EA 3AKJA 4F1TA 3VQUA 1FINA 3CPCA 2BDFA 3VUHA 5E8UA 3II5A 4TW9A 1NXKA 4QNYA 3PXQA 2OG8A 2QKWB 1PYXA 2XIZA 3FWQA 3EN9A 1O9UA 2OLCA 3BLQA 5A3XA 1MUOA 4Y83A 3H0YA 5B2KA 5BVDA 3JUHA 2FSTX 4RMZA 3LFBA 4IMYA 3G0EA 3OVVA 4ANQA 1KE5A 3PJ3A 5AAEA 5L2SA 3W0PA 3ALOA 4Y95A 4OBPA 3ZRKA 4ZJVA 2ITXA 4IB0A 5M4IA 4JL9A 3UO4A 2ETMA 4M84A 3IO7A 3QQHA 3BU3A 3FMDA 2F49A 4MXYA 3R1NA 4ZY6A 5E92A 4C38A 3CP9A 3UYSA 2H8HA 3RAHA 3KMUA 1RDQE 2PSQA 3QU0A 4YZ9A 4Z16A 2OIBA 3FLYA 3CGFA 4LRKA 4RVLA 3RK9A 2XARA 5F95A 4IW0A 4F0IA 3SRVB 1OGUA 2PVLA 5TKDA 4IDTA 2O63A 4UYNA 3FLSA 2Y8OA 3G5DA 5L6PA 3JY9A 5T6KA 4TKSA 3R9RA 2WFYA 4EOSA 2IEWA 1E1VA 4AZTA 3VS2A 4BDFA 3H3CA 3R28A 5CU0A 5F9EA 4USDA 4I41A 5AR5A 4RSSA 5IQAA 4IFGA 2KULA 2UVXA 3VHEA 2WD1A 3OP5A 4QOXA 1SNXA 4EHGA 2I6LA 2WMSA 3QQKA 4GG5A 1MQBA 4LOPA 3IPHA 4YUQA 5LMKA 4U43A 4CFWA 4C34A 3QTQA 4AQKA 3IONA 4TYEA 3HMOA 4QP8A 4G9RA 5AP5A 3C0GA 3EFJA 5EM7A 3VS1A 4WOVA 5CS6A 2NNWB 1DAYA 3E7OA 1Z9XA 4JMQA 1ZARA 2H34A 2IO6A 2ZDTA 2X81A 2XNGA 2O64A 4W8EA 4TNDA 1H07A 4DEAA 3MFSA 4MEDA 3KF7A 3V6RA 4E4XA 2CLQA 2VWUA 3F5GA 3CR0A 3RNIA 4OTPA 1J7UA 3ERKA 3U51A 5ETFA 2RIOA 3LCKA 2E9PA 3ZXTA 3GI3A 4PV0A 3LM5A 1YOLA 2OICA 3VS3A 4DCAA 1OKWA 2F7ZE 1XH9A 4FKGA 4U79A 4LYNA 3RGFA 2R3PA 3TV6A 3U9CA 4EQCA 3Q5ZA 4RRVA 5C26A 4F0FA 5JRQA 4AAYA 4JOAA 5D1JA 4BICA 3QYWA 3OEFX 3H10A 5GZ9A 4FTIA 2PZIA 2P4IA 4CNHA 1OIRA 5E91A 4AX8A 3D4QA 5CEIA 5ANKA 3LVPA 3IQ7A 4RC4A 1TQMA 2NPQA 3BGPA 4QYEA 3AT2A 2QI8A 3BCEA 3C13A 4RJ8A 3DNEA 3D2KA 3C0HA 1JAMA 4I6QA 3LXPA 4IWDA 4A06A 4JIAA 2OZAA 3GCVA 3C4ZA 3BBTB 3JXWA 3OCTA 1H00A 4NWMA 5EDPA 4HVSA 3HDMA 2C6KA 3AD6A 4AQCA 5L6OA 3VS6A 5AEPA 4TXCA 2XALA 2A4LA 4O21A 4C3RA 3DXNA 5BMSA 4L7SA 4YTHA 3VC4A 1PKDA 2XJ1A 3R00A 4DDGA 5HCYA 4O7SA 1YI6A 3EQGA 2R3MA 1Q41A 2PVMA 4FZAB 4ACGA 1H1PA 2IVVA 5FTQA 3PJ2A 2WPAA 2X0PA 4FKIA 3PFQA 4AACA 2QU6A 2R3IA 3GC9A 4YSJA 5EHYA 4QTDA 2FO0A 2VTQA 3VO3A 2QVSE 4BY9E 3REPA 3WYYA 4E6QA 5AP3A 4O0XA 3DKOA 5KMJA 4JX3A 4PMTA 2F57A 4W9WA 4AXEA 3EFLA 4NUSA 1QMZA 2B9FA 2IW9A 3P0MA 4CMTA 5A4LA 3RAWA 2C0TA 5CAVA 2PZRA 4CFXA 2YIXA 4O0TA 4XG7A 5J79A 2HY81 1XMLA 4FG8A 5K4JA 4E5AX 4GVAA 3DDPA 2UVZA 2W5AA 3DGKA 3TUBA 3LMIA 5JZNA 4TWNA 4MKCA 4I20A 3FZTA 4IZ7A 3DBQA 4CMUA 3QQUA 2Z8CA 4NH1A 4J1RA 3QZHA 4FKJA 4OBOA 3BPRA 4FSNA 1CTPE 2R64A 2P0CA 4DH8A 5LCKA 5M08A 4IAFA 4ACCA 4YTFA 4AXCA 2BCJA 4K9YA 4AN9A 3G6GA 4JVGA 4O38A 3UJGA 4I5CA 2X8EA 4MXCA 4RC2A 4QTEA 3DTCA 3HECA 2VWIA 3IDBA 5KUPA 2J0KA 4PDYA 4K11A 4BN1A 3A4OX 2O8YA </