3CPBA

Crystal structure of the vegfr2 kinase domain in complex with a bisamide inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
310
structure length
285
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of Aryl Aminoquinazoline Pyridones as Potent, Selective, and Orally Efficacious Inhibitors of Receptor Tyrosine Kinase c-Kit.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 285
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cpbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cpbA01
5TOZA 3WF6A 2QODA 3MW1A 4FEUA 1Y6BA 3K3IA 3NPCA 3V04A 4FMQA 4RGJA 4I0TA 4RC3A 5DT0A 4LGGA 4ZTQA 4BIBA 1JQHA 5DBXA 3Q3BA 2QOLA 3EYHA 4O7RA 3R00A 5CNOA 3RP9A 4CT2A 4BDFA 4NU1A 4YLJA 3QQKA 2FA2A 1FGIA 1YXVA 4M69B 4YLLA 1Y6AA 4MQ1A 4ASXA 5J7HA 3S1HA 3HMOA 3L1SA 3OTUA 4FOBA 5F95A 2QU5A 3UVPA 4UALA 4NYEA 1OPKA 3WF8A 2X4FA 3PP1A 5IH4A 3MB7A 4BCOA 2VO7A 3CY3A 4QP3A 1A48A 4RVLA 3TUCA 4JX7A 2J2IB 5A6NA 5LVMA 4IH8A 2XCHA 3ORZA 3W55A 4BRXA 3A7HA 1VZOA 3GQIA 3VUTA 5BYLA 2PVKA 3I7BA 3VHEA 2VWWA 2B53A 3JYAA 3SXRA 4ANSA 1WBVA 2J0JA 4AS0A 2Z60A 3EH9A 4TYHA 4XNEA 4O6LA 1CKJA 2C30A 4WNPA 3P9JA 3RNYA 2QLUA 3OXTA 1MP8A 4PL5A 3GU4A 4DFNA 4TL0A 4AW0A 2R9SA 2C3IB 1P4FA 2XM9A 3O71A 4HGTA 3MA3A 2OJFE 1SYKA 3MB6A 4YZ9A 3TNIA 4F6SA 1J7UA 4DTBA 3DKFA 2X1NA 3VBVA 2QOCA 3NAXA 3TACA 3RWPA 4BCKA 3EJ1A 4QMYA 5E7RA 4KKHA 3MY1A 3TT0A 3M2WA 3HV6A 3G2FA 4WRGA 1QPDA 3MN3A 3SC1A 4C38A 4DTAA 2GNJA 5C4LA 1REJA 4NTTA 3R9RA 2R0UA 3U9NA 4C58A 3LFQA 4FKVA 4AAAA 3ZMMA 3QC9A 4EOOA 2UW7A 4FL1A 3E64A 3KVWA 4I4FA 1E9HA 1DI9A 4ZP5A 1O6YA 3OXIA 2HXQA 3PJ2A 4D4VA 4FKSA 5D41A 5CEMA 2XM8A 3MY5A 4BZDA 1TKIA 2X2LA 3IGOA 4HCUA 5CZHA 3WILA 3BYSA 5GINE 3CXWA 2QHMA 2PMOX 4ZY4A 5IQIA 3SAYA 1GJOA 4FEQA 1IRKA 2CDZA 3OW4A 3ZXTA 4O96A 5L8KA 1V0OA 2VWZA 2ERZE 4Z7HA 1PXIA 3D15A 3E88A 3OHTA 5DI1A 1H07A 2UW5A 4V01A 3RAIA 3GNIB 4GT3A 4QP4A 4CKRA 4CFNA 3JVSA 1SZMA 4BKYA 3IECA 4AP7A 4B6LA 2XNPA 2BDJA 4RIYB 4RQVA 1RE8A 1MQBA 3QTWA 3VS1A 1GY3A 4CTBA 1H08A 4AA5A 2PZRA 2I0EA 4F0IA 3QQLA 2O64A 3HVCA 4JBPA 4AWIA 3I0OA 4I6FA 4NFNA 1T45A 4FODA 4R3RA 4TWNA 3ERKA 3K3JA 4DFXE 2UZWE 4JVGA 1BLXA 5E90A 3ZH8A 4F9BA 3HYHA 3LIJA 3ALOA 5KE0A 2JIIA 5IQBA 3QCYA 2X81A 5A54A 1BKXA 2YERA 2XK6A 4CYJA 4XG8A 2DUVA 3MA6A 2Y6MA 3AD4A 3OCBA 2ETMA 2ZB0A 4TWPA 4YZDA 4AU8A 4L42A 1UA2A 3O8PA 1YXSA 3LLTA 2YACA 3WIKA 5J1VA 4ZEGA 4YU2A 2XK8A 1M2PA 4D2SA 5IA2A 2IZUA 5LXMA 4ZTNA 2X0GA 4XEYA 4OAUC 2HYYA 2A27A 3UOJA 5H8GA 4GG7A 5KKRC 5AWMA 4CQGA 5AUUA 3QTZA 1JKLA 1PMNA 4LOPA 3GU6A 4KRCA 4S34A 3WZUA 2YM5A 3GEQA 4YC6A 3QQFA 2WQEA 3BU5A 2QOBA 3S2PA 4QMOA 4RLLA 1SNUA 3VS3A 3H3CA 5J7BA 2UW9A 5A9UA 5KMMA 4YZCA 4ZOGA 4ASZA 3TJDA 4F09A 3Q9XA 2GTNA 2P3GX 4U43A 2F57A 4X3FB 1G3NA 4QMLA 4UXQA 2AC3A 5E8SA 3DK3A 5B2KA 4EK4A 5AA9A 2CNVA 2B54A 4IVBA 3R22A 2CLQA 4F9AA 2VWIA 5M44A 3G9NA 3Q4UA 1PXOA 4UMRA 4ACDA 4MTAA 4O7WA 4R77A 2FB8A 4DH1A 3M1SA 1L8TA 5AV1A 4BKZA 3LJ1A 4RJ5A 5IMEA 4FICA 2EUFB 2BILB 3AXWA 4F7LA 1YI3A 3PVUA 3CPCA 4MF1A 2I40A 1IASA 3KA0A 4WG3A 4EZ7A 1I09A 4FK6A 1K3AA 3UQFA 3QRTA 4IM0A 3QA0A 3EFJA 2UZEA 1H8FA 5ACBC 4BTKA 3ACJA 5TO8A 4BVUA 3UNKA 5HOAA 4GK4A 3TIZA 3C4EA 5CU3A 3WF7A 4EK6A 4MNEB 4G6OA 2BVAA 2RF9A 3H30A 4F0FA 3DBDA 1Q3WA 2O3PA 3JY0A 2Y9QA 4OLIA 3F5GA 3C4ZA 5FLFA 5FRIA 4JQ7A 3DKCA 4HW7A 4ZY5A 3BLRA 3NMUF 2WTWA 2PVJA 2PVLA 3HP2A 5IG1A 4CNHA 1H0WA 4ANOA 3DLZA 4FIIA 5I5ZA 2NRYA 3JVRA 4U81A 5D11A 2VTMA 2X9EA 4A9YA 1Y8YA 4R7IA 5HE3A 2J50A 2C6DA 3G5DA 3KULB 4EH4A 4Q9SA 3PG3A 4I22A 1JSUA 2QD9A 3FC2A 4QOXA 2NRUA 4I5HA 4R6VA 5I9WA 5CSVA 5JFXA 4YPDA 2CCHA 4TWOA 4YO6A 3HX4A 4IFCA 3LFDA 3Q5IA 3OFMA 4I6QA 5J5SA 5HTCA 4TNBA 3ZBFA 1JAMA 2UV2A 4KBAA 4CG9A 3UVQA 2C6MA 3CKWA 4HOKA 4OTFA 5AP0A 5KO1A 1CKPA 1IA8A 2BZIB 4LI5A 4X0MA 2BALA 3SRVB 3RTPA 3P79A 2B9FA 3LW0A 1M2QA 4IIRA 5ANGA 1YHVA 3VS6A 3II5A 3D7TB 4XCUA 2JKMA 5M4IA 5IA5A 1A9UA 4EOQA 2JAVA 3OT3A 5ETIA 4OR5A 1UWJA 4DTKA 1ZXEA 2YFXA 4IX5A 1PYXA 4LRJA 1JKSA 3V5QA 4G3EA 4RLKA 2I0VA 4V05A 4CZYB 4IB0A 4C3RA 4DEEA 4MXYA 1DM2A 4IX4A 3NNUA 4ZJIA 4GKIA 3C4FA 4KSPA 3MH2A 4LUDA 2E9PA 4O21A 5M57A 4BWPA 2PUUA 3DBQA 4KNBA 4EKLA 3EZRA 2UZUE 1UWHA 3N4TA 2IVSA 3R30A 5E8YA 4PNKA 2VWUA 1PJKA 3O50A 1OKZA 1QMZA 5DEWA 3SKCA 3SD0A 4P5QA 4AT4A 2X9FA 1H24A 4ALUA 3F61A 2YIWA 4AZTA 3ZZEA 1YOJA 3QUEA 2R64A 5F20A 3UP2A 3FEGA 2XB7A 4YC3A 2QC6A 3PXYA 4B9DA 3BHHA 5K4IA 4PTEA 5BUIA 4EYJA 3KY2A 4LRMA 5LVNA 3F3WA 2BUJA 3KKVA 4X6RA 5FM3A 5LVLA 1BL6A 3NYOA 3ORTA 3AMAA 4NUSA 3EQBA 4FTKA 2X4ZA 5AJQA 5KBQA 4N0SA 4GIHA 4MXCA 4DCEA 3MVLA 5D7VA 3MVJA 2WMXA 3CS9A 2OI4X 2VTIA 3IDCA 3Q2MA 4QYFA 2Q0NA 5M4FA 3COIA 3P08A 4TT7A 1Q99A 5KCVA 4DN5A 3UG1A 5IQDA 3ULZA 4FTJA 2RGPA 3GT8A 4GFMA 2BFYA 2P4IA 3QD4A 4WIHA 4DH8A 3FJQE 1PMUA 5FXQA 3O0GA 4J8MA 2X8EA 2F2UA 4NM0A 3RPRA 5DGZA 1K2PA 5AUXA 2XNBA 4Y8DA 2C69A 4EYMA 3N4UA 4ZSAA 4E6QA 4O1PA 4C4IA 3KRLA 4Y5QA 2WNTA 5J5TA 1B39A 2O8YA 4IB5A 1JKKA 2UVXA 3UYTA 3FI4A 3UNZA 3AD5A 5AP1A 3EWHA 3VF9A 4HVIA 2JEDA 2B9JA 1Q8TA 5IH5A 3G6HA 4FL2A 3F9NA 1RDQE 2PK9A 3MPTA 4N6ZA 3M11A 5ANIA 4B0GA 4WOVA 3QTQA 3HECA 4CRSA 1PMVA 2WGJA 1Z9XA 4QMSA 4G5JA 2OF4A 4JR7A 3K54A 5C27A 1DAWA 2OJ9A 2UW0A 5TE0A 2WOTA 4F0GA 3IO7A 3KXGA 2PPQA 3I7CA 4BBMA 2WMVA 2YJSA 1JSTA 4G3FA 4ITIA 1YW2A 5HORA 1JWHA 4LM5A 5HX8A 5KMIA 5L6PA 4G16A 3UZRA 3F3UA 1YXXA 2G2FA 4OBPA 1PHKA 2XNGA 3DJ6A 4Y73A 4RA5A 4QYEA 4ZIMA 3WYYA 3AQVA 3FI8A 2GFSA 3U9CA 1UNGA 2UZDA 1VJYA 1WBNA 1PXNA 3VC4A 2YN8A 5ANEA 4HVDA 3P0MA 4ASDA 2PVNA 4OT5A 3BQCA 4NCTA 3BEGA 4FG9A 5IQHA 1GZNA 3DZOA 4BCNA 3BYMA 3GUBA 4TY1A 3TKUA 1ND4A 1OI9A 3HUBA 5AA8A 4IFGA 5DPVA 1GZ8A 3DB8A 3FKNA 5CQUA 5HX6A 4FZ7A 4U6RA 3QQHA 4PTGA 2A4LA 2XYUA 3UOLA 3V8TA 2JDRA 2QONA 4ZMFA 3E5AA 3OBJA 5M53A 3NVMB 5F1ZA 2JIVA 1W82A 5EW9A 3L9NA 2R3OA 1NXKA 3TIYA 4DAWA 3ITZA 4G6NA 2QR7A 3SW4A 4QD6A 4ENXA 5IA1A 5FUTA 5JH6A 3KMMA 5IUIA 3HRCA 3C1XA 3BHYA 4LL5A 4MWIA 4CV8A 1YKRA 3F2AA 3PA3A 4H3BA 4CFMA 4BGQA 3BBWA 4B4LA 5HG8A 1GZKA 3KXNA 4Z9LA 4UYAA 5I9ZA 3E62A 4YZNA 3LHJA 5LCJA 2XKFA 4BIEA 1WBSA 1WVXA 3V3VA 4AOIA 2C6KA 3DNDA 2X2KA 1YDSE 2OZAA 4HYIA 4UEUA 1OUKA 3A7FA 4ZMEA 2IW6A 3PUPA 3CKXA 3ZM9A 5LOHA 1YHSA 2RFEA 3POOA 4JL9A 5CZIA 5DMZA 4PMPA 3Q6WA 3KXXA 4CQEA 5CXHA 3UJGA 5T3QA 4KAOA 2VTAA 5J9LA 3D5VA 2IZSA 2ONLC 3Q4ZA 5HIEA 3BKBA 2W1DA 3RJCA 3UGCA 2RL5A 4TWCA 1M52A 4TYGA 4ZTLA 3W32A 4BTFA 4E4LA 4DE4A 4DFUA 1GIHA 3R2YA 4ZLOA 3I60A 4O0YA 5DRBA 4K6ZA 3NW7A 2GCDA 4W9XA 5EM6A 5T68A 1YI4A 2VO3A 5HE1A 4QRCA 2ITPA 3KL8A 5A4EA 5JFWA 3EQRA 5EM7A 2GNGA 5JGBA 5EDRA 2BAKA 2Q0BA 3ZTXA 2GHLA 2ESMA 4BDCA 5EKOA 2WMQA 3D2KA 4L44A 3V8SA 3BV3A 3QZHA 3ZOSA 4C3FA 4M67A 4BC6A 4KUJA 5JK3A 4F6WA 3EFWA 4F4PA 2X8IA 4CMUA 1ZWSA 2F7EE 2VGPA 2JFLA 3D9VA 4AN3A 1UV5A 2ZB1A 4KS7A 2H8HA 3PIZA 4MAOA 2ZV9A 3EQFA 2W5HA 5K0KA 4ZTMA 1QPJA 2P0CA 1XH9A 5M06A 4QMMA 3AT4A 3BU6A 3KMUA 4C4FA 2C0OA 5HNGA 3BYVA 4BR3A 4QQCA 3N4VA 5EW8A 1M7NA 4DEDA 3GQLA 2CGVA 2XIKA 5LCKA 4G5PA 4DGGA 4YJRA 4EOMA 5DFPA 2OFVA 4D1XA 2CKOA 4BCMA 3V5LA 2QOIA 4FKQA 2JAMA 5AP3A 2CKEA 4FTMA 2QO7A 3OVVA 3ATSA 4PDSA 3ZXZA 4EK8A 3VUHA 4UZHA 4EI4A 1CMKE 5IUGA 1O9UA 2VTJA 3O17A 4LOQA 3ORPA 2GQSA 3GP0A 4FIFA 5KMNA 4PPAA 4PP7A 1U59A 5HE2A 3V5TA 3OT8A 4E4XA 2O63A 5HO6A 3C0IA 5HCZA 2YZAA 2RG5A 5DR6A 4L3JA 2P2IA 3MJ2A 5K0XA 1Q5KA 1YRPA 3EFLA 3PIYA 4RRVA 4S30A 2ITZA 4MBJA 4R7HA 3AC8A 4FV2A 2YIYA 4XG9A 4IAFA 1KV1A 3DK7A 4IX6A 1UU7A 5L8LA 3OCTA 4IB3A 4JX3A 4A9TA 3EN5A 4QMNA 3LE6A 3UO6A 1Q3DA 2JGZA 2OZOA 2IJMA 3W8LA 4RWIA 5LMAA 4HVHA 4V0GA 3HP5A 1BX6A 1VYZA 3VW6A 4A9SA 1OVEA 5IZFA 4DBXA 1R0EA 3DB6A 2GTMA 3ZEWA 4AA4A 3IOKA 2BTRA 3WI6A 3ELJA 4MXXA 3VHKA 4G31A 2CPKE 4TYIA 5CI6A 4YNEA 4X2GA 4JG6A 4RIWB 4D9UA 2V7OA 4JIKA 3MFSA 3MBLA 5KHWA 2J51A 4FNWA 5CLPA 5CALA 1GIJA 4RJ8A 3W2CA 4ZSJA 2XEYA 4UMQA 3DOGA 4RC2A 5FBNC 4GYIA 4QTBA 3QZFA 2VGOA 5DT3A 3LVPA 1KE8A 5FTOA 5L3AA 3SHEA 3FMHA 2BAQA 5DOSA 5AUZA 5CU4A 4FKLA 4JRVA 2WTKC 4LG4A 4CFWA 3CGOA 3QCSA 3QWKA 1H4LA 3FXZA 4JRNA 4A7CA 4GIIA 3RI1A 4F9YA 4AACA 3O7LB 4QNYA 4BFMA 3ZO3A 4UN0C 1WAKA 3VUMA 5CEPA 2PE2A 4QT1A 1YDTE 2JIUA 1YXTA 3H10A 3GU7A 3PG1A 4TPTA 4OW8A 2W0JA 4BCHA 4KIKA 3SVVA 2W06A 5CAPA 2J4ZA 2Y4IB 2QOOA 1LEWA 4GW8A 4PRJA 4RFZA 3TNQB 4GEOA 4KABA 3V6SA 4EONA 3LAUA 4BCQA 1OKWA 2C5NA 3R1YA 2UW8A 4FKRA 4FSTA 4O0TA 1ZLTA 4IJPA 4KBCA 3RHKA 4DHFA 5GJDA 4E7WA 3I6WA 3TNPC 3CGFA 3SOAA 4L46A 4DLJA 3KRXA 4U7ZA 3T8OA 2OBJA 2UVYA 3KK8A 5GIPE 2IVTA 4YTCA 2WMSA 3AC4A 3IGGA 4U5JA 2OJJA 3L9PA 3VUGA 5LWNA 4EL9A 4USFA 4C62A 5AV2A 1U54A 2WPAA 5EYMA 3AG9A 3UO5A 3G90X 1URWA 2BHEA 5A4CA 5EHYA 2WQOA 2W99B 1NVRA 4IVCA 4PL4A 3VO3A 2W5BA 3G0FA 3PY3A 2CSNA 4PY1A 3NUYA 3B8QA 3FMKA 2VU3A 4CMOA 4DC2A 3FHRA 1S9JA 3R8VA 1YWNA 2GNIA 2R3QA 2VWBA 3QQGA 3L9LA 4GCJA 2I0HA 5J87A 3VQHA 3W2SA 4M12A 5C26A 3KU2A 1ZYLA 4ZSGA 2VX0A 4XG3A 3ZSHA 4CLJA 1DAYA 4I23A 5HCXA 1KV2A 1H1SA 4QMVA 3Q9WA 2WU7A 1J3HA 3BHUA 3GGFA 5JQ5A 4HYUA 2Z7SA 5KUPA 4L43A 3VULA 4AGDA 4F1OA 2GQRA 5T6KA 2PL0A 4FSRA 2WQMA 4QMWA 3UPZA 3KC3A 2JBPA 5AFVA 4IWOA 5CU2A 3TTJA 2KULA 5HG9A 3BGZA 3KN5A 4I4EA 4FNXA 1OMWA 3QD3A 5JRQA 2PE0A 4AZVA 5DH3A 3UE4A 2OIQA 3F3ZA 4HNFA 3MESA 1M7QA 4EK3A 1XR1A 4D58A 4MNFA 1SM2A 3ZLXA 2VTTA 4X2NA 2QVSE 3Q96A 3ZC6A 3HV5A 4PF4A 4TXCA 4O0SA 3RK9A 5FP5A 4FZAB 1I44A 3SXFA 3FXXA 2OF2A 4E1ZA 3R8LA 1SVHA 1WVWA 1E1VA 3P5KA 5EI8A 2C3KA 3D4QA 3QKMA 2QG5A 3DJ7A 4FBXA 5AP5A 4FT5A 5AIRA 4AFJA 4MHAA 4Z16A 1OL2A 1U5QA 4XOYA 2A19B 4LRKA 5GZ9A 4W8EA 3UODA 4WBBB 2YWVA 4J8NA 5CVGA 5HEZA 4K18A 4L3PA 4EH2A 1LR4A 3KF7A 2JDVA 4RJ3A 3ORNA 2XP2A 2V22A 4GG5A 4LV8A 5HVYA 2R2PA 4RJ4A 2CKQA 3UOKA 4ZS0A 2HWOA 3KCFA 1Q8WA 3WE8A 2ITVA 4JG7A 2UZVA 4D55A 5C8NA 4UMTA 3OWKA 2R3HA 3LCTA 1ZOEA 1E1XA 3A4OX 5ANKA 1H1WA 3PWYA 3IDPA 5H8EA 1BI8A 4QMTA 2C5YA 1A06A 4W4YA 1R39A 5EYKA 1LP4A 2C3JA 4S31A 3P7BA 1FPUA 5CF4A 3ENHA 4JBVA 2XK4A 4AZFA 2PZYA 5HCYA 4J71A 3EQGA 3OUKA 4M97A 2V55A 1VYWA 3O2MA 4CD0A 1FBNA 4BY9E 1OITA 3NS9A 4NM3A 4O2ZA 4X21A 4C0TA 5IA3A 4MK0A 2JDOA 2XCKA 3A7IA 5HLNA 5KMOA 3QQJA 5HNIX 2YAKA 1XWSA 5I9YA 3RBWA 4XMOA 1Q8ZA 4XRLA 3TKIA 4TW9A 3GFEA 2J7TA 2XK9A 5AR2A 4GU9A 2X6DA 3R02A 4FV7A 2Y6OA 3OY3A 3AGLA 4C34A 4QMUA 5HO7A 5K5XA 5C01A 4FKOA 4ZSLA 3CJGA 3OEZA 4XP3A 1Q4LA 3NW6A 3A7JA 3MH1A 3O23A 2XBJA 2OO8X 3CJFA 4FKGA 4TKSA 3ZLWA 4DT8A 4DLIA 5AMNA 5L2IA 4BYJA 4XV1A 5EG3A 3ZFXA 3RHXA 4Z7GA 2ZM3A 4PDOA 1SNXA 5CT7A 4FV8A 5HLWA 5KMKA 2VWVA 3DZQA 1PXJA 1UNHA 1XH5A 5JRSA 4GYGA 2EB2A 3RPYA 4XLVA 4B8MA 4FT3A 3EIDA 3BIZA 5EDPA 5IUHA 4DFBA 4ZJJA 1CDKA 3OS3A 3B8RA 4PDPA 3ZO4A 4JQEA 1MRUA 4OBOA 2QQ7A 4QP1A 3MSSA 4M7IA 5D12A 2W1IA 4KIOA 1QCFA 4E5AX 3QTUA 2OSCA 2WELA 3GOPA 2Q83A 3PPJA 3BYOA 2PU8A 3ID6C 2W5AA 4NK9A 3QL8A 4F7JA 4FT0A 5HICA 1KSWA 3DKGA 2OZAB 5D1JA 2PVHA 5ANJA 4ZZOA 2J6MA 3FMNA 3CEKA 3WOWA 1APME 1P2AA 3QX2A 2X7OA 5TF9A 3LZBA 4RFMA 4YJSA 4IZYA 2BZJA 1BMKA 3JPVA 3F69A 2XA4A 4NM5A 3DT1A 5FEQA 2ZM1A 2W1CA 2WMWA 4EOJA 3IW6A 3OBGA 2HCKA 4WG5A 3SW7A 3RGFA 5J8IA 3RM6A 4L53A 2WEVA 2KTYA 4BWKA 3QC4A 1B38A 4APPA 4EH5A 1IA9A 3PRFA 4W8DA 2WD1A 5I9VA 2YM7A 4AZWA 5B0XA 2W7XA 5IQEA 3QGYA 2VTHA 2CNQA 3ULIA 4M68A 4ZTSA 5HNBA 5TR6A 2ZV7A 4FSQA 4BWXA 4UX9A 3R2BA 2VTLA 1U46A 3E92A 4EOKA 4LFIA 4D2WA 5JEBA 3ZONA 1Y91A 4WRSA 2R3GA 3L8SA 3BPRA 4EJNA 4KRDA 4ACHA 1OL7A 4UWYA 4YJVA 2JBOA 3V6RA 5IMXA 3CD8A 3OUNB 2JDSA 4IHPA 2VN9A 3A60A 3GCVA 1KOBA 4I93A 4GRBA 3LCSA 4W4WA 2QCSA 4BCPA 3OTVA 5FM2A 3UBDA 4GS6A 3SG9A 4K11A 5CSPA 4MXZA 3FV8A 3ZRMA 4K33A 4JOAA 2F4JA 5M56A 5DRDA 3FY2A 1OM1A 2QOHA 4AG8A 4JDHA 3VN9A 2FYSA 4EORA 5DR2A 4JQ8A 3MJ1A 4QQ5A 4OTQA 2OXXA 4HPUE 5AV0A 2ITWA 2V7AA 3HNGA 4S33A 4YZBA 3MPMA 3FLQA 3VBXA 3VS2A 4YSJA 1BL7A 4PMMA 2JKQA 1ERKA 4C37A 3OF0A 4ACGA 1BUHA 3QUPA 5E8TA 2XJ1A 4N70A 2XF0A 2YABA 2J0LA 4U44A 3OC1A 4KB8A 3C0GA 3QCQA 4KD1A 1YWRA 2B52A 2YCSA 3E7VA 5L4QA 3KCKA 4IAZA 4KIQA 4A4OA 4AGCA 4BHNA 5DWRA 4P2KA 2R3PA 4CFVA 4NSTA 3PP0A 1GIIA 2DS1A 4AGWA 5BVDA 4AN9A 4OTRA 2ZDTA 2JDTA 1OIYA 3D94A 3MWUA 1XH6A 3GCSA 3JS2A 3QCXA 4V0GB 3WYXA 4D2RA 1J7IA 1RW8A 5I4NA 2P33A 2OU7A 4PQNA 4RFYA 4FG8A 4XS2A 3RZBA 3C5IA 5I9XA 2YJRA 3RPOA 3SX9A 3W2RA 3FZPA 2C6EA 4RIXB 2PUIA 3PVGA 4FI1A 3TV6A 3FLNC 5LJJA 5EW3A 2B55A 2BDFA 5DE2A 5J95A 4NW5A 5BVOA 2ZAZA 2YDKA 1MRVA 4XX9A 3HA6A 3HRFA 4NIFA 1CKIA 3DTCA 3HAMA 5CANA 2H34A 3TV7A 1Q61A 4AOTA 4BZNA 3Q60A 4XP0A 4FKPA 4YP8A 3PSCA 3PJ3A 3NIEA 3BELA 4PPCA 5M08A 2OIBA 1PXPA 3VF8A 4EUUA 3LLAA 4PNIA 5HBEA 5CASA 3R7GA 3H9FA 3NUAA 2AC5A 3VUKA 2UZTA 4GK2A 2WAJA 3FI2A 3OG7A 3PE1A 4X2JA 5FG8A 2QNJA 5E91A 2FSTX 3VBWA 3ORKA 4ERKA 2G1TA 3KQ7A 4MEDA 2I7QA 3VWAA 4S2ZA 4I94A 4ASEA 3DU8A 4KIKB 5E8VA 3PWDA 5BMMA 3BX5A 3D2IA 2R3IA 4OUCA 3DQXA 4RJ6A 4J52A 3H0ZA 4YTIA 2YM4A 2BFXA 3ROCA 3QHRA 3T3UA 3NRMA 1Q62A 5CI7A 1XH4A 3MI9A 3QF9A 4U42A 5ETFA 3WBLA 1H1QA 2Z7LA 3WIGA 3ZSGA 3E7OA 4J98A 4O7ZA 1JBPE 2X7GA 3CP9A 3A4PA 3FZTA 3UQGA 4E4NA 5LVOA 3FC1X 1TQMA 3G15A 2ZMCA 3LMIA 4R8QA 4U3ZA 3OD6X 3QU0A 4K8AA 2CN8A 4WD5A 3LQ8A 3R1SA 5CS6A 3BGQA 2XKEA 3R71A 5C8MA 3UYSA 2ETRA 2B9IA 2RG6A 2ZMDA 3GVUA 3LFEA 3E93A 5BVEA 5H8BA 3RKBA 5HTIA 1Q97A 5EYCA 2F7XE 1JKTA 3PZEA 1UKIA 2J0MB 4GH2A 3P7CA 2O65A 5IQGA 5LMKC 3R7YA 4YTFA 4BBEA 1OZ1A 2VZ6A 3T3VA 5DYJA 1LPUA 2BKZA 3R0TA 5FQDC 5K9IA 2QU6A 1NVSA 5DG5A 1V1KA 2XH5A 4MYGA 4Z55A 2VX3A 4HJOA 3W2PA 4PMSA 2G2HA 3UC4A 3QKLA 2C4GA 4BDAA 4GU6A 5EOLA 2GHMA 2WXVA 3AC1A 4BGHA 5L2WA 2NP8A 3BYUA 2HZNA 3LFSA 2YCQA 4G34A 3E8CA 1Z5MA 3VQUA 3CE3A 5F94A 4QMQA 4JAJA 3DY7A 3FDNA 4C61A 4YUQA 3R7OA 2XIZA 1KE5A 4IQ6A 4MD8E 4Q5EA 3FI3A 3W2QA 3ZDUA 3TDWA 1MQ4A 1JPAA 3UZPA 2Y0AA 3E8EA 4RJ7A 4A06A 3NCGA 4EH3A 4HVSA 1YOMA 3Q4CA 3F7ZA 5BNJA 2H96A 2G2IA 1SMHA 2YCFA 3BWJA 2QR8A 2W05A 4FVQA 4U41A 4E20A 4EOLA 5JGDA 1XH8A 5AUVA 2GQGA 3TKHA 4E5WA 4CV9A 2OLCA 3TV4A 4LUEA 3F82A 3KEXA 4OBQA 3FQHA 5AP6A 4U9AA 1MUOA 2WHBA 1WFCA 4F99A 5EH0A 2ZOQA 3H9RA 3VNTA 4J1RA 4FZ6A 4C7TA 2B4SB 2G9XA 5A6OA 1GZOA 4RX9A 1BI7A 1R0PA 1KE9A 3BWFA 1FVRA 4JT3A 4L7FA 3ZFMA 4FGBA 5IDNA 3LXNA 2B0QA 4IW0A 4TRLA 3KREA 3COHA 3RZFA 2IN6A 2CMWA 3LOKA 2I6LA 5JKGA 4L67A 4KBKA 4PTCA 3DXNA 2OK1A 4OTIA 4EQUA 3I4BA 5CWZA 3OXZA 4CVAA 3PZHA 3VS4A 4APCA 5FTQA 2OJIA 2IVVA 3NX8A 4DG2E 1DI8A 5I3RA 5EQPA 3REPA 4GL9A 3TM0A 3ZO1A 2FSOX 4EJ7A 5A46A 4G1WA 5ETCA 4AW1A 4BDHA 3F88A 5BVFA 3UIBA 4FEXA 3QRUA 4CYIA 3F7WA 4F1MA 2H6DA 2RFSA 3M42A 4UMUA 4C4HA 5B7VA 5CF5A 2EXMA 1UU8A 2J0IA 4YR8A 5E4HA 3TZ7A 4C4JA 3ET7A 4JBQA 3ALNA 4EH6A 4GVAA 1OL6A 4EQCA 5A4TA 3K5VA 4YSMA 3NWWA 2A2AA 2J0KA 3OP5A 4FTNA 4TYHB 3UIXA 4QMZA 3FMMA 5EDQA 4FNYA 3T9TA 3NNWA 5DA3A 3LFAA 3N9XA 5L6WL 1ZY4A 4EKKA 5CQWA 3EOCA 2XRWA 3OMVA 1M17A 3CPBA 3SXSA 5L6OA 4L45A 2C5XA 4GFOA 4X3FC 3QTSA 3U4WA 5CF8A 4MD9E 3EZVA 2ITXA 5JZJA 4JIAA 1O6KA 3NYNA 2C6LA 3F5PA 4GSBA 3KRJA 4KIPA 1QL6A 3WZDA 3L8PA 3EB0A 5GJFA 5IEVA 3MIAA 5KMLA 2UUEA 4NM7A 4H1JA 4ACMA 2R3RA 2PMIA 2WMTA 2V5QA 4H3QA 4BIDA 3U6HA 3MS9A 3FPQA 3L8XA 4M13A 3NIZA 1PY5A 2R3NA 4F9WA 4ALWA 3I6UA 4QP7A 1Z57A 2V0DA 4BI0A 3D0EA 3VRYA 5EQYA 3WF5A 3UO4A 5JZNA 3COMA 3BLHA 3HV7A 3TWJA 3FZ1A 3U54A 4BL1A 2IO6A 4FGRA 2YAAA 4BICA 2QURA 4QPMA 3FWQA 4W9WA 2R3MA 1J1CA 4CKIA 3A62A 1URCA 2BCJA 2RFNA 4IM3A 2RFDA 4I41A 4XV3A 3W2OA 4ANMA 4AFEA 2YEXA 4CFUA 5DVRA 3P78A 5J9ZA 4TTHB 4G6LA 2YCRA 2FGIA 2R3JA 5EK7A 4E6DA 3MV5A 4XP2A 4BZOA 3DNEA 4FVRA 1UNLA 4NT4A 2QLQA 3F5XA 5IQFA 2XJ0A 3E8NA 4O7VA 3JY9A 1UKHA 3K2LA 3PJ1A 4O7LA 4DFZE 4LL0A 4ID7A 4YJOA 5FBOA 4O7YA 4B7TA 3I79A 4XHKB 1WMKA 2GHGA 3NDMA 3HLLA 3ZUUA 1FMOE 2BRMA 2UW4A 3A7GA 3PPZA 5BMSA 4WA9A 1YDRE 3TG1A 3V51A 2PZ5A 4YJPA 4CEGA 4Y95A 1XO2B 4RPVA 4JLCA 5HZNA 3SQQA 5IEXA 4DCAA 3TN8A 1QPCA 5AP2A 4EQMA 5KHXA 4C35A 5AV4A 3U55A 1HOWA 2O2UA 3BV2A 4CKJA 2CKPA 3W18A 4EOPA 5IA0A 3HMNA 2XVDA 3VUDA 3F66A 3PFQA 3V5PA 1ZMWA 4TYEA 2ZVAA 1PW2A 3BQRA 4IE9A 4X6QC 4FKIA 2JD5A 4WNOA 5AIKA 2PVFA 4PPBA 4RA4A 4DYMA 4UWCA 4NJ3A 3GBZA 2PSQA 4C59A 2HZIA 1FINA 2QO9A 3FZOA 1PXLA 3D83A 3KXMA 4JJRA 4O91A 4P5ZA 3DQWA 3PTGA 4UBAA 4CLIA 1KWPA 5IPJA 3QTIA 5HBJA 2OICA 4YO4A 1LUFA 2W1ZA 3EYGA 4O38A 1FGKA 3ODYX 4KKEA 3EQCA 2W4OA 3HRBA 2VTQA 2OH0E 3IK3A 4GK3A 2UZOA 1S9IA 3W16A 2UZLA 4RWLA 2QI8A 4L00A 5L2QA 1OIQA 3EN6A 1JNKA 3DCVA 5E8UA 2XS0A 4HPTE 5CVFA 5BVKA 3UIMA 4FIHA 4WT6A 5HBHA 2BRHA 3THBA 2ZJWA 2W96B 3GCQA 3OWPA 5B2LA 3BU3A 4FVPA 2R3FA 5EFQA 3LCOA 4QYYA 3R8PA 4AT5A 1NW1A 4ENYA 5F9EA 1YI6A 4C2WA 4YJTA 2QO2A 3R9OA 3R28A 4E3CA 4EUTA 4IXPA 4TYJA 2VTPA 2YZLA 1R78A 2AYPA 4R1YA 3PSBA 2HZ0A 4XOZA 1K9AA 2GNHA 2X7FA 3IS5A 2H9VA 3O7LD 3PE2A 4FYOA 5CNNA 2YDJA 5DN3A 4ALVA 5AP4A 3RWQA 3RPSA 4EOSA 2PE1A 4XG7A 3C9WA 3MGYA 3NNXA 2XKCA 4GV1A 2IW8A 5I0BA 5CEIA 4QTEA 3IQ7A 2F49A 3QWJA 4IDVA 2OWBA 4MNEA 5DHJA 4ANLA 2W9ZB 4I6BA 5FXSA 2XMYA 2XK7A 2ONLA 2YIRA 2REIA 3CTJA 4CFFA 5CEQA 4XYFA 3PA4A 4L01A 5HGIA 1SVGA 1XJDA 3RAKA 1L3RE 4FF8A 3U51A 3FHIA 2JFMA 4H39A 3HMPA 3VS7A 4OTDA 3UTOA 2PMLX 3SLSA 1YHWA 3KULA 2WTJA 4IMYA 3W1FA 1XKKA 5EQEA 4QTCA 1FVTA 3OZ6A 4KS8A 3GC8A 5K3YA 3U6IA 4E6CA 4XUFA 2YIQA 4C33A 4FG7A 4NIFB 5HG5A 2HOGA 3EQIA 1J1BA 4M8TA 5AUTA 4O6EA 4L6QA 4P4CA 3NUNA 4BCGA 2BIYA 3ZSIA 5A14A 3O96A 1W84A 3SRVA 3FYKX 2VTOA 4AUAA 2WMUA 3Q04A 2CGWA 4U8ZA 4JDJA 2CNUA 1G5SA 5HQ0A 4YJNA 2CGXA 3DK6A 1T46A 3D7TA 3ANQA 4L68A 2BIKB 3IDBA 3FLWA 2R3KA 4G9CA 4EHGA 5CAOA 1OGUA 4ZLYA 3JR1A 3TI1A 3P1AA 5H9BA 2WFYA 4E73A 2VWYA 2OGVA 4I1ZA 3CTQA 5EI2A 5FDXA 2W4KA 3W8QA 3E8DA 2ITTA 3KVXA 3MFUA 4AZSA 3NVKI 3ZRKA 1XH7A 2F7ZE 3TNHA 5DLSA 3MVHA 3MDYA 5KKRB 3NLBA 2WB8A 4UYNA 2OXYA 1OPLA 4IWDA 2IWIA 3FY0A 2YM3A 3ETAA 3NNVA 4IDTA 3TCPA 5TT7A 1NY3A 1YVJA 3S4QA 3QA8A 3ODZX 3C4CA 4QO9A 3GOKA 2XJ2A 2WZJA 5DIAA 5DT4A 3RK5A 4E5BA 2BZKB 5FD2A 4B8LA 3SOCA 2Y7JA 3E63A 4DEHA 3NSZA 3UOHA 2A1AB 5E8ZA 1ZYDA 3TXOA 4WUNA 3D5UA 2C5VA 3OW3A 4BCJA 4IADA 3PXKA 4D2PA 3UQCA 2WTDA 2PUPA 4HYHA 5CENA 3VS0A 2HXLA 2XUUA 4MD7E 4BKJA 3IW4A 2WMAA 1LEZA 2XBAA 4MXAA 2YHVA 3MYGA 5B2MA 4FV1A 3ZBXA 5BVWA 1XBBA 4QPSA 1H26A 5HESA 5AAEA 3I81A 1OIRA 4I20A 3AMBA 3L9MA 4FKTA 2RKUA 5JSMA 4QP8A 4D0XA 4CZUA 4FSNA 4HCTA 4YURA 4BF2A 2WEIA 4FUXA 4IAKA 5JGAA 4F9CA 3QRKA 3MY0A 3NYXA 4QQJA 2OG8A 4J53A 5E1EA 3VRZA 5C8KA 2UZNA 3OCSA 1WBPA 4G9RA 3LM5A 4CT1A 4F64A 3LQ3A 1O6LA 5AUYA 2C6OA 4FZDB 5FTGA 4LV5A 1MRYA 4IAAA 5C03A 1PKDA 4C36A 4RX8A 3UIUA 1JSVA 3G9LX 4YTHA 4N6YA 1YWVA 3RM7A 3UVRA 1OUYA 3Q52A 4K77A 2W1GA 1OPJA 4H1MA 1FQ1B 3Q4TA 4ANBA 2QOFA 5CVHA 3QALE 3ZRLA 3PRIA 3EMGA 3AD6A 4GMYA 4BGGA 4YHTA 3DKOA 4FOCA 4K0YA 4HVGA 4FR4A 2Z7RA 2ERKA 3BRBA 4QP2A 4M14A 4E4MA 2FVDA 5FDPA 3TTIA 3DAJA 3F3VA 1B6CB 2WIPA 4ZSEA 3VVHA 3VUIA 2NNWB 2EB3A 2OH4A 4EC8A 3L8VA 2GU8A 4W4XA 1IR3A 3IG7A 3PSDA 4I3ZA 3ORLA 3HMMA 4U80A 4BN1A 2BRBA 4OTPA 4TZRA 3V5WA 2BROA 1H1PA 2GNLA 1Y8GA 4L8MA 4CZTA 3FSFA 4EH7A 3LXKA 1PF8A 3EQPA 4FV6A 4IJ9A 4A4LA 4DGNA 3DAKA 3FAAA 3OEFX 2QOKA 3Q5ZA 4FTOA 4L3LA 3R8ZA 2WU6A 3VBYA 5I9UA 4EHEA 4B99A 4J95A 2ITQA 4KSQA 3QYZA 4R3PA 4O27B 4NZWB 5CSXA 4FKUA 3V8WA 3GCPA 4WO5A 2X2MA 3DFAA 4FE2A 4I6HA 4O7TA 3CC6A 3COKA 3ACKA 5HU3A 2G15A 3IW8A 3ZUVA 3ORMA 5L2TA 3HAVA 2IZRA 2PVRA 4Y83A 3SV0A 2Z8CA 2PUNA 2BDWA 3QTXA 4J99A 4FK3A 4D2TA 3FQEA 4C3PA 4AQCA 4DEBA 3MFTA 4AX8A 3DAEA 5AEPA 4O84A 2HENA 5CAVA 1WZYA 4ZTRA 5GHVA 3MH0A 3CIKA 4AZEA 4H58A 4XG4A 3GENA 3KXHA 4R7BA 3ZDIA 3NUSA 5AR8A 4FYNA 1Q41A 2C6TA 2FO0A 3WF9A 3Q2JA 3O8UA 2LGCA 4NEUA 4LMUA 3Q6UA 5KZIA 5BX0A 3HDNA 3OWJA 2XIYA 2CHLA 1CTPE 4YGAA 2XNEA 2OFUA 2E2BA 4FTQA 4AGUA 2CCIA 3ANRA 4O0UA 4AXAA 3HGKA 4DA5A 3GCUA 3HKOA 3QUDA 3PDTA 3NAYA 3D7ZA 3N51A 1WBTA 3ZU7A 4ZZMA 3A61A 5TKDA 2R7BA 4D5KA 2VNYA 5AX3A 2VWXA 1OL1A 4O2PA 4X2FA 3DDQA 1FMKA 5AR7A 4N57A 3HMIA 3QBNA 3UZTA 1H0VA 1KE7A 3VJOA 4EHZA 3ENMA 2YWPA 5D7AA 3CCNA 5HIDA 3SDJA 1Y57A 4IWQA 4D9TA 2XEZA 1R1WA 2WKMA 4IAIA 1AGWA 3EQHA 4GT5A 3DPKA 3LFCA 3EHAA 5KNJA 1OL5A 4Y5HA 3KB7A 4ARKA 3QZGA 3TNWA 3QXPA 2EXCX 5F4NA 3LFFA 4O0RA 4G17A 3EKKA 3F2RA 3G0EA 2E9UA 3JXWA 3G33A 4PWNA 4O81A 3BEAA 3PXRA 2FSMX 3OOGA 4ZTHA 4CMTA 2X39A 1FOTA 2R5TA 3KN6A 4IM2A 4OAVB 4EC9A 5IH6A 3F2NA 3V5JA 2B9HA 4DEIA 4AA0A 4YMJA 5LMBA 2Y4IC 3IOPA 3KF4A 4RZVA 4R78A 2E9OA 3RAWA 3U4UA 4RX7A 1JLUE 3QD0A 1PXMA 3Q53A 3V01A 5J79A 2J9MA 2QG7A 4FKJA 1GNGA 3RNIA 1KOAA 3CBLA 2X6EA 2YLFA 3AT3A 4YC8A 3PJCA 1P4OA 4ERWA 4EWHA 4Z3VA 1HCLA 2GS7A 2F2CB 3C51A 4IC7A 2GPHA 2HELA 3U87A 3TUDA 1KUTA 3PA5A 4U40A 1F5QA 3LXLA 4XBRA 3CQEA 1W83A 2BHHA 3K5UA 4FZFB 4HGEA 4X3JA 4FSWA 2B1PA 5AUWA 4CSVA 3BCEA 1ZMVA 5ETAA 3FLYA 3KRWA 5ANOA 5IKWA 4HZSA 5CYIA 2C1AA 3LXPA 4O7SA 4NTSA 2C3LA 2G01A 5FEEA 2YDIA 4CTCA 4JI9A 2O0UA 1QPEA 3QHWA 5IDPA 3E3BX 5KMJA 5CSWA 5M4UA 5M07A 3PXFA 1F3MC 5CAQA 2CGUA 2YM8A 3HDMA 3BLQA 5HTBA 2R7IA 3CD3A 1IAJA 4FIEA 4IX3A 4MWHA 5BQ0A 4HCVA 1W0XC 4PV0A 1ZAOA 2X8DA 3QX4A 2VD5A 3LQ5A 4DITA 3CQWA 1AD5A 4QMXA 3T9IA 3JUHA 4A4XA 5ACKA 2BAJA 2Z2WA 2UW6A 3CLYA 3FMDA 4FIJA 2BPMA 5CX9A 2PMNX 5JFSA 2DQ7X 3ZC5A 2VUWA 4EH9A 4IZAA 3FZSA 2Y8OA 3ZHPC 4FTTA 2ZV8A 4NFMA 5CAUA 1H25A 4L9IA 3FKLA 4PX6A 4XG6A 4ZZNA 4UV0A 3FXWA 1CSNA 2UZBA 5HLPA 2QOQA 4W4VA 4MF0A 3ZLSA 3PLSA 5BUJA 3PJ8A 1PKGA 2YIXA 4FTCA 2JC6A 3LPBA 4RIWA 3RVGA 3D5WA 3P4KA 5E8XA 3RCDA 4U3YA 4QP6A 3VBTA 3PY1A 5FP6A 3R8UA 3FE3A 4IBMA 3P7AA 1SVEA 4NH1A 3RINA 1UVRA 4ANNA 2HAKA 4OT6A 2WMRA 5LVPA 3C4XA 2UW3A 2Z02A 2ACXA 5LWMA 4NJDA 1Q24A 3S3IA 4UMPA 1R3CA 3P23A 4WNKA 3GC9A 1REKA 2GFCA 4F7NA 2BZHB 2GMXA 2BTSA 1EH4A 1ZOGA 4A9UA 1PMEA 4IWPA 1W98A 4F1TA 3RK7A 2VO0A 3DFCB 3HV4A 4CCBA 3MTFA 3TL8A 3IPHA 4YPSA 4ZLZA 2ETKA 3HA8A 2C0TA 3CSVA 4X7QA 4N4SA 4RMZA 5K4JA 2FSLX 5HHWA 4XV2A 4K9YA 4FX3A 4F08A 3VBQA 4BTJA 3PIXA 5AM7A 4OTWA 3BHVA 3HV3A 3O51A 4AN2A 2VTNA 3ZM4A 5LQFA 5IQAA 5FGKA 4GUBA 4E6AA 3E87A 4XJ0A 2VO6A 4D4RA 5FXRA 3B2WA 3WE4A 4FTAA 4GUEA 2JKKA 5AADA 4FL3A 5IF1A 1M2RA 5HKMA 3AC5A 5CT0A 4YZMA 2DWBA 3LFNA 3UDBA 2PHKA 4HYSA 5M51A 3FSKA 4FSYA 3ORIA 4S32A 4OTGA 3VS5A 3MFRA 1OBDA 5E1SA 2YA9A 5IU2A 4U97A 1WCCA 1U54B 3QRIA 3TZMA 4I0SA 3ZS5A 1WBOA 3BZ3A 5H2UA 3RALA 5JN2A 2ZM4A 1UU3A 1IAHA 3DBEA 1AQ1A 1ZRZA 3NEWA 4QTDA 5AM6A 2BRGA 2QKWB 4YHFA 4I5CA 1OB3A 2WIHA 2V62A 2HIWA 4RWJA 3MVMA 4NCTC 4FEWA 3WZEA 4LQMA 4GVJA 3IW5A 4LMNA 2HY0A 2JLDA 4QMPA 4E8AA 3IW7A 4PP9A 4ZXTA 5C1QB 4M66A 3QKKA 3R04A 4Q2AA 3UNJA 2VAGA 4QYHA 3AC3A 4DH3A 5ICPA 1OKVA 1U4DA 1ZOHA 3A8WA 4O22A 2F9GA 5GIOE 3PLAE 2C47A 3GU8A 4LGDA 3DTWA 2YISA 4MQ2A 3MTLA 4IZ5A 3POZA 2ZDUA 4DGOA 1WVYA 3AC2A 3FKOA 4EZ5A 4I5PA 4F6UA 3FQSA 3FZRA 3C4WA 3SG8A 4RX5A 1UU9A 3CR0A 4QYGA 5HO8A 1V0BA 5L8JA 4I21A 1XBAA 4BCFA 4DH7A 4BDGA 5HD7A 2O5KA 3TZ9A 2ITNA 1NVQA 4DT9A 4O7NA 3Q9YA 4RZWA 4GJ2A 4YNOA 4EBWA 4FT7A 4RWKA 4FUYA 4QP9A 4D5HA 4DGLC 4EZ3A 4G3CA 5E9EA 4Q5HA 5EHOA 3EN4A 4ZS4A 3R9NA 3E3PA 1W8CA 4ONAA 4ZK5A 3LM0A 4FNZA 4X2KA 3D5XA 1ZY5A 3ZO2A 4HGSA 4R1VA 5AAGA 4FTLA 5AAFA 4QTAA 5EKNA 2WTCA 5CEKA 2R0IA 4BB4A 4D1ZA 4DFYA 4JS8A 4E93A 3EL8A 1KE6A 2WQBA 4ITHA 4M69A 4O1OA 4YLKA 4BDEA 2WTKB 2IW9A 1XQZA 2P55A 4JDIA 1ZYSA 2OKRA 4BBFA 3R63A 4D1SA 4D4YA 4D4SA 2J5EA 4FSZA 4R5YA 2OJGA 4FTIA 1Q8UA 3KMWA 1VR2A 3FL4A 4CCUA 4AE9A 4AT3A 3MH3A 4MXOA 4RVTA 4Y72A 5EOBA 4FV3A 1OBGA 5EI6A 1JVPP 4WSYA 4O83A 3P86A 2DYLA 1BYGA 5AV3A 3OCGA 2VNWA 3VAPA 3IONA 3PXZA 4JBOA 5JQ8A 5HG7A 4G3GA 5JT2A 3QZIA 4FV5A 4I24A 3QXOA 4U79A 4BDDA 1H28A 4EOIA 4ZJVA 3R9HA 2PY3A 4UY9A 4FIGA 5HI2A 3LKMA 1TQIA 3FYJX 5IA4A 4E26A 1G8SA 4KA3A 2ITOA 5CU0A 4USEA 1ZARA 4NKSA 3QAME 4C02A 3GI3A 4K1BA 3BI6A 1NT2A 4H05A 5GJGA 3R7VA 4BI2A 4XBUA 4NW6A 4PMTA 2PVMA 2OXDA 2HW6A 4BTMA 3PPKA 3KXZA 4KINA 5LMKA 2GSFA 2VV9A 4J97A 4XH6A 2XK3A 4PL3A 3F5UA 5CU6A 2CLXA 3BGPA 5HIBA 2XYNA 4C4GA 4RIOA 3ZYAA 3QLFA 3R7UA 2I0YA 3DXPA 4JXFA 5KBRA 2OIDA 3TDVA 3HUCA 5FEDA 3TEIA 4EWQA 4BCIA 3R6XA 5CF6A 4CFXA 4FEVA 4UZDA 3QGWA 3WARA 3H4JA 1OIUA 4CG8A 5J9YA 1YOLA 4Y46A 2Y4PA 3H0YA 3HL7A 1OKYA 3SGCA 3TJCA 3KK9A 2GS6A 3NZ0A 3PVBA 4O86A 2R3LA 2YITA 3FMLA 2VTRA 1H1RA 5BUEA 4HZRA 3NUPA 3NCZA 5HD4A 3D14A 1OECA 4ZAUA 2W4JA 4NWMA 1ZMUA 3S0OA 4AF3A 4GFGA 1G8AA 1CM8A 3EN7A 2WTIA 2IG7A 4TNDA 3BE2A 2GDOA 2W1HA 3I0QA 4K2RA 4GJ3A 2HW7A 4XV9A 3Q32A 3FL5A 4ITJA 3FLSA 4R3CA 5EM8A 2FH9A 3TZ8A 2Z7QA 4M84A 3U6JA 2BMCA 4RIYA 3FBVA 2EVAA 3RAHA 3CY2A 2C68A 4XG2A 2WTVA 5D10A 2EU9A 2IZTA 2QHNA 4WKQA 1RQQA 3W10A 4RQKA 2YLEA 1P14A 3FPMA 4H3PA 5BYYA 4C8BA 2J5FA 2PYWA 4IEBA 4LOOA 3BBTB 1H01A 2HK5A 3FMEA 4DBNA 4DH5A 4M0ZA 2ITYA 4EK5A 3WZJA 4A9RA 4BDIA 4WSQA 1DS5A 5M09A 2GNFA 2J90A 4YJUA 3DXQA 4F63A 2ITUA 3RPVA 3WZKA 2R4BA 4RVMA 1ZYJA 4O0WA 4BHZA 1ZZ2A 1TVOA 5BYZA 5IQCA 1PYEA 4RBLA 3O8TA 3F6XA 5DNRA 4MCVA 4IZ7A 1ZYCA 3PYYA 4IACA 5AR3A 3C7QA 3LJ2A 4BYIA 2CJMA 4C57A 4M3QA 3PVWA 2HY81 5LARA 4HNIA 2OW3A 4UWBA 5J1WA 5EM5A 3QQUA 4MX9A 3QYWA 1FVVA 3OOMA 2JITA 4CGAA 3DGKA 1YXUA 3GFWA 4TN6A 2UVZA 2GS2A 5AR5A 3LJ0A 3W33A 5HVKA 1IEPA 3NGAA 4FT9A 2VRXA 4JAIA 4L7SA 3ZZWA 3DLSA 4RC4A 4F65A 3A8XA 1H27A 3NUUA 3U8WA 2A0CX 3Q9ZA 3R73A 1XBCA 4FSUA 3H9OA 3HEGA 4C4EA 3BE9A 3G6GA 1JOWB 3NW5A 3AOXA 3EL7A 4X3FA 5CEOA 2BRNA 4WUAA 4ZY6A 3AT2A 1IG1A 3HZTA 1Q8YA 5AX9A 2VTSA 5M55A 4MVFA 2C6IA 2JKOA 2WOUA 4QQTA 3I5NA 4RG0A 1HCKA 2XRUA 4AW2A 3VIDA 5G1XA 4USDA 3R01A 3PXQA 1TQPA 3DDPA 4R5SA 3LFBA 4FTRA 5D9HA 4DG0E 4O0VA 1H00A 3KFAA 2SRCA 2WMBA 2LAVA 5GZAA 1XHAA 3S00A 4FA2A 2QKRA 4YBKA 4I92A 3ZLYA 3LMGA 3R7EA 1F0QA 4ANQA 3DJ5A 3ZUTA 4II5A 4EBVA 4WG4A 3GC0A 5EYDA 3UMXA 4PDYA 2RIOA 2PWLA 3BHTA 4CXAA 3DBFA 3ROYA 4KWPA 3C0HA 5G6VA 3MIYA 2FUMA 4IANA 3I5ZA 3RMFA 3UC3A 2WQNA 5L2SA 4DINA 3QTRA 5A4QA 3R8MA 2IPXA 3KGAA 4D2VA 4C2VA 4IVDA 4FKWA 1GAGA 2XNNA 3B2TA 4LYNA 5DR9A 4EEVA 3F3TA 4UXLA 5FWKK 4A07A 1M14A 4BI1A 4RIXA 4V04A 4FV9A 4IVAA 3QLGA 4RT7A 3EQDA 4RSSA 2XNMA 4JNWA 5M4CA 3ZEPA 2P2HA 3LMHA 4L52A 4Q9ZA 1J91A 3UP7A 3SA0A 3EFKA 2CN5A 3AGMA 4KKGA 3PY0A 1X8BA 5KX8A 4F7SA 4XLIA 5K5NA 3GC7A 4LGHA 5IEYA 3IKAA 2PZIA 4GT4A 3A99A 3QRJA 4WNMA 4JG8A 4FV0A 5E92A 3C5UA 1ATPE 4DEGA 5DEYA 3R9DA 2EXEA 5GZ8A 1PXKA 3GU5A 4WBOA 2W9FB 3ZCLA 2NPQA 4OTHA 4GKHA 3G51A 3FUPA 1V0PA 5AP7A 4FTUA 2WO6A 4M0YA 1RJBA 2NO3A 3UMWA 4MH7A 3C50A 3VW8A 4D28A 4DG3E 4MBLA 2ZV2A 4AE6A 3DA6A 4JR3A 4U45A 4XRJA 3KRRA 5EHLA 3OWLA 5ITAA 4G2FA 4BDBA 5H3QA 3I1AA 2B7AA 4MBIA 4FSMA 1WBWA 3DV3A 4BDKA 3DS6A 5A4LA 4G3DA 4O82A 2IVUA 4P7EA 4QPAA 5HE0A 1YQJA 1PRYA 4NKAA 2C0IA 4YHJA 2PVYA 5I3OA 4I0RA 3AMYA 2XKDA 4OGRA 2HWPA 4MKCA 1VEBA 2C5OA 4PUZA 4BDJA 3QD2B 4DEAA 4U0IA 4AW5A 4EH8A 5BPYA 4YJQA 3CTHA 4QNAA 5C9CA 5JMSA 5CSHA 3R7IA 2AUHA 1GOLA 5CY3A 1J7LA 4NL0A 4YBJA 4DFLA 3LCKA 2C1BA 3NYVA 3OY1A 3R83A 3UG2A 2EWAA 2BR1A 4HGLA 3S95A 5HVJA 2W17A 4DGMA 3TUBA 3DBCA 4Y85A 4J96A 2PTKA 3OROA 4ACCA 3NUXA 4D0WA 4I5MA 4IC8A 5A3XA 3EN9A 3RCJA 1U5RA 3R1NA 3UPXA 4O0XA 1NA7A 4WHZA 4F70A 5HU9A 2PZPA 3CQUA 4J7BA 5GNKA 5CTPA 1P5EA 3C13A 2XIRA 3A2CA 4FV4A 1W7HA 3FLZA 2E9NA 3ATTA 3GB2A 3GXLA 3R21A 4JDKA 4EHVA 5IISA 2E9VA 5JFVA 2BKKA 5ANDA 4H36A 4CRLA 2RSVA 1STCE 2XIXA 3LCDA 4M15A 4P90A 5KZ0A 3VJNA 4ORKA 5BVNA 3FMJA 2YM6A 4FC0A 3ORXA 4IAYA 1ZZLA 3QFVA 2I1MA 2HZ4A 2XNOA 3NR9A 5CXZA 4RVKA 4UB7A 2W1FA 3ZFYA 5E8WA 5AR4A 2PULA 2W1EA 3R1QA 4IB1A 4AOJA 5C4KA 2ZYBA 3EKNA 2XZSA 2VX1A 3MPAA 4DF3A
chains in the Genus database with same CATH superfamily
5TOZA 3WF6A 2QODA 3MW1A 4FEUA 1Y6BA 3K3IA 3NPCA 3V04A 4FMQA 4RGJA 4I0TA 4RC3A 5DT0A 4LGGA 4ZTQA 4BIBA 1JQHA 5DBXA 3Q3BA 2QOLA 3EYHA 4O7RA 3R00A 5CNOA 3RP9A 4CT2A 4BDFA 4NU1A 4YLJA 3QQKA 2FA2A 1FGIA 1YXVA 4M69B 4YLLA 1Y6AA 4MQ1A 4ASXA 5J7HA 3S1HA 3HMOA 3L1SA 3OTUA 4FOBA 5F95A 2QU5A 3UVPA 4UALA 4NYEA 1OPKA 3WF8A 2X4FA 3PP1A 5IH4A 3MB7A 4BCOA 2VO7A 3CY3A 4QP3A 1A48A 4RVLA 3TUCA 4JX7A 2J2IB 5A6NA 5LVMA 4IH8A 2XCHA 3ORZA 3W55A 4BRXA 3A7HA 1VZOA 3GQIA 3VUTA 5BYLA 2PVKA 3I7BA 3VHEA 2VWWA 2B53A 3JYAA 3SXRA 4ANSA 1WBVA 2J0JA 4AS0A 2Z60A 3EH9A 4TYHA 4XNEA 4O6LA 1CKJA 2C30A 4WNPA 3P9JA 3RNYA 2QLUA 3OXTA 1MP8A 4PL5A 3GU4A 4DFNA 4TL0A 4AW0A 2R9SA 2C3IB 1P4FA 2XM9A 3O71A 4HGTA 3MA3A 2OJFE 1SYKA 2IEWA 3MB6A 4YZ9A 3TNIA 4F6SA 1J7UA 4DTBA 3DKFA 2X1NA 3VBVA 2QOCA 3NAXA 3TACA 3RWPA 4BCKA 3EJ1A 4QMYA 3UDZA 5E7RA 4KKHA 3MY1A 3TT0A 3M2WA 3HV6A 3G2FA 4WRGA 1QPDA 3MN3A 3SC1A 4C38A 4DTAA 2GNJA 5C4LA 1REJA 4NTTA 3R9RA 2R0UA 3U9NA 4C58A 3LFQA 4FKVA 4AAAA 3ZMMA 3QC9A 4EOOA 2UW7A 4FL1A 3E64A 3KVWA 4I4FA 1E9HA 1DI9A 4ZP5A 1O6YA 3OXIA 2HXQA 3PJ2A 4D4VA 4FKSA 5D41A 5CEMA 2XM8A 3MY5A 4BZDA 1TKIA 2X2LA 3IGOA 4HCUA 5CZHA 3WILA 3BYSA 5GINE 3CXWA 2QHMA 2PMOX 4ZY4A 5IQIA 3SAYA 1GJOA 4FEQA 1IRKA 2CDZA 3OW4A 3ZXTA 4O96A 5L8KA 1V0OA 2VWZA 2ERZE 4Z7HA 1PXIA 3D15A 3E88A 3OHTA 5DI1A 1H07A 2UW5A 4V01A 3RAIA 3GNIB 4GT3A 4QP4A 4CKRA 4CFNA 3JVSA 1SZMA 4BKYA 3IECA 4AP7A 4B6LA 2XNPA 2BDJA 4RIYB 4RQVA 1RE8A 1MQBA 3QTWA 3VS1A 1GY3A 4CTBA 1H08A 4AA5A 2PZRA 2I0EA 4F0IA 3QQLA 2O64A 3HVCA 4JBPA 4AWIA 3I0OA 4I6FA 4NFNA 1T45A 4FODA 4R3RA 4TWNA 3ERKA 3K3JA 4DFXE 2UZWE 4JVGA 1BLXA 5E90A 3ZH8A 4F9BA 3HYHA 3LIJA 3ALOA 5KE0A 2JIIA 5IQBA 3QCYA 2X81A 5A54A 1BKXA 2YERA 2XK6A 4CYJA 4XG8A 2DUVA 3MA6A 2Y6MA 3AD4A 3OCBA 2ETMA 2ZB0A 4TWPA 4YZDA 4AU8A 4L42A 1UA2A 3O8PA 1YXSA 3LLTA 2YACA 3WIKA 5J1VA 4ZEGA 4YU2A 2XK8A 1M2PA 4D2SA 5IA2A 2IZUA 5LXMA 4ZTNA 2X0GA 4XEYA 4OAUC 2HYYA 2A27A 3UOJA 5H8GA 4GG7A 5KKRC 5AWMA 4CQGA 5AUUA 3QTZA 1JKLA 1PMNA 4LOPA 3GU6A 4KRCA 4S34A 3WZUA 2YM5A 3GEQA 4YC6A 3QQFA 2WQEA 3BU5A 2QOBA 3S2PA 4QMOA 4RLLA 1SNUA 3VS3A 3H3CA 5J7BA 2UW9A 5A9UA 5KMMA 4YZCA 4ZOGA 4ASZA 3TJDA 4F09A 3Q9XA 2GTNA 2P3GX 4U43A 2F57A 4X3FB 1G3NA 4QMLA 4UXQA 2AC3A 5E8SA 3DK3A 5B2KA 4EK4A 5AA9A 2CNVA 4LDTA 2B54A 4IVBA 3R22A 2CLQA 4F9AA 2VWIA 5M44A 2XAMA 3G9NA 3Q4UA 1PXOA 4UMRA 4ACDA 4MTAA 4LV7A 4O7WA 4R77A 2FB8A 4DH1A 3M1SA 1L8TA 5AV1A 4BKZA 3LJ1A 4RJ5A 5IMEA 4FICA 2EUFB 2BILB 3AXWA 4F7LA 1YI3A 3PVUA 3CPCA 4MF1A 2I40A 1IASA 3KA0A 4WG3A 4EZ7A 1I09A 4FK6A 1K3AA 3UQFA 3QRTA 4IM0A 3QA0A 3EFJA 2UZEA 1H8FA 5ACBC 4BTKA 3ACJA 5TO8A 4BVUA 3UNKA 5HOAA 4GK4A 3TIZA 3C4EA 5CU3A 3WF7A 4EK6A 4MNEB 4G6OA 2BVAA 2RF9A 3H30A 4F0FA 3DBDA 1Q3WA 2O3PA 3JY0A 2Y9QA 4OLIA 3F5GA 3C4ZA 5FLFA 5FRIA 4JQ7A 3DKCA 4HW7A 4ZY5A 3BLRA 3NMUF 2WTWA 2PVJA 2PVLA 3HP2A 5IG1A 4CNHA 1H0WA 4ANOA 3DLZA 4FIIA 5I5ZA 2NRYA 3JVRA 4U81A 5D11A 2VTMA 2X9EA 4A9YA 1Y8YA 4R7IA 5HE3A 2J50A 2C6DA 4F78A 3G5DA 3KULB 4EH4A 4Q9SA 3PG3A 4I22A 1JSUA 2QD9A 3FC2A 4QOXA 2NRUA 4I5HA 4R6VA 5I9WA 5CSVA 5JFXA 4YPDA 2CCHA 4TWOA 4YO6A 3HX4A 4IFCA 3LFDA 3Q5IA 3OFMA 4I6QA 5J5SA 5HTCA 4TNBA 3ZBFA 1JAMA 2UV2A 4KBAA 4CG9A 3UVQA 2C6MA 3CKWA 4HOKA 4AAYA 4OTFA 5AP0A 5KO1A 1CKPA 1IA8A 2BZIB 4LI5A 4X0MA 2BALA 3SRVB 3RTPA 3P79A 2B9FA 3LW0A 1M2QA 4IIRA 5ANGA 1YHVA 3VS6A 3II5A 3D7TB 4XCUA 2JKMA 5M4IA 5IA5A 1A9UA 4EOQA 3NFFB 2JAVA 3OT3A 5ETIA 4OR5A 1UWJA 4DTKA 1ZXEA 2YFXA 4IX5A 1PYXA 4LRJA 1JKSA 3V5QA 4G3EA 4RLKA 2I0VA 4V05A 4CZYB 4IB0A 4C3RA 4DEEA 4MXYA 1DM2A 4IX4A 3NNUA 4ZJIA 4GKIA 3C4FA 4KSPA 3MH2A 4LUDA 2E9PA 4O21A 5M57A 4BWPA 2PUUA 3DBQA 4KNBA 4EKLA 3EZRA 2UZUE 1UWHA 3N4TA 2IVSA 3R30A 5E8YA 4PNKA 2VWUA 1PJKA 3O50A 1OKZA 1QMZA 5DEWA 3SKCA 3SD0A 4P5QA 4AT4A 2X9FA 1H24A 4ALUA 3F61A 2YIWA 4AZTA 3ZZEA 1YOJA 3QUEA 2R64A 5F20A 3UP2A 3FEGA 2XB7A 4YC3A 2QC6A 3PXYA 4B9DA 3BHHA 5K4IA 4PTEA 5BUIA 4EYJA 3KY2A 4LRMA 5LVNA 3F3WA 2BUJA 3KKVA 4X6RA 5FM3A 5LVLA 1BL6A 3NYOA 3ORTA 3AMAA 4NUSA 4O4EA 3EQBA 4FTKA 2X4ZA 5AJQA 5KBQA 4N0SA 4GIHA 4MXCA 4DCEA 3MVLA 5D7VA 3MVJA 2WMXA 3CS9A 2OI4X 2VTIA 3IDCA 3Q2MA 4QYFA 2Q0NA 5M4FA 3COIA 3P08A 4TT7A 1Q99A 5KCVA 4DN5A 3UG1A 5IQDA 3ULZA 4FTJA 2RGPA 3GT8A 4GFMA 2BFYA 2P4IA 3QD4A 4WIHA 4DH8A 3FJQE 1PMUA 5FXQA 3O0GA 4J8MA 2X8EA 2F2UA 4NM0A 3RPRA 5DGZA 1K2PA 5AUXA 2XNBA 4Y8DA 2C69A 4EYMA 2IF8A 4ZSAA 4E6QA 3N4UA 4O1PA 4C4IA 3KRLA 4Y5QA 2WNTA 5J5TA 1B39A 2O8YA 4IB5A 1JKKA 2UVXA 3UYTA 3FI4A 3UNZA 3AD5A 5AP1A 3EWHA 3VF9A 4HVIA 2JEDA 2B9JA 1Q8TA 5IH5A 3G6HA 4FL2A 3F9NA 1RDQE 2PK9A 3MPTA 4N6ZA 3M11A 5ANIA 4B0GA 4WOVA 3QTQA 3HECA 4CRSA 1PMVA 2WGJA 1Z9XA 4QMSA 4G5JA 2OF4A 4JR7A 2ZFYA 3K54A 5C27A 3W0QA 1DAWA 2OJ9A 2UW0A 5TE0A 2WOTA 4F0GA 3IO7A 3KXGA 2PPQA 3I7CA 4BBMA 2WMVA 4O4FA 2YJSA 1JSTA 4G3FA 4ITIA 1YW2A 5HORA 1JWHA 4LM5A 5HX8A 5KMIA 5L6PA 4G16A 3UZRA 3F3UA 1YXXA 3BL9A 2G2FA 4OBPA 1PHKA 2XNGA 3DJ6A 4Y73A 4RA5A 4QYEA 4ZIMA 3WYYA 3AQVA 3FI8A 2GFSA 3U9CA 1UNGA 2UZDA 1VJYA 1WBNA 1PXNA 3VC4A 2YN8A 5ANEA 4HVDA 3P0MA 4ASDA 2PVNA 4OT5A 3BQCA 4NCTA 3BEGA 4FG9A 5IQHA 1GZNA 3DZOA 4BCNA 3BYMA 3GUBA 4TY1A 3TKUA 1ND4A 1OI9A 3HUBA 5AA8A 4IFGA 5DPVA 1GZ8A 3DB8A 3FKNA 5CQUA 5HX6A 4FZ7A 4U6RA 3QQHA 4PTGA 2A4LA 2XYUA 3UOLA 3V8TA 2JDRA 2QONA 4ZMFA 3E5AA 3OBJA 5M53A 3NVMB 5F1ZA 2JIVA 1W82A 5EW9A 3L9NA 2R3OA 1NXKA 3TIYA 4DAWA 3ITZA 4G6NA 1TZDA 2QR7A 4QD6A 3SW4A 4ENXA 5IA1A 5FUTA 5JH6A 3KMMA 5IUIA 3HRCA 3C1XA 3BHYA 4LL5A 4MWIA 4CV8A 1YKRA 3F2AA 3PA3A 4H3BA 4CFMA 4BGQA 3BBWA 4B4LA 5HG8A 1GZKA 3KXNA 4Z9LA 4UYAA 5I9ZA 3E62A 4YZNA 3LHJA 5LCJA 2XKFA 4BIEA 1WBSA 1WVXA 3V3VA 4AOIA 2C6KA 3DNDA 2X2KA 1YDSE 2OZAA 4HYIA 4UEUA 1OUKA 3A7FA 4ZMEA 2IW6A 3PUPA 3CKXA 3ZM9A 5LOHA 1YHSA 2RFEA 3POOA 4JL9A 5CZIA 5DMZA 4PMPA 3Q6WA 3KXXA 4CQEA 5CXHA 3UJGA 5T3QA 4KAOA 2VTAA 5J9LA 3D5VA 2IZSA 2ONLC 3Q4ZA 5HIEA 3BKBA 2W1DA 3RJCA 3UGCA 2RL5A 4TWCA 1M52A 4TYGA 4ZTLA 3W32A 4BTFA 4E4LA 4DE4A 4DFUA 1GIHA 3R2YA 4ZLOA 3I60A 4O0YA 5DRBA 4K6ZA 3NW7A 2GCDA 4W9XA 5EM6A 5T68A 1YI4A 2VO3A 5HE1A 4QRCA 2ITPA 3BL7A 3KL8A 5A4EA 5JFWA 3EQRA 5EM7A 2GNGA 5JGBA 5EDRA 2BAKA 2Q0BA 3ZTXA 2GHLA 2ESMA 4BDCA 5EKOA 2WMQA 3D2KA 4L44A 3V8SA 3BV3A 3QZHA 3ZOSA 4C3FA 4M67A 4BC6A 4KUJA 5JK3A 4F6WA 3EFWA 4F4PA 2X8IA 4CMUA 1ZWSA 2F7EE 2VGPA 2JFLA 3D9VA 4AN3A 1UV5A 2ZB1A 4KS7A 2H8HA 3PIZA 4MAOA 2ZV9A 3EQFA 2W5HA 5K0KA 4ZTMA 1QPJA 2P0CA 1XH9A 5M06A 4QMMA 3AT4A 3BU6A 3KMUA 4C4FA 2C0OA 5HNGA 3BYVA 4BR3A 4QQCA 3N4VA 5EW8A 1M7NA 4DEDA 3GQLA 2CGVA 2XIKA 5LCKA 4G5PA 4DGGA 4YJRA 4EOMA 5DFPA 2OFVA 4D1XA 2CKOA 4BCMA 3V5LA 2QOIA 4FKQA 2JAMA 5AP3A 2CKEA 4FTMA 2QO7A 3OVVA 3ATSA 4PDSA 3ZXZA 4EK8A 3VUHA 4UZHA 4EI4A 1CMKE 5IUGA 1O9UA 2VTJA 3O17A 4LOQA 3ORPA 2GQSA 3GP0A 4FIFA 5KMNA 4PPAA 4PP7A 1U59A 1VLRA 5HE2A 3V5TA 3OT8A 4E4XA 2O63A 5HO6A 3C0IA 5HCZA 2YZAA 2RG5A 5DR6A 4L3JA 2P2IA 3MJ2A 5K0XA 1Q5KA 1YRPA 3EFLA 3PIYA 4RRVA 4S30A 2ITZA 4MBJA 4R7HA 3AC8A 4FV2A 2YIYA 4XG9A 4IAFA 1KV1A 3DK7A 4IX6A 1UU7A 5L8LA 3OCTA 4IB3A 4JX3A 4A9TA 3EN5A 4QMNA 3LE6A 3UO6A 1Q3DA 2JGZA 2OZOA 2IJMA 3W8LA 4RWIA 5LMAA 4HVHA 4V0GA 3HP5A 1BX6A 1VYZA 3VW6A 4A9SA 1OVEA 5IZFA 4DBXA 1R0EA 3DB6A 2GTMA 3ZEWA 4AA4A 3IOKA 2BTRA 3WI6A 3ELJA 4MXXA 3VHKA 4G31A 2CPKE 4TYIA 5CI6A 4YNEA 4X2GA 4JG6A 4RIWB 4D9UA 2V7OA 4JIKA 3MFSA 3MBLA 5KHWA 2J51A 4FNWA 5CLPA 5CALA 1GIJA 4RJ8A 3W2CA 4ZSJA 2XEYA 4UMQA 3DOGA 4RC2A 5FBNC 4GYIA 4QTBA 3QZFA 2VGOA 5DT3A 3LVPA 1KE8A 5FTOA 5L3AA 3SHEA 3FMHA 2BAQA 5DOSA 5AUZA 5CU4A 4FKLA 4JRVA 2WTKC 4LG4A 4CFWA 3CGOA 3QCSA 3QWKA 1H4LA 3FXZA 4JRNA 4A7CA 4GIIA 3RI1A 4F9YA 4AACA 3O7LB 4QNYA 4BFMA 3ZO3A 4UN0C 4AXCA 1WAKA 3VUMA 5CEPA 2PE2A 4QT1A 1YDTE 2JIUA 1YXTA 3H10A 3GU7A 3PG1A 4TPTA 4OW8A 2W0JA 4BCHA 4KIKA 3SVVA 2W06A 5CAPA 2J4ZA 2Y4IB 2QOOA 1LEWA 4GW8A 4PRJA 4RFZA 3TNQB 4GEOA 4KABA 3V6SA 4EONA 3LAUA 4BCQA 1OKWA 2C5NA 3R1YA 2UW8A 4FKRA 4FSTA 4O0TA 1ZLTA 4IJPA 4KBCA 3RHKA 4DHFA 5GJDA 4E7WA 3I6WA 3TNPC 3CGFA 3SOAA 4L46A 4DLJA 3KRXA 4U7ZA 3T8OA 2OBJA 2UVYA 3KK8A 5GIPE 2IVTA 4YTCA 2WMSA 3AC4A 3IGGA 4U5JA 2OJJA 3L9PA 3VUGA 5LWNA 4EL9A 4USFA 4C62A 5AV2A 1U54A 2WPAA 5EYMA 3AG9A 3UO5A 3G90X 1URWA 2BHEA 5A4CA 5EHYA 2WQOA 1OGYA 2W99B 1NVRA 4IVCA 4PL4A 3VO3A 2W5BA 3G0FA 3PY3A 2CSNA 4PY1A 3NUYA 3B8QA 3FMKA 2VU3A 4CMOA 4DC2A 3FHRA 1S9JA 3R8VA 1YWNA 2GNIA 2R3QA 2VWBA 3QQGA 3L9LA 4GCJA 2I0HA 5J87A 3VQHA 3W2SA 4M12A 5C26A 3KU2A 1ZYLA 4ZSGA 2VX0A 4XG3A 3ZSHA 4CLJA 1DAYA 4I23A 5HCXA 1KV2A 1H1SA 4QMVA 3Q9WA 2WU7A 1J3HA 3BHUA 3GGFA 5JQ5A 4HYUA 2Z7SA 5KUPA 4L43A 3VULA 4AGDA 4F1OA 2GQRA 5T6KA 2PL0A 4FSRA 2WQMA 4QMWA 3UPZA 3KC3A 2JBPA 5AFVA 4IWOA 5CU2A 3TTJA 2KULA 5HG9A 3BGZA 3KN5A 4I4EA 4FNXA 1OMWA 3QD3A 5JRQA 2PE0A 4AZVA 5DH3A 3UE4A 2OIQA 3F3ZA 4HNFA 3MESA 1M7QA 4EK3A 1XR1A 4D58A 4MNFA 1SM2A 3ZLXA 2VTTA 4X2NA 2QVSE 3Q96A 3ZC6A 1ST4A 4QDVA 3HV5A 4PF4A 4TXCA 4O0SA 3RK9A 5FP5A 4FZAB 1I44A 3SXFA 3FXXA 2OF2A 4E1ZA 3R8LA 1SVHA 1WVWA 1E1VA 3P5KA 5EI8A 2C3KA 3D4QA 3QKMA 2QG5A 3DJ7A 4FBXA 5AP5A 4FT5A 5AIRA 4AFJA 4MHAA 4Z16A 1OL2A 1U5QA 4XOYA 2A19B 4LRKA 5GZ9A 4W8EA 3UODA 4WBBB 2YWVA 4J8NA 5CVGA 5HEZA 4K18A 4L3PA 4EH2A 1LR4A 3KF7A 2JDVA 4RJ3A 3ORNA 2XP2A 2V22A 4GG5A 4LV8A 5HVYA 2R2PA 4RJ4A 3W0RA 2CKQA 3UOKA 4ZS0A 2HWOA 3KCFA 1Q8WA 3WE8A 2ITVA 4JG7A 2UZVA 4D55A 5C8NA 4UMTA 3OWKA 4DDIA 2R3HA 3LCTA 1ZOEA 1E1XA 3A4OX 5ANKA 1H1WA 3PWYA 3IDPA 4MUQA 5H8EA 1BI8A 4QMTA 2C5YA 1A06A 4W4YA 1R39A 5EYKA 1LP4A 2C3JA 4S31A 3P7BA 1FPUA 5CF4A 3ENHA 4JBVA 2XK4A 4AZFA 2PZYA 5HCYA 4J71A 3EQGA 3OUKA 4M97A 2V55A 1VYWA 3O2MA 4CD0A 1FBNA 4BY9E 1OITA 3NS9A 4NM3A 4O2ZA 4X21A 4C0TA 5IA3A 4MK0A 2JDOA 2XCKA 3A7IA 5HLNA 5KMOA 3QQJA 5HNIX 2YAKA 1XWSA 5I9YA 3RBWA 4XMOA 1Q8ZA 4XRLA 3TKIA 4TW9A 3GFEA 2J7TA 2XK9A 5AR2A 4GU9A 2X6DA 3R02A 3AKKA 4FV7A 2Y6OA 3OY3A 3AGLA 4C34A 4QMUA 5HO7A 5K5XA 5C01A 4FKOA 4ZSLA 3CJGA 3OEZA 4XP3A 1Q4LA 3NW6A 3A7JA 3MH1A 3O23A 2XBJA 2OO8X 3CJFA 4FKGA 4TKSA 3ZLWA 4DT8A 4DLIA 5AMNA 5L2IA 4BYJA 4XV1A 5EG3A 3ZFXA 3RHXA 4Z7GA 2ZM3A 4PDOA 1SNXA 5CT7A 4FV8A 5HLWA 5KMKA 2VWVA 3DZQA 1PXJA 1UNHA 1XH5A 5JRSA 4GYGA 2EB2A 3RPYA 4XLVA 4B8MA 4FT3A 3EIDA 3BIZA 5EDPA 5IUHA 4DFBA 4ZJJA 1CDKA 3OS3A 3B8RA 4PDPA 3ZO4A 4JQEA 1MRUA 4OBOA 4O4DA 2QQ7A 4QP1A 3MSSA 4M7IA 5D12A 4QDEA 2W1IA 4KIOA 1QCFA 4E5AX 3QTUA 2OSCA 2WELA 3GOPA 2Q83A 3PPJA 3BYOA 2PU8A 3ID6C 2W5AA 4NK9A 3QL8A 4F7JA 4FT0A 5HICA 1KSWA 3DKGA 2OZAB 5D1JA 2PVHA 5ANJA 4ZZOA 2J6MA 3FMNA 3CEKA 3WOWA 1APME 1P2AA 3QX2A 2X7OA 5TF9A 3LZBA 4RFMA 4YJSA 4IZYA 2BZJA 1BMKA 3JPVA 3F69A 2XA4A 4NM5A 3DT1A 5FEQA 2ZM1A 3W0NA 2W1CA 2WMWA 4EOJA 3IW6A 3OBGA 2HCKA 4WG5A 3SW7A 3RGFA 5J8IA 3RM6A 4L53A 2WEVA 2KTYA 4BWKA 3QC4A 1B38A 4APPA 4EH5A 1IA9A 3PRFA 4W8DA 2WD1A 5I9VA 2YM7A 4AZWA 5B0XA 2W7XA 5IQEA 3QGYA 2VTHA 2CNQA 3ULIA 4M68A 4ZTSA 5HNBA 5TR6A 2ZV7A 4FSQA 4BWXA 4UX9A 4AXFA 3R2BA 2VTLA 1U46A 3E92A 4EOKA 4LFIA 4D2WA 5JEBA 3ZONA 1Y91A 4WRSA 2R3GA 3L8SA 3BPRA 4EJNA 4KRDA 4ACHA 1OL7A 4UWYA 4YJVA 2JBOA 3V6RA 5IMXA 3CD8A 2XANA 3OUNB 2JDSA 4IHPA 2VN9A 2AQXA 3A60A 3GCVA 1KOBA 4I93A 4GRBA 3LCSA 4W4WA 2QCSA 4BCPA 3OTVA 5FM2A 3UBDA 4GS6A 3SG9A 4K11A 5CSPA 4MXZA 3FV8A 3ZRMA 4K33A 4JOAA 2F4JA 5M56A 5DRDA 3FY2A 1OM1A 2QOHA 4AG8A 4JDHA 3VN9A 2FYSA 4EORA 5DR2A 4JQ8A 3MJ1A 4QQ5A 4OTQA 2OXXA 4HPUE 5AV0A 2ITWA 2V7AA 3HNGA 4S33A 4YZBA 3MPMA 3FLQA 3VBXA 3VS2A 4YSJA 1BL7A 4PMMA 2JKQA 1ERKA 4C37A 3OF0A 4ACGA 1BUHA 3QUPA 5E8TA 2XJ1A 4N70A 2XF0A 2YABA 2J0LA 4U44A 3OC1A 4KB8A 3C0GA 3QCQA 4KD1A 1YWRA 2B52A 2YCSA 3E7VA 5L4QA 3KCKA 4IAZA 4KIQA 4A4OA 4AGCA 4BHNA 5DWRA 4P2KA 2R3PA 4CFVA 4NSTA 3PP0A 1GIIA 2DS1A 4AGWA 5BVDA 4AN9A 4OTRA 2ZDTA 2JDTA 1OIYA 3D94A 3TMOA 3MWUA 1XH6A 3GCSA 3JS2A 3QCXA 4V0GB 2X0QA 3WYXA 4D2RA 1J7IA 1RW8A 5I4NA 2P33A 2OU7A 4PQNA 4RFYA 4FG8A 4XS2A 3RZBA 1XMMA 5I9XA 2YJRA 3C5IA 3RPOA 3SX9A 3W2RA 3FZPA 2C6EA 4RIXB 2PUIA 3PVGA 4FI1A 3TV6A 4AXDA 3FLNC 5LJJA 5EW3A 2B55A 2BDFA 5DE2A 5J95A 4NW5A 5BVOA 2ZAZA 2YDKA 1MRVA 4XX9A 3HA6A 3HRFA 4NIFA 1CKIA 3DTCA 3HAMA 5CANA 2H34A 3TV7A 1Q61A 4AOTA 4BZNA 3Q60A 4XP0A 4FKPA 4YP8A 3PSCA 3PJ3A 3NIEA 3BELA 4PPCA 5M08A 2OIBA 1PXPA 3VF8A 4EUUA 3LLAA 3UDTA 4PNIA 5HBEA 5CASA 3R7GA 3H9FA 3NUAA 2AC5A 3VUKA 2UZTA 4GK2A 2WAJA 3FI2A 3OG7A 3PE1A 4X2JA 5FG8A 2QNJA 5E91A 2FSTX 3VBWA 3ORKA 4ERKA 2G1TA 3KQ7A 4MEDA 2I7QA 3VWAA 4S2ZA 4I94A 4ASEA 3DU8A 4KIKB 5E8VA 3PWDA 5BMMA 3BX5A 3D2IA 2R3IA 4OUCA 3DQXA 4RJ6A 4J52A 3H0ZA 4YTIA 2YM4A 2BFXA 3ROCA 3QHRA 3T3UA 3NRMA 1Q62A 5CI7A 4AXEA 1XH4A 3MI9A 3QF9A 4U42A 5ETFA 3WBLA 1H1QA 2Z7LA 3WIGA 3ZSGA 3E7OA 4J98A 4O7ZA 1JBPE 2X7GA 3CP9A 3A4PA 3FZTA 3UQGA 4E4NA 5LVOA 3FC1X 1TQMA 3G15A 2ZMCA 3LMIA 4R8QA 4U3ZA 3OD6X 3QU0A 4K8AA 2CN8A 4WD5A 3LQ8A 3R1SA 5CS6A 3BGQA 2XKEA 3R71A 5C8MA 3UYSA 2ETRA 2B9IA 2RG6A 2ZMDA 3GVUA 3LFEA 3E93A 5BVEA 5H8BA 3RKBA 5HTIA 1Q97A 5EYCA 2F7XE 1JKTA 3PZEA 1UKIA 2J0MB 4GH2A 3P7CA 2O65A 5IQGA 5LMKC 3R7YA 4YTFA 4BBEA 1OZ1A 2VZ6A 3T3VA 5DYJA 1LPUA 2BKZA 3R0TA 5FQDC 5K9IA 2QU6A 1NVSA 5DG5A 1V1KA 2XH5A 4MYGA 4Z55A 2VX3A 4HJOA 3W2PA 4PMSA 2G2HA 3UC4A 3QKLA 2C4GA 4BDAA 4GU6A 5EOLA 2GHMA 2WXVA 3AC1A 4BGHA 5L2WA 2NP8A 3BYUA 2HZNA 3LFSA 2YCQA 4G34A 3E8CA 1Z5MA 3VQUA 3CE3A 5F94A 4QMQA 4JAJA 3DY7A 3FDNA 4C61A 4YUQA 3R7OA 2XIZA 1KE5A 4IQ6A 4MD8E 4Q5EA 3FI3A 3W2QA 3ZDUA 3TDWA 1MQ4A 1JPAA 3UZPA 2Y0AA 3E8EA 4RJ7A 4A06A 3NCGA 4EH3A 4HVSA 1YOMA 3Q4CA 3F7ZA 5BNJA 2H96A 2G2IA 1SMHA 2YCFA 3BWJA 2QR8A 2W05A 4FVQA 4U41A 4E20A 4EOLA 5JGDA 1XH8A 5AUVA 2GQGA 3TKHA 4E5WA 4CV9A 2OLCA 3TV4A 4LUEA 3F82A 3KEXA 4OBQA 3FQHA 5AP6A 4U9AA 1MUOA 2WHBA 1W2FA 1WFCA 4F99A 5EH0A 2ZOQA 3H9RA 3VNTA 4J1RA 1G8KA 4FZ6A 4C7TA 2B4SB 2G9XA 5A6OA 1GZOA 4RX9A 1BI7A 1R0PA 1KE9A 3BWFA 1FVRA 4JT3A 4L7FA 3ZFMA 4FGBA 5IDNA 3LXNA 2B0QA 4IW0A 4TRLA 3KREA 3COHA 3RZFA 2IN6A 2CMWA 3LOKA 2I6LA 5JKGA 4L67A 4KBKA 4PTCA 3DXNA 2OK1A 4OTIA 4EQUA 3I4BA 5CWZA <