5EM8A

Egfr kinase domain with pyridone compound 13: 4-[(2-methoxyphenyl)amino]-~{n}-[4-(4-methylpiperazin-1-yl)phenyl]-2-oxidanylidene-1~{h}-pyridine-3-carboxamide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
323
structure length
303
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridones as Highly Selective, Noncovalent Inhibitors of T790M Double Mutants of EGFR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 90
structure length 303
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5em8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5em8A01
4DN5A 2RGPA 3G33A 5JQ5A 4AGUA 4IDVA 4S2ZA 2C6EA 4DLIA 4DBXA 3TUBA 4J71A 5BVWA 2P2HA 4MF1A 4APPA 5HO6A 3R7IA 4ZXTA 5DT4A 2XJ0A 2A0CX 4M66A 4NJDA 4C38A 3LXPA 3GB2A 3MWUA 3PA4A 1PF8A 2PZPA 3JVSA 2F57A 4FL2A 5LOHA 2ZM3A 2WQBA 2O3PA 2UZTA 5EM6A 2I0EA 2BRMA 4YC6A 2BAJA 4ANBA 4EI4A 4GU9A 3DXPA 1PKDA 4M15A 3NUNA 3VJNA 1U5RA 5FRIA 2NPQA 5IA2A 4I5PA 2A2AA 2LAVA 1J7LA 5ANDA 2GHLA 2BFXA 2W17A 1G3NA 3CPBA 3LCSA 5IQBA 4JG7A 3ZRMA 1J1BA 3TNHA 2XIKA 3BEGA 5ITAA 1W7HA 4CGAA 4Y85A 2R4BA 5IG1A 5E7RA 2BTRA 3BU5A 3LFAA 3PXRA 3SC1A 4O7SA 3PXZA 5KHWA 4R77A 4LV8A 4MNEA 4FMQA 2BIKB 4U7ZA 5CT0A 3W8LA 2CGUA 4MBIA 1W98A 2HCKA 5A4TA 1FQ1B 2BPMA 5DBXA 4CMTA 3DK3A 1MRYA 4X21A 3KXGA 4EJ7A 2IZSA 4JI9A 4U45A 4D5KA 5J5TA 3E62A 3CTHA 2J0IA 2ITPA 3KRXA 5HESA 4A7CA 4CTCA 4NW6A 4BR3A 3EN5A 3FLZA 3G90X 5CSPA 2BVAA 2PSQA 3UZTA 4MK0A 3LM5A 2BAQA 2VNWA 3Q53A 3E8CA 1ZLTA 2B0QA 1GY3A 4F08A 1A06A 3ZM9A 3WILA 2X8EA 5CVGA 4ACDA 3TM0A 3FMHA 4GMYA 3VUKA 4OBOA 3GFEA 2R3PA 3MY1A 3UVPA 3PY3A 1CMKE 1GZNA 5DG5A 4WSYA 1OB3A 4MQ1A 5J79A 4K77A 3KRWA 4U41A 1U59A 4DF3A 5L6OA 4V0GA 3UOKA 3VNTA 2O8YA 2WGJA 4APCA 4QMWA 3L8SA 2C5XA 4LOQA 4I0SA 4E4LA 2R3GA 4C36A 2YN8A 3QQHA 5H8GA 3AC2A 2CKEA 4EK5A 2BILB 4Z55A 4ZAUA 5HTCA 2CNQA 2JAMA 4L3LA 3QKMA 2OFVA 1YI6A 3PPZA 4I22A 4K0YA 3M42A 4PV0A 1OIUA 3FZTA 3PJ3A 4GIHA 3FZOA 4I3ZA 4BCHA 4ZY4A 2R7IA 2PMIA 4ZSLA 3VF9A 4DTKA 2ITYA 4BCIA 2W1ZA 5AP5A 4Z7HA 3ORMA 5HNBA 3F6XA 3UMXA 1PRYA 5IDPA 2VV9A 4JOAA 1OIRA 4NK9A 4LMNA 4QQTA 4LL5A 1OIQA 4XOZA 1JPAA 3TNQB 1B6CB 4WOVA 3W16A 3O0GA 3DPKA 4FTQA 3GOKA 5CSWA 4EOSA 3CTQA 2UW8A 4YHFA 3AC8A 4ZTNA 5M4UA 3FLSA 3ORZA 3O7LB 3R30A 4NKAA 5AR8A 3R63A 3ANQA 4NM7A 2VTMA 3DZQA 3ZM4A 4JJRA 2HWOA 4JR3A 3WOWA 4TYJA 2VX0A 4MF0A 1RDQE 2ETMA 2PVNA 3RNIA 3D14A 2GU8A 4N4SA 1SVHA 2OIDA 4RIXB 1NY3A 3CCNA 2PE1A 2WQNA 3LVPA 4F65A 1PMVA 3AD4A 1T46A 2WB8A 4AE9A 3A4PA 3EZVA 4EQCA 1PKGA 3BE2A 1XKKA 3UYSA 5CI7A 5AP2A 3C4XA 2RSVA 4IM2A 5CS6A 4E6CA 1J1CA 1DI8A 3HV3A 2OXYA 4FKWA 2W96B 4HYHA 3UNZA 3I7BA 5IA5A 1P5EA 3V8WA 3E8EA 1J91A 3HMMA 4QP6A 4S31A 3ORNA 5C03A 3HUCA 4BCGA 1PMUA 2FO0A 3C50A 3QKLA 5JSMA 4I6HA 3EN9A 3QHRA 3KULB 3MN3A 4X2KA 3OS3A 3SD0A 2R0IA 4BCJA 2FSTX 5CI6A 3OHTA 3EIDA 2RG5A 3IGGA 4FIGA 1XH6A 4IANA 2GS2A 4KIKA 4FEWA 2WMSA 2G01A 1MRUA 1Y6AA 4IACA 3WZDA 4GS6A 5ANIA 4FTUA 5HGIA 4GU6A 4O1OA 3Q9ZA 3ZUVA 5E8SA 5DNRA 2WEVA 3E8DA 3PVUA 5ETCA 1XJDA 5BMMA 4S33A 4ANLA 2A1AB 3OBGA 5J8IA 3MB7A 4AN3A 1OL2A 3HKOA 4EOOA 1WBNA 5AMNA 5FLFA 1NA7A 3PXFA 5EW9A 3FC2A 3REPA 4ZLOA 2X6EA 5M53A 4QTDA 4JX7A 2WXVA 4CZUA 4J98A 3VBVA 3RAHA 4AN9A 4BBFA 2FSLX 5HLPA 2QOKA 2J0MB 3F5UA 5FUTA 3BELA 3SRVA 4WD5A 4PDSA 3VUHA 5JN2A 2A4LA 3QD0A 5K3YA 3FI2A 5JFWA 1OZ1A 5IQDA 3VF8A 4BTMA 2P2IA 4FT0A 3VBWA 3ZRLA 2AYPA 5M07A 1E1VA 3TV7A 1OUYA 4FNZA 3WIKA 2JIUA 3HMIA 5EI6A 1JBPE 4BDEA 1PJKA 1YXSA 4KABA 1W8CA 5EKOA 4ANSA 5EM5A 4XLIA 3VS3A 2G2IA 3OCSA 2JD5A 5AR7A 2R2PA 2V5QA 4RIYA 4Y46A 1PHKA 4ZY6A 5CASA 1OUKA 4UYNA 5J9ZA 4EUTA 2Z7LA 4L3PA 1TQIA 1XO2B 3WZKA 4FV2A 5IA0A 1H0WA 1VZOA 4Q5HA 3GCQA 1DS5A 4FV6A 1RQQA 1R39A 3MB6A 3LFBA 4FI1A 4ANOA 4U79A 2P33A 4EH5A 3TV6A 3BBTB 4E5BA 3FXXA 4ZTMA 5M09A 2XUUA 4D4RA 4FTOA 5HG9A 4L9IA 4PL5A 3JVRA 4QQJA 2YZLA 5EFQA 4RJ6A 3BE9A 3NPCA 4J95A 4UMQA 3VW8A 4JR7A 4IWPA 1KUTA 4A4XA 4F6SA 4N70A 3VQHA 3LMHA 4FZAB 5HD7A 1QMZA 3KCKA 3QTZA 3H4JA 5E4HA 2WTDA 2J0KA 4EYJA 5E9EA 2QHNA 2XP2A 2C6TA 2OU7A 2E9PA 3THBA 4JRNA 4WA9A 1YW2A 3AC5A 3W2QA 2PZ5A 4G1WA 4BYIA 1OBDA 2Y4IB 2A27A 5HTIA 2WELA 1P14A 5FP5A 2C47A 2WTIA 3GQIA 3QLGA 5K0KA 2O65A 1KV1A 4ERWA 2VTNA 5AV3A 2B9FA 4JDJA 2W1HA 3HRFA 1H07A 2BDWA 3E88A 2O64A 3I6UA 4FBXA 4QPSA 4Y83A 3VHKA 3ZBFA 1ZOHA 4KINA 2HENA 2YDKA 4YJRA 4L42A 4LRMA 3BGPA 3EWHA 2WTWA 3I0QA 3EQBA 5J1WA 4PTEA 2ITVA 4ARKA 2XVDA 4IFCA 4XG9A 4TTHB 3DV3A 4XLVA 2Y8OA 2XKEA 4OTHA 5CEIA 3HNGA 3GUBA 4GUEA 4IC8A 5EKNA 2RF9A 5CU6A 3FLWA 3ELJA 3DFCB 2GQRA 5BUEA 2IVUA 2JFLA 1WFCA 4RVKA 2E2BA 2JITA 4M7IA 4RWKA 1G8AA 4D0WA 2V62A 1WVYA 5HQ0A 4FV8A 3UIXA 4FGRA 4ZZMA 4YZCA 5DFPA 5FP6A 3S95A 1F3MC 3L9NA 4UY9A 2O2UA 3BHYA 4KIKB 4MEDA 4DHFA 5KBQA 4S32A 2J0LA 4UALA 4CCUA 5F9EA 4USEA 4BCNA 2QG5A 4F9BA 5CU2A 1RE8A 3LCOA 3F61A 1OI9A 4DFNA 4F9AA 1Z9XA 4JAJA 3MPMA 4UXQA 4FSMA 4MXAA 4EZ7A 2QKWB 4YUQA 4RSSA 1NT2A 4IVDA 4C57A 4GT4A 4PPCA 4TZRA 2JKKA 2XCHA 5ANJA 3VUDA 4JT3A 4RJ8A 2PZRA 4YLLA 2ZV2A 4BF2A 3ALOA 4PTGA 2OJ9A 5AM6A 3LLAA 3CSVA 3OCBA 4HNIA 4G3GA 2W1DA 2B54A 2XM9A 4PUZA 4R1VA 4DGGA 5EYDA 4KUJA 4G31A 2FB8A 1UKHA 4Y73A 5FDXA 4E73A 4BY9E 4XNEA 3EFJA 3H0YA 3GFWA 4FG8A 5IEVA 5EDPA 2X7GA 2F2CB 3POOA 4FKUA 4RMZA 4J97A 3G6GA 2UW5A 3Q9WA 3VS7A 5FXSA 1ZMWA 2VZ6A 4JS8A 3IW7A 3MPTA 5HICA 5BVKA 3RWQA 1B38A 3ZYAA 4YJUA 4BDHA 4EUUA 2R3LA 3NEWA 3GU6A 3UG2A 4AZSA 4IXPA 4O7VA 3MH2A 5A14A 3ORIA 2QHMA 1XWSA 3FMMA 4RVTA 4U43A 5HBHA 5CSVA 4FR4A 2OW3A 3BLHA 3QQLA 2GFSA 2XA4A 2QURA 3FYJX 2JDVA 4KSQA 2BZHB 3AT2A 1KE5A 4FIJA 2C4GA 3A62A 3NCGA 5AX9A 3NYNA 5FDPA 1VYZA 2DYLA 3COIA 1W0XC 2C5NA 2WMUA 3O96A 2XIXA 3TWJA 1O6YA 3QTRA 1ND4A 1OL5A 3R7UA 4C35A 2YIXA 4DG2E 3JY0A 2FUMA 5IUIA 4FNWA 3R9OA 2BAKA 3NZ0A 5AUVA 3KN6A 2WEIA 5L8KA 4J8MA 4YZMA 1AGWA 4PDYA 4FTNA 4RWLA 1OM1A 2ZMCA 4BDIA 4A4LA 3GENA 4L45A 1Q8WA 3BV2A 4OW8A 3JUHA 4O84A 1PXLA 3P4KA 1MQ4A 3T9IA 1OPJA 4MXCA 1ZYCA 3B8RA 1S9IA 5LMKA 3RAWA 4CFMA 1A48A 4EC8A 1YOJA 4FKPA 1UWJA 3AOXA 3PDTA 3FUPA 5FBNC 4KBKA 3UQCA 2W4OA 2CGVA 3P79A 3ZBXA 2QLUA 2QOHA 2EWAA 5DR6A 5JRSA 3M2WA 4DGOA 3CJFA 4IVAA 1PW2A 2JDTA 2WMAA 5I3OA 2HK5A 3G9NA 3PJ2A 1E9HA 2PY3A 4D2SA 3VULA 5BYYA 4WG5A 5KKRC 4FZFB 2WQMA 4YJPA 3VS6A 3ZC5A 2ESMA 4AX8A 2XK9A 2EXMA 3TXOA 5CAPA 4EK3A 5HLWA 3MDYA 3A99A 2CLQA 2OI4X 3CKXA 4M3QA 5AP7A 3D7TA 5TOZA 1ZRZA 4CEGA 5I9WA 2VX1A 1GJOA 2W1CA 4BVUA 2JAVA 5CU0A 2ZAZA 4TNBA 1KE6A 4O7NA 1V0OA 1VJYA 4QNYA 5M4IA 3QQGA 5CQWA 4EKKA 4Y5QA 4O7RA 4FTLA 3VBXA 4QMZA 1IEPA 3D5XA 4FKSA 3F2AA 5CYIA 5JMSA 5CENA 2ZM1A 4GKHA 3MVMA 4GKIA 4EWHA 3KCFA 3BYVA 4C61A 3FZPA 3BQRA 5LVNA 3R2BA 4O6LA 2WTCA 2ZB1A 3JY9A 2XRWA 5FTOA 2DUVA 4ZK5A 3ZO2A 4CQEA 4O0WA 3DXQA 3H3CA 2DWBA 4M12A 3KXZA 4BCFA 4G5PA 5K4JA 4X3FC 4Y8DA 3RWPA 3HAVA 4RC2A 2PUUA 4I93A 2WD1A 2WU6A 4W4XA 3L8XA 4S30A 3AT4A 3D94A 3D83A 3IGOA 3MI9A 3TKUA 4ASEA 3LM0A 4O0VA 3CEKA 5JGDA 1KSWA 4MKCA 2PMNX 5IMXA 4QTBA 3QRIA 3OF0A 3QRTA 5HX6A 3QX2A 1QPEA 4IWOA 4AZEA 4DC2A 4C59A 3DKGA 3SLSA 2KTYA 3T8OA 4EH8A 3QALE 3EQRA 4AN2A 5JK3A 4C8BA 3F82A 3CJGA 4OTGA 3HV5A 2QOOA 2YIRA 3ITZA 4QTAA 4S34A 5HIBA 3FEGA 3DLZA 4AT3A 4BGQA 3I4BA 4FEQA 4JNWA 2X4ZA 2XM8A 3HA6A 3KRRA 5IA1A 3OWLA 2Y0AA 5DVRA 1H01A 5CEOA 4O21A 3PSDA 3C4WA 4R6VA 4ZZNA 4QRCA 2R5TA 3D5WA 3TKHA 4C4JA 5HTBA 3KA0A 4DTAA 3PYYA 4R3RA 2XEZA 5D1JA 4A07A 2XF0A 5LMKC 2W1FA 1YXTA 2PTKA 4IAYA 5I5ZA 3DBCA 4FK3A 3IG7A 4ZSJA 3VBYA 3KF4A 3FMLA 1M2RA 2HZ0A 4Y72A 4E6DA 4KB8A 4BDCA 3ZO4A 4F7LA 4G17A 4G3DA 3QCQA 4EH4A 5HNIX 2OXDA 4GYGA 4C4FA 3R8VA 3QCSA 3PVWA 4XMOA 5AM7A 4ALWA 4JDHA 1ZARA 3AD6A 3V5TA 5AR3A 5E8YA 3H0ZA 3C4EA 4AOJA 5EQPA 4HCVA 3BBWA 2X2LA 4YJNA 3VBQA 2UVZA 3CY2A 3PJCA 4LI5A 4QTCA 4ZZOA 5JKGA 4X2FA 5FGKA 3A7HA 2UW6A 4TWPA 2C6LA 3R01A 4GW8A 3FHIA 4HPTE 4ZS0A 1YHWA 4H36A 3EN6A 4P5QA 5GZ8A 4Y95A 1H4LA 1JVPP 5AR4A 4WSQA 4EEVA 3LXKA 3FYKX 5C8NA 2QU6A 2C69A 3AXWA 3DKCA 3EH9A 3V8SA 4AW5A 4DEIA 3NLBA 2IO6A 3NUXA 4FG9A 3FWQA 3K3JA 4DEBA 5KX8A 5HD4A 3OWPA 4K9YA 3FHRA 3L9LA 3MVJA 4EHEA 4EC9A 2JBOA 4ZTQA 4AGDA 3DFAA 4QMSA 1JOWB 3BV3A 4B4LA 3SAYA 4D4SA 3FLNC 3JR1A 4XG3A 3WZUA 3SVVA 4O96A 4I20A 4MXXA 5L8JA 4PPAA 4NSTA 5KMOA 1O9UA 5IPJA 3N4UA 3E8NA 4DFBA 3COMA 3WYXA 2HW7A 3FKNA 2BKKA 3RPOA 4I5HA 3PPKA 1Q5KA 4QMYA 5TF9A 3PE1A 1R0EA 4U3ZA 5E90A 5EM7A 3N4TA 3L1SA 3V04A 1YWVA 2IWIA 2PHKA 2R3HA 4QPAA 4QYHA 3U9CA 3L9PA 4E5WA 1MQBA 2Y4IC 3KB7A 5AR2A 3QFVA 4RQVA 4R7BA 2W5BA 4I6QA 5L2TA 2JKOA 1UKIA 3QTUA 4D2PA 2H34A 2HY81 4FV3A 1YDSE 4G6NA 5C26A 1REJA 1YKRA 2ZOQA 3R1NA 3GNIB 4DYMA 4EH6A 5KMIA 5C4KA 3UGCA 4DGMA 3PZHA 3QC9A 4JVGA 2W4JA 4B8LA 3ANRA 4WNMA 4Z9LA 5C8MA 4CV9A 3KKVA 2BRGA 4KA3A 3HRCA 3QZHA 4D5HA 5DH3A 4A9SA 5L6WL 3E7VA 2ITQA 3CQUA 5CVFA 3PVGA 3RALA 4PDPA 4BBEA 4YP8A 4L00A 2ZM4A 4C34A 1NVSA 3EB0A 3LCTA 3RPVA 4IJPA 3RGFA 3QYWA 2XB7A 5DE2A 1OBGA 3BHVA 1KWPA 5HG7A 4M13A 2WMTA 1ZOEA 5AUYA 2J0JA 2ZB0A 2HELA 1H0VA 5CVHA 5LMAA 5E8WA 3NNXA 4DH3A 3NYOA 4MBLA 4QYEA 3NVMB 4D2WA 4FEXA 4FT3A 3EQFA 4J99A 2Z7QA 5A6NA 5LWMA 3SW4A 2VTOA 2CGWA 3QTXA 4D4VA 3UO4A 3OEFX 2YWVA 3LIJA 4AZVA 4V04A 4FTKA 3R00A 4NJ3A 3HV4A 2XBJA 2YM3A 3NUAA 4I6FA 4K18A 3JXWA 3R83A 1LR4A 2NO3A 2UZNA 4F63A 4CRSA 3FMKA 2PVYA 2YM6A 3AMAA 3EKNA 4O27B 5KUPA 5CQUA 3I81A 3R0TA 2VWVA 4O2PA 2UW9A 3QU0A 4IX4A 3CP9A 2WQEA 1OPLA 4M97A 4C02A 1OMWA 3O7LD 3PG1A 1Q8TA 1CSNA 2VO6A 1GIHA 2YAAA 2YHVA 5IH4A 5LCJA 4QQ5A 4EOQA 2Z60A 3KN5A 3UNKA 1BKXA 4LRKA 3R8ZA 4EYMA 2XKFA 3BZ3A 3TI1A 1CTPE 4F9YA 2XRUA 3GU7A 5EK7A 3D0EA 4K1BA 4YHJA 1YRPA 4F9CA 1QPCA 4HGEA 5E91A 5FD2A 4OTIA 4ANNA 4GT5A 3IW5A 4NTSA 3F7ZA 3RCJA 4TRLA 2J5FA 4YZNA 4YJOA 4AT5A 3LFFA 3QXOA 2WOUA 4UV0A 3SQQA 3O51A 3QQKA 3HGKA 3R9NA 4EZ3A 3QL8A 3FI3A 1SNXA 4FOCA 4O82A 2PU8A 2C68A 2V55A 2X0GA 1OL7A 3FZRA 4RX7A 5EOLA 4EHVA 5HU3A 4YBKA 2UZLA 5JZNA 5ANGA 5LVMA 1UU3A 2B9JA 4UWYA 1H26A 4YZ9A 4PRJA 4C3FA 3VUTA 1JAMA 4MQ2A 5HI2A 5J9YA 4M69B 3BHTA 2BMCA 4JG6A 3LXLA 1W84A 2UZOA 2YACA 5IMEA 1JLUE 3VBTA 3ZZWA 3BHHA 1ZYSA 3KFAA 2B1PA 2IW6A 2C1BA 2YABA 3NNUA 1ZXEA 1I44A 5GZAA 3IW8A 5CX9A 3HMOA 2YDJA 4I5CA 5H8BA 4HZRA 5IQCA 3PUPA 4FTRA 3FI8A 3CR0A 3PLSA 3FI4A 4ZMEA 3QWJA 3UQGA 2OBJA 2EUFB 3NW7A 4QO9A 2QOFA 4MAOA 2XIRA 2VGOA 4WHZA 4ZJVA 2NRYA 3H30A 4NFNA 2IW9A 4FG7A 4GEOA 4A9RA 5KO1A 5EYMA 1FVVA 5JT2A 2V7AA 3GC9A 3KF7A 5CXZA 4QP4A 2YCFA 3FZSA 2WIHA 2XYUA 3C9WA 4H1JA 3TKIA 3QHWA 5FM3A 2C5YA 4H58A 4BZDA 4GRBA 3R22A 4PMTA 5E8TA 5DWRA 3V3VA 1MRVA 3CD3A 5EW3A 3R7OA 4NT4A 1Q8YA 5EM8A 3E3PA 4JG8A 2EB3A 3BI6A 4F99A 2WOTA 4RFMA 3A7IA 2AUHA 1U54B 3MIAA 2NP8A 1URCA 3AG9A 1H00A 1LUFA 3LMGA 4OTWA 4AW0A 4C37A 5HBJA 2AC3A 3I5NA 1NXKA 1AQ1A 2B52A 1PYXA 4FT7A 1GIJA 1XH4A 3G6HA 4KSPA 2V0DA 3PLAE 4BDAA 5HVJA 4V05A 4N0SA 4IB3A 3OOGA 5DEYA 5KE0A 3TUCA 4N6YA 3KQ7A 3RZBA 3DBDA 4TXCA 4CTBA 4AW1A 4DT8A 1SMHA 4TWCA 4O0YA 4BDDA 1XH5A 4FV9A 5JRQA 1WBTA 5IQIA 4YZDA 3EN4A 2RIOA 3GOPA 2RFNA 4IHPA 4NH1A 3IDPA 4MBJA 3KEXA 4FKTA 4ALUA 3S0OA 2OLCA 1GIIA 4R8QA 5E8XA 4PP9A 3CPCA 4YTIA 1WBPA 5J87A 5AJQA 3MESA 2GTNA 4RVLA 5J5SA 3EQGA 2X2KA 4O22A 3TDVA 3B2TA 1KOBA 1RW8A 4D1ZA 2GHGA 2QC6A 3TN8A 1OPKA 1UU9A 3LQ5A 4UWCA 4IB1A 2UVYA 4OTPA 5AX3A 5HE2A 1M7QA 3VRYA 1V0PA 3RAIA 4G3CA 1Q97A 4DLJA 4BCKA 4B9DA 3UOHA 3RNYA 1H27A 2ETRA 3G0EA 2I1MA 5FXQA 3I79A 2O0UA 2WMRA 2OGVA 1WVXA 3IPHA 4LGHA 3RK5A 4IJ9A 3OXTA 1B39A 3FSFA 5KZ0A 3W32A 3FV8A 1IA9A 5BYZA 5LWNA 3HX4A 1STCE 4QMQA 5LVPA 3VS5A 4XP2A 3WF7A 4BKJA 3EQCA 4BHNA 3UJGA 4O7TA 2J7TA 4L44A 4RPVA 3TZ8A 4BCPA 2F9GA 5D41A 4AQCA 4B8MA 4F9WA 2XKDA 3IS5A 5D7VA 3PRIA 2EXEA 2DQ7X 2QCSA 3QXPA 4X6RA 4OTFA 5HHWA 5AP6A 4FSNA 3VUIA 1U46A 1PXIA 2JIVA 5L2SA 3BU6A 4BKZA 4E26A 3IKAA 5J1VA 3F3WA 4QP2A 2C6OA 4GK2A 5CEMA 3PFQA 3G2FA 4MNEB 4R78A 4YNOA 2GSFA 5CNNA 2E9NA 4FL3A 4FZDB 5DRDA 5HVKA 1YXVA 3KY2A 5IA4A 1UWHA 3HRBA 3QTQA 4XUFA 4ITJA 4PQNA 1R3CA 4FYNA 5M56A 3OWJA 2XCKA 2VTRA 3BU3A 2X39A 3D9VA 2QOCA 4DBNA 3E64A 2UZVA 4N6ZA 4EOJA 3NYXA 5H9BA 4IAFA 4YLKA 2WQOA 4X3JA 3HMNA 4FSWA 4IZ7A 1LEZA 4PPBA 3KREA 4K8AA 3C51A 4ZOGA 2CHLA 3PY1A 4IVCA 4H3BA 4R3PA 4YPSA 2R64A 2UUEA 3F9NA 5ACKA 4DTBA 4FEVA 2XNMA 4OR5A 1PXOA 5CNOA 2G2FA 2GQGA 1Y91A 4LMUA 3BYMA 4U42A 3U4WA 3ZFMA 3BEAA 3PSBA 4FKOA 4FOBA 4X3FA 4H3QA 4CMOA 2FVDA 3EL7A 1GZOA 4XEYA 4HW7A 3F2RA 3OY1A 2VTSA 5L4QA 3GXLA 4FVPA 3T9TA 3Q2MA 4RX9A 3PRFA 2G1TA 1JKKA 3IDBA 4IQ6A 4LQMA 3VQUA 3HLLA 2JEDA 3PP0A 3UYTA 2J90A 4FIEA 4M14A 5T3QA 4Q9ZA 2CLXA 3MGYA 4BWKA 2YA9A 4CG8A 3AT3A 3COKA 1OGUA 4BDJA 1XBBA 1ZWSA 3LJ1A 1WCCA 3Q6UA 4EK6A 3C4CA 2B55A 3UVRA 3VUMA 4C4IA 3EQPA 2VTHA 2XK8A 3BX5A 4YZBA 1PYEA 2QNJA 3HV7A 1VR2A 4CXAA 2R7BA 5BPYA 4AAAA 3ETAA 3QTWA 3QZGA 5C9CA 3V6RA 3HAMA 5I9UA 2VUWA 1UV5A 2G2HA 2ZV8A 5ANEA 5FEDA 4YBJA 1IAHA 4O0XA 3N4VA 4O81A 5EQYA 4YC8A 2VTPA 3C5UA 3CS9A 4CVAA 2YISA 5EHLA 4WBBB 3ZSGA 3IW6A 4C3RA 2I6LA 4RWIA 3D2IA 4RLKA 2IZTA 5L6PA 3FC1X 1E1XA 3JYAA 4H39A 2LGCA 2XNPA 1UNLA 4GSBA 5I9VA 4IVBA 5CF4A 1FGKA 4B7TA 2UZWE 3AD5A 3PIXA 5CT7A 4CFFA 4FNYA 4IAKA 3EOCA 4JXFA 4AU8A 3KXHA 3HA8A 4GCJA 5CAOA 1CM8A 4AFJA 3QLFA 2C6IA 3SXRA 5C1QB 3KGAA 4DEAA 3DQWA 3LLTA 4FKGA 4NIFB 3LCKA 2B9IA 1H1SA 4KRCA 5BVOA 1J3HA 4GIIA 3CBLA 5HO7A 4EJNA 5EHOA 4KKHA 3ORXA 4YO4A 1S9JA 3MY5A 4I5MA 3RPYA 3AGMA 4BDGA 5FTQA 5DLSA 2C5VA 5IQEA 3E3BX 3UTOA 2PMLX 3QQJA 4RZVA 2JKMA 3ULZA 1YI4A 3RPSA 2OJIA 3S4QA 5A3XA 3OP5A 4M84A 5KNJA 1R78A 5JQ8A 4L46A 4PX6A 4A4OA 4D2RA 2BALA 4XCUA 4XYFA 3FMDA 4FX3A 3ZCLA 1H1PA 4XP3A 5I4NA 3FKOA 5KKRB 3N51A 3V6SA 1ZY4A 1SNUA 3CQWA 5HU9A 4R7HA 3NAYA 3ZRKA 2VGPA 5AUTA 3AMYA 2X7OA 4QMVA 3TEIA 3TTIA 4GH2A 1PMEA 1OL6A 4BBMA 3CGOA 3IOKA 3OTUA 4XG7A 3SX9A 4EL9A 5F4NA 3NVKI 2HZIA 2PE2A 4E4MA 5L2QA 3U6IA 5DT3A 5M44A 3V5PA 4E93A 5DR2A 4BB4A 5FXRA 5HCZA 4PMPA 1H28A 3KULA 5E1SA 2HYYA 4OT5A 4RT7A 3DJ7A 5H8EA 3RHXA 4X0MA 3IW4A 4O7YA 5IQFA 5FEQA 4CV8A 5EDRA 5AV0A 4QP7A 3NIZA 5AUZA 5IU2A 4OGRA 3OG7A 4U40A 3TL8A 2IZUA 5GJGA 4W9WA 3VHEA 2Z7RA 4EORA 4U3YA 5DMZA 1KE7A 2OZAB 2WO6A 4LOPA 2EU9A 3V8TA 4C3PA 4F0GA 4YHTA 3C7QA 3OFMA 4R5YA 3W10A 1YHVA 2QOIA 4NKSA 4IFGA 2OZAA 1Z5MA 1UVRA 4MH7A 4G5JA 3QZIA 2C0TA 3W33A 3Q6WA 4PY1A 5IEXA 3ZXZA 3GC8A 4EH9A 3DB8A 2GQSA 4PF4A 5HOAA 1XR1A 2VTTA 2GS7A 2J4ZA 4FTCA 2ZV7A 4DFYA 3ACKA 1H24A 4YSMA 4FC0A 3KXNA 4DEEA 1XH9A 3EZRA 4GYIA 3HMPA 3HYHA 5CXHA 3DK7A 4AF3A 2ITTA 2GPHA 5LQFA 2JIIA 4Z3VA 3EQDA 3QUPA 4AS0A 3CXWA 4PMSA 4EOPA 4FSQA 4QMLA 1ERKA 5D11A 3GCUA 4I1ZA 3F3TA 4NUSA 4W4YA 5LXMA 3CKWA 2C0OA 3TJDA 5CU3A 3H9FA 2PVHA 1H1QA 4J8NA 4W4WA 3V51A 4UX9A 4Y5HA 5CZHA 4EOIA 3M1SA 4U80A 4KIPA 3RKBA 1KV2A 4I94A 4I6BA 3MSSA 2R3MA 3MVHA 1YWNA 3LFCA 4Q9SA 1WBVA 4FL1A 1V1KA 3VVHA 4BI2A 5KMKA 2PWLA 3E92A 3QTSA 4BGHA 2YM8A 4EQMA 2I40A 2BFYA 4FIIA 4WRGA 3MJ2A 3E7OA 2HIWA 1QPDA 3QQFA 5JFSA 2VNYA 2QU5A 4QMOA 2XEYA 5ETIA 4B6LA 4J52A 3ORKA 3G51A 4FT5A 3QRJA 4LOOA 4ASZA 2W5HA 3MH3A 5T68A 2IG7A 1G8SA 4NIFA 4MD8E 2C30A 2REIA 4OAVB 1YWRA 3PE2A 3QWKA 4ASXA 4CFWA 2X1NA 3R02A 2QONA 2F7XE 1Q8ZA 3E5AA 3P7BA 4FTAA 3ZLYA 3ZSHA 4CT2A 2IPXA 4KIOA 3O8TA 3RK7A 1X8BA 3GU5A 4CKJA 2W1IA 4JDKA 1XH8A 5C4LA 2ONLC 3DY7A 1K9AA 4K11A 2BTSA 5BMSA 2B53A 4CZTA 1YDTE 3HUBA 4BZNA 2C6DA 4FEUA 2VAGA 4U5JA 3A7FA 4L01A 2R3NA 1O6LA 2BCJA 5E1EA 4YTHA 2C3JA 3FMNA 1M2QA 2XK3A 4MWIA 3H9RA 4F1TA 3VRZA 3K54A 1OITA 5I9ZA 2HXLA 2W1GA 2C6KA 3AGLA 3II5A 4L68A 3A7JA 3F3UA 4EOLA 3R7YA 5KMNA 2QD9A 3RK9A 5TT7A 5AAEA 4XRLA 4ANMA 3WF6A 3UIMA 1F5QA 1JSUA 2WFYA 2JDOA 4UBAA 5D12A 1G5SA 4BDFA 1Q8UA 4BIBA 3V01A 5A46A 1FMOE 3P9JA 5GHVA 4ERKA 5BQ0A 4CFUA 4BWPA 2HOGA 4ITIA 4QTEA 4NM3A 2CNVA 3RAKA 4UMPA 4PTCA 5DOSA 2PYWA 2P0CA 2DS1A 5L2WA 4DGLC 3LXNA 5CEQA 1ZYDA 5TKDA 4DCEA 5IISA 2XK7A 5IF1A 2XMYA 3SA0A 4K2RA 2OH4A 2ITXA 1H25A 4EKLA 1FPUA 5TE0A 5M51A 3NW5A 5KBRA 2GCDA 3PP1A 2YJRA 4FGBA 5A54A 3CLYA 2B9HA 2GMXA 2GS6A 2H8HA 2WNTA 5F94A 3MJ1A 4ZTSA 2XIYA 4KD1A 3OWKA 1XBAA 4PL3A 3VAPA 1Q3WA 5EG3A 4CT1A 3AMBA 3KMMA 1J7IA 3TCPA 4HGSA 2OJFE 1JSTA 2ZYBA 2CSNA 3R1YA 4ONAA 3PWYA 5AIRA 3TZ7A 1JNKA 1TQPA 2UV2A 4RFYA 4AZFA 4JQ8A 2F7EE 4MHAA 3TIZA 4AACA 4C2WA 1M17A 3NWWA 4FSRA 1KOAA 2YM4A 4L6QA 4DFXE 2YM5A 2O5KA 2AC5A 1PXPA 1Q4LA 5G6VA 2BDFA 2XNBA 3R2YA 3I6WA 4RQKA 3TNIA 4ACMA 4EH3A 2RFEA 3SKCA 4DFLA 3UODA 2VO7A 4YGAA 4E6AA 4UN0C 4YO6A 3PIYA 4AA5A 3SOCA 3HVCA 2FSOX 4MXZA 3R71A 4J1RA 3LFSA 4AXAA 5ICPA 5BX0A 4YJVA 4X2GA 4C4GA 5LMBA 2CMWA 3MFTA 1IAJA 3OC1A 4E20A 1Q62A 3SXFA 1WMKA 4OBPA 3BYUA 4G9RA 2W9FB 3R9DA 3O71A 2GNJA 3CE3A 2C1AA 5DIAA 4YJSA 3O23A 3W2PA 4FT9A 3R8PA 4NCTA 4C4HA 2HW6A 4CD0A 5A4LA 4FTIA 4G3EA 2FGIA 3KVWA 3TV4A 3PJ1A 4F1OA 3UG1A 3NUUA 4XH6A 3I60A 3ZHPC 4G2FA 3R8MA 3Q32A 3PPJA 2VRXA 5LVLA 1L3RE 2SRCA 1WBWA 2YFXA 3ZFYA 4ZLYA 4FUXA 2YCSA 3O8PA 3QGYA 5HORA 3OCTA 3VUGA 2WPAA 3LQ3A 2V7OA 4WNPA 1YXUA 4QMPA 4U0IA 5AV2A 4EONA 4I24A 3PVBA 2VO0A 3BQCA 2I0VA 4AOTA 4K6ZA 4A06A 3FJQE 2E9VA 3FQEA 5E8VA 3W2OA 4C33A 3EMGA 3OW3A 1UNGA 3Q9YA 4NZWB 3TJCA 4RX8A 3UVQA 2CPKE 4QMTA 4BTFA 4HCTA 4RG0A 1U4DA 5IZFA 5LVOA 2UZDA 3ZC6A 3FAAA 4I92A 2EVAA 4PNIA 5AV1A 4DITA 4D1SA 4LL0A 4IB0A 3R7GA 5F95A 3NSZA 5ACBC 4UMRA 2UW0A 3KRLA 3NUSA 4FTJA 3EQIA 4FZ6A 2QQ7A 2XZSA 4MTAA 4D55A 3EYGA 2GNLA 4YTCA 1P4FA 3FMEA 3FQSA 4HVDA 5KCVA 2KULA 4G6OA 2QO2A 3BLRA 3G9LX 4BI1A 3O50A 3ZDUA 2YM7A 3S1HA 1BI8A 3C4ZA 5IA3A 3DS6A 4FSZA 4FVRA 2WTVA 4G16A 3DDPA 4EWQA 4GFGA 4IWDA 3MH0A 4AUAA 2Z7SA 5ETFA 4CCBA 2I7QA 2A19B 3Q60A 3LOKA 4RA5A 4WG3A 4CZYB 3U87A 2R3IA 3P1AA 4UZDA 5HCXA 4ZSEA 3FY0A 4D2TA 4DH7A 2OIQA 3EFKA 2HZ4A 1RJBA 3QD3A 4JQ7A 5C27A 2C3IB 3LQ8A 3CC6A 4W9XA 1OKZA 1BYGA 2I0YA 3COHA 3WE4A 2IJMA 1FGIA 2PUPA 3MH1A 5L8LA 4JLCA 1JKSA 5B7VA 2BZIB 4Z16A 3QUEA 3POZA 3OY3A 4BCQA 3EKKA 2BIYA 3FSKA 3GC7A 4AGWA 4ANQA 3RTPA 3M11A 4WG4A 4L7FA 2F4JA 2QO7A 4RIWA 1UU7A 2RKUA 3EFWA 1Q3DA 3RM6A 3CTJA 3ERKA 2WAJA 4F7NA 3PJ8A 1QL6A 3C4FA 3D5VA 3QA0A 5D7AA 4XG2A 5A6OA 4FKQA 4ALVA 2OH0E 5AEPA 3F69A 4W4VA 5K4IA 3R1SA 3ZEWA 4UXLA 2ZV9A 4PWNA 3U9NA 4BCMA 4YLJA 4QPMA 2OKRA 5LJJA 4XV2A 2G9XA 1BL6A 2OJJA 1DM2A 1JSVA 3NS9A 2WTJA 2R9SA 3EHAA 4TY1A 5JH6A 3K3IA 2VWYA 3ZTXA 3Q52A 3NYVA 4WIHA 3RM7A 5A4QA 5IUGA 3HEGA 3WZJA 1FINA 4IBMA 4Q5EA 1AD5A 4IAAA 2OSCA 3IONA 2VTQA 4P2KA 4QMMA 4PP7A 1BL7A 4C2VA 1W83A 5DA3A 4CG9A 2VWXA 3W55A 3DOGA 3P23A 3RZFA 3VS0A 4E1ZA 1SVGA 4KBCA 1CKJA 4FV7A 3FKLA 5CAQA 5CZIA 4Q2AA 4UWBA 1YHSA 2R3RA 3MTLA 4IX6A 5E8ZA 4E7WA 4HVGA 2J2IB 3KVXA 1YQJA 3GC0A 3DKOA 4WT6A 1IG1A 5EOBA 3KXMA 4QD6A 5H3QA 4DH5A 3EFLA 4E4XA 2QR8A 4YR8A 5K0XA 2VX3A 3WYYA 3D4QA 4QQCA 1U5QA 4AP7A 2J6MA 3DB6A 4OAUC 2PUIA 1GZKA 4E4NA 3CIKA 4XV9A 1ZYJA 4NTTA 4ZP5A 3TUDA 3BHUA 4IC7A 3D5UA 4RFZA 3OROA 4UMUA 4N57A 4J7BA 4CLJA 2W5AA 4D1XA 4CFXA 3GT8A 1IR3A 2EXCX 2OXXA 4YMJA 3PTGA 4I4EA 3Q4CA 3TTJA 2CNUA 3ZSIA 5DN3A 1ZOGA 4O83A 2VWWA 1OVEA 3MA3A 2YZAA 4NEUA 5HBEA 4HVIA 5BVFA 3BCEA 2XH5A 4TYHB 1URWA 5CF6A 1Y8YA 2QKRA 4MWHA 2VWUA 3HDNA 2JLDA 2Y4PA 4IAIA 2ETKA 5L2IA 2WU7A 5F1ZA 3DU8A 5AP1A 4HGLA 1U54A 3T3UA 2RFDA 4RJ4A 4D4YA 2IVVA 2IW8A 5CLPA 3GI3A 1L8TA 5D10A 4KS7A 2BZJA 4LUEA 5GJFA 4ZSAA 2F2UA 3ID6C 4HYIA 1DAWA 4NM0A 5CSHA 4E5AX 5FM2A 3LJ0A 4P90A 4E6QA 3V5QA 1NVQA 3DTWA 4DE4A 4JDIA 3EQHA 3BLQA 5M55A 1R1WA 2YIWA 3UC3A 5JGAA 4TYHA 4F6UA 3DLSA 1P4OA 5HVYA 3VJOA 4M8TA 5IQGA 1SM2A 2F49A 4OLIA 3WF8A 2X81A 4BTJA 3DBEA 5M4CA 2XNEA 3UP2A 2XNGA 4RA4A 2QO9A 2QLQA 3VO3A 3R04A 4EOKA 5CAVA 1HOWA 2CGXA 4WNKA 4DEHA 1I09A 1F0QA 1VEBA 5TR6A 4F0FA 5BVNA 5JZJA 4ZS4A 4XRJA 3GCSA 4QP8A 4TYIA 4RJ5A 5C8KA 3OEZA 3I0OA 4DH8A 1HCKA 4U81A 2Z2WA 3SOAA 2NRUA 1PXKA 3VN9A 2OWBA 4L53A 4GV1A 4D9UA 2XK6A 4IM3A 3RINA 3UQFA 3W18A 5DT0A 3SG8A 2GNIA 3SG9A 3S3IA 2PE0A 5AP0A 3QGWA 3Q4ZA 3KRJA 2ERKA 3KXXA 2Z02A 4XV3A 4W8DA 4ZEGA 1Z57A 3D15A 2W0JA 4O2ZA 1XH7A 3GEQA 2OF4A 3Q5IA 3RI1A 3FL5A 4GJ2A 2HWPA 3DAEA 3A7GA 3RVGA 2J51A 2WZJA 4OTDA 5DHJA 4DH1A 5DR9A 3ZS5A 2ITWA 3NCZA 3A2CA 1K2PA 3DJ5A 3LAUA 3QRUA 4RVMA 2J50A 3C0HA 2X4FA 4RIWB 4IX3A 5B0XA 4EOMA 3ZOSA 3FXZA 4JIKA 4TNDA 4BWXA 4NYEA 3VIDA 2W1EA 3O2MA 2WHBA 4IZYA 3DJ6A 3LHJA 2XJ2A 4BDBA 3OUNB 4DFZE 2UW3A 4FA2A 4GJ3A 5EYCA 4QOXA 4IDTA 5GNKA 5CU4A 3L9MA 4HGTA 2YCRA 3PWDA 3BYSA 4LRJA 4IIRA 4O86A 4ZTLA 4O91A 2VN9A 3NDMA 4O7WA 4G3FA 3UDBA 4P5ZA 4GFOA 3NRMA 4J53A 1GOLA 2F7ZE 3C1XA 3ORPA 5HNGA 4FTMA 4X7QA 4ENXA 3KL8A 3ZFXA 1PXNA 1EH4A 5ETAA 3HL7A 4ZSGA 2BHEA 4W8EA 4ZY5A 3WARA 3MFRA 5HZNA 3N9XA 4ZLZA 2R3KA 2VTAA 4TYGA 2B4SB 5DPVA 5HG8A 2IVSA 3R7VA 3VS2A 5EW8A 5J7HA 5GINE 1XBCA 4U44A 4YTFA 4FSUA 2ACXA 3Q3BA 5IQAA 3ZO3A 2R0UA 3U6JA 3ORTA 4KIQA 4RIYB 3Q4TA 2X8DA 3K5VA 4XS2A 3MTFA 4HOKA 3ZDIA 3MPAA 4HPUE 4L43A 5FG8A 1CKPA 2BDJA 3GU4A 4OUCA 4CLIA 3MA6A 1DI9A 1NW1A 5TO8A 3LPBA 2Y6OA 2VTIA 3KMUA 3HZTA 3JS2A 2YCQA 3P86A 3NR9A 4HJOA 3NNWA 4C4EA 4DAWA 2CJMA 2X9EA 5KZIA 5BUIA 3ZLWA 3CQEA 4RZWA 4R5SA 5AUXA 3OVVA 3ZUUA 4BFMA 1M2PA 3LFDA 2OICA 3NNVA 4K33A 4MXOA 4XJ0A 2VTJA 3QC4A 3NW6A 2PZIA 2VWZA 4LG4A 4BN1A 4DA5A 2UZUE 3IK3A 4GFMA 3RJCA 3QZFA 3KMWA 2QI8A 2VTLA 2YERA 4BRXA 4TKSA 3QF9A 2XYNA 4PMMA 5IDNA 5HKMA 2JKQA 1T45A 3U51A 3FZ1A 4L8MA 2UW7A 1FBNA 2HXQA 3F66A 5AUWA 3R1QA 5AP3A 3S2PA 1CKIA 4FSYA 2PULA 1SVEA 4B0GA 5G1XA 4FF8A 4YJQA 4CKIA 4QYYA 3LJ2A 4CFVA 4EK4A 2WMQA 2FYSA 4P7EA 3NUYA 4ITHA 1DAYA 3PXYA 4I23A 1YOLA 3LCDA 4FV5A 4F6WA 3RMFA 4M0ZA 2X6DA 4QP9A 2GHMA 5GZ9A 3UPZA 4D2VA 2PK9A 1TVOA 3BYOA 5K5NA 3KK8A 3R9HA 5J9LA 3DK6A 4DFUA 3K5UA 2X2MA 3TNPC 3L8PA 5HLNA 1FVTA 3MFSA 4HYSA 4OTRA 1TQMA 3CGFA 3PA3A 1Q99A 3P7AA 4ZTRA 2FH9A 2GFCA 4F09A 3ENHA 2VU3A 3UBDA 1Q61A 3GBZA 2WMVA 5IKWA 3HP2A 5M06A 3PXKA 4JAIA 4CMUA 4EK8A 4TYEA 5DYJA 1WVWA 2QR7A 3FY2A 4IX5A 5K9IA 5GIOE 4A9UA 4ACHA 2BKZA 2V22A 4DEGA 5GIPE 1YI3A 2YLFA 4E3CA 2RFSA 2IN6A 3HECA 3ENMA 2ERZE 3TDWA 3UE4A 2ZVAA 2BROA 5EYKA 3R8UA 3RPRA 1ZZLA 2WMXA 1WZYA 2R3QA 4UEUA 1V0BA 5HCYA 1H08A 4JQEA 2P3GX 4JBPA 5H2UA 5CEKA 5EDQA 5KHXA 4RBLA 1XHAA 2Y7JA 4BYJA 2PL0A 5CWZA 4FSTA 3ZONA 1GAGA 4I41A 4GL9A 4RIOA 2W9ZB 4UZHA 4O0TA 5EI8A 4XG8A 3IOPA 4F64A 4FODA 4LUDA 3ZXTA 1IRKA 2NNWB 3PXQA 2CCHA 3NUPA 3ZO1A 3R6XA 5EQEA 4WUAA 4DG3E 4MD9E 1WAKA 3GVUA 4U8ZA 5I0BA 1JWHA 5KMLA 3QKKA 4BL1A 4FZ7A 3RP9A 4MCVA 3ZU7A 4V01A 3G5DA 4ACGA 4H3PA 4XOYA 3JPVA 4HYUA 4WUNA 1OKWA 1PY5A 3GCPA 3RHKA 3ATSA 2BUJA 2XIZA 4WKQA 4H05A 1P2AA 3SHEA 3W2RA 2Y6MA 5CEPA 4MNFA 1K3AA 2ZJWA 3F5XA 3FPMA 3UC4A 2YWPA 4H1MA 2OIBA 3SRVB 2OG8A 3AC3A 3Q2JA 3WZEA 4R1YA 4A9TA 4MXYA 3UO6A 3UOLA 1GZ8A 1MP8A 2BRHA 2XNOA 3A60A 3H9OA 4IE9A 4AE6A 3DXNA 1M52A 3FBVA 4FIHA 1JQHA 4BZOA 4F4PA 2PVFA 4GVJA 3MVLA 4IW0A 3F2NA 3UZRA 1ZMUA 1ZAOA 4ACCA 4OBQA 3LZBA 4MD7E 4JBOA 4BI0A 2UW4A 5I9XA 3QCXA 3RBWA 4DT9A 3DAKA 3U8WA 4LM5A 2RG6A 5AAFA 5LARA 3R73A 4TWOA 4IMYA 3U55A 4CYIA 4BDKA 2H96A 2Z8CA 3E87A 1VYWA 4U6RA 4KWPA 1UU8A 2HY0A 2YDIA 1Y57A 4I0RA 4X2JA 3BKBA 4XV1A 3TT0A 4HNFA 4R3CA 5M4FA 4JL9A 3IQ7A 2X7FA 3OT8A 3QRKA 5HO8A 3BRBA 3F88A 3QAME 1SYKA 4A9YA 1R0PA 5AR5A 2J5EA 2ONLA 4M0YA 2R3JA 3F7WA 2ITZA 4X2NA 4WBOA 5E8UA 4KKGA 4MX9A 1YVJA 3WF5A 4E8AA 1SZMA 1H8FA 1PMNA 4FICA 3P08A 4GT3A 3ACJA 5LCKA 3GU8A 4C62A 3Q4UA 1FVRA 4FNXA 4TWNA 5CANA 3UPXA 2OF2A 4RJ7A 5L3AA 2QG7A 3U6HA 3HV6A 3NGAA 3OXIA 4NW5A 2JFMA 4G34A 4QT1A 1ZZ2A 3F3VA 3OXZA 3PIZA 5B2KA 1APME 4FKLA 4LFIA 4QMUA 3I7CA 3C13A 4HVSA 5E92A 1PXJA 4IB5A 2CN8A 3BIZA 2W05A 2YEXA 4RIXA 3BWFA 1M7NA 3OZ6A 3ALNA 3NIEA 5K5XA 1BMKA 4L3JA 2YLEA 3EYHA 3WE8A 3GCVA 3IO7A 2Q0NA 1JKLA 2VO3A 4LYNA 4USDA 5ANOA 5JFXA 3TZ9A 5CTPA 3ATTA 4I21A 4O38A 2CCIA 3CD8A 2VWBA 1UA2A 3I5ZA 4YNEA 4AZTA 3MW1A 4EHGA 5AA9A 3OT3A 4FV4A 3OOMA 5AA8A 5HIDA 1GNGA 4F70A 4FKRA 3P0MA 4EH7A 3LFNA 4AWIA 4G9CA 3FL4A 1FOTA 4ASDA 4NFMA 4RX5A 5AFVA 3WI6A 3DBQA 3RCDA 3LKMA 5IQHA 4HZSA 3OTVA 3WF9A 1Q24A 1ZMVA 5AP4A 4FE2A 1OECA 2P55A 3MFUA 4XG6A 2HAKA 5CALA 3LE6A 4GUBA 3W2SA 3MV5A 2W4KA 2XNNA 2PMOX 5CAUA 2ITNA 3DQXA 5B2MA 3PSCA 4L52A 3BWJA 3G15A 2X9FA 1KE9A 4UMTA 3V5WA 2CKQA 3VW6A 4RRVA 3BPRA 4FYOA 4MYGA 1Y6BA 3W8QA 2X8IA 2H9VA 2YIQA 2ITUA 4FIFA 2G15A 5FQDC 3HDMA 4IWQA 1YDRE 5FBOA 4LGGA 5J95A 3DGKA 5BVEA 5BNJA 2WTKC 1OKYA 4YJTA 4BCOA 4AZWA 5JEBA 4O7LA 2FSMX 3EL8A 1H1RA 4P4CA 2IVTA 5AADA 4CRLA 2GNGA 4MVFA 4NU1A 2BR1A 3VS1A 1WBOA 4RLLA 3OMVA 4EHZA 3AC4A 3C0GA 4AT4A 1TKIA 2WMBA 3DZOA 4GG7A 4EBVA 1WBSA 3PY0A 2WKMA 3QX4A 4NCTC 4ZJJA 1BLXA 3R8LA 2EB2A 2PVKA 3QA8A 3ROYA 3MIYA 2XBAA 4TN6A 5EI2A 3NMUF 3EN7A 2UZBA 3WBLA 2W99B 4WRSA 2Q83A 1FMKA 2OK1A 1QCFA 2IZRA 2ZDTA 4X6QC 5DEWA 5EH0A 5HIEA 5IUHA 3D7TB 2QOLA 3DNEA 2YJSA 4FV1A 4CFNA 5HX8A 3QTIA 3OD6X 4CYJA 1MUOA 3OCGA 4LGDA 1LEWA 4RWJA 1CDKA 3F5GA 4HVHA 5I9YA 4BIEA 2JBPA 2VWIA 3PZEA 5AIKA 1HCLA 4QMNA 2GTMA 4KRDA 1A9UA 4DEDA 4NL0A 2PVLA 1KE8A 4BGGA 4O6EA 4OTQA 4CKRA 4O0UA 3OBJA 4FKIA 2HZNA 3KK9A 3R9RA 2CN5A 4BIDA 3ULIA 3ZLXA 3OUKA 4GK3A 5JFVA 3LMIA 3TZMA 4C58A 4EQUA 2YITA 4OT6A 5A4EA 2JDRA 3QD2B 3SGCA 5HE3A 3K2LA 3QCYA 2C5OA 4UB7A 3PG3A 3QQUA 3A61A 5BUJA 4KS8A 5FEEA 3W2CA 3O8UA 5KMJA 4DCAA 3TNWA 3SV0A 3L8VA 4AGCA 3UO5A 2UZEA 3FE3A 3P7CA 4FKVA 2E9OA 4ID7A 4ZTHA 4B99A 3AC1A 4F7SA 4FTTA 3W1FA 4IZAA 1M14A 4JX3A 5DRBA 4C7TA 4U9AA 3GP0A 5D9HA 1REKA 2CKPA 1YOMA 4BC6A 4TW9A 3FXWA 3Q04A 3TIYA 4F7JA 4M68A 5I3RA 3ZUTA 3NAXA 2J9MA 1XQZA 3Q9XA 4RC4A 4Z7GA 5C01A 3R28A 2PVMA 3GQLA 1W82A 2FA2A 4BICA 4YC3A 2Y9QA 3OW4A 3P78A 3CY3A 4DINA 3FQHA 3DA6A 3KC3A 4TT7A 3QBNA 4HCUA 4IM0A 4JBQA 3D2KA 4IADA 5A9UA 3KU2A 4G6LA 2JDSA 2PVJA 5CY3A 3UOJA 5GJDA 4KBAA 4KNBA 4D28A 3V5JA 2I0HA 3ZLSA 4RC3A 3ZEPA 1JKTA 4IEBA 1Y8GA 3HP5A 4UYAA 2XJ1A 3FPQA 2R3OA 3TG1A 1BI7A 3A8XA 2QOBA 4AFEA 3SDJA 2OJGA 1ATPE 4AOIA 4C0TA 4CQGA 2OZOA 3A8WA 5ANKA 4O7ZA 2W06A 2YIYA 4DGNA 2PUNA 3DDQA 4XP0A 2ITOA 3MYGA 2PPQA 5CF8A 3E93A 4D0XA 5M57A 4YU2A 4AA4A 3NX8A 4QYFA 2CDZA 3Q5ZA 3ODYX 5EHYA 2VD5A 4ENYA 3QUDA 1ZYLA 3DBFA 3AQVA 3B2WA 2WMWA 3DCVA 4JIAA 2ZMDA 4NWMA 4O1PA 4GVAA 3ORLA 4XBRA 3R7EA 4D58A 5BVDA 4RGJA 2XS0A 5IEYA 4IH8A 3V5LA 5IH6A 4QP1A 3VS4A 4IZ5A 3G0FA 4IAZA 2OFUA 3EJ1A 5FWKK 3SW7A 3DNDA 4L67A 3PA5A 3BGZA 2QVSE 3QYZA 3R21A 1IA8A 4EZ5A 4FVQA 2JGZA 3LFQA 3U4UA 2WTKB 4AG8A 3UP7A 5JGBA 1LPUA 3C5IA 3DKFA 4D9TA 1OL1A 3E63A 2PZYA 3FLQA 4ORKA 4XX9A 4WO5A 4F0IA 2GDOA 2BRNA 3BGQA 2P4IA 3ZH8A 2QOQA 4PNKA 2BRBA 4O0RA 4M69A 4YPDA 4AW2A 2GNFA 5M08A 4X3FB 3T3VA 4V0GB 2BZKB 5HEZA 4QYGA 3FLYA 3FMJA 2UVXA 4ZMFA 1OKVA 2GNHA 3MBLA 4BHZA 3B8QA 5KMMA 4WNOA 1H1WA 5AWMA 4KKEA 1ZY5A 4GG5A 3TACA 3D7ZA 5CSXA 3LW0A 5F20A 2YAKA 4FKJA 4O0SA 3UIUA 4PDOA 3O17A 1YXXA 3MY0A 4RJ3A 5AUUA 3P5KA 4GK4A 1BUHA 1PXMA 4XHKB 3ET7A 3IECA 3VWAA 4QP3A 4L7SA 3ZZEA 4AA0A 5DI1A 4YSJA 4LV5A 2OO8X 3ODZX 5CF5A 1J7UA 2ZDUA 5IH5A 4TL0A 4USFA 3FDNA 1BX6A 1Q41A 3WIGA 2CKOA 4JRVA 2WIPA 2C6MA 2JC6A 4II5A 3UZPA 5FTGA 1NVRA 3DT1A 4R7IA 4F1MA 5T6KA 2W7XA 3U54A 3I1AA 4FUYA 5BYLA 4I4FA 3VC4A 3UIBA 4EBWA 4M67A 3DAJA 5AAGA 3ROCA 4EH2A 3Q96A 1UNHA 2QODA 2C0IA 2C3LA 3MS9A 4PL4A 2E9UA 5HG5A 2Q0BA 4BTKA 3C0IA 3SXSA 1O6KA 3H10A 4TPTA 4FV0A 4XG4A 3DTCA 4U97A 4JBVA 4ZJIA 4YURA 3S00A 4BKYA 2XK4A 4DG0E 1OIYA 4KAOA 4XBUA 4CSVA 4CNHA 2B7AA 4ZIMA 1IASA 2O63A 3LFEA 3QD4A 2XKCA 4J96A 2PVRA 3ZMMA 3F5PA 2H6DA 5AV4A 5A4CA 1QPJA 3UNJA 3A4OX 5B2LA 2BHHA 4I0TA 4FK6A 5HE1A 5J7BA 4QMXA 1LP4A 2RL5A 5HE0A 3IDCA 4NM5A 2R3FA 4QNAA 5DGZA 3UMWA 2C3KA 3F3ZA 3GGFA
chains in the Genus database with same CATH superfamily
4DN5A 2RGPA 3G33A 5JQ5A 4AGUA 4IDVA 4S2ZA 2C6EA 4DLIA 4DBXA 3TUBA 4J71A 5BVWA 2P2HA 4MF1A 4APPA 5HO6A 3R7IA 4ZXTA 5DT4A 2XJ0A 2A0CX 4M66A 4NJDA 4C38A 3LXPA 3GB2A 3MWUA 3PA4A 1PF8A 2PZPA 3JVSA 2F57A 4FL2A 5LOHA 2ZM3A 2WQBA 2O3PA 2UZTA 5EM6A 2I0EA 2BRMA 4YC6A 2BAJA 4ANBA 4EI4A 4GU9A 3DXPA 1PKDA 4M15A 3NUNA 3VJNA 1U5RA 5FRIA 2NPQA 5IA2A 4I5PA 2A2AA 2LAVA 1J7LA 5ANDA 2GHLA 2BFXA 2W17A 1G3NA 3CPBA 3LCSA 5IQBA 4JG7A 3ZRMA 1J1BA 3TNHA 2XIKA 3BEGA 5ITAA 1W7HA 4CGAA 4Y85A 2R4BA 5IG1A 5E7RA 2BTRA 3BU5A 3LFAA 3PXRA 3SC1A 4O7SA 3PXZA 5KHWA 4R77A 4LV8A 4MNEA 2X0PA 4FMQA 2BIKB 4U7ZA 5CT0A 3W8LA 2CGUA 4MBIA 1W98A 2HCKA 5A4TA 2XARA 1FQ1B 2BPMA 5DBXA 4CMTA 3DK3A 1MRYA 4X21A 3KXGA 4EJ7A 2IZSA 4JI9A 4U45A 4D5KA 5J5TA 3E62A 3CTHA 2J0IA 2ITPA 3KRXA 4O4DA 5HESA 4A7CA 4NW6A 4CTCA 4BR3A 3EN5A 3FLZA 3G90X 5CSPA 2BVAA 2PSQA 3UZTA 4MK0A 3LM5A 2BAQA 2VNWA 3Q53A 3E8CA 1ZLTA 2B0QA 1GY3A 4F08A 1A06A 3ZM9A 3WILA 2X8EA 5CVGA 4ACDA 3TM0A 3FMHA 4GMYA 3VUKA 4OBOA 3GFEA 2R3PA 3MY1A 3UVPA 3PY3A 1CMKE 1GZNA 5DG5A 4WSYA 1OB3A 4MQ1A 5J79A 4K77A 3KRWA 4U41A 1U59A 4DF3A 5L6OA 4V0GA 3UOKA 4AAYA 3VNTA 2O8YA 2WGJA 4APCA 4QMWA 3L8SA 2C5XA 4LOQA 4I0SA 4E4LA 2R3GA 4C36A 2YN8A 4MUQA 3QQHA 5H8GA 3AC2A 2CKEA 4EK5A 2BILB 4Z55A 4ZAUA 5HTCA 2CNQA 2JAMA 4L3LA 2XAMA 3QKMA 2OFVA 1YI6A 3PPZA 4I22A 4K0YA 3M42A 4PV0A 1OIUA 3FZTA 3PJ3A 4GIHA 3FZOA 4I3ZA 4BCHA 4ZY4A 2R7IA 2PMIA 4ZSLA 3VF9A 4DTKA 2ITYA 4BCIA 2W1ZA 5AP5A 4Z7HA 3ORMA 5HNBA 3F6XA 3UMXA 1PRYA 5IDPA 2VV9A 4JOAA 1OIRA 4NK9A 4LMNA 4QQTA 4LL5A 1OIQA 4XOZA 1JPAA 3TNQB 1B6CB 4WOVA 3W16A 3O0GA 3DPKA 4FTQA 3GOKA 5CSWA 4EOSA 3CTQA 2UW8A 4YHFA 3AC8A 4ZTNA 5M4UA 3FLSA 3ORZA 3O7LB 3R30A 4BJJA 4NKAA 5AR8A 3R63A 3ANQA 4NM7A 2VTMA 3DZQA 3ZM4A 1OGYA 4JJRA 2HWOA 4JR3A 3WOWA 4TYJA 2VX0A 4MF0A 1RDQE 2ETMA 2PVNA 3RNIA 3D14A 2GU8A 4N4SA 1SVHA 2OIDA 4RIXB 1NY3A 3CCNA 2PE1A 2WQNA 3LVPA 4F65A 1PMVA 3AD4A 1T46A 2WB8A 4AE9A 3A4PA 3EZVA 4EQCA 1PKGA 3BE2A 1XKKA 3UYSA 5CI7A 5AP2A 3C4XA 2RSVA 4IM2A 5CS6A 4E6CA 1J1CA 1DI8A 3HV3A 2OXYA 4FKWA 2W96B 4HYHA 3UNZA 3I7BA 5IA5A 1P5EA 3V8WA 3E8EA 1J91A 3HMMA 4QP6A 4S31A 3ORNA 5C03A 3HUCA 4BCGA 1PMUA 2FO0A 3C50A 3QKLA 5JSMA 4I6HA 3EN9A 3QHRA 3KULB 3MN3A 4X2KA 3OS3A 3SD0A 2R0IA 4BCJA 2FSTX 5CI6A 3OHTA 3EIDA 2RG5A 3IGGA 4FIGA 1XH6A 4IANA 2GS2A 4KIKA 4FEWA 2WMSA 2G01A 1MRUA 1Y6AA 4IACA 3WZDA 3BL9A 4GS6A 5ANIA 4FTUA 5HGIA 4GU6A 4O1OA 3Q9ZA 3ZUVA 5E8SA 5DNRA 2WEVA 3E8DA 3PVUA 5ETCA 1XJDA 5BMMA 4S33A 4ANLA 2A1AB 3OBGA 5J8IA 3MB7A 4AN3A 1OL2A 3HKOA 3W0RA 4EOOA 1WBNA 5AMNA 5FLFA 1NA7A 3PXFA 5EW9A 3FC2A 3REPA 4ZLOA 2X6EA 5M53A 4QTDA 4JX7A 2WXVA 4CZUA 4J98A 3VBVA 3RAHA 4AN9A 4BBFA 2FSLX 5HLPA 2QOKA 2J0MB 3F5UA 5FUTA 3BELA 3SRVA 4WD5A 4PDSA 3VUHA 4O4BB 2A4LA 3QD0A 5K3YA 3FI2A 5JFWA 5JN2A 1OZ1A 5IQDA 3VF8A 4BTMA 2P2IA 4FT0A 3VBWA 3ZRLA 2AYPA 5M07A 1E1VA 3TV7A 1VLRA 1OUYA 4FNZA 3WIKA 2JIUA 3HMIA 5EI6A 1JBPE 4BDEA 1PJKA 1YXSA 4KABA 1W8CA 5EKOA 4ANSA 5EM5A 4XLIA 3VS3A 2G2IA 3OCSA 2JD5A 5AR7A 2R2PA 2V5QA 4RIYA 4Y46A 1PHKA 4ZY6A 5CASA 1OUKA 4UYNA 5J9ZA 4EUTA 2Z7LA 4L3PA 1TQIA 1XO2B 3WZKA 4FV2A 5IA0A 1H0WA 1VZOA 4Q5HA 3GCQA 1DS5A 4FV6A 1RQQA 1R39A 3MB6A 3LFBA 4FI1A 4ANOA 4U79A 2P33A 4EH5A 3TV6A 3BBTB 4E5BA 3FXXA 4ZTMA 5M09A 2XUUA 4D4RA 4FTOA 5HG9A 4L9IA 4PL5A 3JVRA 4QQJA 2YZLA 5EFQA 4RJ6A 3BE9A 3NPCA 4J95A 4UMQA 3VW8A 4JR7A 4IWPA 1KUTA 4A4XA 4F6SA 4N70A 3VQHA 3LMHA 4FZAB 5HD7A 1QMZA 3KCKA 3QTZA 3H4JA 5E4HA 2WTDA 2J0KA 4EYJA 5E9EA 2QHNA 2XP2A 2C6TA 2OU7A 2E9PA 3THBA 4JRNA 4WA9A 1YW2A 3AC5A 3W2QA 2PZ5A 4G1WA 4BYIA 1OBDA 2Y4IB 2A27A 5HTIA 2WELA 1P14A 5FP5A 2C47A 2WTIA 3GQIA 3QLGA 5K0KA 2O65A 1KV1A 4ERWA 2VTNA 5AV3A 2B9FA 4JDJA 2W1HA 3HRFA 1H07A 2BDWA 3E88A 2O64A 3I6UA 4FBXA 4QPSA 4Y83A 3VHKA 3ZBFA 1ZOHA 4KINA 2HENA 2YDKA 4YJRA 4L42A 4LRMA 3BGPA 3EWHA 2WTWA 3I0QA 3EQBA 5J1WA 4PTEA 2ITVA 4ARKA 2XVDA 4IFCA 4XG9A 4TTHB 3DV3A 4XLVA 2Y8OA 2XKEA 4OTHA 5CEIA 3HNGA 3GUBA 4GUEA 4IC8A 5EKNA 2RF9A 5CU6A 3FLWA 3ELJA 3DFCB 2GQRA 5BUEA 2IVUA 2JFLA 1WFCA 4RVKA 2E2BA 2JITA 4M7IA 4RWKA 1G8AA 4D0WA 2V62A 1WVYA 5HQ0A 4FV8A 3UIXA 4FGRA 4ZZMA 4YZCA 5DFPA 5FP6A 3S95A 1F3MC 3L9NA 4UY9A 2O2UA 3BHYA 4KIKB 4MEDA 4DHFA 5KBQA 4S32A 2J0LA 4UALA 4CCUA 5F9EA 4USEA 4BCNA 2QG5A 4F9BA 5CU2A 1RE8A 3LCOA 3F61A 1OI9A 4DFNA 4F9AA 1Z9XA 4JAJA 3MPMA 4UXQA 4FSMA 4MXAA 4EZ7A 2QKWB 4YUQA 4RSSA 1NT2A 4IVDA 4C57A 4GT4A 4PPCA 4TZRA 2JKKA 2XCHA 5ANJA 3VUDA 4JT3A 4RJ8A 2PZRA 4YLLA 2ZV2A 4BF2A 3ALOA 4PTGA 2OJ9A 5AM6A 3LLAA 3CSVA 3OCBA 4HNIA 4G3GA 2W1DA 2B54A 2XM9A 4PUZA 4R1VA 4DGGA 5EYDA 4KUJA 4G31A 2FB8A 1UKHA 4Y73A 5FDXA 4E73A 4BY9E 4XNEA 3EFJA 3H0YA 3GFWA 4FG8A 5IEVA 5EDPA 2X7GA 2F2CB 3POOA 4FKUA 4RMZA 4J97A 3G6GA 2UW5A 3Q9WA 3VS7A 5FXSA 1ZMWA 2VZ6A 4JS8A 3IW7A 3MPTA 5HICA 5BVKA 3RWQA 1B38A 3ZYAA 4YJUA 4BDHA 4EUUA 2R3LA 3NEWA 3GU6A 3UG2A 4AZSA 4IXPA 4O7VA 3MH2A 5A14A 3ORIA 2QHMA 1XWSA 3FMMA 4RVTA 4U43A 5HBHA 4AXFA 5CSVA 4FR4A 2ZFYA 2OW3A 4O4CA 3BLHA 3QQLA 2GFSA 2XA4A 2QURA 3FYJX 2JDVA 4KSQA 2BZHB 3AT2A 1KE5A 4FIJA 2C4GA 3A62A 3NCGA 5AX9A 3NYNA 5FDPA 1VYZA 2DYLA 3COIA 1W0XC 2C5NA 2WMUA 3O96A 2XIXA 3TWJA 1O6YA 3QTRA 1ND4A 1OL5A 3R7UA 4C35A 2YIXA 4DG2E 3JY0A 2FUMA 5IUIA 4FNWA 3R9OA 2BAKA 3NZ0A 5AUVA 3KN6A 3W0QA 2WEIA 5L8KA 4J8MA 4YZMA 1AGWA 4PDYA 4FTNA 4RWLA 1OM1A 2X0OA 2ZMCA 4A4LA 3GENA 4BDIA 3W0OA 4L45A 1Q8WA 3BV2A 4OW8A 3JUHA 4O84A 1PXLA 3P4KA 1MQ4A 3T9IA 1OPJA 4MXCA 1ZYCA 3B8RA 1S9IA 5LMKA 3RAWA 4CFMA 1A48A 4EC8A 1YOJA 4FKPA 1UWJA 3AOXA 3PDTA 3FUPA 5FBNC 4KBKA 2NYAA 3UQCA 2W4OA 2CGVA 3P79A 3ZBXA 2QLUA 2QOHA 2EWAA 5DR6A 5JRSA 3M2WA 4DGOA 3CJFA 4IVAA 1PW2A 2JDTA 2WMAA 5I3OA 2HK5A 3G9NA 3PJ2A 1E9HA 2PY3A 4D2SA 3VULA 5BYYA 4WG5A 5KKRC 4FZFB 2WQMA 4YJPA 3VS6A 3ZC5A 2ESMA 4AX8A 2XK9A 2EXMA 3TXOA 5CAPA 4EK3A 5HLWA 3MDYA 3A99A 2CLQA 2OI4X 3CKXA 4M3QA 5AP7A 3D7TA 5TOZA 1ZRZA 4CEGA 5I9WA 2VX1A 1GJOA 2IEWA 2W1CA 2JAVA 4BVUA 5CU0A 2ZAZA 4TNBA 1KE6A 4O7NA 1V0OA 1VJYA 4QNYA 5M4IA 3QQGA 5CQWA 4EKKA 4Y5QA 4O7RA 4FTLA 3VBXA 4QMZA 1IEPA 3D5XA 4FKSA 3F2AA 5CYIA 5JMSA 5CENA 2ZM1A 4GKHA 3MVMA 4GKIA 4EWHA 3KCFA 3BYVA 4C61A 3FZPA 3BQRA 5LVNA 3R2BA 4O6LA 2WTCA 2ZB1A 3JY9A 2XRWA 5FTOA 2DUVA 4ZK5A 3ZO2A 4CQEA 4O0WA 3DXQA 3H3CA 2DWBA 4M12A 3KXZA 4BCFA 4G5PA 5K4JA 4X3FC 4Y8DA 3RWPA 3HAVA 4RC2A 2PUUA 4I93A 2WD1A 2WU6A 4W4XA 3L8XA 4S30A 3AT4A 3D94A 3D83A 3IGOA 3MI9A 3TKUA 4ASEA 3LM0A 4O0VA 3CEKA 5JGDA 1KSWA 4MKCA 2PMNX 5IMXA 4QTBA 3QRIA 3OF0A 3QRTA 5HX6A 3QX2A 1QPEA 4IWOA 4AZEA 4DC2A 4C59A 3DKGA 3SLSA 2KTYA 3T8OA 4EH8A 3QALE 3EQRA 4AN2A 5JK3A 4C8BA 3F82A 3CJGA 4OTGA 3HV5A 2QOOA 2YIRA 3ITZA 4QTAA 4S34A 5HIBA 3AKKA 3FEGA 3DLZA 4AT3A 4BGQA 3I4BA 4FEQA 4JNWA 2X4ZA 2XM8A 3HA6A 3KRRA 5IA1A 3OWLA 2Y0AA 5DVRA 1H01A 5CEOA 4O21A 3PSDA 3C4WA 4R6VA 4ZZNA 4QRCA 2R5TA 3D5WA 3TKHA 4C4JA 5HTBA 3KA0A 4DTAA 3PYYA 4R3RA 2XEZA 5D1JA 4A07A 2XF0A 5LMKC 2W1FA 1YXTA 2PTKA 4IAYA 5I5ZA 3DBCA 4FK3A 3IG7A 4ZSJA 3VBYA 3KF4A 3FMLA 1M2RA 2HZ0A 4Y72A 4E6DA 4KB8A 4BDCA 3ZO4A 4F7LA 4G17A 4G3DA 3QCQA 4EH4A 5HNIX 2OXDA 4GYGA 4C4FA 3R8VA 3QCSA 3PVWA 4XMOA 5AM7A 4ALWA 4JDHA 1ZARA 3AD6A 3V5TA 5AR3A 5E8YA 3H0ZA 3C4EA 4AOJA 5EQPA 4HCVA 3BBWA 2X2LA 4YJNA 3VBQA 2UVZA 3CY2A 3PJCA 4LI5A 4QTCA 4ZZOA 5JKGA 4X2FA 5FGKA 3A7HA 2UW6A 4TWPA 2C6LA 3R01A 4GW8A 3FHIA 4HPTE 4ZS0A 1YHWA 4H36A 3EN6A 4P5QA 5GZ8A 4Y95A 1H4LA 1JVPP 5AR4A 4WSQA 4EEVA 3LXKA 3FYKX 5C8NA 2QU6A 2C69A 3AXWA 3DKCA 3EH9A 3V8SA 4AW5A 4LV7A 4DEIA 3NLBA 2IO6A 3NUXA 4FG9A 3FWQA 1ST0A 3K3JA 4DEBA 5KX8A 5HD4A 4AXEA 3OWPA 4K9YA 3FHRA 3L9LA 3MVJA 4EHEA 4EC9A 2JBOA 4ZTQA 4AGDA 3DFAA 4QMSA 1JOWB 3BV3A 4B4LA 3SAYA 4D4SA 4DDGA 3FLNC 3JR1A 4XG3A 3WZUA 3SVVA 4O96A 4I20A 4MXXA 5L8JA 4PPAA 4NSTA 5KMOA 1O9UA 5IPJA 3N4UA 3E8NA 4DFBA 3COMA 3WYXA 2HW7A 3FKNA 2BKKA 3RPOA 4I5HA 3PPKA 1Q5KA 4QMYA 5TF9A 3PE1A 1R0EA 4U3ZA 5E90A 5EM7A 3N4TA 3L1SA 3V04A 1YWVA 2IWIA 2PHKA 2R3HA 4QPAA 4QYHA 3U9CA 3L9PA 4E5WA 1MQBA 2Y4IC 3KB7A 5AR2A 3QFVA 4RQVA 4R7BA 2W5BA 4I6QA 5L2TA 2JKOA 1UKIA 3QTUA 4D2PA 2H34A 2HY81 4FV3A 1YDSE 4G6NA 5C26A 1REJA 1YKRA 2ZOQA 3R1NA 3GNIB 4DYMA 4EH6A 5KMIA 5C4KA 3UGCA 4DGMA 3PZHA 3QC9A 4JVGA 2W4JA 4B8LA 3AKJA 3ANRA 4WNMA 4Z9LA 5C8MA 4CV9A 3KKVA 3W0MA 2BRGA 4KA3A 3HRCA 3QZHA 4D5HA 5DH3A 4A9SA 5L6WL 3E7VA 2ITQA 3CQUA 5CVFA 3PVGA 3RALA 4PDPA 4BBEA 4YP8A 4L00A 2ZM4A 4C34A 1NVSA 3EB0A 3LCTA 3RPVA 4IJPA 3RGFA 3QYWA 2XB7A 5DE2A 1OBGA 3BHVA 1KWPA 5HG7A 4M13A 2WMTA 1ZOEA 5AUYA 2J0JA 2ZB0A 2HELA 1H0VA 5CVHA 5LMAA 5E8WA 3NNXA 4DH3A 3NYOA 4MBLA 4QYEA 3NVMB 4D2WA 4FEXA 4FT3A 3EQFA 4J99A 2Z7QA 5A6NA 5LWMA 3SW4A 2VTOA 2CGWA 3QTXA 4D4VA 3UO4A 3OEFX 2YWVA 3LIJA 4AZVA 4V04A 4FTKA 3R00A 4NJ3A 3HV4A 2XBJA 2YM3A 3NUAA 4I6FA 4K18A 3JXWA 3R83A 1LR4A 2NO3A 2UZNA 4F63A 4CRSA 3FMKA 2PVYA 2YM6A 3AMAA 3EKNA 4O27B 5KUPA 5CQUA 3I81A 3R0TA 2VWVA 4O2PA 2UW9A 3QU0A 4IX4A 3CP9A 2WQEA 1OPLA 4M97A 4C02A 1OMWA 3O7LD 3PG1A 1Q8TA 1CSNA 2VO6A 1GIHA 2YAAA 2YHVA 5IH4A 5LCJA 4QQ5A 4EOQA 2Z60A 3KN5A 3UNKA 1BKXA 4LRKA 3R8ZA 4EYMA 2XKFA 3BZ3A 3TI1A 1CTPE 4F9YA 2XRUA 3GU7A 5EK7A 3D0EA 4K1BA 4YHJA 1YRPA 4F9CA 1QPCA 4DHZA 4HGEA 5E91A 5FD2A 4OTIA 4ANNA 4GT5A 3IW5A 4NTSA 3F7ZA 3RCJA 4TRLA 2J5FA 4YZNA 4YJOA 4AT5A 3LFFA 3QXOA 2WOUA 4UV0A 3SQQA 3O51A 3QQKA 3HGKA 3R9NA 4EZ3A 3QL8A 3FI3A 1SNXA 4FOCA 4O82A 2PU8A 2C68A 2V55A 2X0GA 1OL7A 3FZRA 4RX7A 5EOLA 4EHVA 5HU3A 4YBKA 2UZLA 5JZNA 5ANGA 5LVMA 1UU3A 2B9JA 4UWYA 4FRFA 1H26A 4YZ9A 4PRJA 4C3FA 3VUTA 1JAMA 4MQ2A 5HI2A 5J9YA 4M69B 3BHTA 2BMCA 4JG6A 3LXLA 1W84A 2UZOA 2YACA 5IMEA 1JLUE 3VBTA 3ZZWA 3BHHA 1ZYSA 3KFAA 2B1PA 2IW6A 2C1BA 2YABA 3NNUA 1ZXEA 1I44A 5GZAA 3IW8A 5CX9A 3HMOA 2YDJA 4I5CA 5H8BA 4HZRA 5IQCA 3PUPA 4FTRA 3FI8A 3CR0A 3PLSA 3FI4A 4ZMEA 3QWJA 3UQGA 2OBJA 2EUFB 3NW7A 4QO9A 2QOFA 4MAOA 2XIRA 2VGOA 4WHZA 4ZJVA 2NRYA 3H30A 4NFNA 2IW9A 4FG7A 4GEOA 4A9RA 5KO1A 5EYMA 1FVVA 5JT2A 2V7AA 3GC9A 3KF7A 5CXZA 4QP4A 2YCFA 3FZSA 2WIHA 2XYUA 3C9WA 4H1JA 3TKIA 3QHWA 5FM3A 2C5YA 4H58A 4BZDA 4GRBA 3R22A 4PMTA 5E8TA 5DWRA 3V3VA 1MRVA 3CD3A 5EW3A 3R7OA 4NT4A 1Q8YA 5EM8A 3E3PA 4JG8A 2EB3A 3BI6A 4F99A 2WOTA 4RFMA 3A7IA 3NFFB 2AUHA 1U54B 3MIAA 2NP8A 1URCA 3AG9A 1H00A 1LUFA 3LMGA 4OTWA 4AW0A 4C37A 5HBJA 2AC3A 3I5NA 1NXKA 1AQ1A 2B52A 1PYXA 4FT7A 1GIJA 1XH4A 3G6HA 4KSPA 2V0DA 3PLAE 4BDAA 5HVJA 3PUFC 4V05A 4N0SA 4IB3A 3OOGA 5DEYA 5KE0A 3TUCA 4N6YA 3KQ7A 3RZBA 3DBDA 4TXCA 4CTBA 4AW1A 4DT8A 1SMHA 4TWCA 4O0YA 4BDDA 1XH5A 4FV9A 5JRQA 1WBTA 5IQIA 4YZDA 3EN4A 2RIOA 3GOPA 2RFNA 4IHPA 4NH1A 3IDPA 4MBJA 3KEXA 4FKTA 4ALUA 3S0OA 2AEGA 1GIIA 4R8QA 5E8XA 4PP9A 3CPCA 4YTIA 1WBPA 5J87A 5AJQA 3MESA 2GTNA 4RVLA 5J5SA 3EQGA 2X2KA 4O22A 3TDVA 3B2TA 1KOBA 1RW8A 4D1ZA 2GHGA 2QC6A 3TN8A 1OPKA 1UU9A 3LQ5A 4UWCA 4IB1A 2UVYA 4OTPA 5AX3A 5HE2A 1M7QA 3VRYA 1V0PA 3RAIA 4G3CA 4JMQA 1Q97A 4DLJA 4BCKA 4B9DA 3UOHA 3RNYA 1H27A 2ETRA 3G0EA 2I1MA 5FXQA 3I79A 4DHJA 2O0UA 2WMRA 2OGVA 1WVXA 3IPHA 4LGHA 3RK5A 4IJ9A 3OXTA 1B39A 3FSFA 5KZ0A 3W32A 3FV8A 1IA9A 5BYZA 5LWNA 3HX4A 1STCE 4QMQA 5LVPA 3VS5A 4XP2A 3WF7A 4BKJA 3EQCA 4BHNA 3UJGA 4O7TA 2J7TA 4L44A 4RPVA 3TZ8A 4BCPA 2F9GA 5D41A 3AKLA 4AQCA 4B8MA 4F9WA 2XKDA 3IS5A 5D7VA 3PRIA 2EXEA 2DQ7X 2QCSA 3QXPA 4X6RA 4OTFA 5HHWA 5AP6A 4FSNA 3VUIA 1U46A 1PXIA 2JIVA 5L2SA 3BU6A 4BKZA 4E26A 3IKAA 5J1VA 3F3WA 4QP2A 2C6OA 4GK2A 5CEMA 3PFQA 3G2FA 4MNEB 4R78A 3UDZA 4YNOA 2GSFA 5CNNA 2E9NA 4FL3A 4FZDB 5DRDA 5HVKA 1YXVA 3KY2A 5IA4A 1UWHA 3HRBA 3QTQA 4XUFA 4ITJA 4PQNA 1R3CA 4FYNA 5M56A 3OWJA 2XCKA 2VTRA 3BU3A 3PFYA 2X39A 3D9VA 2QOCA 4DBNA 3E64A 2UZVA 4N6ZA 4EOJA 3NYXA 5H9BA 4IAFA 4YLKA 2WQOA 4X3JA 3HMNA 4FSWA 4IZ7A 1LEZA 4PPBA 3KREA 4K8AA 3C51A 4ZOGA 2CHLA 3PY1A 4IVCA 4H3BA 4R3PA 4YPSA 2R64A 2UUEA 3F9NA 5ACKA 4DTBA 4FEVA 2XNMA 4OR5A 1PXOA 5CNOA 2G2FA 2GQGA 1Y91A 4LMUA 3BYMA 4U42A 3U4WA 3ZFMA 3BEAA 3PSBA 4FKOA 4FOBA 4X3FA 4H3QA 4CMOA 2FVDA 3EL7A 1GZOA 4XEYA 4HW7A 3F2RA 3OY1A 2VTSA 5L4QA 3GXLA 4FVPA 3T9TA 3Q2MA 4RX9A 3PRFA 2G1TA 1JKKA 3IDBA 4IQ6A 4LQMA 3VQUA 3HLLA 2JEDA 3PP0A 3UYTA 2J90A 4FIEA 4M14A 5T3QA 4Q9ZA 2CLXA 3MGYA 4BWKA 2YA9A 4CG8A 3AT3A 3COKA 1OGUA 4BDJA 1XBBA 1ZWSA 3LJ1A 1WCCA 3Q6UA 4EK6A 3C4CA 2B55A 3UVRA 3VUMA 4C4IA 3EQPA 2VTHA 2XK8A 3BX5A 4YZBA 1PYEA 2QNJA 3HV7A 1VR2A 4CXAA 2R7BA 5BPYA 4AAAA 3ETAA 3QTWA 3QZGA 5C9CA 3V6RA 3HAMA 5I9UA 2VUWA 1UV5A 2G2HA 2ZV8A 5ANEA 5FEDA 4YBJA 1IAHA 4O0XA 3N4VA 4O81A 5EQYA 4YC8A 2VTPA 3C5UA 3CS9A 4CVAA 2YISA 5EHLA 4WBBB 3ZSGA 3IW6A 4C3RA 2I6LA 4RWIA 3D2IA 4RLKA 2IZTA 5L6PA 3FC1X 1E1XA 3JYAA 4H39A 2LGCA 2XNPA 1UNLA 4GSBA 4QDVA 5I9VA 4IVBA 5CF4A 1FGKA 4B7TA 2UZWE 3AD5A 3PIXA 5CT7A 4CFFA 4FNYA 4IAKA 3EOCA 4JXFA 4AU8A 3KXHA 3HA8A 4GCJA 5CAOA 1CM8A 4AFJA 3QLFA 2C6IA 3SXRA 5C1QB 3KGAA 4DEAA 3DQWA 3LLTA 4FKGA 4NIFB 3LCKA 3VONA 2B9IA 1H1SA 4KRCA 5BVOA 1J3HA 4GIIA 3CBLA 5HO7A 4EJNA 5EHOA 4KKHA 3ORXA 4YO4A 1S9JA 3MY5A 4I5MA 3RPYA 3AGMA 4BDGA 5FTQA 5DLSA 2C5VA 5IQEA 3E3BX 3UTOA 2PMLX 3QQJA 4RZVA 3KIOC 2JKMA 3ULZA 1YI4A 3RPSA 2OJIA 3S4QA 5A3XA 3OP5A 4M84A 5KNJA 3W0NA 1R78A 1TZDA 5JQ8A 4L46A 4PX6A 4A4OA 4D2RA 2BALA 4XCUA 4XYFA 3FMDA 4FX3A 3ZCLA 1H1PA 4XP3A 5I4NA 3FKOA 5KKRB 3N51A 3V6SA 1ZY4A 1SNUA 3CQWA 5HU9A 4R7HA 3NAYA 3ZRKA 2VGPA 5AUTA 3AMYA 2X7OA 4QMVA 3TEIA 3TTIA 4GH2A 1PMEA 1OL6A 4BBMA 3CGOA 3IOKA 3OTUA 4XG7A 3SX9A 4EL9A 5F4NA 3NVKI 2HZIA 2PE2A 4E4MA 5L2QA 3U6IA 5DT3A 5M44A 3V5PA 4E93A 5DR2A 4BB4A 5FXRA 5HCZA 4PMPA 1H28A 3KULA 5E1SA 2HYYA 4OT5A 4RT7A 3DJ7A 5H8EA 3RHXA 4X0MA 2XAOA 3IW4A 4O7YA 5IQFA 5FEQA 4CV8A 5EDRA 5AV0A 4QP7A 3NIZA 5AUZA 5IU2A 4OGRA 3OG7A 4U40A 3TL8A 2IZUA 5GJGA 4W9WA 3VHEA 2Z7RA 4EORA 1XMLA 4U3YA 5DMZA 1KE7A 2OZAB 2WO6A 4LOPA 2EU9A 3V8TA 4C3PA 4F0GA 4YHTA 3C7QA 3OFMA 4R5YA 3W10A 1YHVA 2QOIA 4NKSA 4IFGA 2OZAA 1Z5MA 1UVRA 4MH7A 4G5JA 3QZIA 2C0TA 3W33A 3Q6WA 4PY1A 5IEXA 3ZXZA 3GC8A 4EH9A 3DB8A 2GQSA 4PF4A 5HOAA 1XR1A 2VTTA 2GS7A 2J4ZA 4FTCA 2ZV7A 4