3CPBA

Crystal structure of the vegfr2 kinase domain in complex with a bisamide inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
310
structure length
285
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of Aryl Aminoquinazoline Pyridones as Potent, Selective, and Orally Efficacious Inhibitors of Receptor Tyrosine Kinase c-Kit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 285
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cpbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cpbA01
3S0OA 5AUVA 4D2RA 4AUAA 4F09A 4HVSA 1XH5A 2BDJA 4WSQA 5ANIA 4D2TA 3NVMB 2BDWA 4PL4A 4ANLA 4FSNA 4QMZA 5FXSA 3W8LA 4H3PA 4ZXTA 3R8MA 2B1PA 3QLFA 4EQUA 3IGOA 4D4RA 4KIKA 4AOIA 4O6EA 3ZU7A 4C2WA 5DWRA 2JC6A 3LCTA 4BI0A 3BV3A 3FYKX 4PWNA 4FBXA 4EKKA 5ACBC 2QOBA 2PVFA 4IB3A 4MWIA 4XRJA 1XO2B 3UNJA 4ACMA 1KWPA 2PSQA 4UMQA 2J50A 4ID7A 3QCYA 4NWMA 4PPBA 3CP9A 3WYYA 4AN2A 5L2WA 5DEYA 2OU7A 3S95A 1ZMWA 5AUWA 5L2IA 3OOMA 3UP7A 5B2KA 3ZRMA 4YJRA 1U59A 4JG7A 5EYCA 4U40A 1GIHA 3E7OA 4X3FA 5JRSA 3D4QA 2ITXA 3VW6A 2HXLA 2QO9A 3PVUA 5HO7A 4PL5A 2DWBA 4HCUA 1J7UA 5FUTA 2R3IA 4II5A 4XX9A 3ZZWA 2CN5A 3MH1A 4RJ8A 4WNPA 3VHEA 2I40A 5K5NA 4QPMA 5AR5A 4IZAA 4FNZA 3MIAA 4V05A 4L00A 3WF7A 1KV1A 3Q9WA 2I0VA 3QTRA 3R63A 4FUXA 4GJ2A 1XH4A 3MB6A 1WCCA 4RIWB 4QQCA 5I9XA 1BLXA 4JBPA 4BDGA 4Y46A 3DTWA 2FSLX 2C6IA 4F64A 3E88A 5ANDA 3PXYA 4FIGA 1VZOA 1O9UA 3MFUA 5IQEA 3CXWA 4OTIA 5EDQA 4F9CA 3P79A 4DFYA 3PXZA 3E64A 3SKCA 2XK4A 4MYGA 2C3JA 2C5XA 1UWHA 2VTQA 3CC6A 1JKTA 5HNIX 4D2SA 2DYLA 4O0WA 3NLBA 1J7IA 1PXLA 4ZLOA 4F63A 4LG4A 3UOJA 5HG8A 4C4EA 3S1HA 5DR2A 3W8QA 4V0GA 2QOCA 5EM6A 5CAOA 5JSMA 1PRYA 5CQUA 5EM5A 2OH0E 4ERKA 3E62A 4F9BA 4IAIA 4X7QA 3SGCA 5JN2A 2VTMA 3PP1A 4FTJA 4GIHA 1YKRA 2B7AA 5KHWA 5KO1A 5C01A 3ZXTA 4NW5A 1YXUA 2GTMA 3H9RA 4FF8A 4RIXA 1OPKA 4DITA 4E6CA 4LRJA 4RZWA 4JOAA 3O50A 2C3KA 2CKQA 5FDXA 4RJ3A 4FT9A 4YPDA 4G17A 5HG7A 2OIQA 4JBOA 2VTOA 5F9EA 2GFSA 3RM6A 2PK9A 2QNJA 1SVEA 3QCSA 3QQKA 3HKOA 3W33A 4MH7A 4LUEA 4D9TA 1M2RA 1XWSA 2ZV2A 2C4GA 3QTIA 5IQDA 4IH8A 3IW5A 4IWQA 4FODA 4HYHA 5CZHA 1MQBA 3KCKA 5JZNA 1H1PA 1OUYA 1WMKA 2WMTA 4O2ZA 3VJOA 4C59A 5FBOA 3VS4A 4TY1A 1F0QA 4RVTA 1YWNA 2W96B 4GCJA 5CI6A 3M2WA 4ANMA 3F5XA 4DC2A 3A4PA 2ACXA 3L8SA 4KA3A 4KS8A 5TOZA 3KN5A 4J8NA 4U80A 1DI9A 3ATSA 2ZV9A 4BDJA 3JUHA 4KIOA 4DG3E 4YZMA 4W4YA 2VGOA 2WEVA 3UIMA 4A07A 2YJSA 4FTMA 1IASA 1PF8A 4GW8A 3NUYA 5C4LA 3G0FA 5EW9A 1WBSA 3KC3A 4DYMA 3C7QA 2QU5A 2HELA 3O8PA 3W2PA 3KRWA 4WKQA 3VS1A 4U3YA 4RJ6A 4O7NA 3WI6A 3KK8A 3C50A 1YWRA 3HRFA 3DKOA 4ALUA 3OUNB 3PXKA 4GU9A 4FYNA 3IGGA 4RGJA 2XBJA 4BDIA 5AP3A 2R7BA 3ZEWA 3P7AA 3UQFA 4O82A 2JKQA 1NW1A 2YLEA 4YJVA 2VTSA 2WTJA 3NUNA 3BIZA 3PVWA 3WE8A 2F9GA 4BN1A 2WEIA 4E5BA 5L2SA 3EIDA 5IMXA 4GH2A 2VWIA 1YOMA 4IAAA 1KE5A 4FG7A 5DLSA 5EH0A 4ZTLA 2CJMA 1L3RE 2XH5A 3LFAA 5H9BA 5CU0A 4IB0A 1L8TA 1J1BA 3PP0A 2XNGA 4W4VA 3KMMA 3BBTB 4YZCA 3ULIA 4AT5A 1TQPA 4FZFB 5HCZA 4EH7A 4DH7A 3ZZEA 4OBOA 3MA3A 3VW8A 4AT3A 5KMJA 3PYYA 5LQFA 2OJ9A 2JDTA 2NP8A 4B7TA 2WQBA 4QYEA 4TRLA 4YU2A 3BWJA 4QMQA 5ETIA 1JLUE 4NIFB 4GFGA 1NT2A 5AA8A 3KXZA 4AGUA 4A9RA 2XEYA 2RSVA 3VBTA 3SRVA 2W7XA 2WTVA 4F6SA 1M14A 3I6WA 3S4QA 2W4JA 4C2VA 4F7SA 3KRRA 4R7BA 3PIYA 1VJYA 2XNMA 3DBDA 4GU6A 3ACJA 3PVBA 4ZMFA 5K4JA 3ZSIA 4LRMA 4MKCA 3CPBA 5T68A 5C03A 1B38A 2BHEA 4JX3A 2PVMA 5CNNA 5C27A 1YVJA 4PTGA 5G1XA 1R3CA 4V01A 4RJ4A 3PJ2A 2I0EA 5CT0A 3RCJA 4U97A 3UMXA 1GZKA 5M4UA 1OIQA 2HZ0A 1OB3A 2ETRA 3LPBA 3RPSA 4BZDA 3EH9A 4P90A 2OSCA 4Z55A 2XJ0A 5E7RA 4WNKA 2WMRA 2Y9QA 1W84A 5EYDA 3LMIA 3QTXA 3TNWA 3PIZA 4PL3A 4EK8A 4EBVA 3JYAA 4B8LA 3T8OA 3DXNA 4JRVA 4X21A 1YXTA 3KK9A 4EOMA 2GHLA 4G16A 4EUUA 4RVKA 3QRKA 2JFMA 3DBFA 3SG8A 5CZIA 3H10A 3IONA 3VULA 5J9YA 3CLYA 2REIA 3OCBA 4ZZOA 4EKLA 2OLCA 2VWUA 4HCVA 2QR7A 4RQKA 3AT3A 2JD5A 4LGDA 3DAEA 3ZLXA 4KKGA 3NAXA 3AC5A 2O63A 4KIKB 5EM7A 4D1ZA 2XKDA 4D4YA 1R78A 4BB4A 4X2KA 1RE8A 2XMYA 2YHVA 5DR6A 4ACHA 3FHRA 5HG5A 3RAIA 3R30A 4JRNA 4YURA 5EYKA 1WBWA 4BI1A 2XYUA 4HZRA 1V0PA 2Z7QA 1ZOHA 4CKRA 5E8ZA 3C5UA 2RG5A 5AAFA 3V8TA 3VUTA 4YO4A 3QC4A 2ZDUA 3DAKA 4JS8A 3THBA 2X7GA 5JFWA 5I5ZA 2Z7LA 1A48A 1KOBA 2XIYA 1YOLA 2UZBA 3LXPA 4QPAA 1AGWA 4IFGA 1DAYA 3F5GA 4MWHA 3D5VA 2JGZA 2Y4IB 2YDIA 1STCE 1BL7A 4X3FB 5AP7A 3R9DA 4CFXA 3FYJX 4F1MA 4GG7A 3R8LA 5E91A 2JDSA 3VN9A 3ZDUA 5J95A 1Q62A 3LMHA 3GCQA 5HICA 3VBYA 2XF0A 1UU9A 2CDZA 1SMHA 3EZRA 5JMSA 5AR3A 1TQIA 4N4SA 4GKHA 2EWAA 2HYYA 1MP8A 1OL1A 5CY3A 5JQ8A 2XNBA 4Q5EA 2GNFA 3DXQA 1ZY5A 1R39A 5HVYA 2WIHA 2Y6OA 3KGAA 3C9WA 2B53A 3BE2A 2W4OA 3IQ7A 4Y73A 3BV2A 5ANJA 3ZFYA 4FV4A 4BZNA 4F65A 4IDTA 1XBBA 1ZRZA 4W4XA 5CT7A 3C5IA 3RPVA 2YM3A 5FP5A 5D7VA 4RX9A 4HYUA 2WTKC 3UC4A 4FL3A 4GYIA 3W55A 4K33A 4P5ZA 5FDPA 1IAHA 3HAMA 4E4LA 2NNWB 1NVRA 4BTFA 3WF6A 1PKDA 1Y57A 4E7WA 2UZTA 3COMA 3TKIA 4DF3A 3E3PA 3SA0A 3CY2A 5TKDA 2BHHA 4HGTA 2WMUA 4DEDA 3TEIA 4IAKA 4ZOGA 3VAPA 3QHRA 4ITHA 5HU3A 4EK5A 1Z57A 3FMNA 3KA0A 2XUUA 4YHJA 4UZDA 5DT4A 4V0GB 3FL4A 4D2VA 4O84A 2VUWA 3A7IA 2YCSA 2Y6MA 2BROA 2AC5A 1I44A 1TKIA 3VS5A 4D4SA 3RP9A 2I1MA 1FGIA 4NFMA 2GU8A 4E26A 4I22A 4W9XA 2YCQA 3LM5A 2G2HA 4XP2A 4FG8A 5LOHA 5CTPA 1H00A 2Q0BA 3NS9A 4FA2A 1B6CB 2OXDA 3FPMA 2XIKA 3QBNA 4BVUA 4ZSLA 1H28A 4RIXB 4D1XA 3TJDA 3HRCA 1J91A 4R1YA 3OTVA 5CEKA 4FKLA 2QURA 3QRUA 3NDMA 3F66A 4BGGA 3AC3A 3DGKA 4FIFA 4FSTA 3BYVA 3NUAA 4QP2A 2IG7A 4I92A 4IEBA 3SOAA 3UPZA 1Y91A 4XOZA 1FVTA 2J4ZA 3L9PA 1QPCA 1JOWB 3OY3A 4O0TA 5D10A 2FSOX 3D14A 4CLIA 2FA2A 1S9JA 2UVZA 2BFYA 4U44A 2IW9A 3RJCA 2XJ1A 1GJOA 4BIDA 1GZNA 4QP1A 5KNJA 3FLZA 4PPCA 3TIYA 4FIEA 4O96A 2W17A 3LFNA 4KRCA 4UWCA 3VS0A 2OI4X 2J0IA 2FO0A 5HBHA 4KWPA 4WA9A 4HNIA 5I3OA 2QHMA 1OBGA 2XIXA 3V3VA 5IA0A 3O8TA 4FV7A 1JBPE 3NMUF 1JNKA 4IIRA 2R5TA 4AQCA 4FK6A 4XBUA 3G0EA 1XHAA 4ZTNA 3RNIA 4D2WA 2YJRA 3G9LX 2JBPA 4OLIA 5IEVA 2BAJA 2IPXA 4BCJA 1Q41A 4TWNA 5CQWA 3QCXA 3HMPA 5ANGA 1YW2A 3CS9A 1KE7A 3ZLYA 4CKIA 3A61A 2C3LA 2YDJA 4AFJA 4CEGA 3TUBA 3DOGA 1E9HA 1YI6A 4FIIA 3R73A 5E8WA 3HL7A 3RINA 1QPEA 5EKNA 3UOHA 1PHKA 3BHVA 3OW4A 2F2UA 2VN9A 4NK9A 4FKRA 4TNDA 4E4NA 5LVPA 3T3UA 5CEOA 1H26A 4DEAA 3ELJA 1ZZLA 3QD3A 2PVJA 2HW7A 3UG2A 4UXLA 4B0GA 3OXTA 3B2TA 4FL1A 4I6FA 4NH1A 2VD5A 3AGMA 4YLLA 1IG1A 3HDMA 3SD0A 5K5XA 4UWBA 4FGBA 2IVVA 3LAUA 1WVYA 4QTEA 4I0RA 4W4WA 3DFAA 5CU6A 3H9FA 4LMUA 2WU6A 3VWAA 4O7WA 2DUVA 3AD5A 3HMMA 4USDA 4E5WA 4NCTA 4BDDA 3VHKA 4ZLZA 5GINE 2W1FA 3O2MA 2F4JA 5BUEA 3AC4A 3N4TA 3R1SA 2QQ7A 4C4HA 3Q2MA 5AUYA 5HO8A 2YIYA 4RZVA 4H36A 3E8NA 3ZO2A 3DAJA 3BLHA 3BLRA 4RVLA 4JBVA 4GMYA 1XH6A 3NUXA 3EOCA 3SRVB 2J9MA 1PXOA 1SM2A 2IW6A 5DVRA 1M52A 2JAVA 3ZOSA 3CY3A 4FSUA 5J5TA 4BDBA 2ITZA 2X9EA 3OS3A 2YM4A 3Q60A 4NTSA 4O27B 1UNHA 5IKWA 3UJGA 3ZYAA 4DTKA 5LVOA 2XK8A 4HOKA 4XRLA 3K5UA 3FJQE 3QZFA 3NRMA 3OWPA 2FB8A 3IDBA 4FKWA 3N4VA 3TDWA 1Q8TA 1YHSA 2GMXA 2HY0A 1W0XC 3I0OA 4ONAA 5L6OA 2R3JA 2BIYA 4FVRA 4IZYA 3FSKA 5IZFA 1R0PA 4E93A 4DFNA 1SYKA 4RRVA 4X2GA 5HE0A 2ESMA 2A19B 3RK5A 2WTCA 4TYJA 1Q97A 4QP9A 2W0JA 3FC2A 3A7HA 3I6UA 5DBXA 5LWMA 2F7ZE 1CDKA 5FGKA 2CKEA 4QQTA 2PUPA 4ZZMA 3ZDIA 4XEYA 1ZWSA 2P55A 2FSMX 1FGKA 4FK3A 5EW8A 3ORKA 4E8AA 2PZ5A 3VRZA 4WNMA 4XJ0A 3BCEA 4HYIA 4M8TA 3HV7A 3ENMA 3TG1A 3UYSA 4YMJA 4OTGA 4ARKA 1OL7A 1A06A 2IJMA 4ZP5A 1JKSA 5FM2A 4TNBA 4CG9A 1GZOA 4QT1A 2IVTA 2J0KA 3DLSA 1UWJA 2AC3A 1SVHA 4GFOA 3R28A 4CMTA 4YR8A 5HBJA 2UW0A 4Z3VA 1JAMA 3F3WA 4O0RA 5IUIA 5IU2A 2VO7A 4O0XA 2XK6A 4GFMA 3UO5A 3BHTA 3Q4TA 5DG5A 1AD5A 5FP6A 3DKCA 3OT3A 2YAKA 4O7TA 4PRJA 5E4HA 2DQ7X 4C02A 5HE2A 5K3YA 3I4BA 4FT5A 4AZWA 5CAVA 3FV8A 2YISA 1WVXA 3LOKA 4WHZA 1VYWA 4WUAA 3QYZA 4FKGA 3A7GA 5CXHA 5C8MA 3CPCA 3QQHA 4G3FA 3FHIA 1HOWA 1XJDA 2C6MA 2C6KA 4XV9A 4XV3A 4AW0A 5CANA 3ZHPC 2V0DA 2R4BA 4ZTSA 1JPAA 4EYJA 2VU3A 2P2IA 5GZAA 3EQBA 3QU0A 3PJCA 5IQCA 3KXXA 1GOLA 2UW4A 1Q24A 5IUGA 2WOUA 4G31A 4PTCA 4FV5A 1F3MC 4IVBA 4IW0A 3ROYA 3L9LA 1UA2A 4BIBA 5CF5A 2IWIA 2JBOA 4FT0A 2B0QA 4PUZA 4TKSA 3C13A 3COIA 3RCDA 4TWPA 5BYZA 3KXHA 4C4FA 4F7JA 4D1SA 1CMKE 4E20A 5JRQA 3E92A 3TM0A 2B9IA 4JLCA 4AZEA 3A60A 3HV5A 5IH4A 3RAKA 4PMMA 4YJQA 3QZHA 2GFCA 5JFVA 4AXAA 2BRMA 5H8EA 4BDKA 3LFFA 4PMTA 3R9NA 2OO8X 5CEIA 4N57A 2A2AA 3DT1A 3FI3A 5CLPA 4YJUA 2C6TA 3P4KA 5D9HA 5LVMA 4X6QC 5I9YA 4JBQA 3PFQA 2PE1A 3QRIA 5ACKA 3RHXA 3EN5A 4GIIA 4JIAA 4WRSA 4M7IA 4XP0A 1PMUA 4FZDB 4O7RA 1OKWA 4FICA 3PXFA 2Z7RA 3DB8A 4JAIA 4BCMA 3FEGA 2B54A 3NEWA 3LXNA 5HTIA 5CAQA 2JLDA 3CD8A 3ZRKA 4CFMA 2VGPA 1XH9A 3MJ1A 4ZSEA 3VVHA 5A4EA 2FUMA 5C26A 4WT6A 4IE9A 3WIGA 3Q3BA 3GEQA 4BICA 4KD1A 4DEBA 3LQ3A 5IQAA 3VO3A 4FTOA 2PTKA 2RGPA 2Q0NA 1DS5A 3K5VA 1E1VA 2UW9A 3GUBA 4UXQA 4YJOA 2A4LA 2HZNA 3PWDA 3QZIA 4XV1A 3TUDA 1T46A 1KSWA 3FWQA 4HPTE 3VF9A 3P9JA 4ZJIA 2ZB1A 4L3JA 4DFXE 5AUUA 4I0TA 5HE3A 3R2YA 2VO0A 5KUPA 1XBCA 2QOLA 3TCPA 3NNXA 4YTHA 3I0QA 5JEBA 3MIYA 3AMYA 1MQ4A 4HNFA 1GIJA 1Q61A 5EHOA 2WQMA 5HIBA 3VUIA 3QUPA 4EOIA 2PMOX 4L3PA 4HYSA 3FQHA 3QRTA 5AUZA 4BTJA 1G5SA 3GU6A 2B9JA 4C61A 2YCRA 3LJ2A 4EOJA 3OWLA 4FTKA 3GU7A 4F99A 3BQRA 4NCTC 3BWFA 4A9SA 4CGAA 4I4FA 4FC0A 2BPMA 4CT1A 5B0XA 5BVEA 3R00A 3FZRA 2OICA 3VBWA 5M57A 2ERKA 3CR0A 3IG7A 4DFUA 2HWOA 4G3GA 5DA3A 3R8UA 2R3NA 5DMZA 3FQSA 4TYEA 4JJRA 2YIXA 5DT0A 4RT7A 3EQPA 4JR3A 4W8DA 2JIIA 2CN8A 4NJ3A 4DLIA 2Q83A 5CXZA 5HO6A 4FKUA 5L6WL 3MS9A 3ID6C 3EFLA 5JKGA 3DXPA 3IPHA 2P3GX 4ANSA 4FTAA 3BLQA 2BRNA 3KVXA 4TT7A 4JT3A 4FV6A 3BEGA 2ITTA 2QI8A 5IEXA 1ZY4A 2ZV7A 3D9VA 5DFPA 3F5UA 2W99B 2YZAA 3FKLA 3COHA 3UQCA 4O86A 3ZXZA 1IA8A 5CSVA 3RWPA 4PMPA 2W06A 3A4OX 4GRBA 4ACDA 3UG1A 4NM0A 5CALA 4QYYA 4S32A 3PJ3A 4FEXA 3TNIA 3ORZA 4CQGA 3D83A 4AACA 5CF4A 2Y0AA 5GZ8A 2E9NA 5IF1A 3C0HA 3FKOA 4H58A 4Q2AA 4RC3A 2XNEA 4L01A 5GZ9A 3UGCA 3OCGA 5IA5A 2XK3A 1ZYCA 3G90X 2PYWA 4DFBA 1G8SA 1W82A 1Y8YA 4QYFA 3G15A 3FLQA 3VS7A 4GK4A 3FXWA 4NM7A 4O6LA 4GJ3A 2ZV8A 4I94A 3V5JA 2IZUA 4DCEA 4UMTA 4FIJA 2QCSA 3NZ0A 3AC1A 2VTIA 5T3QA 1NY3A 3ZUUA 4E5AX 2C6DA 4FT3A 4YC3A 4FSMA 4EOSA 4AW5A 3DA6A 3FUPA 2V7AA 5AV3A 2X6DA 4C33A 4HVHA 3TACA 3KRJA 4DAWA 1IA9A 3C1XA 1LP4A 3MH2A 4QNYA 5DOSA 1YHVA 3F7ZA 3LW0A 5A4QA 2C1BA 4NKSA 3U9CA 3CQUA 4UEUA 4EHEA 3DK6A 4G5JA 1JKKA 3A7JA 3QC9A 4PDPA 5J9ZA 2WTDA 5AV2A 4CMOA 5IA2A 5IQIA 2J51A 4BL1A 5KKRC 4L53A 1QPJA 3LCSA 2UUEA 3HYHA 3JY0A 3DTCA 1ZXEA 2PWLA 4DH1A 3LMGA 1OIUA 4QTCA 4U7ZA 1Z9XA 5F95A 5CSPA 3PZEA 5AP5A 3LJ0A 2CLQA 2ZYBA 3NW5A 1YDSE 4YBJA 5HI2A 2ETMA 4ZLYA 4FEUA 4U9AA 3FLNC 3T3VA 5J1WA 1Q4LA 2VTJA 3G6GA 4PX6A 1VYZA 3OWJA 2CNUA 1F5QA 2ZM1A 3IOPA 5GJDA 5FXQA 3ALOA 3V6RA 1U46A 1Q99A 3HV4A 2IW8A 2J5FA 1H1RA 2QU6A 4IM2A 3RGFA 4HGLA 4ALVA 1DI8A 5EYMA 3RAHA 5KMNA 3K2LA 5DGZA 3EYHA 1Z5MA 5AAEA 4XG8A 1CKIA 2P4IA 3BI6A 1KE6A 3GXLA 4U0IA 1DAWA 2X7FA 4OTDA 5HIDA 4F1OA 4E73A 3IW4A 4FTLA 4G6LA 5DNRA 2BCJA 3IS5A 1LEZA 3SXSA 4EOOA 3BE9A 4HCTA 5HESA 1GY3A 3A8XA 5KKRB 4BYIA 3PE2A 2YWVA 4DH3A 3HRBA 5GIPE 2R3OA 5AAGA 4M69B 2Y4PA 5LJJA 4AP7A 3Q4ZA 2R64A 3LCOA 4CV8A 3POOA 4JDHA 1OIYA 2X4ZA 5HEZA 4EK6A 2W9ZB 1ZYJA 3QQFA 4ANBA 3F6XA 3EB0A 3FZSA 2W5HA 3FMKA 3KN6A 3B8QA 4F0IA 4UWYA 4C38A 3RM7A 4BBMA 1GIIA 4J99A 3RTPA 4F4PA 2PE0A 3MJ2A 3PA5A 3TTIA 4FNWA 2X2LA 3NSZA 4FNYA 1MRVA 2OJGA 5FXRA 4RBLA 3N9XA 4KUJA 4YHFA 2IZTA 4XP3A 1UKIA 2ZJWA 3VQUA 5CEQA 4H39A 2YFXA 4R78A 3W18A 4FSQA 3FMLA 3MTFA 4FSZA 4BRXA 5IUHA 5GJFA 1Q8ZA 2PE2A 4XLVA 5D41A 3TZ7A 3TI1A 2H96A 4P2KA 4C62A 2CLXA 3Q9YA 4C3PA 3BYOA 2J7TA 3UO6A 5IPJA 5LVNA 1Y6BA 3C0IA 4F9WA 5IISA 4I6BA 4ZSGA 4Z9LA 3HP5A 4UYNA 4RC4A 3FE3A 2R0UA 5IDPA 4GSBA 3SAYA 4LI5A 4J1RA 4KIQA 3GOPA 1XH7A 1ZYSA 2ZDTA 3TUCA 3BYSA 5CNOA 4EWQA 1BX6A 4C37A 5ETCA 1H0VA 3QRJA 3LXLA 4PDSA 4XG2A 2PU8A 4EH6A 1QCFA 2O3PA 3RK9A 1YRPA 2I6LA 3EWHA 2QVSE 4J98A 4XMOA 3OT8A 3RI1A 3TZ9A 4J8MA 4M67A 3PDTA 2Z02A 3R7VA 4QP8A 4XLIA 2R3LA 3IW6A 3WARA 3FKNA 4LRKA 4GKIA 4R5SA 4MVFA 5A6NA 3HECA 1K9AA 4L68A 3GNIB 4NZWB 4OBPA 4CZUA 4KS7A 3R8VA 5ANOA 3REPA 2BZHB 2GDOA 4WO5A 2OJJA 3EKKA 4QMTA 2YABA 3LVPA 4ENXA 1V1KA 5LMKA 5FTGA 1PXKA 1ZZ2A 3ENHA 2IO6A 2PPQA 5GNKA 5EG3A 2XM9A 3DBQA 3VUMA 3F3UA 4FKSA 4RJ5A 1ZOGA 3DNEA 3F69A 3KQ7A 4EORA 4RA5A 3DCVA 2ZM3A 1PMNA 4RIYA 3MGYA 1OMWA 4HZSA 2PMLX 4CT2A 3CTQA 4BCQA 2VNWA 3V6SA 3VS6A 3PPJA 1A9UA 4NEUA 4QMMA 2XRWA 1FMOE 3CIKA 3KXNA 4CRSA 4WOVA 5HNGA 3L1SA 5A9UA 4MNEB 5JT2A 3OBJA 3POZA 3BGQA 5DH3A 1KE9A 3FQEA 3QGYA 2EB2A 2O64A 2PUIA 3HAVA 4QQ5A 3E87A 4XYFA 4R3RA 2VAGA 1UNGA 3Q53A 1J1CA 2ITYA 4QP4A 3Q6WA 3OHTA 4L46A 4QMSA 1SZMA 4XV2A 1RDQE 3E8DA 3NYOA 4J71A 3PG3A 4EZ7A 4FV0A 4LM5A 2CKOA 5HD7A 3QALE 5FEEA 3P23A 1NVSA 2BRBA 4YP8A 4LL0A 1R0EA 5L2TA 2R3RA 1LPUA 2HAKA 4IADA 2ITOA 5HX6A 4U42A 1JSVA 4IANA 5HLPA 2JIUA 3DK3A 3NIZA 4NUSA 5BVDA 4G5PA 1PMVA 4PNIA 3UNZA 4EK3A 3MBLA 4C58A 5AP0A 4OTRA 3BEAA 4YNOA 4GYGA 5FG8A 5IQGA 1ZYDA 5BVWA 5H8GA 3ZLSA 1PXJA 2XNPA 2Z60A 5AX9A 2E9VA 4CQEA 2EXEA 4AZSA 2XCHA 3GC8A 4L42A 4BWXA 4DINA 4UALA 3DLZA 5FTQA 3FI4A 4KB8A 4QP3A 4AE9A 5M09A 4EH4A 4JG6A 5CYIA 1BMKA 3BBWA 3FMDA 3ERKA 4G9CA 3WZJA 4EYMA 4F08A 4Z16A 4QMPA 1IRKA 2CGWA 2BALA 2RFDA 3M42A 4FI1A 4FKOA 4RMZA 2UZLA 3U51A 5HOAA 4YJPA 2WMSA 3EZVA 4OTQA 3TNPC 3RPOA 4G9RA 4ZEGA 3R7EA 3EL8A 4N70A 1PY5A 2Z7SA 2QOQA 4O7VA 2ITPA 1OZ1A 2RKUA 4I5CA 5L8JA 3NW6A 4KKHA 4BBFA 4F7LA 2VWZA 3W2OA 2W1CA 5FEQA 3R6XA 4AG8A 5TF9A 4TW9A 2CNVA 5I9ZA 3GI3A 4FE2A 4LFIA 2KULA 2WMAA 3MV5A 5ICPA 5ETFA 3EN4A 4DBXA 3CTHA 3MFRA 1TQMA 3PLAE 2C5NA 2J0JA 2R3KA 3OFMA 4RPVA 3UZRA 5FLFA 4Q5HA 4C4JA 3MVLA 4BCPA 1H1QA 4BF2A 4NYEA 3LJ1A 3OF0A 1PXPA 4K9YA 5H3QA 3MYGA 4JQEA 1H08A 3FPQA 4EK4A 5LXMA 2C5VA 1OUKA 2NRUA 4IHPA 3VRYA 1QL6A 3MVHA 3ANRA 3E8CA 4UBAA 4C7TA 1H1SA 2OF2A 3EN6A 4IX3A 4EOKA 5BVNA 2HXQA 1JWHA 3QQGA 3Q32A 4IAFA 4NU1A 5AP6A 5AFVA 4R77A 5K9IA 5A46A 1OVEA 3RVGA 2YITA 5AADA 4HVGA 3ZBXA 5HLNA 2X6EA 3IDPA 4BI2A 4HPUE 4XG3A 2GCDA 2PZIA 2W5BA 4WNOA 4Y85A 3TL8A 5JZJA 3KCFA 4BTKA 3G5DA 3ZC6A 3V01A 3U8WA 4KAOA 2YLFA 3GCPA 5I9WA 4MQ1A 4MBLA 1PKGA 3R7YA 3TXOA 2P0CA 2X8IA 3OBGA 4FV9A 2PVHA 3DPKA 3OP5A 2EXMA 4IVCA 4S2ZA 1IR3A 3S00A 2UV2A 4OT5A 3OVVA 2VWBA 4FV8A 5HTBA 2QOFA 3FZ1A 4J96A 3W2RA 4ZIMA 5IQHA 3FAAA 1U54A 3HP2A 2PY3A 3UTOA 5CX9A 1J7LA 4K0YA 2IN6A 1ZAOA 5CF8A 3UYTA 2XIRA 3LFDA 5AEPA 3AQVA 2WTKB 3HMOA 4N0SA 4U79A 5GHVA 4EH2A 1APME 2BAKA 1FPUA 2UZWE 2Y8OA 3VNTA 4AZFA 3R04A 4OAUC 2E9PA 5HU9A 3W1FA 2WNTA 2QG5A 4O1OA 2R3FA 1BUHA 4AX8A 4CFNA 4MD9E 3MTLA 3P08A 3QUDA 2HZIA 2PVRA 4KABA 4QOXA 4X2FA 3K3JA 3VBXA 3GOKA 2ONLC 5I3RA 1ZMUA 3D5WA 4JR7A 3MA6A 1I09A 1BKXA 2VNYA 3FZTA 4O1PA 3QQJA 5E8SA 4I0SA 4QYHA 3WZKA 4ASEA 1P2AA 4TXCA 4I23A 2ZB0A 5AR2A 4BCFA 3E3BX 2GNLA 4K8AA 4O7YA 4IAZA 3SV0A 1NXKA 2NO3A 4D5HA 4HGEA 2GNIA 5J87A 4ZJJA 5M07A 4CRLA 4CVAA 1V0BA 1LEWA 3JS2A 3R7GA 4S34A 4YSMA 5BNJA 3F9NA 2VX1A 4L67A 4M0ZA 4IX4A 2HCKA 2XP2A 3D0EA 4GS6A 4RIOA 3H0ZA 3R7IA 3TJCA 1SVGA 3V5WA 4AZVA 4B99A 3EN7A 5LMKC 4ZY5A 3MVMA 2ZMDA 1CKPA 4KBCA 4TL0A 4EOQA 4IJPA 4QMYA 4I20A 5KZIA 2CPKE 3U6HA 3JR1A 1CTPE 3UOLA 3NCGA 5BYLA 3KY2A 4Q9SA 4ZAUA 4RSSA 1WBVA 1H1WA 5AM6A 3IK3A 3QTZA 3KMWA 5HHWA 5L3AA 2B52A 1XBAA 5AM7A 4RX8A 2YM6A 5DIAA 5HKMA 4CD0A 4EC9A 3QA8A 3KRXA 4C0TA 5A4TA 1W7HA 3HMNA 4FKTA 3D94A 4X3JA 1XQZA 3VJNA 3LLTA 4L6QA 2O2UA 4O7SA 2OG8A 2X81A 5I4NA 5C9CA 4RJ7A 3FZPA 3KRLA 3DBEA 2I0HA 4PDOA 4P5QA 4QMLA 3FSFA 4BKYA 3W10A 3PXQA 3RKBA 4CV9A 3F7WA 1OI9A 4UX9A 1VR2A 5AWMA 4BCGA 3QD0A 4KIPA 5TO8A 3EKNA 3V8SA 4UB7A 3CGFA 4IJ9A 4F9AA 3DY7A 3FMJA 4RIYB 2ZAZA 1M2PA 2XRUA 2O5KA 5BX0A 5LMBA 3HLLA 5A4CA 2G01A 3U9NA 4EUTA 2I0YA 3BRBA 4FZ7A 5BQ0A 1ZLTA 3CSVA 3QUEA 2V5QA 4LV5A 4G2FA 4AA4A 4F6UA 1EH4A 3VIDA 4EH5A 1T45A 4PPAA 1BI8A 3F3VA 5FQDC 2XKFA 5I9VA 2WAJA 3KFAA 5E8VA 4X0MA 4KRDA 3QX4A 4F0GA 4K2RA 3WIKA 2CMWA 2JITA 4OTWA 3MDYA 3VBVA 1G3NA 1M2QA 2C3IB 3KVWA 4O0SA 4EZ3A 4C35A 2OFUA 4AW2A 3R9RA 4R5YA 3SW7A 3G6HA 3ZFMA 3ZONA 5C1QB 3R8PA 4M84A 3EJ1A 3P1AA 3QWJA 2AYPA 4DHFA 4WRGA 5CU2A 4PMSA 3UODA 5EI6A 2H34A 3FC1X 5DEWA 3AMAA 3NNVA 2WQNA 4I93A 4LYNA 2Z8CA 4FSRA 4UYAA 3WE4A 2RFSA 2H6DA 4BDFA 1REKA 5BYYA 4M15A 3SC1A 2ETKA 3VQHA 2YZLA 2WMVA 3CJFA 5B2LA 4UZHA 4FSYA 3HUBA 3H30A 3KXMA 5A14A 5EKOA 5IG1A 3RALA 4LGHA 3ORMA 5M4IA 3MH0A 2WIPA 4DFZE 3EQCA 2W4KA 3VS3A 1BYGA 2X2KA 4CMUA 1P5EA 2ITQA 3H0YA 3AD6A 3NUSA 3NNUA 3OCTA 3OTUA 3QD4A 2J6MA 5EHYA 3PPKA 1H0WA 4UMUA 5CAPA 3FI2A 4P4CA 3DKFA 4I3ZA 2VO3A 3SQQA 3MY1A 3BKBA 3I5ZA 3RK7A 1LUFA 4YBKA 3R1QA 3EFWA 4YLKA 4JQ7A 3ZSHA 4WD5A 4A06A 1Q3WA 3E93A 4BDEA 2F7XE 3WZUA 1SNXA 3ALNA 5E92A 2PUUA 2WXVA 2WMWA 2XKCA 4U41A 4D4VA 4FVQA 3V5LA 4EHZA 5BVKA 4G6NA 5JH6A 5FEDA 2V62A 2UZNA 5M51A 3PPZA 5L8KA 2E9UA 4UMRA 4AU8A 4PNKA 3TV7A 3GU5A 3D2IA 3K3IA 3QTWA 4BC6A 4PY1A 2X9FA 3BX5A 4M12A 1OGUA 3C0GA 2R3QA 3HVCA 3QQUA 2ITWA 3HNGA 5KMIA 4BGQA 2C68A 1YI3A 3Q9ZA 2WMBA 5CF6A 3MPAA 5CI7A 3MH3A 2GQSA 3QTSA 3LFBA 4MXZA 4DCAA 4O2PA 4O0YA 3PJ1A 5DI1A 1PXNA 4JNWA 5I0BA 2XEZA 5M4CA 2R0IA 3NX8A 3QAME 3R22A 4KBKA 5D7AA 2OK1A 3E63A 4AA0A 2WMXA 4BBEA 5D11A 2HWPA 5AUTA 5EW3A 5EDRA 4FKQA 2WMQA 4LOQA 4BWKA 3DQWA 5KMOA 3R8ZA 3BZ3A 3H4JA 4PP9A 5CEMA 4NW6A 2XIZA 3CQWA 4FIHA 4I5MA 3MW1A 3GVUA 5A6OA 5AMNA 1JKLA 3WZEA 4MD8E 5AP4A 5FWKK 3QTUA 3QZGA 4A7CA 3TTJA 2HIWA 3D5UA 3LFQA 5H8BA 3ZC5A 3Q52A 3ZO3A 4GUBA 1ZMVA 5CVHA 4FEWA 3QA0A 4RG0A 3BGPA 2WO6A 3KXGA 5T6KA 4H05A 5DRBA 4YUQA 3BHYA 2W1EA 1QPDA 5ETAA 3MB7A 4FVPA 4K1BA 3QKLA 4N6YA 4RWJA 4MCVA 3EL7A 4EJ7A 3MPMA 4FMQA 1PMEA 3BHHA 4IWOA 1JSUA 4DA5A 3RMFA 2G2FA 4QMXA 2VTPA 1XR1A 2OH4A 3QFVA 4WIHA 3F2NA 4YTIA 3ZS5A 3QD2B 3ZSGA 4JDJA 4IXPA 3D7ZA 3RBWA 2BUJA 5KX8A 5TE0A 4EC8A 3GC0A 4CFVA 4H3QA 3ODZX 3MSSA 4FTIA 3CGOA 5K0XA 4DGOA 5IA1A 4IX5A 1YDTE 4FZAB 2O65A 3TN8A 4CCBA 4NKAA 1J3HA 4FTUA 3P5KA 4G3EA 3DB6A 4TPTA 1Q8UA 1KE8A 1Q8YA 4ALWA 4QYGA 3V51A 3CE3A 3ZM4A 3ROCA 4NIFA 3UBDA 4Q9ZA 2UW6A 5M55A 4AFEA 2B9HA 3OXIA 5EI8A 3NGAA 2G9XA 5KCVA 4FOBA 4MTAA 4B6LA 3LKMA 2CGXA 5DPVA 3WOWA 4EH9A 3A7FA 3GB2A 3TNQB 3CEKA 1PYEA 3NYNA 4FR4A 3VUKA 1MUOA 5IQBA 4CG8A 4DH8A 3L8PA 2BKKA 1PXMA 4I5HA 4MXYA 2ZVAA 4BIEA 2GQRA 3EQFA 5C4KA 2YN8A 3H9OA 3LHJA 3NUPA 4MXXA 3K54A 4AA5A 1Q8WA 1U5RA 3VC4A 1KOAA 3D7TA 4MF1A 3RZBA 3V5TA 2VX3A 3TKHA 5KHXA 4UV0A 4IWDA 1OL5A 2YIQA 2OIDA 5E1EA 5CENA 3ZUTA 4C34A 3D15A 4MX9A 4G3DA 1Q3DA 3QCQA 5FTOA 2QLQA 3JVRA 4BCOA 3O17A 3RZFA 3HGKA 3DK7A 4TWOA 2NRYA 4F1TA 5K0KA 5HIEA 3IECA 3ZO4A 3C51A 3EMGA 4GL9A 3HMIA 3EFJA 3ATTA 4OTHA 4IAYA 4OTPA 2QHNA 5IEYA 3C4XA 5L6PA 3G51A 2VTRA 3FXXA 3IW8A 5CS6A 3UE4A 3MN3A 2GS2A 5E1SA 2R3PA 1RW8A 3CKWA 4MQ2A 3PXRA 3QTQA 2FVDA 4P7EA 2JDOA 3OWKA 5M08A 2WQEA 3PLSA 4OTFA 4R7IA 5DRDA 3WZDA 3RWQA 2R2PA 4D28A 3PY3A 3EQHA 3F2AA 2UW3A 4FTCA 5CU4A 1WFCA 3CCNA 4QPSA 4Z7HA 3U55A 3U6JA 1WBNA 4AAAA 5A3XA 4NTTA 3RHKA 2PUNA 5HQ0A 5AV1A 2X4FA 2BRHA 5IA4A 3GP0A 4PV0A 4BR3A 3L9NA 4AN3A 3RPRA 3WF8A 3C4CA 2VZ6A 2C5OA 4NFNA 4Y83A 2WOTA 1JQHA 3ZEPA 2RL5A 1YOJA 5IDNA 5J7HA 5HTCA 5KMKA 3AMBA 3EQRA 4CLJA 2HK5A 2IZSA 2WB8A 5HCXA 2J5EA 3ORNA 3ZTXA 4K6ZA 3NAYA 4AS0A 5CEPA 5L8LA 2C6OA 3QKMA 1FVRA 2P2HA 4TYGA 3FZOA 4X6RA 5HD4A 3D2KA 4FEQA 3PTGA 3V5QA 5EDPA 2UZEA 3AGLA 3S2PA 3KKVA 3UP2A 4CFUA 3UZPA 4ERWA 2XS0A 4U81A 5E90A 4L7SA 2WELA 2G2IA 1TVOA 2JAMA 2B9FA 1XKKA 3GQLA 3HUCA 3FL5A 4WBOA 3UVPA 2QOKA 3U6IA 1OKZA 2XB7A 2VV9A 4AGWA 3GT8A 2UVXA 4CTBA 5ANKA 2OF4A 2VTNA 3R83A 3MVJA 3RPYA 2PMNX 3F88A 3M11A 4R3CA 2E9OA 4YNEA 2C47A 3FY0A 4GT5A 4CFFA 2HOGA 1OL2A 3ORPA 4DBNA 1Y8GA 2UW5A 3QF9A 5TT7A 3TDVA 5AX3A 3QLGA 4ZZNA 4EWHA 4IWPA 4QMVA 2CCHA 2JEDA 4E3CA 1Y6AA 4L9IA 4S30A 3I60A 5K4IA 1OECA 2XM8A 3KF4A 2PZYA 4ASDA 1OPLA 3RAWA 4APCA 4DN5A 3SXFA 2QKRA 5HVKA 3BYMA 2NPQA 4AE6A 4EEVA 4HW7A 5AA9A 5JFXA 3SOCA 4BCKA 2DS1A 3KULA 4QMOA 2A1AB 4ZS4A 4BYJA 4RVMA 3MWUA 3KU2A 3UDBA 4DTAA 2ZOQA 1NA7A 1WBOA 2JIVA 3AC2A 4O22A 4RWKA 1AQ1A 4TYHA 4F7NA 2YERA 3S3IA 3DU8A 3L8XA 4Y8DA 5ANEA 2ITVA 2OJFE 4KNBA 4WG4A 1H27A 5HBEA 3SG9A 4CYIA 4I41A 3UIUA 2CHLA 4GV1A 4C4IA 3NNWA 4JAJA 4BDAA 3DFCB 4APPA 4BKJA 4DLJA 4FTNA 2C69A 3GU4A 1W98A 3W32A 5BVFA 5CASA 3AC8A 2C1AA 1UNLA 5CAUA 3ITZA 4K18A 4OUCA 4KKEA 3P7CA 5BUIA 2XVDA 3T9IA 3P0MA 1OPJA 3NPCA 5FD2A 3OROA 3FMEA 1OL6A 3I81A 3I5NA 4XBRA 4CXAA 5C8KA 4G1WA 5AIKA 2QOOA 4DEGA 5EQEA 4TZRA 4BCIA 4XCUA 4R8QA 5A4LA 3O0GA 3Q2JA 4I1ZA 4ASZA 3DDPA 2ONLA 4ANNA 3Q5IA 3KF7A 2XA4A 2YM8A 2R3MA 3PA3A 4JVGA 4M14A 4F70A 4IC8A 4BWPA 4C8BA 3OG7A 4JDKA 4D0WA 4I6HA 2WHBA 2WD1A 2ERZE 4MXCA 1CKJA 2QOIA 4ASXA 4AT4A 3U54A 2WZJA 2PVKA 4MHAA 4DGMA 3PIXA 3SW4A 5HX8A 3ACKA 4YZDA 1O6LA 2X8DA 1REJA 1URCA 4YC6A 4RX7A 2VWVA 3Q6UA 4NM5A 3EHAA 4M0YA 3MY5A 4EONA 5AV4A 4DGGA 4OR5A 4FTTA 3GFEA 2GS6A 2GS7A 1JVPP 2BVAA 2W5AA 3UO4A 4F6WA 5M56A 3LXKA 2J0MB 4BHZA 2WKMA 2EU9A 2BTRA 4S31A 3R2BA 4ZSJA 3UC3A 3R9HA 3PE1A 3FMHA 3CTJA 4GT3A 5GJGA 2OZOA 3FBVA 4C3FA 4TYIA 2R9SA 2UZVA 3BU6A 2YAAA 5EFQA 2PVNA 4I5PA 4EZ5A 4FZ6A 2QKWB 3FY2A 4O91A 3FLSA 3W2SA 4DFLA 2YCFA 4QTAA 3COKA 3I1AA 2G15A 2X39A 3OCSA 4U3ZA 3ORTA 4L7FA 2BILB 2X1NA 4ZY6A 2GNJA 2PMIA 4W9WA 4GK2A 3HV3A 5DR9A 5E9EA 3A62A 3CQEA 3UNKA 2YACA 2BKZA 2QO2A 3O96A 4AGDA 3QX2A 2WPAA 4USFA 2VX0A 3MY0A 3R0TA 4O0VA 3BU3A 4USEA 2J2IB 3MESA 5DYJA 3HX4A 2GNHA 3A2CA 3QWKA 2BMCA 2QO7A 2YM7A 3G2FA 2WTWA 2CGVA 4GK3A 4WSYA 3TZ8A 4DEIA 3D7TB 4EOLA 1G8AA 3EN9A 5KZ0A 3A99A 4UY9A 5LMAA 5L4QA 3HDNA 1GZ8A 4XOYA 3BGZA 3ZM9A 4GUEA 2ZMCA 4IFCA 5M44A 2HY81 2W1DA 4DE4A 3ODYX 3DZQA 4FTQA 4TWCA 3PSBA 4DEHA 2CNQA 3EQDA 4A9UA 4AZTA 4BY9E 2RFNA 3GQIA 4H1MA 2YIWA 4I21A 4LOOA 4IBMA 4GVAA 5L2QA 4B4LA 4WG3A 5AR7A 2BRGA 2XJ2A 3I7BA 3ZUVA 3AT2A 4XHKB 4RWIA 4X3FC 5EOBA 2Y4IC 4JG8A 4M3QA 4IB1A 3ZMMA 5E8UA 4A9TA 3WBLA 5AP2A 2CSNA 3F82A 3LM0A 2ZM4A 4I6QA 3UQGA 4IX6A 5EHLA 3ETAA 1GAGA 5IH5A 1ZARA 2RG6A 4CZYB 5DT3A 2XZSA 3MI9A 2FSTX 1CSNA 1W8CA 3I79A 3OZ6A 3UVQA 3QHWA 4GEOA 2VTAA 5CSWA 5BPYA 2XNNA 2HENA 5F20A 3EYGA 4R7HA 4YJNA 3QYWA 4RQVA 3GCSA 4YTCA 1K2PA 4CKJA 1WBTA 3NIEA 2VTHA 1UU8A 2UW7A 1R1WA 2A27A 3DNDA 3QL8A 4E4MA 2H8HA 2C0IA 2QR8A 2VWYA 4OW8A 4D55A 4YO6A 1V0OA 4O7ZA 1M7QA 4FT7A 4BCNA 2BIKB 4RC2A 5J8IA 1KV2A 5KMMA 3UVRA 2YWPA 4MK0A 1WVWA 4QD6A 4DG2E 1UU7A 2QONA 4WG5A 4IM3A 1P14A 3U4UA 3BYUA 3LZBA 5EOLA 4HVDA 3AT4A 2GPHA 3HA8A 2WQOA 3PG1A 3HV6A 3FI8A 1OKYA 2C5YA 3DS6A 4MXOA 4QRCA 4CCUA 1YXVA 5FBNC 4IQ6A 4XG4A 4BTMA 3F61A 2P33A 3CBLA 4NT4A 1OM1A 3R7UA 4EL9A 4KSPA 4CYJA 3O7LD 4QTDA 3M1SA 3DJ6A 4YHTA 3FXZA 2YIRA 4IVDA 4LMNA 4OAVB 3PY0A 2O8YA 4BZOA 3PWYA 2OZAA 2IZRA 1YQJA 3DBCA 3DJ7A 2IVSA 4L8MA 1IAJA 3NYXA 3WILA 4MF0A 4L3LA 4X2JA 3LIJA 2X0GA 3DZOA 2W05A 3Q9XA 2GHGA 4U45A 3OD6X 3QQLA 3UZTA 2ITNA 2G1TA 4IM0A 2QODA 4TTHB 4YZ9A 5E8TA 4FGRA 2RFEA 3KULB 4O83A 3PA4A 2GQGA 4D0XA 3LE6A 4MAOA 3ULZA 4C3RA 1WAKA 3GFWA 4FUYA 4I4EA 4M13A 3JY9A 4GVJA 4TYHB 4ZSAA 2JFLA 4AW1A 4EHGA 3QKKA 4XG9A 4HVIA 4C36A 2W1GA 2W9FB 4C4GA 1CM8A 2BDFA 3LQ5A 2PZRA 2J90A 1YI4A 4PQNA 3HEGA 2FYSA 3MFTA 3GC9A 3FMMA 4RFZA 4AOTA 5LCJA 1UKHA 2QOHA 3PRFA 3VUHA 4EOPA 3KB7A 3GCUA 3O7LB 4L44A 1FVVA 3HZTA 4IACA 4GT4A 1O6KA 4M68A 4MEDA 3B8RA 3V04A 4FKPA 4O21A 3P78A 1GNGA 3ZBFA 2LGCA 3AOXA 4J95A 2R7IA 4D9UA 4S33A 5AJQA 3OEFX 5M53A 3BQCA 4Y5HA 4IVAA 2VO6A 4IB5A 3UIBA 5JGAA 5F94A 4FKJA 4KINA 2PVYA 5EQPA 2X8EA 2PHKA 3OMVA 4B9DA 3PY1A 3AD4A 5HNBA 1ND4A 4ORKA 2CCIA 4FV1A 3CJGA 2X7OA 3EQIA 3Q4UA 2HW6A 5KBRA 4FV2A 5KMLA 3PRIA 4K11A 5C8NA 4MBIA 5TR6A 1NVQA 4M66A 1SNUA 3G33A 4DEEA 4JXFA 4QMNA 1WBPA 1IEPA 2JKOA 3DQXA 1U4DA 4NJDA 3PSCA 3TV4A 1RJBA 2VWWA 5HLWA 4A4LA 4PTEA 5DHJA 1MRUA 4LL5A 1URWA 2FGIA 2OGVA 2W1IA 4U8ZA 2XNOA 4GG5A 3O8UA 4QMWA 4V04A 4EH8A 4G34A 1MRYA 3N4UA 3ORLA 3SXRA 2QG7A 2X2MA 3TT0A 5HZNA 1XH8A 4IC7A 3Q04A 1FINA 3F3ZA 3PUPA 3QXOA 1W83A 2W1ZA 3R1YA 3R71A 1OKVA 2SRCA 5CSHA 5I9UA 2XK9A 5JK3A 3IO7A 5J1VA 4JL9A 1H01A 3VUDA 2BZJA 1P4OA 2BTSA 4KBAA 2GSFA 1PJKA 5AIRA 4TN6A 2A0CX 2EB3A 4MBJA 1UU3A 1YXSA 3TIZA 2JDRA 5J9LA 5EI2A 2W1HA 5LWNA 1LR4A 2AUHA 3ZRLA 4AOJA 1U5QA 4ACGA 2J0LA 2JKKA 4WBBB 5IMEA 4LGGA 2WTIA 4H3BA 3H3CA 5D12A 4H1JA 3MFSA 4QP7A 5EM8A 5CWZA 3W2QA 4JDIA 3C4ZA 1OBDA 4FV3A 3LFSA 2JDVA 3MPTA 3KREA 2V55A 4ITJA 4FKIA 3ORIA 3ZLWA 2PZPA 3O51A 4AGCA 1FBNA 1P4FA 4ITIA 4IZ5A 2RF9A 4Y5QA 5HE1A 4JX7A 4JIKA 3LCDA 4E6DA 3LFCA 2YDKA 2BR1A 3ZO1A 3SX9A 3B2WA 4ZJVA 3LCKA 4BCHA 4FEVA 4R3PA 4RWLA 2OIBA 2OBJA 1M17A 1QMZA 2BZKB 2RIOA 3GC7A 5AV0A 4MNFA 2WFYA 4U5JA 1PYXA 3SLSA 4X2NA 5J5SA 3ANQA 4BDCA 1ZOEA 5ITAA 3HA6A 4RA4A 2GHMA 1JSTA 1PXIA 3L8VA 3P86A 3L9MA 4XG7A 3GCVA 2WGJA 1O6YA 5HCYA 3DV3A 4J53A 4OBQA 3U87A 5BVOA 4QO9A 5IA3A 3F2RA 4R1VA 5LVLA 4E1ZA 3C4WA 2V7OA 2QC6A 3UMWA 3NR9A 4RIWA 1FMKA 2XYNA 2OXXA 4UMPA 5E8YA 3QGWA 5BMSA 2BFXA 5IH6A 4FOCA 2UW8A 1M7NA 3WF5A 2PVLA 3C4FA 3BPRA 4ZY4A 2EUFB 4QP6A 1RQQA 3ZFXA 2PL0A 1DM2A 1FQ1B 5A54A 3TV6A 4RX5A 5JGDA 5KBQA 3DKGA 5B2MA 3R01A 1H4LA 3NVKI 2F57A 4BKZA 3LLAA 2YEXA 2EXCX 3KMUA 4G6OA 4JI9A 4NM3A 4NSTA 5D1JA 5HGIA 5KE0A 3RNYA 4R6VA 3WYXA 5B7VA 2R3GA 3G9NA 2YA9A 5CU3A 5LCKA 4QNAA 3TNHA 2OFVA 4A4XA 3FLWA 4DGLC 5JGBA 2E2BA 2F2CB 3GENA 5HG9A 1HCKA 3OXZA 4Y72A 3V5PA 2R3HA 3ET7A 4ANOA 3OY1A 5JQ5A 3PZHA 4YJTA 2C0TA 4YZNA 2XCKA 1H07A 2VRXA 3O23A 3F5PA 4FKVA 5G6VA 4AF3A 4F9YA 2OWBA 3FLYA 3PSDA 3R7OA 4YGAA 4N6ZA 3Q4CA 2XKEA 3OUKA 3U4WA 1H24A 1PW2A 4O38A 1S9IA 2B4SB 5FRIA 2OJIA 4M69A 4LUDA 2EVAA 4DT9A 3DJ5A 4XG6A 4FG9A 4WUNA 4YSJA 2XBAA 1YXXA 4Z7GA 4NL0A 1UV5A 3Q5ZA 4YJSA 4E6AA 4UN0C 4YZBA 4I24A 4L45A 2Y7JA 5M4FA 2XK7A 3F3TA 4HJOA 5FM3A 4AN9A 4FSWA 2C6EA 4QQJA 3SVVA 2F49A 4XNEA 4ZTHA 3BU5A 3IKAA 3CKXA 3OW3A 2C6LA 3IOKA 3NCZA 2JKMA 1WZYA 3W16A 3R1NA 3NYVA 3KL8A 3LFEA 3NWWA 5BUJA 2HZ4A 4A4OA 2VTTA 1FOTA 4YC8A 2KTYA 4QMUA 1YWVA 3E8EA 3IDCA 4L52A 2QD9A 4FYOA 2GNGA 4LOPA 4Y95A 2VTLA 2Z2WA 3C4EA 4IZ7A 4MD7E 2LAVA 2ITUA 4EBWA 4OGRA 1K3AA 3D5XA 4PDYA 3E7VA 2V22A 4JQ8A 5J7BA 2I7QA 3CD3A 3BELA 4K77A 4YPSA 3NUUA 4ZTMA 4DG0E 1H25A 5BMMA 3P7BA 2IVUA 2YM5A 4ZTQA 5IQFA 4HGSA 5CVFA 2OZAB 2QLUA 3O71A 3ORXA 4ZS0A 3PJ8A 4BGHA 3VBQA 4L43A 3AG9A 3KEXA 5F4NA 4BFMA 1U54B 5CSXA 2WU7A 4XUFA 4CZTA 5JFSA 3E5AA 4EH3A 4CTCA 3SHEA 4KSQA 5EQYA 4B8MA 3UIXA 1OIRA 2PULA 3T9TA 3SDJA 3VF8A 2BZIB 4ACCA 4U6RA 4PP7A 3R9OA 4RLLA 5DE2A 4CFWA 3R02A 3TKUA 4DTBA 3JVSA 4O0UA 2OKRA 3PVGA 4OT6A 1ATPE 1KUTA 3DDQA 3V8WA 2C30A 3ZCLA 2C0OA 4DH5A 3A8WA 4AWIA 2BAQA 4EJNA 4J52A 4E6QA 3TWJA 4DGNA 3W2CA 4XH6A 3FDNA 1Q5KA 3WF9A 5J79A 4CSVA 2UZUE 4O7LA 4RLKA 5AP1A 4EQCA 4QTBA 3JXWA 3EQGA 3GBZA 5H2UA 4G3CA 3GGFA 3GU8A 3OC1A 4LQMA 3NW7A 4ENYA 3EFKA 4A9YA 3BHUA 3I7CA 2CGUA 5AR8A 3R21A 4ZK5A 4RFYA 1E1XA 3VS2A 4C57A 4CNHA 4FTRA 4F0FA 5M06A 5EK7A 4D58A 1YHWA 4YTFA 1ZYLA 4YLJA 3VUGA 4ZMEA 5CVGA 4LV8A 4EI4A 4W8EA 2UZDA 5HVJA 1YDRE 5E8XA 3LQ8A 4MXAA 1X8BA 4J97A 4U43A 4XS2A 3OOGA 3AXWA 5DN3A 1OITA 5AR4A 4BDHA 4MNEA 4ANQA 2O0UA 4E4XA 3ZH8A 3II5A 4IMYA 3JPVA 4PF4A 1UVRA 5GIOE 4J7BA 1BI7A 2OW3A 2F7EE 3UPXA 3QXPA 1VEBA 4ZTRA 2H9VA 3OEZA 2UZOA 4D2PA 5HORA 2CKPA 1BL6A 2VWXA 4FL2A 4D5KA 5F1ZA 4EHVA 4BHNA 3Q96A 4EQMA 2UVYA 1ERKA 4FNXA 3TZMA 4RFMA 4M97A 3N51A 2GTNA 2FH9A 5LARA 1H8FA 4DT8A 5AUXA 1B39A 1HCLA 4FX3A 2OXYA 3UOKA 4IDVA 4O81A 2B55A 3IW7A
chains in the Genus database with same CATH superfamily
3S0OA 5AUVA 4D2RA 4AUAA 4F09A 4HVSA 1XH5A 2BDJA 4WSQA 5ANIA 4D2TA 3NVMB 2BDWA 4PL4A 4ANLA 4FSNA 4QMZA 5FXSA 3W8LA 4H3PA 4ZXTA 3R8MA 2B1PA 3QLFA 4EQUA 3IGOA 4D4RA 4KIKA 4AOIA 4O6EA 3ZU7A 4C2WA 5DWRA 2JC6A 3LCTA 4BI0A 3BV3A 3FYKX 4PWNA 4FBXA 4EKKA 5ACBC 2QOBA 2PVFA 4IB3A 4MWIA 4XRJA 1XO2B 3UNJA 4ACMA 1KWPA 2PSQA 4UMQA 2J50A 4ID7A 3QCYA 4NWMA 4PPBA 3CP9A 3WYYA 4AN2A 5L2WA 5DEYA 2OU7A 3S95A 1ZMWA 5AUWA 5L2IA 3OOMA 3UP7A 5B2KA 3ZRMA 4YJRA 1U59A 4JG7A 5EYCA 4U40A 1GIHA 3E7OA 4X3FA 5JRSA 3D4QA 2ITXA 3VW6A 2HXLA 2QO9A 3PVUA 5HO7A 4PL5A 2DWBA 4HCUA 1J7UA 5FUTA 2R3IA 4II5A 4XX9A 3ZZWA 2CN5A 3MH1A 4RJ8A 4WNPA 3VHEA 2I40A 5K5NA 4QPMA 5AR5A 4IZAA 4FNZA 3MIAA 4V05A 4L00A 3WF7A 1KV1A 3Q9WA 2I0VA 3QTRA 3R63A 4FUXA 4GJ2A 1XH4A 3MB6A 1WCCA 4RIWB 4QQCA 5I9XA 1BLXA 4JBPA 4BDGA 4Y46A 3DTWA 2FSLX 2C6IA 4F64A 3E88A 5ANDA 3PXYA 4FIGA 1VZOA 1O9UA 3MFUA 5IQEA 3CXWA 4OTIA 5EDQA 4F9CA 3P79A 4DFYA 3PXZA 3E64A 3SKCA 2XK4A 4MYGA 2C3JA 2C5XA 1UWHA 2VTQA 3CC6A 1JKTA 5HNIX 4D2SA 2DYLA 4O0WA 3NLBA 1J7IA 1PXLA 4ZLOA 4F63A 4LG4A 3UOJA 5HG8A 4C4EA 3S1HA 5DR2A 3W8QA 4V0GA 2QOCA 5EM6A 5CAOA 5JSMA 1PRYA 5CQUA 5EM5A 2OH0E 4ERKA 3E62A 4F9BA 4IAIA 4X7QA 3SGCA 4AXDA 5JN2A 2VTMA 3PP1A 4FTJA 4GIHA 1YKRA 2B7AA 5KHWA 5KO1A 5C01A 3ZXTA 4NW5A 4F78A 1YXUA 2GTMA 3H9RA 4FF8A 4RIXA 1OPKA 4DITA 4E6CA 4LRJA 4RZWA 4JOAA 3O50A 2C3KA 2CKQA 5FDXA 4RJ3A 4FT9A 4YPDA 4G17A 5HG7A 2OIQA 4JBOA 2VTOA 5F9EA 2GFSA 3RM6A 2PK9A 2QNJA 1SVEA 3QCSA 3QQKA 3HKOA 3W33A 4MH7A 4LUEA 4D9TA 1M2RA 1XWSA 2ZV2A 2C4GA 3QTIA 5IQDA 4IH8A 3IW5A 4IWQA 4FODA 4HYHA 5CZHA 1MQBA 3KCKA 5JZNA 1H1PA 1OUYA 1WMKA 2WMTA 4O2ZA 3VJOA 4C59A 5FBOA 3VS4A 4TY1A 1F0QA 4RVTA 1YWNA 2W96B 4GCJA 5CI6A 3M2WA 4ANMA 3F5XA 4DC2A 3A4PA 2ACXA 3L8SA 4KA3A 4KS8A 5TOZA 3KN5A 4J8NA 4U80A 1DI9A 3ATSA 2ZV9A 4BDJA 3JUHA 4KIOA 4DG3E 4YZMA 4W4YA 2VGOA 2WEVA 3UIMA 4A07A 5BV3A 2YJSA 4FTMA 1IASA 1PF8A 4GW8A 3NUYA 5C4LA 3G0FA 5EW9A 1WBSA 3KC3A 4DYMA 3C7QA 2QU5A 2HELA 3O8PA 3W2PA 3KRWA 4WKQA 3VS1A 4U3YA 4RJ6A 4O7NA 3WI6A 3KK8A 3C50A 1YWRA 3HRFA 3DKOA 4ALUA 3OUNB 3PXKA 4GU9A 4FYNA 3IGGA 4RGJA 2XBJA 4BDIA 5AP3A 2R7BA 3ZEWA 3P7AA 3UQFA 4O82A 2JKQA 1NW1A 2YLEA 4YJVA 2VTSA 2WTJA 3NUNA 3BIZA 3PVWA 3WE8A 2F9GA 4BN1A 2WEIA 4E5BA 5L2SA 3EIDA 5IMXA 4GH2A 2VWIA 1YOMA 4IAAA 1KE5A 4FG7A 5DLSA 5EH0A 4ZTLA 2CJMA 1L3RE 2XH5A 3LFAA 5H9BA 5CU0A 4IB0A 1L8TA 1J1BA 3PP0A 2XNGA 4W4VA 3KMMA 3BBTB 4YZCA 3ULIA 4AT5A 1TQPA 4FZFB 5HCZA 4EH7A 4DH7A 3ZZEA 4OBOA 3MA3A 3VW8A 4AT3A 5KMJA 3PYYA 5LQFA 2OJ9A 2JDTA 2NP8A 4B7TA 2WQBA 4QYEA 4TRLA 4YU2A 3BWJA 4QMQA 5ETIA 1JLUE 4NIFB 4GFGA 1NT2A 5AA8A 3KXZA 4AGUA 4A9RA 2XEYA 2RSVA 3VBTA 3SRVA 2W7XA 2WTVA 4F6SA 1M14A 3I6WA 3S4QA 2W4JA 4C2VA 4F7SA 3KRRA 4R7BA 3PIYA 1VJYA 2XNMA 3DBDA 4GU6A 3ACJA 4BJJA 3PVBA 4ZMFA 5K4JA 3ZSIA 4LRMA 4MKCA 3CPBA 5T68A 5C03A 1B38A 2BHEA 4JX3A 2PVMA 5CNNA 5C27A 1YVJA 4PTGA 5G1XA 1R3CA 4V01A 4RJ4A 3PJ2A 2I0EA 5CT0A 3RCJA 4U97A 3UMXA 1GZKA 5M4UA 1OIQA 2HZ0A 1OB3A 2ETRA 3LPBA 3RPSA 4BZDA 3EH9A 4P90A 2OSCA 4Z55A 2XJ0A 5E7RA 4WNKA 2WMRA 2Y9QA 1W84A 5EYDA 3LMIA 3O5AA 3QTXA 3TNWA 3PIZA 4PL3A 4EK8A 4EBVA 3JYAA 4B8LA 3T8OA 3DXNA 4JRVA 4X21A 1YXTA 3KK9A 3P5JC 4EOMA 2GHLA 4G16A 4EUUA 4RVKA 3QRKA 2JFMA 3DBFA 3SG8A 5CZIA 3H10A 3IONA 3VULA 5J9YA 3CLYA 2REIA 3OCBA 4ZZOA 4EKLA 2OLCA 2VWUA 4HCVA 2QR7A 4RQKA 3AT3A 2JD5A 4LGDA 3DAEA 3ZLXA 4KKGA 3NAXA 3AC5A 2O63A 4KIKB 5EM7A 4D1ZA 2XKDA 4D4YA 1R78A 4BB4A 4X2KA 1RE8A 2XMYA 2YHVA 5DR6A 4ACHA 3FHRA 5HG5A 3RAIA 3R30A 4JRNA 4YURA 5EYKA 1WBWA 4BI1A 2XYUA 4HZRA 1V0PA 2Z7QA 1ZOHA 4CKRA 5E8ZA 3C5UA 2RG5A 5AAFA 3V8TA 3VUTA 4YO4A 3QC4A 2ZDUA 3DAKA 4JS8A 3THBA 2X7GA 5JFWA 5I5ZA 2Z7LA 1A48A 1KOBA 2XIYA 1YOLA 2UZBA 3LXPA 4QPAA 1AGWA 4IFGA 1DAYA 3F5GA 4MWHA 3D5VA 2JGZA 2Y4IB 2YDIA 1STCE 1BL7A 4X3FB 5AP7A 3R9DA 4CFXA 3FYJX 4F1MA 4GG7A 3R8LA 5E91A 2JDSA 3VN9A 3ZDUA 5J95A 1Q62A 3LMHA 3GCQA 5HICA 4LDTA 3VBYA 2XF0A 1UU9A 2CDZA 1SMHA 3EZRA 5JMSA 5AR3A 1TQIA 4N4SA 4GKHA 2EWAA 2HYYA 1MP8A 1OL1A 5CY3A 5JQ8A 2XNBA 4Q5EA 2GNFA 3DXQA 1ZY5A 1R39A 5HVYA 2WIHA 2Y6OA 3KGAA 3C9WA 2B53A 3BE2A 2W4OA 3IQ7A 4Y73A 3BV2A 5ANJA 1W2DA 4FV4A 4BZNA 4F65A 4IDTA 1XBBA 1ZRZA 4W4XA 5CT7A 3C5IA 3RPVA 2YM3A 5FP5A 5D7VA 4RX9A 4HYUA 2WTKC 3UC4A 4FL3A 4GYIA 3W55A 4K33A 4P5ZA 5FDPA 1IAHA 3HAMA 4E4LA 2NNWB 1NVRA 4BTFA 3WF6A 1PKDA 1Y57A 4E7WA 2UZTA 3COMA 3TKIA 4DF3A 3E3PA 3SA0A 3CY2A 5TKDA 2BHHA 4HGTA 2WMUA 4DHZA 4DEDA 3TEIA 4IAKA 4ZOGA 3VAPA 3QHRA 4ITHA 5HU3A 4EK5A 1Z57A 3FMNA 3KA0A 2XUUA 4YHJA 4UZDA 5DT4A 4V0GB 3FL4A 4D2VA 4O84A 2VUWA 3A7IA 2YCSA 2Y6MA 2BROA 2AC5A 1I44A 1TKIA 3VS5A 4D4SA 3RP9A 2I1MA 1FGIA 4NFMA 2GU8A 4E26A 4I22A 4W9XA 2YCQA 3LM5A 2G2HA 4XP2A 4FG8A 5LOHA 5CTPA 1H00A 2Q0BA 3NS9A 4FA2A 1B6CB 2OXDA 3FPMA 2XIKA 3QBNA 4BVUA 4ZSLA 1H28A 4RIXB 4D1XA 3TJDA 3HRCA 1J91A 4R1YA 3OTVA 5CEKA 4FKLA 2QURA 3QRUA 3NDMA 3F66A 4BGGA 3AC3A 3DGKA 4FIFA 4FSTA 3BYVA 3NUAA 4QP2A 2IG7A 4I92A 4IEBA 3SOAA 3UPZA 1Y91A 4XOZA 1FVTA 2J4ZA 3L9PA 1QPCA 1JOWB 3OY3A 4O0TA 5D10A 2FSOX 3D14A 4CLIA 2FA2A 1S9JA 2UVZA 2BFYA 4U44A 2IW9A 3RJCA 2XJ1A 1GJOA 4BIDA 1GZNA 4QP1A 5KNJA 3FLZA 4PPCA 3TIYA 4FIEA 4FRFA 2X0OA 2W17A 3LFNA 4KRCA 4O96A 4UWCA 3VS0A 2OI4X 2J0IA 2FO0A 5HBHA 4KWPA 4WA9A 4HNIA 5I3OA 2QHMA 1OBGA 2XIXA 3V3VA 5IA0A 3O8TA 4FV7A 1JBPE 3NMUF 1JNKA 4IIRA 2R5TA 4AQCA 4FK6A 4XBUA 3G0EA 1XHAA 4ZTNA 3RNIA 4D2WA 2YJRA 3G9LX 2JBPA 4OLIA 5IEVA 2BAJA 2IPXA 4BCJA 1Q41A 4TWNA 5CQWA 3QCXA 3HMPA 5ANGA 1YW2A 3CS9A 1KE7A 3ZLYA 4CKIA 3A61A 2C3LA 2YDJA 4AFJA 4CEGA 3TUBA 3DOGA 1E9HA 1YI6A 4FIIA 3R73A 5E8WA 3HL7A 3RINA 1QPEA 5EKNA 3UOHA 1PHKA 3BHVA 3OW4A 2F2UA 2VN9A 4NK9A 4FKRA 4TNDA 4E4NA 5LVPA 3AKJA 3T3UA 5CEOA 1H26A 4DEAA 3ELJA 1ZZLA 3QD3A 2PVJA 2HW7A 3UG2A 4UXLA 4B0GA 3OXTA 3B2TA 4FL1A 4I6FA 4NH1A 2VD5A 3AGMA 4YLLA 1IG1A 3HDMA 3SD0A 5K5XA 4UWBA 4FGBA 2IVVA 3LAUA 1WVYA 4QTEA 4I0RA 4W4WA 3DFAA 5CU6A 3H9FA 4LMUA 2WU6A 3VWAA 4O7WA 2DUVA 3AD5A 3HMMA 4O4EA 4USDA 4E5WA 4NCTA 4BDDA 3VHKA 4ZLZA 5GINE 2W1FA 3O2MA 2F4JA 5BUEA 3AC4A 3N4TA 3R1SA 2QQ7A 4C4HA 3Q2MA 5AUYA 5HO8A 2YIYA 4RZVA 4H36A 3E8NA 3ZO2A 3DAJA 3BLHA 3BLRA 4RVLA 4JBVA 4GMYA 1XH6A 3NUXA 3EOCA 3SRVB 2J9MA 1PXOA 1SM2A 2IW6A 5DVRA 1M52A 2JAVA 3ZOSA 3CY3A 4FSUA 5J5TA 4BDBA 2ITZA 2X9EA 3OS3A 2YM4A 3Q60A 4NTSA 4O27B 1UNHA 5IKWA 3UJGA 3ZYAA 4DTKA 5LVOA 2XK8A 4BJJB 4HOKA 4XRLA 3K5UA 3FJQE 3QZFA 1G8JA 3NRMA 3OWPA 2FB8A 3IDBA 4FKWA 3N4VA 3TDWA 1Q8TA 1YHSA 2GMXA 2HY0A 1W0XC 3I0OA 4ONAA 5L6OA 2R3JA 2BIYA 4FVRA 4IZYA 3FSKA 5IZFA 1R0PA 4E93A 4DFNA 1SYKA 4RRVA 4X2GA 5HE0A 2ESMA 2A19B 3RK5A 2WTCA 4TYJA 1Q97A 4QP9A 2W0JA 3FC2A 3A7HA 3I6UA 5DBXA 5LWMA 2F7ZE 1CDKA 5FGKA 2CKEA 4QQTA 2PUPA 4ZZMA 3ZDIA 4XEYA 1ZWSA 2P55A 2FSMX 1FGKA 4FK3A 5EW8A 3ORKA 4E8AA 2PZ5A 3VRZA 4WNMA 4XJ0A 3BCEA 4HYIA 4M8TA 3HV7A 3ENMA 3TG1A 3UYSA 4YMJA 4OTGA 4ARKA 1OL7A 1A06A 2IJMA 4ZP5A 1JKSA 5FM2A 4TNBA 4CG9A 1GZOA 4QT1A 2IVTA 2J0KA 3DLSA 1UWJA 2AC3A 1SVHA 4GFOA 3R28A 4CMTA 4YR8A 5HBJA 2UW0A 4Z3VA 1JAMA 3F3WA 4O0RA 5IUIA 5IU2A 2VO7A 4O0XA 2XK6A 4GFMA 3UO5A 3BHTA 3Q4TA 5DG5A 1AD5A 5FP6A 3DKCA 3OT3A 2YAKA 4O7TA 4PRJA 5E4HA 2DQ7X 4C02A 5HE2A 5K3YA 3I4BA 4FT5A 4AZWA 5CAVA 3FV8A 2YISA 1WVXA 3LOKA 4WHZA 1VYWA 4WUAA 3QYZA 4FKGA 2IEWA 3A7GA 5CXHA 3CPCA 3QQHA 5C8MA 4G3FA 3FHIA 1HOWA 1XJDA 2C6MA 2C6KA 4XV9A 4XV3A 4AW0A 5CANA 3ZHPC 2V0DA 2R4BA 4ZTSA 1JPAA 4EYJA 2VU3A 2P2IA 5GZAA 3EQBA 3QU0A 3PJCA 5IQCA 3KXXA 1GOLA 2UW4A 1Q24A 5IUGA 2WOUA 4G31A 4PTCA 4FV5A 1F3MC 4IVBA 4IW0A 3ROYA 3L9LA 1UA2A 4BIBA 5CF5A 2IWIA 2JBOA 4FT0A 2B0QA 4PUZA 2XANA 4TKSA 3C13A 3COIA 3RCDA 4TWPA 5BYZA 3KXHA 4C4FA 4F7JA 4DHIB 4D1SA 1CMKE 4E20A 5JRQA 3E92A 3TM0A 2B9IA 4JLCA 4AZEA 3A60A 3HV5A 5IH4A 3RAKA 4PMMA 4YJQA 3QZHA 2GFCA 5JFVA 4AXAA 2BRMA 5H8EA 4BDKA 3LFFA 4PMTA 3R9NA 2OO8X 5CEIA 4N57A 2A2AA 3DT1A 3FI3A 5CLPA 4YJUA 2C6TA 3P4KA 5D9HA 5LVMA 4X6QC 5I9YA 4JBQA 3PFQA 2PE1A 3QRIA 5ACKA 3RHXA 3EN5A 4GIIA 4JIAA 4WRSA 4M7IA 4XP0A 1PMUA 4FZDB 4O7RA 1OKWA 4FICA 3PXFA 2Z7RA 3DB8A 4JAIA 4BCMA 3FEGA 2B54A 3NEWA 3LXNA 5HTIA 5CAQA 1W2CA 2JLDA 3CD8A 3ZRKA 2VGPA 1XH9A 3MJ1A 4ZSEA 3VVHA 4O4CA 2FUMA 5C26A 4WT6A 4IE9A 3WIGA 3Q3BA 3GEQA 4BICA 4KD1A 4DEBA 3LQ3A 5IQAA 3VO3A 4FTOA 2PTKA 2RGPA 2Q0NA 1DS5A 3K5VA 1E1VA 2UW9A 3GUBA 4UXQA 4YJOA 2A4LA 2HZNA 3PWDA 3QZIA 4XV1A 3TUDA 1T46A 1KSWA 3FWQA 4HPTE 3VF9A 3P9JA 4ZJIA 2ZB1A 4L3JA 4DFXE 5AUUA 4I0TA 5HE3A 3R2YA 2VO0A 5KUPA 1XBCA 2QOLA 3TCPA 3NNXA 4YTHA 3I0QA 5JEBA 3MIYA 3AMYA 1MQ4A 4HNFA 1GIJA 1Q61A 5EHOA 2WQMA 3BL9A 5HIBA 3VUIA 3QUPA 4EOIA 2PMOX 4L3PA 4HYSA 3FQHA 3QRTA 1OGYA 5AUZA 4BTJA 1G5SA 3GU6A 2B9JA 4C61A 2YCRA 3LJ2A 4EOJA 3OWLA 4I6LA 4FTKA 3GU7A 4F99A 3BQRA 4NCTC 3BWFA 4A9SA 4CGAA 4I4FA 4FC0A 2BPMA 4CT1A 5B0XA 5BVEA 3R00A 3FZRA 2OICA 3VBWA 5M57A 2ERKA 3CR0A 3IG7A 4DFUA 2HWOA 4G3GA 5DA3A 3R8UA 2R3NA 5DMZA 3FQSA 4TYEA 4JJRA 2ZFYA 2YIXA 5DT0A 4RT7A 3EQPA 4JR3A 4W8DA 2JIIA 2CN8A 4NJ3A 4DLIA 2Q83A 5CXZA 5HO6A 4FKUA 5L6WL 3MS9A 3ID6C 3EFLA 5JKGA 3DXPA 3IPHA 2P3GX 4ANSA 4FTAA 3BLQA 2BRNA 3KVXA 3NFFB 4TT7A 4JT3A 4FV6A 3BEGA 2ITTA 4QDVA 2QI8A 5IEXA 1ZY4A 3BL7A 2ZV7A 3D9VA 5DFPA 3F5UA 2W99B 2YZAA 3FKLA 3COHA 3UQCA 4O86A 3ZXZA 1IA8A 5CSVA 3RWPA 4PMPA 2W06A 3A4OX 4GRBA 4ACDA 3UG1A 4NM0A 5CALA 4QYYA 4S32A 3PJ3A 4FEXA 3TNIA 3ORZA 4CQGA 3D83A 4AACA 5CF4A 2Y0AA 5GZ8A 2E9NA 5IF1A 3W0OA 3C0HA 3W0PA 3FKOA 4H58A 4Q2AA 4RC3A 2XNEA 4L01A 5GZ9A 3UGCA 3OCGA 5IA5A 2XK3A 1ZYCA 3G90X 2PYWA 4DFBA 1G8SA 1W82A 1Y8YA 4QYFA 3G15A 3FLQA 3VS7A 4GK4A 3FXWA 4NM7A 4O6LA 4GJ3A 2ZV8A 4I94A 3V5JA 2IZUA 4DCEA 4UMTA 4FIJA 2QCSA 3NZ0A 3AC1A 2VTIA 5T3QA 1NY3A 3ZUUA 4E5AX 2C6DA 4FT3A 4YC3A 4FSMA 4EOSA 4AW5A 3DA6A 3FUPA 2V7AA 5AV3A 2X6DA 4C33A 4HVHA 3TACA 3KRJA 4DAWA 1IA9A 3C1XA 1LP4A 3MH2A 4QNYA 5DOSA 1YHVA 3F7ZA 3LW0A 5A4QA 2C1BA 4NKSA 3U9CA 3CQUA 4UEUA 4EHEA 3DK6A 4LV7A 4G5JA 1JKKA 3A7JA 3QC9A 4PDPA 5J9ZA 2WTDA 5AV2A 4CMOA 5IA2A 5IQIA 2J51A 4BL1A 5KKRC 4L53A 1QPJA 3LCSA 2UUEA 3HYHA 3JY0A 3DTCA 1ZXEA 2PWLA 4DH1A 3LMGA 1OIUA 4QTCA 4U7ZA 1Z9XA 5F95A 5CSPA 3PZEA 5AP5A 3LJ0A 2CLQA 2ZYBA 3NW5A 1YDSE 4YBJA 5HI2A 2ETMA 4ZLYA 4FEUA 4U9AA 3FLNC 3T3VA 5J1WA 1Q4LA 2VTJA 3G6GA 4PX6A 1VYZA 3OWJA 2CNUA 1F5QA 2ZM1A 3IOPA 5GJDA 5FXQA 3ALOA 3V6RA 1U46A 1Q99A 3HV4A 2IW8A 2J5FA 1H1RA 2QU6A 4IM2A 3RGFA 4HGLA 4ALVA 1DI8A 5EYMA 3RAHA 5KMNA 3K2LA 5DGZA 3EYHA 1Z5MA 5AAEA 4XG8A 1CKIA 2P4IA 3BI6A 1KE6A 3GXLA 4U0IA 1DAWA 2X7FA 4OTDA 3PUFC 5HIDA 4F1OA 4E73A 3IW4A 4FTLA 4G6LA 5DNRA 2BCJA 3IS5A 1LEZA 3SXSA 4EOOA 3BE9A 4HCTA 5HESA 1GY3A 3A8XA 5KKRB 4BYIA 3PE2A 2YWVA 4DH3A 3HRBA 5GIPE 2R3OA 5AAGA 4M69B 2Y4PA 5LJJA 4AP7A 3Q4ZA 2R64A 3LCOA 4CV8A 3POOA 4JDHA 1OIYA 2X4ZA 5HEZA 4EK6A 2W9ZB 1ZYJA 3QQFA 4ANBA 3F6XA 3EB0A 3FZSA 2W5HA 3FMKA 3KN6A 3B8QA 4F0IA 4UWYA 4C38A 3RM7A 4BBMA 1GIIA 4J99A 3RTPA 4F4PA 2PE0A 3MJ2A 4FJVA 3PA5A 3TTIA 4FNWA 2X2LA 3NSZA 4FNYA 1MRVA 2OJGA 5FXRA 4RBLA 3N9XA 4KUJA 4YHFA 2IZTA 4XP3A 1UKIA 2ZJWA 3VQUA 5CEQA 4H39A 2YFXA 4R78A 3W18A 4FSQA 3FMLA 3MTFA 4FSZA 4BRXA 5IUHA 5GJFA 1Q8ZA 2PE2A 4XLVA 5D41A 3TZ7A 1ST0A 3TI1A 2H96A 4P2KA 4C62A 2CLXA 3Q9YA 4C3PA 3BYOA 2J7TA 3UO6A 5IPJA 5LVNA 1Y6BA 2AQXA 3C0IA 4F9WA 5IISA 4I6BA 4ZSGA 4Z9LA 3HP5A 4UYNA 4RC4A 3FE3A 2R0UA 4O4DA 5IDPA 4GSBA 3SAYA 4LI5A 4J1RA 4KIQA 3GOPA 1XH7A 1ZYSA 2ZDTA 3TUCA 3BYSA 5CNOA 4EWQA 1BX6A 4C37A 5ETCA 1H0VA 3QRJA 3LXLA 4PDSA 4XG2A 2PU8A 4EH6A 1QCFA 2O3PA 3RK9A 1YRPA 2I6LA 3EWHA 2QVSE 4J98A 4XMOA 3OT8A 3RI1A 3TZ9A 4J8MA 4M67A 3PDTA 2Z02A 3R7VA 4QP8A 4XLIA 2R3LA 3IW6A 3WARA 3FKNA 4LRKA 4GKIA 4R5SA 4MVFA 5A6NA 3HECA 1K9AA 4L68A 3GNIB 4NZWB 4OBPA 4CZUA 4KS7A 3R8VA 5ANOA 3REPA 2BZHB 2GDOA 4WO5A 2OJJA 3EKKA 4QMTA 2YABA 3LVPA 4ENXA 1V1KA 5LMKA 5FTGA 1PXKA 1ZZ2A 3ENHA 2IO6A 2PPQA 5GNKA 5EG3A 2XM9A 3DBQA 3VUMA 3F3UA 4FKSA 4RJ5A 1ZOGA 3DNEA 3F69A 3KQ7A 4EORA 4RA5A 3DCVA 2ZM3A 1PMNA 4RIYA 3MGYA 1OMWA 4HZSA 2PMLX 4CT2A 3CTQA 4BCQA 2VNWA 3V6SA 3VS6A 3PPJA 1A9UA 4NEUA 4QMMA 2XRWA 1FMOE 3CIKA 2A98A 3KXNA 4CRSA 4WOVA 5HNGA 3L1SA 5A9UA 4MNEB 5JT2A 3OBJA 3POZA 3BGQA 5DH3A 1KE9A 3FQEA 3QGYA 2EB2A 2O64A 2PUIA 3HAVA 4QQ5A 3E87A 4XYFA 4R3RA 2VAGA 2XALA 1UNGA 3Q53A 1J1CA 2ITYA 4QP4A 3Q6WA 3OHTA 4L46A 4QMSA 1SZMA 4XV2A 1RDQE 3E8DA 3NYOA 4J71A 3PG3A 4EZ7A 4FV0A 4LM5A 2CKOA 5HD7A 3QALE 5FEEA 3P23A 1NVSA 2BRBA 4YP8A 4LL0A 1R0EA 5L2TA 2R3RA 1LPUA 2HAKA 4IADA 2ITOA 5HX6A 4U42A 1JSVA 4IANA 5HLPA 2JIUA 3DK3A 3NIZA 4NUSA 5BVDA 4G5PA 1PMVA 4PNIA 3UNZA 4EK3A 3MBLA 4C58A 5AP0A 4OTRA 3BEAA 4YNOA 4GYGA 5FG8A 5IQGA 1ZYDA 5BVWA 5H8GA 3ZLSA 1PXJA 2XNPA 2Z60A 5AX9A 2E9VA 5A4EA 4CQEA 2EXEA 4AZSA 2XCHA 3GC8A 4L42A 4BWXA 4DINA 3UDZA 4UALA 3DLZA 5FTQA 3FI4A 4KB8A 4QP3A 4AE9A 5M09A 4EH4A 4JG6A 5CYIA 1BMKA 3BBWA 3FMDA 3ERKA 4G9CA 3WZJA 4EYMA 4F08A 4Z16A 4QMPA 1IRKA 2CGWA 2BALA 2RFDA 3M42A 4FI1A 4FKOA 4RMZA 2UZLA 3U51A 5HOAA 4YJPA 2WMSA 3EZVA 4OTQA 3TNPC 3RPOA 4G9RA 4ZEGA 3R7EA 3EL8A 3ZFYA 4N70A 1PY5A 2Z7SA 2QOQA 4O7VA 2ITPA 1OZ1A 2RKUA 4I5CA 5L8JA 3NW6A 4KKHA 4BBFA 4F7LA 2VWZA 3W2OA 2W1CA 5FEQA 3R6XA 4AG8A 5TF9A 4TW9A 2CNVA 5I9ZA 3GI3A 4FE2A 4LFIA 2KULA 2WMAA 3MV5A 5ICPA 5ETFA 3EN4A 4DBXA 3CTHA 3MFRA 1TQMA 3PLAE 2C5NA 2J0JA 2R3KA 3OFMA 4RPVA 3UZRA 5FLFA 4Q5HA 4C4JA 3MVLA 4BCPA 1H1QA 4BF2A 4NYEA 3LJ1A 3OF0A 1PXPA 4K9YA 5H3QA 3MYGA 4JQEA 1H08A 3FPQA 4EK4A 5LXMA 2C5VA 1OUKA 2NRUA 4IHPA 3VRYA 1QL6A 3MVHA 3ANRA 3E8CA 4UBAA 4C7TA 1H1SA 2OF2A 3EN6A 4IX3A 4EOKA 5BVNA 2HXQA 1JWHA 3QQGA 3Q32A 4IAFA 4NU1A 5AP6A 5AFVA 4R77A 5K9IA 5A46A 1OVEA 3RVGA 2YITA 5AADA 4HVGA 3ZBXA 5HLNA 2X6EA 3IDPA 4BI2A 4HPUE 4XG3A 2GCDA 2PZIA 2W5BA 4WNOA 4Y85A 3TL8A 5JZJA 3KCFA 4MUQA 4BTKA 3G5DA 3ZC6A 3V01A 3U8WA 4KAOA 2YLFA 3GCPA 5I9WA 4MQ1A 4MBLA 1PKGA 3R7YA 3TXOA 2P0CA 2X8IA 3OBGA 4FV9A 2PVHA 3DPKA 3OP5A 4DDIA 2EXMA 4IVCA 4S2ZA 1IR3A 3S00A 2UV2A 4OT5A 3OVVA 2VWBA 4FV8A 5HTBA 2QOFA 3FZ1A 4J96A