3HV5A

Human p38 map kinase in complex with rl24
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Displacement assay for the detection of stabilizers of inactive kinase conformations.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 339
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hv5A01
4JT3A 4TWNA 5AWMA 4QP6A 3VRYA 1G3NA 2J6MA 3KQ7A 2XBAA 5LQFA 4TY1A 2BFXA 3VULA 4R3PA 1Y6AA 3FQHA 4AOJA 2BTRA 5T3QA 2WB8A 3V01A 1OZ1A 4HCUA 5AP3A 3DNEA 4BGQA 5BUIA 3VBWA 4TYJA 3IW4A 5HGIA 1OL7A 3F61A 1I09A 4XG6A 4L00A 2XNOA 1LEWA 4HOKA 3CS9A 4TYHB 3R9OA 3TV6A 1LPUA 1XBCA 5DWRA 3NVKI 4PQNA 3BE9A 5E8XA 1P5EA 3UIXA 2B54A 3H4JA 2FUMA 4G16A 4GK4A 4JG8A 4FV1A 5DE2A 4L68A 1XR1A 4XBUA 3O8UA 3HRFA 2BILB 3C4XA 4ASXA 4A9YA 2E9OA 2BCJA 3M2WA 3KXMA 5GHVA 2REIA 4JDKA 4XG7A 3B2WA 5D7VA 4F7SA 1KSWA 2A27A 4BTJA 4G5PA 2UZEA 4MD8E 2YAKA 4YC3A 5EG3A 3QXOA 2X7OA 3R7VA 2GQRA 4I0RA 4XP2A 5J5TA 4FV3A 5M51A 4BHZA 2OICA 5CEIA 4EOMA 3AT4A 4O27B 4A4LA 3WZDA 5C4LA 4H1MA 4E1ZA 3ATTA 3MYGA 4R6VA 4G1WA 3CKXA 3MS9A 1R0EA 3QALE 3UNKA 1OPKA 1BKXA 3DA6A 4YJOA 3RJCA 2XYUA 3DKFA 5E8TA 3VS3A 4A06A 2UZOA 3TUDA 3KREA 1ZXEA 2W5AA 4IC8A 3ALNA 4JAJA 4JX3A 3ZHPC 3PA5A 5E8SA 2OFUA 2ITPA 5HE1A 4BDAA 5HG8A 2ZM3A 4BI2A 4RJ5A 2QI8A 4IHPA 3P78A 5AEPA 5B2MA 3HRCA 2C6EA 5L2SA 3FQEA 2VTRA 4EOPA 4I5HA 4BCQA 5EQPA 2IZUA 3TV7A 2XK4A 1PKGA 4UN0C 3RP9A 4GU9A 2F7ZE 4P7EA 4PL3A 3A7JA 3UYSA 4NEUA 5KHXA 3QCXA 3BLRA 3NR9A 3GFWA 2W05A 4MCVA 3OWJA 3R22A 4ZMEA 2Z8CA 3MH1A 5T6KA 4BTMA 2OO8X 2XP2A 4ASZA 5BYYA 5ANGA 5C01A 2JAVA 3KA0A 4XMOA 2QR7A 2VWZA 1ZRZA 1Q4LA 3F9NA 3OWPA 3V6SA 4O86A 3TNHA 2WGJA 3OC1A 1SNXA 3ZLYA 2X1NA 2JFLA 3AC4A 4K0YA 2A1AB 2QCSA 4Y8DA 2Z60A 4KIPA 3OWKA 4O7LA 4D9TA 4IVCA 2O5KA 4K9YA 5E1SA 3F2AA 4NW5A 1DI8A 3DXNA 3PE1A 1OKYA 4V05A 4NM5A 4BBEA 4PTEA 5TT7A 4XS2A 2XZSA 4TNDA 5CEPA 5IF1A 3SDJA 3U4WA 2WAJA 4ZZMA 3IKAA 1G8SA 3QWKA 4ZSJA 4X2JA 4PP9A 1KOBA 3KMWA 3G51A 4FZAB 2VTTA 3KK9A 4I1ZA 1YWRA 4E6CA 4FTTA 4EWHA 5IQBA 4FKVA 3R8VA 4AGDA 5D11A 3BYUA 4WG5A 4CG9A 5JZNA 4DLIA 3CGOA 3P08A 5IEVA 5DG5A 4RVLA 3MVHA 2PUNA 3CJGA 4G3EA 3UNZA 1Q3WA 3FLSA 5AV1A 3U6IA 4C7TA 2CDZA 3U8WA 3VW6A 3ORPA 4M97A 2OXDA 1UKIA 2WTVA 3ZRLA 2YLEA 4F6SA 5AP6A 1H00A 5HQ0A 2W1GA 3B8QA 4FL3A 2G2FA 4RFZA 3N9XA 3NUPA 4ASDA 2G2HA 4OLIA 2WQEA 4YZBA 1BI7A 1FBNA 1MUOA 4XJ0A 5I9YA 5IUHA 3BV2A 1W7HA 3POZA 2XNPA 1FQ1B 4JBQA 2OBJA 3MPMA 5CYIA 3IOPA 4AZWA 2YACA 2IZSA 1PXLA 2CGUA 2UW4A 3WIGA 4R5YA 3T8OA 3ID6C 3JVSA 2WPAA 4IFGA 4QYYA 5BUEA 3U51A 1IAJA 4RIXA 3H0YA 2YA9A 3QA8A 5GJFA 3UYTA 4X2GA 3SRVA 2C5YA 5KKRB 2GS2A 1JKLA 2ZM1A 4G6LA 4W4WA 4PMMA 2IW9A 4BGGA 4PMPA 4CV8A 4BR3A 3A99A 3JYAA 4I6QA 3KKVA 4FYOA 1B38A 1YRPA 3R1SA 5AMNA 4CTBA 2Z7SA 4ALUA 3QTUA 4PL5A 5CXZA 3MWUA 5LVNA 3DB6A 1CMKE 5LMBA 4O7WA 3E3PA 4MBJA 4NM3A 5IISA 3GENA 3M1SA 2JKKA 2QOOA 3CPBA 2ZV8A 2OU7A 5BNJA 4I94A 4KRDA 3RBWA 3ETAA 5F9EA 3TDVA 5JRSA 4FV0A 2FSLX 3QC9A 3F2RA 4KBKA 4EQUA 4EQCA 5A46A 4DTBA 3ZSIA 4JVGA 4O7TA 1NVSA 3R8MA 5L8KA 5M08A 3AGMA 3CP9A 4ZS4A 2UZDA 3MPAA 1Q3DA 2ITZA 2QU5A 3ORIA 5E91A 2VTSA 5D7AA 2Y7JA 4EL9A 4O0WA 3EQDA 5DN3A 3D2IA 3F69A 2V22A 4BDKA 2YWVA 2XB7A 2BALA 3P9JA 2HZIA 2PULA 2CGXA 4FVPA 4YJNA 4PTCA 3QAME 4E6AA 2X39A 2AUHA 2UZTA 3JVRA 4F09A 3PSBA 1YVJA 2ITXA 4GK3A 4QMMA 4EJ7A 2YCQA 2B0QA 4KBAA 1CDKA 4DCAA 3EN5A 3NNWA 1PKDA 3OEFX 2PSQA 1JPAA 4G3DA 2IW6A 3BZ3A 3HZTA 1ZARA 3FZPA 3P4KA 5D1JA 4BFMA 4RC3A 4EONA 4EOLA 2QOKA 3RCJA 5LMAA 1WBPA 1ZOGA 4FKIA 1OBDA 4L43A 4APCA 1J7LA 4JAIA 3C4WA 4IM0A 4YZMA 3SXSA 1Q8ZA 4FTQA 4GVJA 4DCEA 3MTLA 3UOJA 3FXWA 1U54A 2XYNA 3TZMA 2RFEA 5CAPA 4RBLA 4RIOA 3RZBA 4BF2A 2PTKA 1UV5A 4BYIA 2B9JA 4H36A 4G9RA 2UZNA 3TV4A 5BQ0A 2PZIA 2VWYA 2GHGA 4GIIA 4L9IA 5LVOA 5AV4A 2J0LA 3VUIA 4AU8A 2UVZA 4KS8A 5IQGA 1YXXA 1AQ1A 3KULB 2W9FB 4RVMA 1Y57A 2JEDA 4XLIA 5L2TA 1XWSA 4KBCA 3S2PA 4ALWA 2CJMA 4JOAA 4W4VA 3F3WA 5C26A 4E26A 5ANDA 4NTTA 3WYXA 4BWXA 4KS7A 2WEVA 3HUCA 3DBCA 3MFRA 1OBGA 1O6KA 4WKQA 2R4BA 2JC6A 2PK9A 3A61A 3W2RA 4AFJA 2RL5A 3VWAA 2PE2A 3CQUA 4FKQA 4A07A 4ANLA 5KNJA 1WCCA 3CQEA 3GCPA 4QYGA 2SRCA 3FKNA 3K2LA 2PVYA 3RCDA 4PNIA 3CE3A 5J8IA 2YJRA 4QOXA 1H28A 3TNQB 4RA5A 4DGLC 1JBPE 3EFLA 4BBMA 4PDSA 3EL8A 3WF6A 4WBBB 1FGIA 4QTDA 5HO8A 3RWQA 3HMPA 4MXOA 3GU4A 4L6QA 4ZTNA 5LMKA 3H9FA 2B9FA 2OFVA 4JX7A 1TQPA 4DTKA 4WO5A 3C13A 2CSNA 3H9OA 4O0YA 4WNMA 2ETMA 4XG3A 4NYEA 2OJIA 3NW5A 5HZNA 4OT5A 3QD2B 2W4KA 2YM4A 4FBXA 3L8VA 3Q3BA 3PY1A 4RJ7A 4MXYA 3VBVA 4LV5A 4A9SA 4NJDA 3FI2A 1UU9A 3QRIA 3PTGA 1UNLA 4D1SA 1J91A 2C0TA 1T45A 5JRQA 3G2FA 3JUHA 4HZSA 3KRRA 4E3CA 2I0YA 4GT3A 4J99A 5AP7A 4A9TA 4ACMA 1PYEA 4D2PA 4TWCA 3ZSGA 4XV2A 4N0SA 4IE9A 2X2MA 3MFTA 3TJDA 4AT4A 3SGCA 2R3QA 1Q41A 3IW6A 3NS9A 4O0TA 1BI8A 3QKMA 3R21A 4G5JA 3QRKA 3C51A 3ORLA 3QTRA 1W98A 2PZYA 1DAYA 1CKIA 4IVAA 4FNZA 5E92A 2XMYA 5CVGA 4EH7A 2UUEA 3GOPA 4C59A 3MA6A 4FODA 5JFVA 5AV0A 3HAVA 4H3PA 4L7SA 4A9RA 3PJ3A 2IG7A 4ZS0A 2R3HA 5GZ9A 4AW2A 4FTKA 4K8AA 4OTHA 5KE0A 3PVUA 3FXZA 3O8TA 4RIXB 3ORNA 2XK3A 2X0GA 2Y6OA 4CZTA 4MX9A 4EOSA 2XKEA 5CEKA 5CEMA 5AM7A 4EC8A 3KRXA 3A62A 4HPUE 5FGKA 3F82A 4UZHA 4B6LA 4DFXE 4E6QA 1XQZA 3ULZA 5BMSA 4UV0A 3JY0A 4IZYA 2XCHA 5CZHA 3ZONA 4EYMA 1GIHA 1JSVA 4E5WA 3VHKA 4ANQA 3ANRA 5M4IA 2OF4A 4M66A 2LAVA 3LAUA 5IKWA 4B7TA 4RRVA 3CY2A 4IQ6A 2RFSA 3ZU7A 3CGFA 4EK5A 5AUTA 3BEAA 3NIZA 1SVEA 3ZLWA 5AR4A 3VBYA 1IA9A 1OIYA 1M2RA 1FINA 3ZFMA 4LOQA 3FPMA 3D7TB 3ANQA 4TRLA 3Q9YA 4RJ3A 2C6IA 3TG1A 5IDPA 3F3UA 3R2YA 3ZUVA 1OKWA 3IG7A 1PMNA 1OVEA 1UNGA 4I21A 3ZFYA 1KOAA 4QYHA 5HHWA 3R8PA 2HZ4A 5M53A 1XH6A 4FX3A 4BCFA 3RAWA 5IA0A 3UQFA 2PUPA 1H4LA 2BHEA 4AQCA 5L3AA 3GFEA 3R9NA 5L6PA 4CVAA 2VO0A 2FGIA 3FLNC 5KHWA 2R7BA 4X2KA 4EHEA 5HD7A 2YIWA 4BB4A 3EQHA 2J0KA 3D4QA 1A48A 1IR3A 2J5EA 3CJFA 4BDHA 4C37A 2C1AA 2QKRA 4IFCA 1NA7A 5ETIA 5FEEA 3W16A 1YDRE 5BYZA 5DH3A 2C6MA 3WARA 4FL1A 2W7XA 1DI9A 2WQNA 4J96A 3COKA 3NNVA 4XG4A 1PXJA 5LVMA 5J1WA 3F7ZA 4ZJVA 3MI9A 5CXHA 1PF8A 3P7BA 4U5JA 2C3JA 3WI6A 4GT5A 5LVLA 4D9UA 3QCYA 1JSTA 5C8KA 3HYHA 3ZDUA 2BPMA 4RG0A 1QCFA 2CN5A 3LM0A 2GNFA 4U40A 5E8ZA 3UC3A 3IQ7A 3UOLA 2X81A 2BIKB 3ZZEA 4R1YA 4HGTA 4YTHA 4Z7HA 5H8GA 1YOLA 3SXRA 5HCZA 2PE1A 4C35A 5E90A 2W9ZB 5KBRA 3VS0A 4Z16A 2X7GA 1YDSE 3HP5A 4YSMA 3PJ2A 2BDFA 4GK2A 3OW3A 4HCVA 3UODA 4CFUA 1SYKA 4CGAA 4DA5A 2E9NA 3TZ8A 3ZO1A 4CYJA 4D5KA 2CNVA 5AR7A 3FMEA 3G90X 3LFBA 5G1XA 3TZ7A 5KMJA 3VBTA 3SG8A 5FDXA 4MXZA 1V0PA 4ZMFA 4FSYA 4TL0A 5JN2A 3MY1A 4FT3A 4ALVA 3FY2A 2IW8A 3S4QA 3LXPA 3V5PA 3HECA 3OMVA 5ETCA 3KGAA 3NCZA 4RX9A 4HVIA 1ZMVA 4J95A 4RA4A 3ZZWA 4EZ3A 5HVKA 2R9SA 4WBOA 4EOQA 2NPQA 5CEOA 4HJOA 2UZLA 2HZNA 1REKA 2GS6A 2QHNA 3DCVA 3KB7A 3WE8A 2YISA 3CR0A 4KSQA 4Q5HA 2ZAZA 2QO9A 3LLTA 3GC9A 3W33A 3MSSA 4AGUA 5F94A 5IUGA 2WQBA 1H01A 3GCVA 4QTCA 3CCNA 3NGAA 3LLAA 4EOIA 3PVGA 4U97A 3RPSA 3G6HA 4ZTHA 3I79A 3C5UA 3O7LB 3DLZA 3QQHA 4DG2E 4JDIA 1IG1A 5FRIA 3A7GA 5A4TA 2CNUA 4QMQA 3EQFA 1KWPA 2BRGA 3ZSHA 3V8WA 1KE9A 3KXZA 5D10A 4DEHA 5DGZA 2B52A 2G15A 2YERA 4ZTQA 4CFMA 2PHKA 4ENXA 4YTCA 5EW3A 1PMEA 5AA8A 4EOKA 4QMZA 4BKJA 4Q9ZA 4JXFA 4ITIA 2Y4IC 3GC7A 4TYHA 4ZSGA 4FT7A 2G1TA 1XH7A 3FZTA 2G2IA 5AAEA 4MWIA 1JVPP 4TYEA 3VAPA 2Y4PA 3KRLA 5FEDA 1P2AA 4QNYA 4FV7A 3OS3A 3EN4A 4FTAA 3QUPA 4B9DA 3KMUA 4KA3A 3PYYA 5GNKA 4R5SA 4E4MA 5HG7A 5FM2A 1BL6A 2HXLA 4FT5A 3VS6A 4IAIA 3K3IA 3R2BA 2JKOA 1VYWA 5HLPA 4PNKA 5M4FA 2R3OA 2YAAA 1L8TA 4GRBA 3QZHA 3VJOA 3D0EA 3BU3A 4C57A 3COIA 3Q2JA 1JLUE 4TYGA 3QZIA 3GI3A 5IA3A 4BCOA 4O7YA 1H26A 1NY3A 2UZVA 4I0SA 2AYPA 2F4JA 4F7JA 2CCIA 5EYMA 1ND4A 4H05A 3NUSA 3IGGA 4K11A 3QTXA 4BRXA 2XRUA 4QRCA 1JKTA 2EB3A 3HDMA 3EIDA 3HV7A 4G17A 3VS4A 3AD6A 1R3CA 2OKRA 4C58A 4WRSA 5G6VA 4IX6A 3VN9A 5GIPE 4AZVA 3SKCA 3SQQA 3R30A 2IWIA 5IA2A 2QC6A 3AC2A 3VUHA 1BLXA 2YM7A 1LEZA 4RIYB 4UYNA 2ETRA 2X6DA 2ZV9A 3BBWA 3PZEA 4FYNA 4PTGA 5HG9A 5TF9A 2YM8A 1J7UA 1Q8UA 2QR8A 2ESMA 3RPRA 2CN8A 4DGNA 1ZAOA 5IH4A 3GVUA 2WMUA 3BV3A 2QU6A 4YZNA 2WTWA 4RPVA 3ZRKA 5BVDA 4O82A 1H07A 4O1PA 3O0GA 3GB2A 4NSTA 2P55A 1SM2A 5DT3A 1BL7A 3F2NA 1NVQA 3VUTA 4O7SA 2WMTA 2VWUA 3PP1A 3UZTA 1ZY4A 1SNUA 1WVXA 3C9WA 3L1SA 5CNOA 3FHRA 4C61A 4AZFA 4RGJA 3S1HA 3GC0A 2I1MA 3E8NA 5AA9A 2OH4A 5D12A 2PMIA 3H0ZA 5ITAA 3DDQA 3NEWA 3DK7A 5CT0A 5EK7A 4AN3A 2PVNA 4OW8A 1UVRA 2J50A 4USDA 3FQSA 5L8LA 2Z7RA 1DM2A 3KXXA 4FV5A 2YWPA 4BDJA 5I9WA 3L9MA 3LFAA 2UW3A 4X3FB 4D2RA 1O9UA 2X4ZA 3DQWA 4D4RA 3V5TA 2HWPA 3FMHA 2GNLA 1OL5A 2B53A 1J1CA 3OG7A 4IVDA 3TN8A 4DH3A 2IO6A 2X2KA 4BCKA 5CF5A 4ZTRA 3TUBA 5EKOA 4CZYB 3VS2A 4YJUA 4FIJA 5CWZA 4XOZA 5HNIX 4AGCA 2PVKA 3LOKA 2PUUA 2ZJWA 4I5CA 3MDYA 2PVFA 3ZEWA 4C3PA 3P7CA 3BWFA 3P7AA 3TNIA 3NWWA 5JFWA 3SW7A 2O2UA 1R1WA 1M7NA 4OTDA 2VWXA 3AOXA 3IW8A 3LFQA 4FTLA 5AP4A 2R64A 5HESA 4RVTA 4ONAA 4QNAA 2QG5A 4U0IA 3FI8A 4D2VA 4GYIA 4BVUA 2V7OA 4QO9A 2W1IA 2QOBA 5CI7A 4D1ZA 3ORZA 1PYXA 4QPAA 4ZAUA 3KVWA 4F1OA 3C50A 4IXPA 4DT8A 2OW3A 3NW7A 4EBVA 3GOKA 3OF0A 3EN7A 4O0XA 4U8ZA 3IK3A 1PMUA 4NKSA 5ANJA 3R83A 4GT4A 2XKDA 3Q9ZA 4AN2A 4S30A 4BWKA 4WIHA 4I6FA 1VYZA 4G3CA 5FWKK 4Z7GA 2YM3A 2PZ5A 2ZMDA 3Q4ZA 4K33A 3SLSA 2C5OA 3Q5IA 2C3LA 3DKGA 4HNIA 3PLAE 4RZWA 5I9UA 3NNXA 3BI6A 3SXFA 4C3FA 4EH2A 3I4BA 3HRBA 4I22A 1ZYCA 2P2IA 4IJ9A 4ACGA 3ENHA 4YSJA 5LCKA 4FTJA 4K6ZA 3EN9A 5IMEA 2WTDA 3BGPA 4QMXA 1B39A 3UOKA 2ZDTA 4YHFA 4C36A 3BE2A 4BZNA 4B8LA 5BMMA 3TKIA 5DLSA 3PPKA 5IQHA 2CGVA 2HW6A 3DPKA 3D83A 2W1EA 3C4ZA 2FVDA 3I6WA 4U3YA 5JMSA 4FK3A 3R8LA 1TVOA 4C4GA 4U79A 3ULIA 4CRLA 4BI0A 4IWPA 4EHZA 2CKQA 2PY3A 3FE3A 2ETKA 4TPTA 2CMWA 5DFPA 4FR4A 5CVFA 5HIBA 2CKEA 4ITHA 4DEAA 3I60A 1UA2A 3TI1A 3DXQA 4R78A 1CM8A 2YIQA 1YHWA 3ACKA 3NW6A 4Y72A 1WMKA 4RFMA 3ZO3A 4X0MA 5DIAA 4ZTLA 4PMSA 1YXVA 3W8LA 4RLLA 2Z7LA 4OBOA 4YMJA 2BRMA 3QYZA 1Y8GA 1S9IA 4OAVB 4NW6A 2BKKA 1OGUA 2ITVA 1KE6A 3IOKA 4N6YA 4F7NA 4O0RA 3Q60A 4MXAA 4AOTA 4MD9E 2XNBA 4U43A 4AT5A 3Q32A 3LXNA 3JXWA 1F3MC 3CKWA 3HL7A 5C27A 4CMUA 3L8PA 3O50A 4W9XA 3RZFA 4AA0A 3AG9A 5HTIA 2JDVA 4BL1A 3KCFA 3C0HA 1UU8A 4YGAA 5J9YA 3KL8A 3KVXA 4ANSA 4O7RA 5EM6A 3WZJA 4E20A 5CU0A 3FZRA 2UZUE 3PDTA 3OTUA 5E8UA 2W4JA 3PXQA 2YHVA 3VF9A 3NCGA 3T3UA 4O7ZA 2EB2A 3CTJA 4WT6A 4FNYA 3U9NA 3F6XA 4QMVA 3W2PA 2VGOA 1GJOA 3QA0A 3PJCA 4GUBA 4QTAA 4UX9A 2OI4X 3V5QA 4G3FA 2VTQA 3IDBA 4D4SA 3KULA 3W55A 1IA8A 5CAOA 2RSVA 5HLNA 3R7EA 4DH7A 3PXZA 1PJKA 4FKSA 1M2QA 1IEPA 4FSMA 2NP8A 5LMKC 4I6BA 3EKKA 4QPSA 1Q24A 4QTBA 2WIPA 2ZB1A 3N51A 5JZJA 2V5QA 4WSYA 3FWQA 4IH8A 4WRGA 3G9NA 2EUFB 2C6OA 4MYGA 3TTJA 4ERKA 2Y9QA 4LFIA 2F9GA 2P2HA 3BWJA 3D5VA 2BRBA 3LFCA 3PE2A 1VZOA 3IONA 5FD2A 4C4HA 4ZTSA 1ZMWA 4JDJA 3UC4A 1XBAA 4DEBA 1FMOE 5CI6A 3BLQA 5FXSA 1XHAA 5AJQA 4DEDA 5JGBA 4J52A 4YJTA 3QRJA 2RFNA 4QMOA 4KIOA 4YHTA 4EK6A 4GSBA 3HV5A 4U3ZA 3D94A 4TW9A 2WHBA 2UW7A 3C7QA 3LCDA 4UALA 2JITA 4IANA 1SVGA 4S34A 4AW1A 2HOGA 2QOCA 1UNHA 4P4CA 3EQCA 2B4SB 4EK8A 3BBTB 4ZZNA 4GJ3A 5CSXA 4F63A 3LCSA 4I5MA 2JLDA 2CNQA 3KY2A 2OJ9A 5EH0A 4AACA 4HVSA 3LM5A 4NIFB 5EW8A 3T9IA 5IQIA 1OM1A 3BELA 4FT9A 5H9BA 3F3ZA 2BZJA 2WZJA 3MVJA 3S0OA 3EQBA 1YXSA 3W18A 2JDOA 3FPQA 5CU2A 4DFNA 4LUEA 3QKLA 1OB3A 4FSWA 2YN8A 1LUFA 5FP6A 4DEGA 3PJ1A 4ZY5A 3L8SA 2R7IA 3OHTA 4X3JA 4ZSAA 2J0JA 3PWDA 4LMUA 4RX8A 2UW0A 4D0XA 2IZRA 2JDTA 2R3IA 4FEWA 5A4EA 3QD0A 3E64A 4YLLA 5EM8A 3FHIA 4BY9E 3FI3A 5GJDA 2VTHA 3TACA 2VV9A 3AMAA 3HEGA 2B1PA 4R7BA 3QHRA 3AC5A 2XVDA 3ZCLA 4M68A 3UGCA 4OUCA 3V5JA 5J9ZA 3PRFA 3BYVA 4C4IA 3R1QA 4LRJA 4YJVA 3RNIA 3UVPA 2Y6MA 4OTGA 4JL9A 3R28A 3FC2A 4W8EA 3QD3A 4IWQA 2PVHA 4R8QA 5D41A 5JGDA 3SVVA 3HVCA 2EXEA 2W96B 3PSDA 4F6UA 3LCKA 4FTMA 5EI8A 4P5ZA 3OCBA 4XNEA 3UBDA 2WOUA 3DXPA 2GNHA 3QX2A 1WBVA 5IQDA 3BHYA 3FY0A 4AW0A 5DYJA 3C4CA 4CEGA 4D1XA 2UW5A 3BX5A 4G3GA 2YCFA 1A06A 5CAQA 3W2QA 4W8DA 2JKMA 4U81A 4USFA 2W99B 4UEUA 2PVJA 2HXQA 2VD5A 3RK9A 4FEQA 3UNJA 2W0JA 3AMBA 3VVHA 5IA4A 3UO6A 2XK9A 4HGEA 3S00A 4IX4A 3HMMA 3OOGA 4TYIA 4EYJA 2QVSE 1V1KA 1NW1A 3D7TA 2QURA 3Q6UA 4QMLA 5FXQA 2YCSA 4FIGA 1ZOEA 2Z2WA 5KO1A 3KF7A 4K2RA 2XK8A 4ZJIA 5IZFA 4X3FC 3CC6A 3DNDA 1YHSA 1OIQA 3AC8A 3I5NA 1Q5KA 3D5WA 2XEZA 4GIHA 4UXLA 3OBGA 4GH2A 4KAOA 3K5UA 4M69B 4IAZA 4QYEA 3BHUA 2YEXA 3RPOA 3ROCA 2O65A 3LVPA 1F5QA 1B6CB 5HOAA 3N4UA 5FQDC 2V7AA 3FMMA 3OOMA 3DKCA 5FEQA 4PY1A 1E1XA 4IX5A 4OTWA 4PRJA 3VF8A 5GINE 3KEXA 2F7EE 3Q96A 1HCLA 3T9TA 2RG5A 2FYSA 3RAHA 3NDMA 4QPMA 4EHGA 1Q62A 4O38A 2B7AA 4RJ4A 3LZBA 1PRYA 4PWNA 4UY9A 3LMIA 3ZBFA 3ZC6A 2WQMA 4HGLA 3Q6WA 5FG8A 2FSTX 5EM7A 5IEXA 3LFSA 4XYFA 4ORKA 5EOLA 5KMKA 2X9EA 3HA8A 4BDBA 2R0UA 4WG3A 3ENMA 5KMNA 2HAKA 4PL4A 2XM8A 4FVRA 1IRKA 4DH1A 1FOTA 3TWJA 3K54A 4AZEA 3T3VA 2HY0A 3BYMA 3DOGA 5FLFA 4IDVA 3E8DA 3FC1X 3CXWA 4BDIA 2PU8A 4LOPA 3NVMB 5IH6A 4O6EA 3MVMA 3LQ8A 3JPVA 4IWOA 4LL5A 4OBPA 3QQUA 4U6RA 5HVJA 3PFQA 4GKHA 4BGHA 4DGOA 3O2MA 5HE3A 1H1WA 2BZKB 4PX6A 4RJ6A 4U80A 5GJGA 5B2LA 1WFCA 5CASA 4AS0A 4OGRA 2XM9A 2I7QA 2H8HA 4E5AX 1KV1A 4LMNA 4UZDA 4F9CA 2GHLA 2C3KA 4FTNA 3VO3A 4C34A 1QPEA 5E1EA 4GW8A 4ANNA 5HD4A 3LCOA 5ACBC 4QD6A 5ETAA 4QQCA 4DBNA 4EH8A 4U7ZA 3U87A 4IACA 3VS5A 1H1SA 3KFAA 3OFMA 5AUVA 4RJ8A 4RZVA 5EFQA 2H96A 2PZRA 4C3RA 3DQXA 2X4FA 4UWYA 3BHVA 3O23A 3A60A 3V5LA 4ZZOA 3LJ0A 3MH0A 1YWNA 1M7QA 2GQSA 1XBBA 4WSQA 4DG3E 5AFVA 3BKBA 4U9AA 4EKLA 4FE2A 3P23A 2XIZA 4AOIA 3AGLA 2CPKE 3E62A 4NUSA 4O2PA 4ID7A 3RVGA 4BDDA 4EOJA 5EQYA 2FSMX 1UWHA 5C8MA 4G2FA 4TNBA 4YTIA 3LFNA 3ZXTA 3PUPA 5A14A 3R6XA 2C1BA 2O63A 1YHVA 1OPJA 1MRUA 1OL2A 4Y5QA 4F08A 4I5PA 3W32A 3KMMA 3MIYA 3K3JA 4OTFA 5CY3A 5DT0A 5L6OA 4DEEA 2BZHB 3ZDIA 3EB0A 3C0GA 5ICPA 5AADA 3JS2A 4MEDA 3IS5A 3VC4A 4L8MA 3FKLA 4Q2AA 3C1XA 1YI6A 4WA9A 3Q53A 1TKIA 2UV2A 3QLGA 5EKNA 5A6OA 1XJDA 4L7FA 2QOHA 2PMOX 3QUEA 1ZZ2A 3R02A 4LL0A 5EDPA 3KU2A 4C33A 3G15A 3RAIA 3WF8A 2Z7QA 5EW9A 2IVUA 4FZ6A 4FSZA 4QMSA 4YTFA 2YJSA 1PW2A 4AZTA 1R0PA 2EVAA 5BVFA 4HNFA 1V0BA 5EI2A 3FMKA 3TKUA 4H58A 4G31A 3WF7A 3AC3A 2RIOA 3FI4A 3QU0A 1H25A 2J7TA 3OCGA 5DEYA 4ZSEA 3TIZA 3W2SA 5AR3A 2QOLA 4XEYA 3AQVA 3GT8A 3RGFA 4FT0A 3FLQA 4L44A 4K18A 3NUUA 4QQJA 1P4OA 3PY0A 5J95A 2R0IA 3RNYA 4FSRA 4C4FA 4G9CA 3LQ5A 5M44A 2C6DA 1OL1A 2BDWA 2ITUA 2WTIA 4DBXA 3WIKA 4X6RA 1XH8A 2WFYA 5A9UA 3VUGA 2VO6A 3DBDA 1KE5A 4X6QC 3D15A 4BCMA 5KMLA 3DTCA 3UG1A 3WZKA 4RIYA 4QMNA 5DPVA 5BVWA 2WTKB 2GQGA 1W8CA 2IN6A 4W4XA 4CTCA 4A9UA 4BYJA 2ZV2A 5CAUA 4GU6A 5HKMA 3D14A 5A54A 3OCTA 3ZYAA 3V3VA 3TIYA 4TWOA 4UMPA 4TZRA 1URWA 4F0GA 3E7OA 4NTSA 2BVAA 3HKOA 3QQJA 2XF0A 5HEZA 3GNIB 3FZSA 3I5ZA 4FTOA 2EU9A 5FTOA 3RWPA 3FMJA 3HUBA 3ODYX 3DBQA 4EHVA 2DYLA 4F7LA 2QLQA 1HCKA 4ZOGA 1GZOA 4FV6A 4O96A 5CAVA 4FGBA 4D2WA 1OUKA 3NYVA 4C2VA 4YO4A 3PXYA 2OIDA 2OIQA 1H0WA 5C4KA 3NRMA 4E5BA 4RC4A 4KKHA 4UBAA 1KUTA 3NUYA 3PPZA 1I44A 5LOHA 3FZOA 1RDQE 4TT7A 1CKJA 4AZSA 4X3FA 5IA5A 1Z5MA 4O2ZA 1Y6BA 4GEOA 3OT3A 1YI4A 5AUXA 2LGCA 3Q5ZA 4MNFA 4PDPA 4HW7A 4XH6A 2VTPA 2NNWB 2YZLA 5JFSA 2ZDUA 2FSOX 3PIXA 3VJNA 2XCKA 5K0KA 4G6OA 1OKVA 2F2CB 4V01A 3ZLSA 5HBJA 3PXFA 4QMWA 2PL0A 5DRBA 2A0CX 3QYWA 4EOOA 4HYUA 4FNWA 4IVBA 5JSMA 3ZM9A 4MXCA 4XP0A 2C6KA 5DI1A 2A19B 5AIKA 4LRKA 2HY81 4F4PA 3UQCA 2NRYA 4IC7A 4TTHB 3Q04A 2YIRA 3R9DA 4HYIA 3QGYA 4YC6A 4BIDA 3U55A 1SMHA 4GL9A 4WD5A 5I4NA 1U46A 2PVMA 3ZXZA 2PMNX 4IAFA 5EYCA 3ZTXA 5KKRC 5JQ8A 2YM5A 4S32A 4V0GA 4EH4A 1Q8TA 3LE6A 4C0TA 3U6JA 3QC4A 4PUZA 2ZV7A 3HGKA 4DEIA 4FKJA 3BEGA 4ERWA 1G8AA 2ZMCA 5ANKA 3RAKA 2XKFA 3DV3A 3EL7A 4MAOA 5EYKA 3MTFA 4I4FA 1M17A 1YDTE 4AF3A 2OG8A 4RWIA 2C6TA 3FKOA 4CFVA 5ANOA 3G0EA 5AP0A 3LPBA 2WMXA 2A4LA 1UU3A 4GCJA 2WMBA 2V55A 4CT2A 5LWMA 4FGRA 4XLVA 1PXMA 2F2UA 3VBXA 3DFAA 4FIHA 1QL6A 1U5RA 2XIYA 2O0UA 3KXNA 3II5A 5C9CA 2X2LA 4JS8A 3I6UA 1W84A 4ITJA 5BPYA 4FKUA 4O84A 4Y83A 3KXHA 1IASA 1FVVA 1WVYA 5M06A 2XNEA 2WMSA 3CTHA 1WBWA 2JKQA 3GXLA 3RI1A 4CMOA 5GZ8A 5IA1A 3Q52A 4B8MA 4CXAA 2JBOA 4GG7A 3QCQA 3NLBA 3PSCA 4HGSA 1OECA 3E87A 4C4JA 5LXMA 3GGFA 3CSVA 5E4HA 2GTMA 4YJSA 2UVXA 3TL8A 2BDJA 3A2CA 2GPHA 4L45A 4QMYA 4BC6A 3DBFA 2XUUA 2BAKA 3QGWA 4O0SA 4IB3A 3SA0A 3V6RA 1T46A 3VUDA 2GFCA 5L2QA 3K5VA 1FMKA 3E3BX 3FDNA 4CKRA 4KIKB 2J2IB 5A3XA 5M57A 5M4CA 3DU8A 4YPSA 1V0OA 4CD0A 3HMOA 5HI2A 1K9AA 1PXPA 5AR2A 4DH8A 5FBOA 4ZXTA 5FP5A 5HO6A 3DK6A 3MB7A 5IDNA 4JG6A 5A6NA 3P0MA 3IECA 3OROA 3L9LA 2GDOA 3MA3A 3RHKA 4UMUA 1Z9XA 2R3FA 2W1DA 4U45A 5JEBA 3M11A 3RKBA 4RFYA 3ZM4A 3CY3A 2FB8A 4XP3A 3PLSA 5AV2A 4D58A 1ZYDA 3AC1A 2VO7A 4RMZA 4FUXA 4CCUA 3GU7A 3LMGA 3ZBXA 4O0UA 4YZ9A 1FGKA 1H1PA 4AE6A 5DT4A 5K5XA 4DAWA 2VTIA 3ORKA 2X9FA 3G6GA 3MJ1A 4I24A 5K4IA 2XJ1A 4EORA 3EMGA 4KRCA 4EUUA 2P3GX 4FKRA 2C69A 1H24A 1ZLTA 2ZVAA 1OMWA 4FVQA 4QYFA 4YU2A 3COMA 5KX8A 3NSZA 3ODZX 1MRYA 1JNKA 3VS1A 3IO7A 4IMYA 4DYMA 3SD0A 3MGYA 2I0VA 3QTZA 4EK3A 3KRJA 4E6DA 2C0IA 4FI1A 3QTSA 4NFNA 2YABA 2BAQA 3AXWA 3WZEA 5HCXA 4L53A 4BTFA 3BIZA 3MVLA 3CEKA 3Q9XA 4EJNA 4C4EA 3SG9A 3FL4A 4FTCA 3IDCA 2OJJA 3TJCA 3FAAA 5JQ5A 4LRMA 2RF9A 4D4VA 1FVRA 1Y91A 2IJMA 5HE0A 5ANEA 3U6HA 4X2NA 3MESA 3W10A 2OZAB 3NIEA 3OVVA 3HV4A 5HX8A 3ZS5A 2WD1A 4QP2A 4AWIA 4O7NA 3R63A 1PMVA 5L6WL 2VTOA 2RFDA 2P0CA 3W1FA 1YW2A 2R3KA 4DFZE 5JH6A 3QRTA 4DGMA 2ITYA 4R77A 4RIWB 1U4DA 2XIRA 3KK8A 3VRZA 4EC9A 4CT1A 3QX4A 1BX6A 2JDSA 3P1AA 3TNWA 4RLKA 4X21A 3F66A 3MBLA 3OW4A 4FF8A 3PZHA 5DMZA 4YPDA 2PVRA 4QP4A 5EI6A 1ZOHA 3E7VA 3VIDA 2C5XA 2HYYA 1PXNA 3ZFXA 3WILA 3O71A 3MY0A 3W2CA 3EZRA 3IPHA 3OP5A 5AUZA 4NIFA 3PWYA 3EQGA 4IAAA 4BN1A 4EZ5A 2V62A 3HMIA 4M12A 5I9VA 1XH9A 2GMXA 5TKDA 3UJGA 3O51A 3EKNA 4V0GB 4AFEA 3WBLA 4I4EA 2QHMA 5IG1A 2PWLA 2VTJA 4XV1A 3FYJX 3DZQA 2PUIA 1RQQA 4AA5A 5J9LA 2I40A 3UTOA 1ZY5A 3SX9A 2JD5A 4Q9SA 3DJ5A 3A4PA 4M0YA 1GZ8A 4FTIA 2VTAA 4IX3A 3Q4CA 5EOBA 5IUIA 4FEXA 2JDRA 3FJQE 5TR6A 2X6EA 3G9LX 4FK6A 5KUPA 1YOJA 2YZAA 4RX5A 4L52A 4DN5A 3BQRA 4YHJA 4AGWA 4C02A 5HU3A 3NUAA 5HBHA 4IB0A 5EDQA 3LFDA 3GU8A 1YI3A 3UG2A 2YIYA 4X2FA 2WMVA 3L8XA 3O17A 4YO6A 4CQEA 4ZLZA 5T68A 2WTKC 2FO0A 4KUJA 2WNTA 3BYSA 2VTLA 5BYLA 3QF9A 5HBEA 1PHKA 1MQ4A 5DNRA 4FSQA 1A9UA 2JIIA 3MY5A 4MXXA 4R3CA 5DHJA 4ANBA 5DR6A 4IDTA 2F49A 3EFJA 4EEVA 1Q99A 1W83A 2IVSA 3QTWA 4ZTMA 3B8RA 1R78A 3ERKA 3TNPC 4F9WA 5F1ZA 3MW1A 4EZ7A 3PY3A 2C5VA 4YNEA 2B9HA 4JQ8A 4JI9A 1M2PA 3H30A 1XKKA 3R7IA 3ZMMA 5LWNA 4FKWA 4CFXA 4OT6A 2YDIA 3R00A 3QBNA 4QT1A 4BDCA 5FXRA 4BCNA 2B9IA 3WF9A 3TUCA 3OXTA 1RE8A 2GTNA 3F3VA 1GY3A 3QLFA 4FKTA 3RMFA 4AA4A 1VJYA 2DS1A 3LQ3A 5EYDA 5BUJA 2JAMA 4GKIA 4IJPA 4NZWB 4YBJA 4IB5A 3W2OA 2QONA 1ZYJA 1OIRA 2E9VA 2QO7A 5HLWA 3BU5A 3Q4UA 2VZ6A 4FIIA 5AM6A 3CQWA 4M69A 3I7CA 4LM5A 1H1RA 2OIBA 2QOIA 3OUKA 1ERKA 4LGGA 2JGZA 2AC5A 3UMWA 2VUWA 5HVYA 2WOTA 2I0HA 4J71A 1DAWA 2UW6A 3UO5A 3G5DA 5IQCA 2IVTA 2JIVA 1K3AA 1JWHA 4QMPA 3AT3A 2FH9A 4X7QA 5H2UA 3O96A 4FTRA 4FIEA 2C3IB 3UIUA 3RHXA 3TM0A 4FZ7A 2RGPA 2J0MB 4ANMA 2V0DA 4BCGA 4O7VA 4Z55A 4F70A 3DAEA 1RJBA 4CG8A 3GBZA 2FA2A 1BYGA 4XHKB 5CF6A 1WBSA 1OITA 5DBXA 4K77A 3KXGA 2R3NA 4O0VA 4TWPA 3NZ0A 4AUAA 4CLJA 5JK3A 5DA3A 2BFYA 3TT0A 4CKIA 3E8EA 3HV3A 4M14A 2H9VA 4YR8A 1LP4A 3FLWA 3PXKA 5H8EA 4E93A 4TN6A 1LR4A 5EDRA 2HIWA 1TQIA 2EXMA 3FSFA 4UB7A 4ARKA 1SZMA 4EQMA 2IPXA 4DG0E 5C8NA 5E9EA 2OH0E 3VQHA 2OZOA 4MQ2A 4D2TA 4W4YA 4JJRA 3KF4A 5IEYA 2WO6A 4EI4A 5CALA 3GEQA 2J51A 1H27A 2OJFE 2DUVA 5EHLA 2HZ0A 2C68A 4FTUA 4O6LA 3R9RA 2JFMA 4KKGA 5IQFA 3DLSA 3D5UA 3L9PA 2R3LA 5IQAA 2ONLA 4BDFA 4E8AA 2R5TA 1UU7A 2O64A 4H39A 4F1TA 2GSFA 3LJ1A 4B4LA 3NUXA 4C2WA 1GNGA 4TXCA 4FV9A 4M8TA 4D0WA 3UQGA 3FLZA 3EH9A 3FSKA 3U54A 5KBQA 5LVPA 1EH4A 2QLUA 4M0ZA 5H8BA 2KULA 5K4JA 3H3CA 1KV2A 4JBOA 3R7UA 3AD4A 3OD6X 3OEZA 2WU7A 2Y8OA 4WHZA 2C30A 4YZDA 4ZLOA 2DQ7X 3EHAA 3Q9WA 3KRWA 4N4SA 3MH3A 1R39A 4O91A 2BTSA 4QMUA 4KABA 5K5NA 5I0BA 3FMLA 3AT2A 2CKOA 2BIYA 4JR3A 4NCTC 3TKHA 2UZBA 3GC8A 5CSHA 3ZUTA 4S2ZA 5F95A 1P4FA 5L2WA 4FMQA 5CQWA 1NT2A 3MFUA 4HYHA 4QP3A 4YLKA 5C03A 4MNEB 3NUNA 4QQTA 1QPCA 5HIEA 2WMRA 3CD8A 4FKOA 1YQJA 4NJ3A 5AP5A 4ZEGA 5CSVA 1XO2B 3BQCA 2H6DA 4MBLA 1YXTA 2BUJA 2YIXA 3R9HA 4NT4A 4D2SA 3REPA 4ENYA 4A4OA 3LXKA 3DY7A 4EBWA 1K2PA 2GNGA 2VAGA 3VS7A 4F0IA 2R3RA 3SHEA 3EWHA 4GV1A 4QP9A 3RPYA 4EH6A 3SV0A 2RKUA 1ZYSA 3UMXA 4LG4A 4BHNA 4F64A 4L3JA 1FVTA 3MJ2A 5EQEA 1MQBA 3O7LD 4JDHA 4MQ1A 4E4LA 3LJ2A 2C6LA 3EJ1A 1OL6A 4XRJA 4QP8A 2OK1A 3NNUA 3HDNA 3NAYA 3R04A 3E88A 3PP0A 3BCEA 4XBRA 4ANOA 4J98A 4JQEA 4M3QA 5AUWA 4F99A 4U41A 4CKJA 5HG5A 4YBKA 5B7VA 1BUHA 4UXQA 3MPTA 5LCJA 4AAAA 3QL8A 4F65A 3NPCA 2O3PA 3U9CA 4WNPA 1WBNA 3VQUA 4Y73A 5HTCA 2W1CA 1M14A 5IPJA 4R1VA 1J1BA 4J8NA 5DR2A 3NX8A 3UOHA 1J7IA 1OPLA 3V04A 3RM7A 4NL0A 4PP7A 5IU2A 4DT9A 4NU1A 3B2TA 2A2AA 5C1QB 3E93A 4MHAA 4ACDA 3D2KA 4XV3A 3JR1A 3UIMA 2WELA 4BWPA 3R8ZA 2ZOQA 4PPAA 3SAYA 4MVFA 5CLPA 5M09A 2HW7A 2VN9A 3PVWA 3UVQA 5L4QA 4DFUA 4LYNA 2CKPA 2O8YA 3E8CA 4L42A 4M13A 3RK5A 2QODA 2VWIA 4I41A 2XIKA 3UE4A 2CLXA 3GCSA 5J87A 4EWQA 1NVRA 5AP1A 3OZ6A 3TTIA 3RM6A 4CQGA 3C4FA 4FA2A 4YP8A 3P5KA 2BHHA 1RW8A 3EYHA 3FUPA 4O83A 5AR5A 3R7GA 3LKMA 2E9UA 4KINA 2XK6A 4CMTA 1CTPE 5KCVA 4Y46A 5CVHA 4P2KA 1PXIA 4HVGA 2YDKA 4QQ5A 2YLFA 3HX4A 5I3RA 3QZFA 5J5SA 1WBTA 3IW5A 2VWVA 4OBQA 3UPXA 5JT2A 5BX0A 2Y4IB 3E5AA 2QO2A 4FV8A 5K3YA 3FBVA 3CLYA 2W5BA 4F9YA 1CKPA 4IEBA 1YXUA 4EH9A 4FG8A 4BCJA 5AUYA 2WTJA 4L67A 3BHTA 2I6LA 3QKKA 1MP8A 1UWJA 4E4NA 2QKWB 1XH4A 3CBLA 4OR5A 3TXOA 3A7HA 3PA4A 3EN6A 4XCUA 4FNXA 4XG2A 3BU6A 4JBVA 1VR2A 3OXZA 3QQFA 4L3PA 1IAHA 3OBJA 2ITNA 1GAGA 4LGHA 1Q97A 3LMHA 3FMDA 2C4GA 4DTAA 4QP7A 4USEA 5KMOA 2EXCX 3V5WA 3IW7A 2YCRA 3GU5A 3BLHA 3V8SA 1PXOA 4N57A 5A4LA 2NRUA 2XJ2A 2XNMA 3E63A 3F5UA 3I1AA 1SVHA 3R7OA 2WEIA 1Q8YA 2PE0A 3EFKA 2C5NA 3OY1A 4FZFB 3OUNB 4E7WA 4PV0A 4EH3A 1O6YA 3QQLA 4AT3A 3IGOA 4DFLA 3FL5A 4ZP5A 3TZ9A 4RC2A 1O6LA 4MD7E 2HWOA 2UVYA 3ORTA 2X7FA 4L3LA 4BI1A 3ELJA 2W1ZA 4YJRA 3R1NA 2ITWA 3RINA 5I3OA 3IDPA 4GFMA 4YUQA 3A4OX 4N6ZA 4D28A 5DEWA 4I23A 4LOOA 1L3RE 3DB8A 3UO4A 4K1BA 2VO3A 3D7ZA 4KKEA 2J9MA 3PIZA 1XH5A 3A7FA 4DF3A 4YZCA 2VGPA 2WMQA 4IWDA 3OCSA 4C38A 4NKAA 2E2BA 2ITOA 3QZGA 4LI5A 4CRSA 3OTVA 1URCA 4BZOA 4WUAA 2QOQA 2ERKA 4BZDA 1QPJA 3ACJA 5CU4A 4H3BA 3FV8A 3ZEPA 5I9ZA 3ET7A 2KTYA 4UWCA 3GCUA 3Q2MA 2OJGA 4GS6A 4A4XA 3OXIA 4RWKA 5J7HA 4NCTA 4NM7A 1PXKA 3WE4A 1KE8A 2CGWA 4IIRA 4KIKA 1F0QA 3LFEA 3M42A 4GJ2A 2BMCA 5HCYA 4ZIMA 3VHEA 4CFNA 5EHOA 5CF4A 3DJ7A 3I81A 4DGGA 3VW8A 4I92A 4O81A 3A7IA 3QTQA 4RWJA 2XS0A 3DAKA 3C5IA 3DT1A 2R3JA 1JOWB 2J0IA 2B55A 4WNOA 4Y95A 4PDYA 4M7IA 1FPUA 4O21A 3HAMA 2VX1A 3PVBA 4NH1A 4EKKA 3V8TA 5EHYA 2OXYA 4FKLA 4J97A 1WAKA 3S3IA 1BMKA 5K0XA 1H1QA 2F57A 4BTKA 5CANA 2AC3A 5CSWA 4JRVA 1JKKA 1QMZA 4RT7A 3PG3A 4FV2A 5ACKA 4YNOA 3TCPA 4F1MA 1AD5A 4CZUA 2X8EA 3H9RA 1GZKA 3SRVB 4DE4A 2BAJA 4OTRA 4BBFA 3QCSA 3MFSA 4IW0A 5E7RA 5E8WA 1HOWA 2F7XE 4FUYA 2J5FA 5I9XA 5TE0A 3KCKA 4XX9A 5L2IA 4XOYA 3O8PA 5M56A 4DH5A 1P14A 3ZH8A 3LCTA 1STCE 4FSTA 4IM2A 4FC0A 3TDWA 4F9AA 4P5QA 4HVDA 1U59A 2WKMA 4WOVA 5JKGA 4BIBA 4PPCA 3AMYA 2G01A 3PG1A 4RQVA 1Q8WA 2RG6A 3CIKA 2GFSA 2ZB0A 5CX9A 3ZRMA 5CF8A 3R7YA 4DC2A 1KE7A 5A4QA 4IADA 2PVLA 3FYKX 3F5PA 3DAJA 4TKSA 4EH5A 3UIBA 4G6NA 5AAFA 4BCIA 5M4UA 2BROA 3BPRA 4JRNA 5I5ZA 2GU8A 4UWBA 3W8QA 4IAKA 4JR7A 2C0OA 1JQHA 3CPCA 5FUTA 4BKYA 2YDJA 2W5HA 2OZAA 4WNKA 5HIDA 2W1FA 2ITTA 2HCKA 2XKCA 4WG4A 2HENA 5CU3A 2E9PA 3N4TA 4QTEA 4QP1A 2ZM4A 4YC8A 4I6HA 5CZIA 4HYSA 2XK7A 2XBJA 5DRDA 3LW0A 2CLQA 3HV6A 4IZAA 1NXKA 1Z57A 2VNYA 3BGZA 4RIWA 4UYAA 4FKGA 4OTPA 3WZUA 4DFYA 5FDPA 5HU9A 1GZNA 3G0FA 4G34A 3ZOSA 4C62A 3PJ8A 4JNWA 4GUEA 4RQKA 1MRVA 1YWVA 4MTAA 4CFFA 1QPDA 4CNHA 4R3RA 5M07A 1H08A 5ETFA 4CYIA 4HPTE 1REJA 3P79A 3HP2A 4AW5A 4F6WA 4BKZA 4FEUA 3UPZA 4MK0A 4GFOA 4WUNA 2XEYA 1DS5A 4CFWA 3NYOA 2P4IA 4MF1A 2R3MA 4NFMA 4I93A 4JLCA 3DZOA 1GOLA 4EUTA 2VX3A 3LXLA 4J53A 4NWMA 5K9IA 1U54B 5F20A 3GUBA 5H3QA 4KIQA 4BDEA 3P86A 3GQLA 4FZDB 3R01A 4I20A 4KNBA 2I0EA 3LFFA 1H0VA 4E4XA 2QQ7A 4DINA 2BZIB 2ACXA 3F3TA 5DOSA 2J4ZA 4AX8A 1ZWSA 3C4EA 5AX3A 4LQMA 2QG7A 4J1RA 3F5XA 3DTWA 4RWLA 2ZYBA 2YM6A 4CV9A 3DJ6A 3V51A 4I3ZA 4U42A 4IM3A 3QD4A 3UVRA 3PXRA 1APME 2WU6A 3DBEA 5CENA 4XRLA 5HE2A 4YURA 4JG7A 3RALA 2XH5A 3ZO4A 2EWAA 2WIHA 3JY9A 4L46A 3I7BA 3E92A 5E8YA 4M84A 5BVEA 3R71A 5F4NA 4O1OA 3OWLA 4B0GA 2VRXA 1OKZA 3NYNA 4LUDA 4RSSA 1UKHA 3GQIA 3U4UA 2VWWA 3EYGA 2VU3A 4ACCA 5D9HA 1M52A 3BRBA 3GP0A 5JGAA 4D4YA 4KD1A 1E1VA 1OIUA 1ZYLA 2R3PA 5LARA 3SOCA 2Q0BA 4FKPA 1VEBA 3QQKA 2HELA 3GCQA 4BDGA 5AX9A 3H10A 3NYXA 1GIJA 4I0TA 5CTPA 5HORA 2R3GA 2IZTA 4FG7A 5J79A 5IQEA 2UW9A 3WYYA 2GNJA 3D9VA 3KN5A 3ZLXA 2Z02A 4HZRA 3QUDA 2BRNA 2VWBA 3R0TA 4FOCA 4IBMA 3UDBA 5KMMA 5J1VA 4R7HA 3SOAA 1WZYA 3MIAA 2QD9A 4MH7A 4BCPA 2H34A 2X8IA 3DKOA 3R8UA 2XJ0A 5KMIA 3PRIA 3G33A 4JQ7A 2PPQA 3COHA 1OI9A 4PF4A 1W82A 3LIJA 1J3HA 4IAYA 5GZAA 3QTIA 5TOZA 1TQMA 2WXVA 5HNGA 3CD3A 3DK3A 4JIAA 4R7IA 3HA6A 4RVKA 5E8VA 4BCHA 3LHJA 5CQUA 3QHWA 2PYWA 3UP2A 4EK4A 4JBPA 3GU6A 4DHFA 3ORXA 5M55A 2Q0NA 4FG9A 3QRUA 4MKCA 3POOA 4HCTA 5HICA 2Y0AA 1OUYA 3EQPA 3I0QA 4Y85A 2XRWA 3ITZA 4MWHA 5A4CA 4ZY4A 4H1JA 2WTCA 3A8XA 4ZY6A 1WVWA 5EM5A 2XIXA 4UMQA 1JSUA 4M15A 4S33A 5J7BA 2DWBA 3S95A 3ALOA 2CHLA 3MH2A 5AUUA 1ATPE 4NK9A 5AR8A 5FBNC 5BVOA 5FTQA 2OWBA 4F0FA 4DITA 4Q5EA 4ZLYA 4DLJA 4KSPA 3THBA 3TEIA 4UMRA 3DDPA 2ITQA 4Z3VA 4FL2A 2ONLC 3ROYA 3NMUF 2CCHA 2VTNA 4GMYA 4KB8A 4E73A 4F9BA 3HLLA 1G5SA 4IB1A 4CLIA 3OY3A 5CSPA 4ZK5A 2JIUA 3EFWA 3RPVA 5L8JA 1CSNA 4S31A 4OTQA 5AIRA 2GCDA 2W06A 4J7BA 5AAGA 4Y5HA 3RTPA 2ERZE 3MB6A 3QFVA 3QXPA 4XG9A 4ZJJA 3DS6A 5HNBA 2W4OA 4OTIA 3C0IA 5CU6A 3FLYA 5B2KA 5DR9A 4Z9LA 3BYOA 1X8BA 5CNNA 4IZ5A 1S9JA 3R1YA 2W1HA 1H8FA 2PMLX 2WMWA 5B0XA 4J8MA 3L9NA 4JIKA 4B99A 1ZZLA 2YITA 2QNJA 3EQIA 1JAMA 2XNGA 3EZVA 4UMTA 2J90A 4P90A 5HTBA 5BVNA 3HMNA 2C47A 3A8WA 1Y8YA 4FICA 4L01A 4XUFA 2XNNA 2OLCA 5AP2A 3F88A 3DGKA 4AXAA 4PMTA 3ATSA 4AP7A 2VTMA 3F5GA 3VUMA 2OGVA 3RK7A 2VNWA 4MBIA 3N4VA 5ANIA 4ASEA 1ZMUA 4FSNA 2OXXA 3CTQA 4YJQA 1JKSA 4KWPA 4CSVA 2Q83A 3AD5A 3Q4TA 4PDOA 2IVVA 3OT8A 4V04A 4AN9A 5CEQA 3UZPA 4FSUA 4QMTA 3DFCB 4U44A 4O22A 3VNTA 4GVAA 3UZRA 4II5A 1U5QA 4MNEA 2PZPA 4CCBA 5AV3A 4BICA 4FOBA 3SC1A 4W9WA 5DVRA 3MV5A 3PIYA 2OSCA 2WQOA 4RX7A 1Q61A 2HK5A 3QWJA 4M67A 3F7WA 2X8DA 3MN3A 1E9HA 4AG8A 3HNGA 4MF0A 3FMNA 4APPA 5HO7A 3UP7A 4YJPA 4BIEA 4IZ7A 3NAXA 4YLJA 4AE9A 2WMAA 1WBOA 3KN6A 1GIIA 4A7CA 3FEGA 5LJJA 2GS7A 3BHHA 4NM0A 4C8BA 4DFBA 1AGWA 1PY5A 5BVKA 2BKZA 3FXXA 5IMXA 4FIFA 5TO8A 3ZO2A 2GHMA 3PPJA 3QQGA 2BRHA 4XV9A 3D5XA 3FZ1A 5CS6A 4ZSLA 4ACHA 4H3QA 3ZUUA 2OF2A 2BR1A 4LGDA 3ZC5A 5FTGA 2P33A 2R2PA 1YOMA 1W0XC 5GIOE 2UZWE 3EOCA 2QOFA 3VUKA 4D55A 5HX6A 4GFGA 4GYGA 2YFXA 3R73A 3VBQA 2G9XA 3KC3A 4N70A 2XA4A 2JBPA 4LV8A 4FV4A 4GG5A 4XG8A 4HVHA 4PPBA 3WOWA 5IH5A 3I0OA 5FM3A 2VX0A 2UW8A 2GNIA 5CT7A 2NO3A 3PA3A 5KZIA 4D5HA 2W17A 4FEVA 1YKRA 3EQRA 3WF5A 5KZ0A 3ORMA 3SW4A 4OAUC 5JFXA 3BGQA
chains in the Genus database with same CATH superfamily
4JT3A 4TWNA 5AWMA 4QP6A 3VRYA 1G3NA 2J6MA 2XALA 3KQ7A 2XBAA 5LQFA 4TY1A 2BFXA 3VULA 4R3PA 3VONA 1Y6AA 3FQHA 4AOJA 2BTRA 5T3QA 2WB8A 3V01A 1OZ1A 4HCUA 5AP3A 3DNEA 4BGQA 5BUIA 3VBWA 4TYJA 3IW4A 5HGIA 1OL7A 3F61A 1I09A 4XG6A 4L00A 2XNOA 1LEWA 4HOKA 3CS9A 4TYHB 3R9OA 3TV6A 1LPUA 1XBCA 5DWRA 3NVKI 4PQNA 3BE9A 5E8XA 1P5EA 3UIXA 2B54A 3H4JA 2FUMA 4G16A 4GK4A 4JG8A 4FV1A 5DE2A 4L68A 1XR1A 4XBUA 3O8UA 3HRFA 2BILB 3C4XA 4ASXA 4A9YA 2E9OA 2BCJA 3M2WA 3KXMA 5GHVA 2REIA 4JDKA 4XG7A 3B2WA 5D7VA 4F7SA 1KSWA 2A27A 4BTJA 4G5PA 2UZEA 4MD8E 2YAKA 4YC3A 5EG3A 3QXOA 2X7OA 3R7VA 2GQRA 4I0RA 4XP2A 5J5TA 4FV3A 5M51A 4BHZA 2OICA 5CEIA 4EOMA 3AT4A 4O27B 4A4LA 3WZDA 5C4LA 4H1MA 4E1ZA 3ATTA 3MYGA 4R6VA 4G1WA 3CKXA 3MS9A 1R0EA 3QALE 3UNKA 1OPKA 1BKXA 3DA6A 4AQKA 4YJOA 3RJCA 2XYUA 3DKFA 5E8TA 3VS3A 4A06A 2UZOA 3TUDA 3KREA 1ZXEA 2W5AA 4IC8A 3ALNA 4JAJA 4JX3A 3ZHPC 3PA5A 5E8SA 2OFUA 2ITPA 5HE1A 4BDAA 5HG8A 2ZM3A 4BI2A 4RJ5A 2QI8A 4IHPA 3P78A 5AEPA 5B2MA 3HRCA 2C6EA 5L2SA 3FQEA 2VTRA 4EOPA 4I5HA 4BCQA 5EQPA 2IZUA 3TV7A 2XK4A 1PKGA 4UN0C 3RP9A 4GU9A 2F7ZE 4P7EA 4PL3A 3A7JA 3UYSA 4NEUA 5KHXA 3QCXA 3BLRA 3NR9A 3GFWA 2W05A 4MCVA 3OWJA 3R22A 4ZMEA 2Z8CA 3MH1A 5T6KA 4BTMA 2OO8X 2XP2A 4ASZA 2XAMA 5BYYA 5ANGA 5C01A 2JAVA 3KA0A 4XMOA 2QR7A 2VWZA 1ZRZA 1Q4LA 3F9NA 3OWPA 3V6SA 4O86A 3TNHA 2WGJA 3OC1A 1SNXA 3ZLYA 2X1NA 2JFLA 3AC4A 4K0YA 2A1AB 2QCSA 4Y8DA 2Z60A 4KIPA 3OWKA 4O7LA 4D9TA 4IVCA 2O5KA 4K9YA 5E1SA 3F2AA 4NW5A 1DI8A 3DXNA 3PE1A 1OKYA 4V05A 4NM5A 4BBEA 4PTEA 5TT7A 4XS2A 2XZSA 4TNDA 5CEPA 5IF1A 3SDJA 3U4WA 2WAJA 4ZZMA 3IKAA 1G8SA 3QWKA 4ZSJA 4X2JA 1W2FA 4PP9A 1KOBA 3KMWA 3G51A 4FZAB 2VTTA 3KK9A 4I1ZA 1YWRA 4E6CA 4FTTA 4EWHA 5IQBA 4FKVA 3R8VA 4AGDA 5D11A 3BYUA 4WG5A 4CG9A 5JZNA 4DLIA 3CGOA 3P08A 5IEVA 5DG5A 4RVLA 3MVHA 2PUNA 3CJGA 4G3EA 3UNZA 1Q3WA 3FLSA 5AV1A 3U6IA 4C7TA 2CDZA 3U8WA 3VW6A 3ORPA 4M97A 2OXDA 1UKIA 2WTVA 3ZRLA 2YLEA 4F6SA 5AP6A 1H00A 5HQ0A 2W1GA 3B8QA 4FL3A 2G2FA 4RFZA 3N9XA 3NUPA 4ASDA 2G2HA 4OLIA 2WQEA 4YZBA 1BI7A 1FBNA 1MUOA 2X0PA 4XJ0A 5I9YA 5IUHA 3BV2A 1W7HA 3POZA 2XNPA 1FQ1B 4JBQA 2OBJA 3MPMA 5CYIA 3IOPA 4AZWA 2YACA 2IZSA 1PXLA 2CGUA 2UW4A 3WIGA 4R5YA 3T8OA 3ID6C 3JVSA 2WPAA 4IFGA 4QYYA 5BUEA 3U51A 1IAJA 4RIXA 3H0YA 2YA9A 3QA8A 5GJFA 3UYTA 4X2GA 3SRVA 2C5YA 5KKRB 2GS2A 1JKLA 2ZM1A 4G6LA 4W4WA 4PMMA 2IW9A 4BGGA 4PMPA 4CV8A 4BR3A 3A99A 3JYAA 4I6QA 3KKVA 4FYOA 1B38A 1YRPA 3R1SA 5AMNA 4CTBA 2Z7SA 4ALUA 3QTUA 4PL5A 5CXZA 3MWUA 5LVNA 3DB6A 1CMKE 5LMBA 2XAOA 4O7WA 3E3PA 4MBJA 4NM3A 5IISA 3GENA 3M1SA 2JKKA 2QOOA 3CPBA 2ZV8A 2OU7A 5BNJA 4I94A 4KRDA 3RBWA 3ETAA 5F9EA 3TDVA 5JRSA 4FV0A 2FSLX 3QC9A 3F2RA 4KBKA 4EQUA 4EQCA 5A46A 4DTBA 3ZSIA 4JVGA 4O7TA 1NVSA 3R8MA 5L8KA 5M08A 3AGMA 3CP9A 4ZS4A 2UZDA 3MPAA 1Q3DA 2ITZA 2QU5A 3ORIA 5E91A 2VTSA 5D7AA 2Y7JA 4EL9A 4O0WA 3EQDA 5DN3A 3D2IA 3F69A 2V22A 4BDKA 2YWVA 2XB7A 2BALA 3P9JA 2HZIA 2PULA 2CGXA 4FVPA 4YJNA 4PTCA 3QAME 4E6AA 2X39A 2AUHA 2UZTA 3JVRA 4F09A 3PSBA 1YVJA 2ITXA 4GK3A 4QMMA 4EJ7A 2YCQA 2B0QA 4KBAA 1CDKA 4DCAA 3EN5A 3NNWA 1PKDA 3OEFX 2PSQA 1JPAA 4G3DA 2IW6A 3BZ3A 3HZTA 1ZARA 3FZPA 3P4KA 5D1JA 4BFMA 4RC3A 4EONA 4EOLA 2QOKA 3RCJA 1XMLA 5LMAA 1WBPA 1ZOGA 4FKIA 1OBDA 4L43A 4APCA 1J7LA 4JAIA 3C4WA 4IM0A 4YZMA 3SXSA 1Q8ZA 4FTQA 4GVJA 4DCEA 3MTLA 3UOJA 3FXWA 1U54A 2XYNA 3TZMA 2RFEA 5CAPA 4RBLA 4RIOA 3RZBA 4BF2A 2PTKA 1UV5A 4BYIA 2B9JA 4H36A 4G9RA 2UZNA 3TV4A 5BQ0A 2PZIA 2VWYA 2GHGA 4GIIA 4L9IA 5LVOA 5AV4A 2J0LA 3VUIA 4AU8A 2UVZA 4KS8A 4AXCA 1YXXA 5IQGA 1AQ1A 3KULB 2W9FB 4RVMA 4BY9E 1Y57A 2JEDA 4XLIA 5L2TA 1XWSA 4KBCA 3S2PA 4ALWA 2CJMA 4JOAA 4W4VA 3F3WA 5C26A 4E26A 4I6LA 5ANDA 4NTTA 3WYXA 4BWXA 4KS7A 2WEVA 3HUCA 3DBCA 3MFRA 1OBGA 1O6KA 4WKQA 2R4BA 2JC6A 2PK9A 3A61A 3W2RA 4AFJA 2RL5A 3VWAA 2PE2A 3CQUA 4FKQA 4A07A 4ANLA 5KNJA 1WCCA 3CQEA 3GCPA 4QYGA 2SRCA 3FKNA 3K2LA 2PVYA 3RCDA 4PNIA 3CE3A 5J8IA 2YJRA 4QOXA 1H28A 3TNQB 4RA5A 4DGLC 1JBPE 3EFLA 4BBMA 4PDSA 3EL8A 3WF6A 4WBBB 1FGIA 4QTDA 5HO8A 3RWQA 3HMPA 4MXOA 3GU4A 4L6QA 4ZTNA 5LMKA 3H9FA 2B9FA 2OFVA 4JX7A 1TQPA 4DTKA 4WO5A 3C13A 2CSNA 3H9OA 4O0YA 4WNMA 2ETMA 4XG3A 4NYEA 2OJIA 3NW5A 5HZNA 4OT5A 3QD2B 2W4KA 2YM4A 4FBXA 4AXEA 3L8VA 3Q3BA 3PY1A 4RJ7A 4MXYA 3VBVA 4LV5A 4A9SA 4NJDA 3FI2A 1UU9A 3QRIA 3PTGA 1UNLA 4D1SA 1J91A 2C0TA 1T45A 5JRQA 3G2FA 3JUHA 4HZSA 3KRRA 4E3CA 2I0YA 4GT3A 4J99A 5AP7A 4A9TA 4ACMA 1PYEA 4D2PA 4TWCA 3ZSGA 4XV2A 4N0SA 4IE9A 2X2MA 3MFTA 3TJDA 4AT4A 3SGCA 2R3QA 1Q41A 3IW6A 3NS9A 4O0TA 1BI8A 3QKMA 3R21A 4G5JA 3QRKA 3C51A 3ORLA 3QTRA 1W98A 2PZYA 1DAYA 1CKIA 4IVAA 4FNZA 5E92A 2XMYA 5CVGA 4EH7A 2UUEA 3GOPA 4C59A 3MA6A 4FODA 5JFVA 5AV0A 4QDVA 3HAVA 4H3PA 4L7SA 4A9RA 3PJ3A 2IG7A 4ZS0A 2R3HA 5GZ9A 4AW2A 4FTKA 4K8AA 4OTHA 5KE0A 3PVUA 3FXZA 3O8TA 4RIXB 3ORNA 2XK3A 2X0GA 2Y6OA 4CZTA 4MX9A 4EOSA 2XKEA 5CEKA 5CEMA 5AM7A 4EC8A 3KRXA 3A62A 4HPUE 5FGKA 3F82A 4UZHA 4B6LA 4DFXE 4E6QA 1XQZA 3ULZA 5BMSA 4UV0A 3JY0A 4IZYA 2XCHA 5CZHA 3ZONA 4EYMA 1GIHA 1JSVA 4E5WA 3VHKA 4ANQA 3ANRA 5M4IA 2OF4A 4M66A 2LAVA 3LAUA 5IKWA 4B7TA 4RRVA 3CY2A 4IQ6A 2RFSA 3ZU7A 3KIOC 3CGFA 4EK5A 5AUTA 3BEAA 3NIZA 1SVEA 3ZLWA 5AR4A 3VBYA 1IA9A 4AXDA 1OIYA 1M2RA 1FINA 3ZFMA 4LOQA 3FPMA 3D7TB 3ANQA 4TRLA 3Q9YA 4RJ3A 2C6IA 3TG1A 5IDPA 3F3UA 3R2YA 3ZUVA 1OKWA 3IG7A 1PMNA 1OVEA 1UNGA 4I21A 3ZFYA 1KOAA 4QYHA 5HHWA 3R8PA 2HZ4A 5M53A 1XH6A 4FX3A 4BCFA 3RAWA 5IA0A 3UQFA 2PUPA 1H4LA 2BHEA 4AQCA 5L3AA 3GFEA 3R9NA 5L6PA 4CVAA 2VO0A 2FGIA 3FLNC 5KHWA 2R7BA 4X2KA 4EHEA 5HD7A 2YIWA 4BB4A 3EQHA 2J0KA 3D4QA 1A48A 1IR3A 2J5EA 3CJFA 4BDHA 4C37A 2C1AA 2QKRA 4IFCA 1NA7A 5ETIA 5FEEA 3W16A 1YDRE 5BYZA 5DH3A 2C6MA 3WARA 4FL1A 2W7XA 1DI9A 2WQNA 4J96A 3COKA 3NNVA 4XG4A 1PXJA 5LVMA 5J1WA 3F7ZA 4ZJVA 3MI9A 5CXHA 1PF8A 3P7BA 4U5JA 2C3JA 3WI6A 4GT5A 5LVLA 4D9UA 3QCYA 1JSTA 5C8KA 3HYHA 3ZDUA 2BPMA 4RG0A 1QCFA 2CN5A 3LM0A 2GNFA 4U40A 5E8ZA 3UC3A 3IQ7A 3UOLA 2X81A 2BIKB 3ZZEA 4R1YA 4HGTA 4YTHA 4Z7HA 5H8GA 1YOLA 3SXRA 5HCZA 2PE1A 4C35A 5E90A 2W9ZB 5KBRA 3VS0A 4Z16A 2X7GA 1YDSE 3HP5A 4YSMA 3PJ2A 2BDFA 4GK2A 3OW3A 4HCVA 3UODA 4CFUA 1SYKA 3W0QA 4CGAA 4DA5A 3BL9A 2E9NA 3TZ8A 3ZO1A 4CYJA 4D5KA 2CNVA 5AR7A 3FMEA 3G90X 3LFBA 5G1XA 3TZ7A 5KMJA 3VBTA 3SG8A 5FDXA 4MXZA 1V0PA 4ZMFA 4FSYA 4TL0A 5JN2A 3MY1A 4FT3A 4ALVA 3FY2A 2IW8A 3S4QA 3LXPA 3V5PA 3HECA 3OMVA 5ETCA 3KGAA 3NCZA 4RX9A 4HVIA 1ZMVA 4J95A 4RA4A 3ZZWA 4EZ3A 5HVKA 2R9SA 4WBOA 4EOQA 2NPQA 5CEOA 4HJOA 2UZLA 2HZNA 1REKA 2GS6A 2QHNA 3DCVA 3KB7A 3WE8A 2YISA 3CR0A 4KSQA 4Q5HA 2ZAZA 2QO9A 3LLTA 3GC9A 3W33A 3MSSA 4AGUA 5F94A 5IUGA 2WQBA 1H01A 3GCVA 4QTCA 3CCNA 3NGAA 3LLAA 4EOIA 3PVGA 4U97A 3RPSA 3G6HA 4ZTHA 3I79A 3C5UA 3O7LB 3DLZA 3QQHA 4DG2E 4JDIA 1IG1A 5FRIA 3A7GA 5A4TA 1G8KA 2CNUA 4QMQA 3EQFA 1KWPA 2BRGA 3ZSHA 3V8WA 3ML1A 1KE9A 3KXZA 5D10A 4DEHA 5DGZA 2B52A 2G15A 2YERA 4ZTQA 4CFMA 2PHKA 4ENXA 4YTCA 5EW3A 1PMEA 5AA8A 4EOKA 4QMZA 4BKJA 4Q9ZA 4JXFA 4ITIA 2Y4IC 3GC7A 4TYHA 4ZSGA 4FT7A 2G1TA 1XH7A 3FZTA 2G2IA 5AAEA 4MWIA 1JVPP 4TYEA 3VAPA 2Y4PA 3KRLA 5FEDA 1P2AA 4QNYA 4FV7A 3OS3A 3EN4A 4FTAA 3QUPA 4B9DA 3KMUA 4KA3A 3PYYA 5GNKA 4R5SA 4E4MA 5HG7A 5FM2A 1BL6A 2HXLA 4FT5A 3VS6A 4IAIA 3K3IA 3R2BA 2JKOA 1VYWA 5HLPA 4PNKA 5M4FA 2R3OA 2YAAA 1L8TA 4GRBA 3QZHA 3VJOA 3D0EA 3BU3A 4C57A 3COIA 3Q2JA 1JLUE 4TYGA 3QZIA 3GI3A 5IA3A 4BCOA 3W0SA 4O7YA 1H26A 1NY3A 2UZVA 4I0SA 2AYPA 2F4JA 4F7JA 2CCIA 5EYMA 1ND4A 4H05A 3NUSA 3IGGA 4K11A 3QTXA 4BRXA 2XRUA 4QRCA 1JKTA 2EB3A 3HDMA 3EIDA 3HV7A 4G17A 3VS4A 3AD6A 1R3CA 2OKRA 4C58A 4WRSA 5G6VA 4IX6A 3VN9A 5GIPE 4AZVA 3SKCA 3SQQA 3R30A 2IWIA 5IA2A 2QC6A 3AC2A 3VUHA 1BLXA 2YM7A 1LEZA 4RIYB 4UYNA 2ETRA 2X6DA 2ZV9A 3BBWA 3PZEA 4FYNA 4PTGA 5HG9A 5TF9A 2YM8A 1J7UA 2ZFYA 1Q8UA 3W0OA 2QR8A 2ESMA 3RPRA 2CN8A 4DGNA 1ZAOA 5IH4A 3GVUA 2AEGA 2WMUA 3BV3A 2QU6A 4YZNA 2WTWA 4RPVA 3ZRKA 5BVDA 4O82A 1H07A 4O1PA 3O0GA 3GB2A 4NSTA 2P55A 1SM2A 5DT3A 1BL7A 3F2NA 1NVQA 3VUTA 4O7SA 2WMTA 2VWUA 3PP1A 3UZTA 1ZY4A 1SNUA 1WVXA 3C9WA 3L1SA 5CNOA 3FHRA 4C61A 3PFYA 4AZFA 4RGJA 3S1HA 3GC0A 2I1MA 3E8NA 5AA9A 2OH4A 5D12A 2PMIA 3H0ZA 5ITAA 3DDQA 3NEWA 4QDEA 3DK7A 5CT0A 5EK7A 4AN3A 2PVNA 4OW8A 1UVRA 2J50A 4USDA 3FQSA 5L8LA 2Z7RA 1DM2A 3KXXA 1TFFA 4FV5A 2YWPA 4BDJA 5I9WA 4O4EA 3L9MA 3LFAA 2UW3A 4X3FB 4D2RA 1O9UA 2X4ZA 3DQWA 4D4RA 3V5TA 2HWPA 3FMHA 2GNLA 1OL5A 2B53A 1J1CA 3OG7A 4IVDA 3TN8A 4DH3A 2IO6A 2X2KA 4BCKA 5CF5A 4ZTRA 3TUBA 5EKOA 4CZYB 4LV7A 3VS2A 4YJUA 4FIJA 5CWZA 4XOZA 5HNIX 4AGCA 2PVKA 3TYKA 3LOKA 2PUUA 2ZJWA 4I5CA 3MDYA 2PVFA 3ZEWA 4C3PA 3P7CA 3BWFA 3P7AA 3TNIA 3NWWA 5JFWA 3SW7A 2O2UA 1R1WA 1M7NA 4OTDA 2VWXA 2X0QA 3AOXA 3IW8A 3LFQA 4FTLA 5AP4A 2R64A 5HESA 4RVTA 4ONAA 4QNAA 2QG5A 3BL7A 4U0IA 3FI8A 4D2VA 4GYIA 4BVUA 2V7OA 4QO9A 2W1IA 2QOBA 5CI7A 4D1ZA 3ORZA 1PYXA 4QPAA 4ZAUA 3KVWA 4F1OA 3C50A 4IXPA 4DT8A 2OW3A 3NW7A 4EBVA 3GOKA 3OF0A 3EN7A 4O0XA 4U8ZA 3IK3A 1PMUA 4NKSA 5ANJA 3R83A 4GT4A 2XKDA 3Q9ZA 4AN2A 4S30A 4BWKA 4WIHA 4I6FA 1VYZA 4G3CA 5FWKK 4Z7GA 2YM3A 2PZ5A 2ZMDA 3Q4ZA 4K33A 3SLSA 2C5OA 3Q5IA 2C3LA 3DKGA 4HNIA 3PLAE 4RZWA 5I9UA 3NNXA 3BI6A 3SXFA 4C3FA 4EH2A 3I4BA 3HRBA 4I22A 3AKJA 1ZYCA 2P2IA 4IJ9A 4ACGA 3ENHA 4YSJA 5LCKA 4FTJA 4K6ZA 3EN9A 5IMEA 2WTDA 3BGPA 4QMXA 1B39A 3UOKA 2ZDTA 4YHFA 4C36A 3BE2A 4BZNA 4B8LA 5BMMA 3TKIA 5DLSA 3PPKA 5IQHA 2CGVA 2HW6A 3DPKA 3D83A 2W1EA 3C4ZA 2FVDA 3I6WA 4U3YA 5JMSA 4FK3A 3R8LA 1TVOA 4C4GA 4U79A 3ULIA 4CRLA 4BI0A 4IWPA 4EHZA 2CKQA 2PY3A 3FE3A 2ETKA 4TPTA 2CMWA 5DFPA 3BLAA 4FR4A 5CVFA 5HIBA 2CKEA 4ITHA 4DEAA 3I60A 1UA2A 3TI1A 3DXQA 4R78A 1CM8A 2YIQA 1YHWA 3ACKA 3NW6A 4Y72A 1WMKA 4RFMA 3ZO3A 4X0MA 5DIAA 4ZTLA 4PMSA 1YXVA 3W8LA 4RLLA 2Z7LA 4OBOA 4YMJA 2BRMA 3QYZA 1Y8GA 1S9IA 4O4BB 4OAVB 4NW6A 2BKKA 1OGUA 2ITVA 1KE6A 3IOKA 4N6YA 4F7NA 4O0RA 3Q60A 4MXAA 4AOTA 4MD9E 2XNBA 4U43A 4AT5A 3Q32A 3LXNA 3JXWA 1F3MC 3CKWA 3HL7A 5C27A 4CMUA 3L8PA 3O50A 4W9XA 3RZFA 4AA0A 3AG9A 5HTIA 2JDVA 4BL1A 3KCFA 3C0HA 1UU8A 4YGAA 5J9YA 3KL8A 3KVXA 4ANSA 4O7RA 5EM6A 3WZJA 4E20A 5CU0A 3FZRA 2UZUE 3PDTA 3OTUA 5E8UA 2W4JA 3PXQA 2YHVA 3VF9A 3NCGA 3T3UA 4O7ZA 2EB2A 3CTJA 4WT6A 4FNYA 3U9NA 3F6XA 4QMVA 3W2PA 2VGOA 1GJOA 3QA0A 3PJCA 4GUBA 4QTAA 4UX9A 2OI4X 3V5QA 4G3FA 2VTQA 3IDBA 4D4SA 3KULA 3W55A 1IA8A 5CAOA 3O5AA 2RSVA 5HLNA 3R7EA 4DH7A 3PXZA 1PJKA 4FKSA 1M2QA 1IEPA 4FSMA 2NP8A 5LMKC 4I6BA 3EKKA 4QPSA 3AKKA 1Q24A 4QTBA 2WIPA 2ZB1A 3N51A 5JZJA 2V5QA 4WSYA 3FWQA 4IH8A 4WRGA 3G9NA 2EUFB 2C6OA 4MYGA 3TTJA 4ERKA 2Y9QA 4LFIA 2F9GA 2P2HA 3BWJA 3D5VA 2BRBA 3LFCA 3PE2A 1VZOA 3IONA 5FD2A 4C4HA 4ZTSA 1ZMWA 4JDJA 3UC4A 1XBAA 4DEBA 1FMOE 5CI6A 3BLQA 5FXSA 1XHAA 5AJQA 4DEDA 5JGBA 4J52A 4YJTA 3QRJA 2RFNA 4QMOA 4KIOA 4YHTA 4EK6A 4GSBA 3HV5A 4U3ZA 3D94A 4TW9A 2WHBA 2UW7A 3C7QA 3LCDA 4UALA 2JITA 4IANA 1SVGA 4S34A 4AW1A 2HOGA 2QOCA 1UNHA 4P4CA 3EQCA 2B4SB 4EK8A 3BBTB 4ZZNA 4GJ3A 5CSXA 4F63A 3LCSA 4I5MA 2JLDA 2CNQA 3KY2A 2OJ9A 5EH0A 4AACA 4HVSA 3LM5A 4NIFB 5EW8A 3T9IA 5IQIA 1OM1A 3BELA 4FT9A 5H9BA 3F3ZA 2BZJA 2WZJA 3MVJA 3S0OA 3EQBA 1YXSA 3W18A 2JDOA 3FPQA 5CU2A 4DFNA 4LUEA 3QKLA 1OB3A 4FSWA 2YN8A 1LUFA 5FP6A 4DEGA 3PJ1A 4ZY5A 3L8SA 2R7IA 3OHTA 4X3JA 4ZSAA 2J0JA 3PWDA 4LMUA 4RX8A 2UW0A 4D0XA 2IZRA 2JDTA 2R3IA 2AQXA 5A4EA 3QD0A 3E64A 4YLLA 5EM8A 3FHIA 4FEWA 3FI3A 5GJDA 2VTHA 3TACA 2VV9A 3AMAA 3HEGA 2B1PA 4R7BA 3QHRA 3AC5A 2XVDA 3ZCLA 4M68A 3UGCA 4OUCA 3V5JA 5J9ZA 3PRFA 3BYVA 4C4IA 3R1QA 4LRJA 4YJVA 3RNIA 3UVPA 2Y6MA 4OTGA 4JL9A 3R28A 3FC2A 4W8EA 4JMQA 3QD3A 4IWQA 2PVHA 4R8QA 5D41A 5JGDA 3SVVA 3HVCA 2EXEA 2W96B 3PSDA 4F6UA 3LCKA 4FTMA 5EI8A 4P5ZA 3OCBA 4XNEA 3UBDA 2WOUA 3DXPA 2GNHA 3QX2A 1WBVA 5IQDA 3BHYA 3FY0A 4AW0A 5DYJA 3C4CA 4CEGA 4D1XA 2UW5A 3BX5A 4G3GA 2YCFA 1A06A 5CAQA 3W2QA 4W8DA 2JKMA 4U81A 4USFA 2W99B 4UEUA 2PVJA 2HXQA 2VD5A 3RK9A 4FEQA 3UNJA 2W0JA 3AMBA 3VVHA 5IA4A 3UO6A 2XK9A 4HGEA 3S00A 4IX4A 3HMMA 3OOGA 4TYIA 4EYJA 2QVSE 1V1KA 1NW1A 3D7TA 2QURA 3Q6UA 4QMLA 5FXQA 2YCSA 4FIGA 1ZOEA 2Z2WA 5KO1A 3KF7A 4K2RA 2XK8A 4ZJIA 5IZFA 4X3FC 3CC6A 3DNDA 1YHSA 1OIQA 3AC8A 3I5NA 1Q5KA 3D5WA 2XEZA 4GIHA 4UXLA 3OBGA 4GH2A 4KAOA 3K5UA 4M69B 4IAZA 4QYEA 3BHUA 2YEXA 3RPOA 3ROCA 2O65A 3LVPA 1F5QA 1B6CB 5HOAA 3N4UA 5FQDC 2V7AA 3FMMA 3OOMA 3DKCA 5FEQA 4PY1A 1E1XA 4IX5A 4OTWA 4PRJA 3VF8A 5GINE 3KEXA 2F7EE 3Q96A 1HCLA 3T9TA 2RG5A 2FYSA 3RAHA 3NDMA 4QPMA 4EHGA 1Q62A 4O38A 2B7AA 4RJ4A 3LZBA 1PRYA 4PWNA 4UY9A 3LMIA 3ZBFA 3ZC6A 2WQMA 4HGLA 3Q6WA 5FG8A 2FSTX 5EM7A 5IEXA 4QEBA 3LFSA 4XYFA 4ORKA 5EOLA 5KMKA 2X9EA 3HA8A 4BDBA 2R0UA 4WG3A 3ENMA 5KMNA 2HAKA 4PL4A 2XM8A 4FVRA 1IRKA 4DH1A 1FOTA 3TWJA 3K54A 4AZEA 3T3VA 2HY0A 3BYMA 3DOGA 4O4FA 5FLFA 4IDVA 3E8DA 3FC1X 3CXWA 4BDIA 2PU8A 4LOPA 3NVMB 5IH6A 4O6EA 3MVMA 3LQ8A 3JPVA 4IWOA 4LL5A 4OBPA 1VLRA 3QQUA 4U6RA 5HVJA 3PFQA 4GKHA 4BGHA 4DGOA 3O2MA 5HE3A 1H1WA 2BZKB 4PX6A 4RJ6A 4U80A 5GJGA 5B2LA 1WFCA 5CASA 4AS0A 4OGRA 2XM9A 2I7QA 2H8HA 4E5AX 1KV1A 4LMNA 4UZDA 4F9CA 2GHLA 2C3KA 4FTNA 3VO3A 4C34A 1QPEA 5E1EA 4GW8A 4ANNA 5HD4A 4DDGA 3LCOA 5ACBC 4QD6A 5ETAA 4QQCA 4DBNA 4EH8A 4U7ZA 3U87A 4IACA 3VS5A 1H1SA 3KFAA 3OFMA 5AUVA 4RJ8A 4RZVA 5EFQA 2H96A 2PZRA 4C3RA 3DQXA 2X4FA 4UWYA 3BHVA 3O23A 3A60A 3V5LA 4ZZOA 3LJ0A 3MH0A 1YWNA 1M7QA 2GQSA 1XBBA 4WSQA 4DG3E 5AFVA 3BKBA 4U9AA 4EKLA 4FE2A 3P23A 2XIZA 4AOIA 3AGLA 2CPKE 3E62A 4NUSA 4O2PA 4ID7A 3RVGA 4BDDA 4EOJA 5EQYA 2FSMX 1UWHA 5C8MA 4G2FA 4TNBA 4YTIA 3LFNA 3ZXTA 3PUPA 5A14A 1W2DA 2C1BA 3R6XA 2O63A 1YHVA 1OPJA 1MRUA 1OL2A 4Y5QA 5BV3A 4F08A 4I5PA 3W32A 3KMMA 3MIYA 3K3JA 4OTFA 5CY3A 5DT0A 5L6OA 4DEEA 2BZHB 3ZDIA 3EB0A 3C0GA 5ICPA 5AADA 3JS2A 4MEDA 3IS5A 3VC4A 4L8MA 3FKLA 4Q2AA 3C1XA 1YI6A 4WA9A 3Q53A 1TKIA 2UV2A 3QLGA 5EKNA 5A6OA 1XJDA 4L7FA 2QOHA 2PMOX 3QUEA 1ZZ2A 3R02A 4LL0A 5EDPA 3KU2A 4C33A 3G15A 3RAIA 3WF8A 2Z7QA 5EW9A