5EM8A

Egfr kinase domain with pyridone compound 13: 4-[(2-methoxyphenyl)amino]-~{n}-[4-(4-methylpiperazin-1-yl)phenyl]-2-oxidanylidene-1~{h}-pyridine-3-carboxamide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
323
structure length
303
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Pyridones as Highly Selective, Noncovalent Inhibitors of T790M Double Mutants of EGFR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 303
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5em8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5em8A01
4F7SA 2WMAA 2LAVA 4EORA 3NUYA 4CLJA 3FKOA 2F2CB 4IB5A 4JOAA 5DRBA 3OW3A 3CQWA 4GYIA 3JXWA 2PU8A 4U6RA 3QX4A 2OBJA 3U6HA 4BFMA 4XHKB 2XK9A 3QRIA 2PUIA 3II5A 4GK3A 4CKJA 2OJFE 1J7LA 4FNWA 2Z7LA 5CI7A 3TZ9A 5HI2A 1G8SA 1JKKA 2H9VA 3HVCA 5LVNA 4GT5A 4Y72A 1YWRA 1XJDA 2WTDA 4BI2A 3Q9YA 3V5QA 4FV9A 4U40A 2HCKA 1KE7A 3F5UA 3QRTA 3PJCA 4YNOA 5EHLA 5CF4A 3W2SA 3MVMA 4DFYA 3C51A 2GCDA 3QTWA 4JG6A 1QMZA 4K6ZA 4XH6A 4FSUA 4DGLC 2EXCX 3FKNA 4FSMA 5DPVA 4ALWA 2R0UA 3QBNA 4C37A 4IC7A 3SW7A 5AIKA 3QA8A 2QOQA 4OT5A 3RHXA 4BZOA 1BL6A 3PP0A 4E20A 4UX9A 4KBKA 4RJ7A 4A9TA 1H00A 4UBAA 4ACGA 5M51A 4NM0A 2HYYA 3FE3A 5EW8A 1KOBA 2RFNA 3B8RA 3COHA 3TKUA 2JDRA 4QNAA 1Q99A 4UMTA 3Q4TA 4KIOA 5CALA 3RM6A 4UWYA 5AMNA 3F2AA 3MESA 3HMNA 3FYJX 3GC8A 4IX4A 3HP2A 1O9UA 2C0TA 4FT5A 4FYOA 5EM8A 2RFEA 2PZPA 4IB3A 5D1JA 4RWJA 3UYTA 5FXQA 3ZONA 4EOQA 4R3RA 1QPCA 2OKRA 5M4UA 3PFQA 1VYZA 4X0MA 5KMLA 1XH4A 3KK8A 3CJGA 4IIRA 1GIIA 5TR6A 4O0WA 3LKMA 4PP7A 3QLFA 5DYJA 1H8FA 2PMOX 4F0GA 1B38A 1T45A 2ZMDA 3R7GA 3C13A 4FL1A 4QQJA 4EEVA 4M14A 3HA8A 2R7IA 2VTPA 3VS7A 2PUUA 3RPVA 5I9ZA 5J9YA 5BVEA 3UQGA 4ZTSA 2BFXA 2R0IA 4EHEA 1OPJA 1SMHA 2GNGA 4I92A 2Y4IC 3GEQA 3EYGA 2JFMA 5DVRA 3NYOA 2ZAZA 4FF8A 4FG7A 4C2VA 4EOSA 2J5FA 3NNWA 2ITQA 3LMGA 4RJ3A 2Y8OA 2PVFA 2HXLA 2WU7A 3FMEA 4O0VA 4A4XA 4F70A 4CZYB 3COKA 3PE1A 4M13A 4WG4A 2XS0A 1W8CA 5BQ0A 5DEYA 3BCEA 4BYJA 3O23A 5AADA 5K5NA 4IBMA 3OT3A 4WHZA 1HCLA 4G5PA 2O63A 4LGDA 4R3PA 2FVDA 4RC2A 4YBKA 5H2UA 1LPUA 3R83A 1B6CB 4CFNA 3R8LA 1OECA 4DFXE 4F08A 5LMKA 3Q52A 2BZHB 3BI6A 5T68A 4O1PA 3GNIB 5CLPA 3VS1A 2W1HA 3FQSA 4LUDA 4QTAA 1OM1A 1Q62A 1VJYA 4KSPA 1OL7A 4YZMA 5TO8A 3GI3A 4FGRA 4JRNA 3EQHA 4ZSJA 4BF2A 3RAKA 4MD7E 4A4OA 3D2IA 4DCAA 5HNBA 4DLIA 4YTCA 1R3CA 3QD0A 2BAQA 4K18A 4YZ9A 3SVVA 1BL7A 3QTZA 4N6ZA 4IB0A 2IW8A 4DYMA 2Z2WA 4PWNA 3PIZA 3RBWA 4FSRA 3AC2A 3W16A 4L44A 3LLTA 4XG9A 5FLFA 4BTKA 4A9SA 3MPAA 3MJ1A 4CT1A 2ACXA 4D9TA 3R8UA 3RWPA 3NCZA 2ONLA 4M66A 5LMAA 1O6LA 5J9LA 4FKLA 1VYWA 4YZDA 4YC8A 5DBXA 2WMBA 4HPUE 2BKKA 3OVVA 5J8IA 4QMXA 4NJDA 5BUEA 1PXJA 3O8PA 4KRCA 2P0CA 2ITTA 4GU6A 3L8XA 3G2FA 4S31A 3RNYA 2JD5A 3ZZWA 4FBXA 5DT4A 1IA9A 3ZCLA 3BHTA 4GIHA 1V1KA 1YWVA 3A4PA 4ITHA 3ANRA 3FMMA 1CKJA 3R9DA 4MNEA 3EN4A 1GIHA 4QO9A 2C47A 3WI6A 2ZYBA 3OD6X 3E7OA 3H0ZA 4JDHA 4L67A 4GSBA 4P90A 2C1AA 2CN8A 2O2UA 4FTLA 3CXWA 2HK5A 5K0KA 2OJ9A 5JFXA 4LI5A 2EB2A 5AFVA 2AC3A 2HELA 4ANBA 4PDOA 4Z9LA 1OKYA 4M7IA 5IEXA 4BBFA 2WQMA 3UZPA 3I0OA 3OFMA 4FVRA 4BCNA 4I21A 3TIYA 2PSQA 5CSPA 4H36A 4DEIA 1H1SA 4FKIA 5EH0A 5JH6A 1SNUA 2RG5A 5FGKA 5CAVA 3P86A 3BWJA 3KMUA 4ZSLA 3FHRA 2WMTA 2PVYA 3GENA 4O0XA 5ANGA 4RVLA 1Y8YA 4LGHA 4HVHA 3BE2A 3F7WA 2OIBA 3BIZA 2QU5A 3TUCA 5L8JA 1YI4A 2C3LA 4ZY4A 3FLNC 4O22A 5LVOA 4CGAA 3NMUF 3NWWA 1U5QA 3EHAA 2H96A 3ZBFA 4E5AX 3D0EA 4H3BA 4FEVA 2NO3A 2REIA 1F5QA 2PE2A 4D9UA 2PVLA 4D1ZA 4RWKA 4W9WA 2GTMA 2PVNA 3C4ZA 3CY2A 5HU3A 3I7BA 4QP9A 3SW4A 5BMSA 4H3QA 4A9RA 4X2JA 3UPXA 4EOPA 3H9OA 3LJ0A 3PXKA 3E87A 3IDCA 3DKFA 1PYEA 1W83A 4EH8A 2H8HA 4TYHB 4NCTA 4PDYA 5I9YA 4U3YA 3PZHA 4AN9A 4DEDA 3QCSA 2VD5A 4QPAA 5CS6A 2UUEA 2V7AA 4HVDA 4APPA 3FMDA 2QC6A 4NTSA 2PMNX 2CSNA 3OBGA 4L43A 4FTUA 2CMWA 3TTIA 5KHXA 1H1RA 3DU8A 4FEWA 4FV5A 2E9NA 4R8QA 4CMUA 3MY0A 4KSQA 4I4FA 5AV1A 4CMOA 4PDPA 4OTPA 4CFVA 5CI6A 5IU2A 1E1XA 3NW6A 3EOCA 4AWIA 5BVDA 4CKIA 3ORMA 5KKRC 1YOJA 3EFWA 4J1RA 4N0SA 4EHZA 2QQ7A 3QD4A 5E8WA 5FEEA 5JKGA 1ZOGA 4G3DA 5M57A 4AF3A 4XV3A 3VUIA 2J6MA 3M42A 5ACBC 4QYFA 5M44A 4EOJA 2YIRA 1ZOEA 2ZJWA 3HAVA 4FUXA 1GY3A 3QTRA 4A06A 2C6MA 4GCJA 5HE2A 2OLCA 2X4FA 4MQ1A 4O6LA 1IAJA 3E88A 4EH3A 4ASXA 3CQEA 2G01A 3C1XA 3E63A 1QCFA 1KSWA 4FC0A 5A9UA 3LLAA 3GGFA 3FKLA 1M2PA 1LR4A 1OIYA 4FIFA 2BTRA 2B53A 4WG3A 5CU2A 1JSVA 3G9NA 3ZUTA 3UZTA 3FSFA 2ITOA 1J1CA 2A19B 4IAZA 4U9AA 4C57A 1OB3A 4OAUC 2WMSA 1RQQA 3Q9XA 4EHVA 3FV8A 4BB4A 4UY9A 4YJVA 4YP8A 4YO6A 3S95A 3IW8A 4MX9A 3U6JA 4XYFA 2Y7JA 4BWKA 3POOA 2W1EA 3IQ7A 3Q6WA 4ZJIA 1WFCA 2QHNA 3MY5A 4F7LA 1H07A 3AT3A 3VNTA 2AC5A 4BCOA 5B2KA 2UW8A 1OL1A 5DWRA 3RZBA 3JY9A 3OWKA 4DLJA 4MQ2A 2J0KA 4J8NA 3W10A 4TW9A 3CY3A 3FLWA 4V0GB 5DIAA 5A54A 3FC2A 3VRZA 3P7BA 3NGAA 4HVGA 4LOQA 5FEQA 1OUKA 5CU6A 1J91A 3PIXA 5L6WL 4C3PA 4C4EA 4EZ5A 2FA2A 5AP3A 4PMSA 2GNFA 4RIWA 4FKWA 4DGNA 5KMKA 4ACMA 5HD7A 1KE6A 1Z5MA 3LFCA 5CU3A 1UU3A 4NTTA 3VN9A 4ZSEA 4FTOA 3FWQA 4XRLA 3DV3A 1PMEA 3RWQA 5IQDA 5E7RA 3SKCA 3G5DA 3L8PA 4QP6A 3D4QA 4QPMA 4A7CA 3NAYA 2XCHA 4ZZNA 4HGTA 5DI1A 2CCIA 3BHHA 4JJRA 3WBLA 4FKTA 5I5ZA 4ORKA 3E64A 2Z60A 2F49A 1Q41A 3V8TA 5F9EA 5AV0A 4HZRA 3R71A 2NPQA 4DCEA 3MA6A 3RTPA 4EOIA 3H30A 3IKAA 5AX3A 4CMTA 4X21A 5IQCA 4MHAA 4EK5A 4AZSA 3QCYA 4MBLA 4G1WA 4FKVA 3OTVA 5BX0A 2WTKB 4O6EA 2QOHA 1NT2A 4HVSA 1P4FA 4MVFA 4OW8A 2YZLA 4YLJA 4FZAB 3DQXA 4RSSA 3TZ8A 2VWBA 3VBYA 2OG8A 1Y6AA 4FV3A 5DT0A 4KS8A 1UKIA 2BCJA 2VWVA 5CEIA 1WVXA 4RIYB 4IWOA 1FPUA 4YSMA 4BDKA 3FI3A 4XV9A 2HW7A 2BROA 4I5CA 1DI8A 3BX5A 3HEGA 5AUYA 3G9LX 4WG5A 3QZGA 3DBEA 3EFLA 3ZS5A 4TNBA 4O0UA 2FB8A 2X7GA 4S34A 5D7AA 3TNHA 3KA0A 4KRDA 5L2TA 5A4TA 2YM4A 4FEXA 4GS6A 4WRGA 3SOCA 3V5LA 3PY0A 4B0GA 3BU3A 3V6RA 4MYGA 3C5IA 5A4EA 2C5XA 2VTRA 4H3PA 3I6WA 1OL5A 3HMOA 4D5KA 3H3CA 1WBTA 2IVSA 3MH3A 2WMRA 1BI8A 2FO0A 4AZFA 2XNEA 4WIHA 5AA9A 4ZTMA 4U42A 3PZEA 1L8TA 4IXPA 4Y95A 4I24A 3F3TA 4XBRA 4IZYA 5IF1A 2W5AA 4JT3A 3ATTA 3GT8A 3NCGA 1CKIA 3QQJA 2VTMA 3R0TA 3PRFA 4QMSA 3UG2A 1NVQA 4ZMFA 2W1DA 5BPYA 3BBTB 3OOMA 2BZKB 2WU6A 5AUXA 1Q4LA 4RQVA 5HLNA 4XG6A 3ZM9A 5DR2A 4A4LA 1OPKA 3RAWA 1PMVA 2VGOA 3DS6A 3G6HA 3W55A 1WZYA 3DDPA 4O7RA 2J5EA 4DITA 3RCJA 5HLPA 2VO7A 3CPBA 4QQTA 2WOUA 1M7NA 2OXDA 4J99A 1K9AA 4BVUA 4AX8A 3NLBA 5FG8A 3V5JA 3VUGA 5HZNA 3DKGA 4DTAA 3PVWA 3SG8A 4GU9A 4PPCA 3KULB 3V5WA 4BBMA 1ZYLA 3G90X 1ZMVA 2YCQA 2Y4IB 3EQDA 3DZQA 4NFNA 4FV7A 1SM2A 2VV9A 5CENA 4I94A 4C0TA 2ITWA 4L01A 3E8EA 4RVKA 5ETAA 5GZ9A 4X3FC 4XLVA 2QOKA 5LVLA 4FNYA 3AC5A 3R9RA 3DXNA 2EXMA 5I3OA 1PXOA 3D7TA 1R39A 2VN9A 4WRSA 3SLSA 3VJOA 4FA2A 4QP3A 2W99B 4FNZA 5HBHA 3NX8A 4YBJA 2DWBA 5F1ZA 3RKBA 2QOLA 4V05A 4QTDA 2BRNA 2QONA 3FMLA 4X2KA 4ANOA 4CD0A 1FVVA 1Q3WA 2WGJA 3FDNA 3D94A 3HRFA 4HYSA 4EBVA 3D7ZA 2IN6A 3IW7A 3A8XA 2OI4X 5KUPA 4WT6A 3QA0A 2J50A 4HGEA 4LV5A 4AA5A 5CEPA 2B54A 3RAHA 1WVWA 2BILB 4D0XA 4GKIA 4XG7A 3A61A 2W96B 3Q04A 1YHSA 4CQEA 4CZTA 4L3PA 5I9XA 4DTBA 2QKRA 5C4KA 3LFAA 1H24A 4LYNA 3RZFA 3NIZA 3DPKA 5FTQA 1ND4A 3GU8A 2B0QA 5AP0A 5HGIA 5L8KA 3E3BX 2XJ1A 4BDGA 1H26A 2XK3A 2X8EA 2CPKE 5L8LA 2F2UA 2PK9A 4YNEA 3AC1A 1GIJA 4QYYA 1WCCA 4FSYA 2E9PA 5JMSA 4AGUA 3U4UA 3PA3A 3EQBA 2QOFA 3KC3A 2BDJA 3C9WA 4JBPA 2WB8A 4M15A 1PY5A 3AMAA 4Y8DA 4AN3A 2BHEA 2WEIA 5CEOA 3PA5A 4KIPA 3BLHA 4P5ZA 3NYXA 3DZOA 5GZAA 2W1FA 5FP6A 3AMYA 2OJJA 4PV0A 4I3ZA 4DG2E 5DR6A 3SOAA 2BKZA 4AT5A 4R6VA 2PE0A 4BZNA 4YC3A 2KTYA 2BALA 3BV3A 4OTQA 5CXHA 2VWIA 4O7LA 3KULA 4DGGA 2HIWA 4FG9A 3HDMA 4O0SA 3DJ5A 1OL2A 1H1WA 4FTAA 1I09A 2X1NA 4MCVA 3K3JA 2J0MB 2IG7A 1W0XC 2QLQA 1WBPA 4YSJA 3MTFA 4ZSGA 3RNIA 5CTPA 5HTCA 2HZ4A 4IFGA 1P2AA 3U51A 2C0IA 2G2FA 3PY3A 4TKSA 4QP8A 3VW8A 3WZEA 4BL1A 4HCVA 5E8VA 5CSXA 3RALA 3B2TA 4Y46A 4Z7GA 2WHBA 4OT6A 5EYKA 4GMYA 3UBDA 3G6GA 4OBQA 1G8AA 2XNGA 4KKGA 3R8ZA 4F6SA 3PXYA 3QYWA 4B6LA 1UU8A 3OOGA 4KIKB 2HZNA 1W98A 5IMXA 2VGPA 3EFKA 3PPKA 3OCGA 4L42A 1YDRE 3EQCA 4R3CA 2BRGA 4ASDA 4EH5A 4QMUA 1YW2A 2BFYA 4EK3A 1YKRA 4NK9A 3D5UA 4C2WA 4OTHA 2VTIA 4BGHA 4MXOA 3CQUA 5L4QA 4NH1A 4LV8A 4EC9A 3MPMA 4PF4A 4EH7A 4QP4A 1KE9A 1CSNA 2C4GA 2OICA 3CR0A 3F3VA 3QGYA 3RI1A 3DXPA 3O96A 5BUIA 3QC4A 1XHAA 3QQUA 4C4FA 2WQNA 4D2PA 4LL5A 5E8UA 4DEAA 4EH6A 1V0OA 4KNBA 3PRIA 3GCVA 2HZIA 4I93A 3TL8A 2XBAA 4FGBA 4DE4A 4CEGA 3VVHA 3ZO2A 2O65A 2ZV7A 5H8GA 3DAEA 4ZOGA 3M11A 1OITA 3MY1A 4C3RA 5L2SA 4YUQA 2WO6A 2WTWA 3PSBA 3ZLWA 3LCTA 3FZTA 3ZZEA 2BR1A 4PRJA 4MD9E 4EWQA 5KKRB 2JIVA 4B8MA 2G9XA 3QRKA 5EQEA 3O8TA 5F4NA 4CV9A 4I5PA 2F7EE 2YIYA 5CZIA 2CKEA 4MXXA 1YI3A 2YA9A 2BZJA 3AOXA 3VRYA 5AUTA 3P7CA 1ZWSA 2OJGA 3COIA 1WMKA 5T3QA 2W1ZA 2WNTA 1ZY5A 3R73A 4I1ZA 4NZWB 2X2LA 4FKRA 4Y73A 5DT3A 4PL5A 5BYZA 4NEUA 3CTJA 5KZIA 1AQ1A 4R1VA 3DK6A 3RPRA 3V51A 4RFYA 5HE0A 2X7FA 5EFQA 3QUDA 4UWCA 1XH9A 1NVRA 2ZOQA 3CPCA 3QTUA 4KB8A 4RGJA 4E7WA 5CEMA 5J5SA 4XOZA 5EQYA 4EH2A 2XEYA 3TEIA 4GRBA 5CU4A 2QVSE 3HLLA 3MDYA 3V3VA 3UOHA 4TYJA 3ZO4A 3FHIA 4I0RA 4RZWA 2YAKA 5CF5A 4U80A 2UW3A 4RX5A 3E3PA 2V22A 5HCZA 3KCFA 5FBNC 5IUIA 3FZ1A 4JG7A 4M3QA 3ZTXA 3KEXA 4ITIA 5F20A 3VS6A 4HYIA 1Y6BA 3D83A 3ZH8A 5IA3A 1XH6A 2BRMA 4O7SA 2R3FA 3O7LB 3LFQA 3DXQA 3R04A 4CRLA 4L7FA 5J1WA 4AW0A 4N57A 4NM7A 2UZEA 5LWMA 5IPJA 1MP8A 3TZ7A 1LP4A 2W1IA 4Z7HA 1E9HA 3R30A 1PKGA 1Q8WA 2VNYA 3R63A 4LRKA 2XIKA 3TXOA 2OZAB 5F94A 4O38A 4D2VA 5HTBA 5L6PA 5M08A 3ZO1A 3R00A 2E9VA 3Q2MA 3OXTA 3A8WA 3NVKI 2YHVA 3PJ3A 4TWCA 5C8MA 2X9EA 3R9NA 3N4TA 4YO4A 2IWIA 2VTAA 4AS0A 4EC8A 1YQJA 3MBLA 2X6DA 3F7ZA 4JIAA 4NKAA 5HESA 1XQZA 3BYMA 1BUHA 3RPSA 3KGAA 4Z16A 4CSVA 4YURA 2RFSA 3BWFA 3NUAA 2G2IA 4CVAA 4J8MA 3LQ8A 4TZRA 5DGZA 5M09A 3ORTA 3UZRA 2X2MA 5KMOA 4JNWA 3OXZA 3RCDA 1OBDA 5DHJA 1JSTA 2R2PA 2BRBA 4G6NA 1MRUA 2R7BA 5HKMA 2OXYA 4ARKA 4IX5A 3A4OX 1FQ1B 4I23A 2W4JA 4ZS4A 3ET7A 3I0QA 4FTMA 3WF5A 5EM6A 3EJ1A 3TV4A 4AFJA 1MRYA 2JIIA 3HRBA 3QHRA 2PUNA 4FKUA 2YIQA 3K5VA 3Q5ZA 4FTJA 3LVPA 1U4DA 2XRUA 3K3IA 3AC3A 2R3IA 4ASZA 5HIBA 2ETMA 2UZDA 4P4CA 3MWUA 4JX7A 2YDKA 4UN0C 1STCE 3ERKA 2VO6A 3UQFA 1H1QA 4ENXA 3P7AA 4J7BA 4FKOA 2J2IB 2Z7QA 2OZOA 2ZM1A 1ZXEA 2VTHA 4UMUA 4C58A 3FI4A 2LGCA 2O5KA 4IVDA 3BZ3A 3DFAA 2WIPA 2VTNA 5JZJA 4RPVA 2XUUA 5BVWA 2PYWA 2PZIA 2R64A 4YZCA 4QMLA 4F1MA 4IHPA 4J98A 2B9JA 3UO5A 3L1SA 3LHJA 3OY1A 3U9CA 3IK3A 3O51A 3P5KA 4LL0A 3F5XA 2BHHA 1APME 3HZTA 4N6YA 4WNPA 2ESMA 2ITPA 4C36A 3OCBA 4ERKA 3RP9A 4DH8A 5K5XA 2OU7A 3QTXA 5JQ8A 1PMUA 4O83A 2A0CX 2C5OA 2JKKA 2WPAA 3LM0A 4FG8A 4J53A 1PXKA 3TACA 4EQUA 4E4XA 2XVDA 3DBDA 2GQRA 5EI6A 4E5WA 5IEYA 3SXRA 4DFNA 4O7VA 1FINA 2O64A 2BRHA 3Q9WA 4CKRA 2YJSA 2YM6A 3ORNA 3PVUA 2H6DA 3IONA 3F3ZA 2OFUA 1CTPE 4PX6A 3VUDA 4EOKA 4DG0E 2XK4A 4TYGA 5BVNA 2XKCA 3BEAA 4GJ3A 3PWYA 1FVTA 4QQ5A 3W32A 4AU8A 3OUKA 2YACA 4WA9A 3DTWA 1VEBA 5CWZA 3GCUA 3EQGA 1U5RA 2QU6A 4G6OA 3ZHPC 3V8WA 4BIEA 5LXMA 2SRCA 2NRUA 2Y9QA 2B4SB 5KZ0A 3S2PA 2R5TA 1YOMA 5IH6A 2PZYA 4FV2A 5AR3A 1PKDA 2JBPA 5GZ8A 5M55A 1RDQE 4YJRA 3W8QA 2DUVA 2UW4A 3HNGA 5EDPA 5IUHA 4PPAA 3NR9A 4Q5HA 2GS2A 1YDTE 3AD4A 1CKPA 1SNXA 4QQCA 4R5YA 3R7EA 3TJDA 4DAWA 3FMJA 1XH7A 3HYHA 4ID7A 4AOIA 4XCUA 3NRMA 4XG2A 4EZ3A 2WTJA 4DH3A 2UVYA 4CNHA 3BYSA 3C4EA 1YOLA 3F3UA 5EW9A 1M7QA 2Y0AA 4PL4A 1PXIA 3UDBA 2PULA 2XNOA 2W17A 3N4UA 2YLEA 1NW1A 4QD6A 3QKKA 3PXZA 4QTCA 4AZWA 3VS5A 4I41A 2ZB0A 3GUBA 3R1SA 5LCJA 3A7FA 4EK4A 3GB2A 4CCBA 2WMUA 5E92A 4H05A 3SC1A 4KAOA 2W4KA 3TUDA 3RHKA 3TDVA 3ZO3A 5T6KA 4ZXTA 3NDMA 1XH8A 5A46A 3O2MA 4UB7A 1B39A 2ZM4A 3O7LD 3VS3A 4BIDA 2QO7A 1GOLA 3K2LA 3GBZA 5HBEA 2XMYA 3TNIA 2W9FB 2JDTA 3WYYA 2BMCA 3PXQA 4HCTA 1ZRZA 5AP5A 5EYMA 2QKWB 5IDPA 4BZDA 1ZZLA 4H39A 4RJ8A 2Z02A 2QR8A 5K9IA 4FL2A 4LGGA 4Q9SA 3KU2A 4EH4A 4OTRA 3CKWA 2ITYA 1U59A 4WNMA 3ZC5A 3UVPA 4QMMA 3OEZA 3IO7A 2GTNA 2F57A 3G0FA 2UZOA 2UZNA 3VS4A 3PJ2A 1YXSA 3MTLA 2WTVA 4C02A 1SVHA 3QLGA 3DAKA 2Y4PA 3QTSA 4AXAA 5TKDA 4DFBA 3FSKA 4RQKA 4X6RA 4WBBB 3FPQA 3H0YA 2W5HA 2JKQA 4KS7A 3UNKA 4KUJA 3OEFX 4PTGA 3ORKA 4ALUA 4L6QA 3TM0A 3E92A 3KMMA 3LQ3A 5D41A 1XWSA 3WILA 5IA1A 3CTHA 3M1SA 2ITXA 2GU8A 3AG9A 3QUEA 4XNEA 2GFCA 1O6KA 4K8AA 5CYIA 3IS5A 5H3QA 3QZHA 5D11A 4O7ZA 2B9HA 2PL0A 2J51A 2JKMA 2WOTA 3FBVA 4LUEA 3ENHA 1PXLA 1UNGA 2PTKA 3BKBA 3UG1A 4WSYA 1KV1A 1CDKA 1K2PA 3VHKA 3VBTA 3P0MA 3QYZA 5A6NA 2C1BA 3N51A 1H0VA 4C35A 4QYHA 4AZTA 3UC3A 3I1AA 1ZYDA 3H9FA 4YJSA 2VO3A 5M4FA 4JR7A 2XIXA 3PJ1A 5CANA 2VWUA 4FTNA 4OBOA 4E6DA 4DG3E 3WF9A 3OCTA 5CF6A 1FVRA 5C9CA 2ZVAA 5LOHA 4IW0A 5BVFA 3PA4A 5JT2A 4KBCA 4NYEA 4CG9A 4WNOA 2BZIB 3DLSA 4APCA 3C4WA 3KF7A 3Q32A 4HNIA 4U3ZA 1XO2B 3GXLA 3M2WA 3MFTA 4JBVA 3GU5A 4JLCA 4RX7A 4RWLA 2XIYA 4KKHA 4YZNA 3RVGA 3PLSA 5E1EA 4UYNA 3DTCA 5DOSA 5AA8A 1FMKA 1FBNA 4TTHB 2QG5A 5AV3A 2CGUA 4EJ7A 5DRDA 3ZLYA 3REPA 5JK3A 3UPZA 5HEZA 4AOTA 3JUHA 1IAHA 1BX6A 4MWIA 5IA4A 3Q5IA 3LM5A 5IDNA 4UYAA 3R1QA 2GSFA 2I0VA 1ZZ2A 2CGVA 3Q3BA 2RSVA 4BHNA 2QO2A 4KBAA 2UW6A 4FKQA 2PZRA 3DBQA 5DH3A 4YZBA 4USFA 2CJMA 2FUMA 2C69A 3VF8A 3F2NA 3ORIA 3WZJA 1Q3DA 4F9YA 3Q6UA 1Q97A 2XNBA 3P78A 1MQBA 4AACA 4QMVA 2J7TA 2V7OA 4RC4A 3CCNA 3LCKA 2VUWA 2VX1A 3FMHA 4GJ2A 1OMWA 3TV6A 4PY1A 3QFVA 5CEQA 2OJIA 1HCKA 1P4OA 2UVXA 1T46A 4I4EA 5K4IA 2OIQA 2XIRA 3D14A 1NXKA 3FZOA 4HW7A 2ITNA 1W84A 4EWHA 5JRQA 4L9IA 4ACDA 5FM2A 1PHKA 3L8VA 3DKCA 3DK7A 4UWBA 4O7TA 3F6XA 4IAAA 3B8QA 4O0RA 4RJ5A 4CFXA 3ZSGA 4QTEA 2G15A 3LMHA 3LE6A 1YHWA 5CNOA 5D12A 3UODA 1E1VA 2GHLA 4OTIA 1VR2A 1UVRA 3O50A 3TV7A 3A99A 5HX6A 1X8BA 2QI8A 4FICA 4MD8E 3FMNA 4HZSA 4RLKA 4G3EA 1NY3A 1ZLTA 3R2YA 4QMZA 4TYEA 3BLRA 2EVAA 4AFEA 3IOKA 4C34A 5CASA 5HNGA 5KX8A 4FMQA 5IH4A 2OF4A 1WBVA 4TYHA 2YCFA 3Q9ZA 4BCQA 4U97A 3OF0A 2CNUA 5L3AA 4X2NA 3RJCA 4WBOA 2WTIA 5BUJA 1G3NA 5CVHA 4XG4A 3CSVA 3IECA 1BMKA 3TIZA 2EU9A 3KRRA 4CFUA 4G3GA 2YWPA 4F0IA 5JN2A 3D5VA 4DH1A 1XBAA 3HRCA 3MFRA 4G6LA 5IG1A 2C5NA 2XNPA 2O3PA 4GH2A 2W06A 5ANIA 3DFCB 3W2PA 3PPJA 4RWIA 1YWNA 5A4CA 4ZZOA 4TNDA 5K0XA 4G34A 3KRLA 3HMPA 3O71A 2GDOA 1DAYA 2OF2A 4M12A 4ENYA 5JRSA 3T8OA 2PVHA 3ROCA 3UO6A 2BDFA 2ZB1A 4K77A 3UIUA 2Q0NA 1PYXA 3PWDA 4EQMA 2YDJA 3OTUA 3WE4A 4DFZE 4BDDA 3BHUA 4R77A 2J0IA 2VWYA 4LRJA 3TT0A 4CFWA 2RFDA 4MXZA 3U87A 3FMKA 3EQPA 3OWJA 2I7QA 4DFLA 2WD1A 4BWPA 4QMQA 3QCQA 4ZJVA 2JFLA 4B9DA 5AUWA 4G17A 3F3WA 1M14A 2YIXA 3GP0A 3TI1A 4C4JA 2CKPA 2JLDA 4IAFA 2B52A 4YTIA 4HPTE 3FAAA 4UV0A 4FTTA 1Q8ZA 3E8CA 2O0UA 3IDPA 4B8LA 3QZFA 4IM3A 1REKA 5LMKC 2BDWA 4BBEA 1KUTA 4H1JA 1YVJA 2C5VA 3W1FA 1NA7A 3RK7A 4BDHA 5J5TA 5FUTA 1IG1A 5I9UA 5CZHA 4C59A 3I5ZA 3VJNA 3OC1A 1R0PA 4QNYA 2WELA 4FTQA 4FZ6A 2HXQA 2PVMA 3D2KA 1TVOA 2P3GX 2X0GA 3OROA 3LIJA 4BKYA 1MRVA 2VWWA 3ID6C 4G2FA 3L8SA 3ANQA 1JQHA 4V01A 1Q8UA 2FSMX 3MVLA 3MB6A 4JQ7A 5AP4A 2QOCA 1PMNA 2GHMA 4RJ4A 4XEYA 4XV1A 5M4CA 4N4SA 3PYYA 2IZRA 3WOWA 5LQFA 5HLWA 1Y8GA 3BBWA 2VTQA 3IW4A 3DAJA 3HX4A 5LVPA 4HCUA 4EUTA 1UA2A 3BYUA 1J1BA 5HIEA 4V0GA 4TN6A 5JSMA 4LMUA 3E7VA 4I6BA 1OPLA 5E8SA 4ZIMA 3GC0A 4S33A 2QR7A 4EOLA 2VZ6A 4QYGA 5HO6A 5D9HA 1Q5KA 2YM5A 4G3FA 5L2IA 2CLQA 3R8VA 4F64A 4EOMA 1PXNA 3CLYA 5DR9A 2XM9A 2C6OA 4L45A 3EFJA 2QHMA 4AG8A 4R7HA 2R4BA 4TWOA 3F66A 3MVHA 4L68A 4IVCA 4E3CA 2EB3A 4D4RA 3PY1A 4YJTA 5E9EA 2QOOA 3CIKA 4K33A 2R3LA 3TWJA 2GPHA 2VO0A 2YEXA 4FKSA 2J90A 3UC4A 4TY1A 4EYMA 3L9NA 4X6QC 4Q9ZA 1DS5A 3O0GA 4NIFB 3ZUVA 2ZDTA 4BDEA 4E6CA 3SGCA 3FLYA 2H34A 3V8SA 3I6UA 3D9VA 3KRJA 3R28A 4HYUA 5HG9A 3VQUA 3OY3A 5J1VA 3MN3A 1YXVA 3V01A 3KFAA 2XIZA 3SX9A 4W8DA 5DNRA 4BDIA 4EONA 5HORA 2VTLA 3W2QA 5FD2A 1GZKA 5FDXA 2GNHA 2VAGA 4KINA 2OFVA 3UOJA 1QL6A 2A1AB 1OVEA 4ZTLA 3FY2A 1PJKA 4RIYA 3TN8A 4EK6A 2Y6OA 3D5XA 4FV1A 4BRXA 1Q8TA 2VTTA 2QCSA 5IMEA 4IM0A 4NWMA 3BHVA 2YM8A 2WMWA 5CSVA 5B2LA 2R3RA 4AQCA 3R02A 3ENMA 2Z7RA 2XJ2A 2XRWA 5ICPA 3P4KA 4F1TA 5JQ5A 2XNNA 3DGKA 3HGKA 4FIJA 2A2AA 2I0YA 2UV2A 3EQIA 3FXWA 3GOKA 2PY3A 2XYUA 4ZEGA 5AM6A 5CAQA 4QMPA 5KO1A 3HKOA 4NCTC 4ACHA 4FVQA 1YHVA 1ZARA 4DEBA 4K1BA 1FOTA 4JBOA 4DEGA 4NW5A 5BYYA 1BI7A 2NP8A 4A07A 4BICA 4F9CA 4FX3A 2DQ7X 3C4CA 3IDBA 3KXGA 4XJ0A 3NUUA 3DOGA 5FM3A 3WZUA 1IEPA 1H27A 5D10A 4FNXA 5M56A 3U9NA 5BNJA 3DB8A 2JITA 3BQCA 4G9CA 1RJBA 5ANJA 3FLZA 4FE2A 4CFMA 5IQBA 5GINE 2C30A 3DCVA 1JPAA 1M52A 2UW9A 3UIMA 3UE4A 4BI1A 5I9WA 3UIBA 3PVGA 3G33A 5E8XA 2QOBA 4ZZMA 3P08A 1OL6A 1O6YA 4HVIA 4I5MA 1A48A 3AD5A 4ZTRA 2P33A 4UEUA 5KMMA 1TQIA 5TE0A 3WARA 5AM7A 4E26A 3S00A 3ATSA 4XP0A 1UU9A 4IQ6A 5AX9A 4AA4A 1V0PA 4BC6A 4M0YA 4E1ZA 5HG7A 3HAMA 4YPSA 3K54A 3RGFA 3MGYA 4FSNA 2JKOA 2JAMA 5JFSA 3ZUUA 3DNEA 4BCFA 3MH1A 2WEVA 4NM5A 5A6OA 3C0GA 3ZLSA 4U43A 3ZDIA 4BY9E 4NIFA 4XRJA 4KWPA 3R22A 4EL9A 4X2FA 2P4IA 3QQFA 4GVAA 5BVOA 4R5SA 5LARA 5GNKA 4D1SA 1M2RA 4LMNA 3CE3A 4YPDA 3ZFXA 3W18A 4NW6A 2UZBA 4MXCA 3U4WA 5IQAA 3OS3A 3OCSA 3U8WA 2OWBA 3L9PA 3TKHA 3LPBA 3POZA 3ZEPA 4IH8A 3QALE 5LCKA 3KXXA 2G2HA 3NS9A 3PUPA 2YZAA 4FI1A 3FPMA 2J0JA 4PPBA 3WF7A 3QX2A 4C3FA 3WYXA 4LOPA 1XKKA 3EL8A 4OBPA 1WBOA 3EZRA 4UZDA 3CD8A 2PZ5A 3KF4A 5FP5A 4QMWA 3F82A 2YLFA 2XK6A 3D5WA 4NKSA 4K11A 2PWLA 3F9NA 1BKXA 3KXNA 2W1CA 1JKTA 4F0FA 3MIAA 3QTIA 3KMWA 4FEQA 3S3IA 4JXFA 3T9IA 5LVMA 2ERZE 4R7IA 4L53A 3ELJA 3HDNA 4IVAA 4J71A 4XP3A 5AAFA 3WIGA 4F9BA 5CU0A 4J95A 2IW6A 3ZMMA 4MBJA 4FYNA 3LFDA 2WZJA 4Y5QA 4IANA 4IZ5A 5CVFA 5AP6A 3A62A 3AGMA 2CGXA 1UV5A 2XBJA 4WNKA 3DK3A 5E90A 3A7GA 3FI2A 5H9BA 4EUUA 5C01A 4AGCA 4BDAA 3WZDA 2FH9A 4ZTQA 2OH4A 3H9RA 4FOBA 1WBNA 3E5AA 4RIOA 3JVRA 3R7OA 2YCSA 5ANKA 4BKJA 4EYJA 4CYJA 4MXYA 4ZMEA 1KOAA 5JFWA 1PW2A 3TTJA 4QYEA 3R7IA 2CKOA 3UOLA 4BKZA 5M53A 1SVEA 2R3OA 1PRYA 4ACCA 4U45A 5BMMA 4DTKA 5FWKK 4RFMA 5KBQA 4CLIA 2W0JA 3NUNA 4NU1A 3DJ6A 4PL3A 4KD1A 3UVQA 5EOBA 4ZJJA 5AR4A 1R0EA 3ZLXA 1OIUA 1IRKA 5AUVA 3F5PA 4TWPA 3KQ7A 3PTGA 4BDFA 1Q8YA 3KY2A 4Q5EA 4DT9A 2R3KA 3PE2A 4PMPA 5LWNA 4JQEA 1Q61A 4II5A 4Y85A 4L46A 3MH0A 4BTFA 4MWHA 5ITAA 4ZLZA 3GCPA 3LJ2A 3KXMA 3Q96A 4YC6A 3R7VA 4C4HA 4RIXB 3C50A 3U6IA 4F7JA 3R9OA 3NSZA 4RRVA 4UXQA 4PTEA 4AA0A 4BYIA 2X2KA 3C7QA 2W7XA 3LCSA 4AE9A 4C4GA 5EKNA 2J9MA 1RW8A 4BTMA 3IW5A 1DM2A 4G16A 4CV8A 4DGOA 4FK3A 5CSHA 5E1SA 3SAYA 5HVKA 5FBOA 2HWOA 2GNLA 3ORZA 4G9RA 4KA3A 4NFMA 4PMMA 5E8YA 2KULA 2XZSA 3AD6A 4G3CA 5JFVA 1J7IA 2JC6A 3C0IA 4FTIA 2X81A 1OZ1A 4FVPA 4HGLA 4PNIA 2JDSA 3AC4A 2R3MA 4AUAA 4R78A 1OKZA 1XBBA 2CNVA 2PVJA 4KIKA 2UZWE 3QGWA 4LM5A 4FIIA 4M84A 5JGDA 4EOOA 1H25A 5TT7A 5AR5A 4G5JA 5EM7A 3VC4A 2VTSA 4GK2A 4BR3A 3GFWA 1SYKA 2C6DA 4L8MA 4E5BA 4F99A 4TWNA 3KK9A 2VX0A 5ETIA 5CT0A 4BHZA 3AT2A 3V6SA 5CQUA 4UMPA 2C6LA 3HA6A 3FQEA 4ANNA 4RVTA 2P55A 2QNJA 4GT4A 2RL5A 3DJ7A 4FIEA 4O21A 2IVTA 4DT8A 4C61A 1AGWA 3HV4A 3DA6A 4YJUA 4RX8A 4IZ7A 4AAAA 1JSUA 2OO8X 4I22A 3ITZA 3KREA 4PNKA 3B2WA 3ROYA 3O17A 4AZVA 4D4YA 3GCSA 5HD4A 4FT0A 2WFYA 1SZMA 4O7YA 4M0ZA 2RIOA 4FKGA 4U0IA 4MK0A 4FZ7A 4IMYA 2JBOA 4CTBA 1Q24A 3VULA 1ATPE 3R8MA 3UQCA 2OGVA 2ITVA 3I60A 2WTKC 2PVRA 5A4LA 4FSWA 5KBRA 1ZAOA 2R3HA 5FXRA 4RX9A 4PDSA 2YABA 2ZMCA 2Q83A 4YTFA 3FUPA 1WAKA 3VW6A 4FK6A 4XG8A 2VTOA 2QLUA 3ORXA 3F5GA 2OIDA 3IG7A 1PXMA 2BTSA 2UVZA 3MSSA 3MYGA 2XA4A 4FODA 4HNFA 3ZEWA 4BWXA 3ETAA 4YGAA 4RIXA 4YJQA 1UNHA 3QWKA 4EK8A 4F4PA 5I9VA 2JDVA 3EN9A 3LZBA 3UNZA 1F0QA 2X9FA 4ZY5A 3NUSA 4A9UA 4EBWA 4IEBA 3AC8A 5JGAA 4JDIA 5D7VA 5AP1A 2R3JA 5HIDA 4FTCA 5K3YA 2UZVA 4H1MA 3L9MA 5HICA 4OTWA 5E4HA 4DC2A 3HV3A 4FTRA 2OH0E 4I0SA 5EQPA 4TYIA 2YM3A 1GZNA 3ZRLA 4E8AA 4XOYA 3HL7A 3R9HA 1LEZA 1UNLA 4GFGA 1JKSA 2WKMA 4BCGA 3KXZA 4J96A 1JKLA 1R78A 4J97A 3KVXA 4S2ZA 3A7HA 1Z57A 4Y83A 3VHEA 1A06A 2CN5A 1TQMA 3K5UA 4RJ6A 2YM7A 4ANQA 4OTGA 2IZTA 1WVYA 3KVWA 3LFNA 4L3JA 4PP9A 1GNGA 2YAAA 1H28A 3HUBA 3ACKA 3LXLA 2VRXA 4NJ3A 1TKIA 4B7TA 5HE3A 3WE8A 3ULIA 4BIBA 4ASEA 2UW0A 3I7CA 2OZAA 3LAUA 4IAIA 4WKQA 1G5SA 2A27A 3MPTA 3HMMA 1KWPA 5EM5A 2BIKB 4E4LA 3MA3A 5A14A 4W4VA 5L2QA 4P7EA 3LXPA 3LW0A 4KABA 1GAGA 4QP2A 2CCHA 2VU3A 4FIHA 4MNEB 4RMZA 4C7TA 4ZLYA 3NAXA 4FR4A 3ZSHA 5HO7A 1H08A 3OWLA 3FYKX 3A2CA 5FXSA 4QMOA 3VUKA 3W8LA 2C6KA 2DYLA 3NNUA 3BGZA 3KKVA 2YN8A 3LFBA 3NW5A 4JIKA 5BYLA 3UYSA 2X8IA 3LFEA 1Y91A 4EJNA 2XK7A 2VWZA 3UTOA 4LQMA 3ODZX 4GUBA 4AT3A 3E8DA 4BTJA 2V0DA 4BDCA 3LCOA 4D55A 1UKHA 2OW3A 2YJRA 3RPYA 4CRSA 5EYDA 2PMLX 4U81A 1J3HA 3H4JA 1ZMWA 5BVKA 2YWVA 4X3FB 3W2CA 2CLXA 4RA4A 4S30A 5EYCA 3BELA 4WUAA 3QU0A 3OMVA 5CNNA 2XJ0A 3EN7A 4LOOA 4GKHA 3EIDA 2O8YA 3CEKA 1Y57A 3NW7A 1F3MC 4IE9A 3IPHA 5AJQA 3DDQA 4ANLA 4XUFA 2QODA 3QL8A 2Y6MA 3SQQA 4DFUA 3QXPA 3N9XA 4YLKA 4ALVA 3PG3A 4CCUA 3SA0A 1QPDA 4JVGA 2W9ZB 5EHYA 5EHOA 1K3AA 4QMTA 3W33A 4L7SA 4BDBA 2HW6A 3EN5A 3FL5A 4IJPA 2ERKA 3Q4UA 2CHLA 5C8KA 4L00A 4I5HA 4XG3A 3ZU7A 3AQVA 3PSDA 3VBXA 3FI8A 3BLQA 4JDJA 4P5QA 4YLLA 5AP2A 5JGBA 4RZVA 3UIXA 4AOJA 4OR5A 3NUXA 3UP7A 4DINA 4EH9A 3LOKA 1DAWA 4JR3A 4FSZA 4F63A 3QUPA 3CKXA 3LCDA 5EI2A 2YFXA 3R01A 2IZUA 1JOWB 3NUPA 3LXNA 1JBPE 4ERWA 3BU6A 4E4NA 4Z55A 1ZMUA 3QRUA 3ZYAA 5KHWA 2QURA 4O81A 5H8EA 4E6AA 4C38A 3C4FA 3MS9A 4X2GA 4ZY6A 2HWPA 3KCKA 2WXVA 4S32A 3I4BA 3ZFMA 2X7OA 3VBVA 1A9UA 3CC6A 3VUTA 4F9WA 3EH9A 4IAKA 4D4VA 1FGKA 2XKDA 4MEDA 4AW1A 5B2MA 2GMXA 1REJA 3NEWA 4IWPA 1ZYJA 2PVKA 3GU4A 5CAPA 3WF8A 4QOXA 3QQGA 4IDTA 2X4ZA 2XEZA 4O27B 1ZYCA 3QKLA 4FTKA 2CKQA 4O82A 1JLUE 4MKCA 2IPXA 4D5HA 3A7JA 3QD3A 3JS2A 3I79A 4NT4A 4O96A 3GC9A 5B0XA 2IJMA 1LUFA 5CVGA 4GG5A 4DEEA 2ETKA 2F4JA 4L52A 3FQHA 1H1PA 4GV1A 2VX3A 5KMNA 5HO8A 4BI0A 2B9IA 4X3FA 2WTCA 2UW5A 3UOKA 2P2IA 3KB7A 5E91A 5HCYA 3Q53A 4E6QA 2FYSA 2C6TA 5C27A 4AW5A 3ZFYA 5CQWA 3WF6A 3S4QA 3KXHA 4FUYA 2B55A 4ZP5A 3GU7A 4NM3A 5LJJA 2C3KA 3MI9A 3PDTA 4I6FA 2WAJA 3PIYA 4MXAA 4CFFA 5IA2A 4I20A 3BU5A 1JVPP 4BGGA 4W4XA 3TG1A 1XBCA 3IW6A 2JDOA 4UZHA 3OG7A 5J79A 1H0WA 4MBIA 1CMKE 5C26A 5CX9A 3ALNA 3I5NA 4GT3A 4ITJA 2I1MA 2PHKA 4JAIA 5CY3A 3JR1A 3JYAA 3P79A 2XCKA 3OT8A 4GUEA 4O1OA 2WQOA 1UU7A 3OWPA 4OUCA 4WD5A 1YXUA 3PLAE 1P5EA 2JIUA 4RIWB 3E8NA 4EZ7A 3CS9A 3JY0A 3LJ1A 4GVJA 5CAOA 4DBXA 2XKFA 5FTGA 4M97A 3R1NA 3R2BA 5AV2A 4FV6A 3LXKA 2C0OA 1MUOA 3EL7A 4CTCA 3SXSA 4DBNA 4Q2AA 4O2PA 2IVVA 4YHFA 4GK4A 4V04A 3MJ2A 3ZRKA 5M06A 2WQEA 4GYGA 4TRLA 4USEA 5IUGA 1JAMA 4W9XA 4DHFA 5DMZA 3EQFA 4N70A 4HGSA 4F09A 3QHWA 2HAKA 3KN5A 2QG7A 2J0LA 3TUBA 1WBSA 2PUPA 3MV5A 3O8UA 4FT7A 4IAYA 4D4SA 1FMOE 1KE8A 5A4QA 4JS8A 3SDJA 4O0TA 2XB7A 3E62A 3SRVB 3Q2JA 4QT1A 2YISA 2YDIA 4ONAA 3QQHA 4IZAA 3G15A 4NUSA 2QD9A 4XLIA 1YI6A 3NNXA 3L9LA 4MTAA 2GNIA 4W4WA 5C8NA 5KNJA 2ZV2A 4DH7A 5IQFA 1W7HA 3RM7A 5AUUA 4ANSA 3WZKA 5DA3A 3KL8A 3NYNA 4GFOA 3RPOA 1OIQA 1CM8A 4X7QA 1W82A 2FSLX 3PXRA 4YJPA 5HVYA 1J7UA 5DG5A 4M8TA 2GS7A 2CGWA 3F61A 2HY81 4U7ZA 2I0EA 5CXZA 3W2RA 3ZRMA 4PTCA 3ALOA 1PXPA 5IKWA 3HECA 4MH7A 2AYPA 4XP2A 2C5YA 4BCJA 3IGGA 3BHYA 3H10A 2PPQA 5IQIA 2RKUA 4C8BA 4ZAUA 3VWAA 3PSCA 4IWDA 3U55A 2BUJA 5C03A 3IOPA 3PXFA 3ZM4A 4CXAA 2UZLA 2ITZA 1UWJA 2UW7A 4E73A 2OSCA 2C6EA 4YTHA 5L2WA 1JWHA 3MFSA 3GC7A 3LFSA 4W8EA 3S0OA 4JX3A 4F9AA 2XP2A 5HX8A 1H4LA 4CT2A 2PMIA 4AN2A 4BCIA 4F7NA 4CQGA 3COMA 2F7ZE 4JG8A 4U44A 4F1OA 1OKWA 2OK1A 3FJQE 3N4VA 4KIQA 5A3XA 3OP5A 2WIHA 4CZUA 4HOKA 5KMIA 4HYHA 4D2RA 5ANOA 5FTOA 3V5TA 3RINA 2EUFB 4EKKA 1OBGA 4EHGA 4RFZA 3DY7A 3R7UA 4AZEA 4U5JA 3EWHA 4O0YA 2DS1A 4FKPA 5I0BA 3FL4A 5C1QB 2R9SA 4MAOA 5HCXA 3QWJA 3BQRA 5EG3A 3LQ5A 3DBCA 3R21A 5EDQA 2CNQA 3HUCA 3MW1A 1S9JA 3ZXZA 5IQGA 4D1XA 5GJGA 3QKMA 2R3PA 4BN1A 3SRVA 4ZTHA 5K4JA 5F95A 4EKLA 3QD2B 5FRIA 1HOWA 2I6LA 3VUHA 3NIEA 2WMXA 2XYNA 2GQGA 3VIDA 3VUMA 5GIOE 2ONLC 3DNDA 4IVBA 5JZNA 3C4XA 4I6QA 4HJOA 3FLSA 3D7TB 2HOGA 3LMIA 4FZFB 3ZXTA 4OTFA 1EH4A 4AE6A 3UO4A 1KE5A 5H8BA 4O91A 4AGDA 4XX9A 2FSOX 3I81A 2GQSA 1AD5A 3BGPA 3FXXA 4LRMA 3D15A 3QXOA 3ZC6A 3F69A 3CJFA 3ORLA 5DLSA 3AXWA 4RVMA 2R3QA 3A7IA 4AW2A 3NNVA 3ORPA 3SV0A 4BCHA 4PQNA 1GZ8A 2HY0A 5AWMA 5IEVA 3UVRA 1YRPA 5AAEA 1BYGA 4IWQA 4AP7A 4XS2A 5GIPE 4U41A 3FZRA 3RAIA 1YDSE 5TF9A 3ZDUA 4WUNA 1ZOHA 3BPRA 3AGLA 4C62A 5KE0A 3VBQA 5HG8A 3CBLA 5LMBA 5E8ZA 1S9IA 3QZIA 2VTJA 5AUZA 3OBJA 4O7WA 3Q4ZA 4D2WA 4TL0A 5IA5A 4H58A 3EN6A 5TOZA 4J52A 3ZSIA 2GNJA 3PPZA 3TKIA 5HBJA 4OAVB 3FEGA 5HE1A 3F2RA 4O86A 5I4NA 1ERKA 4QP7A 1QPJA 4D2SA 4IDVA 2W5BA 2C6IA 4O84A 2RF9A 4JBQA 4M68A 3QCXA 2VWXA 3TJCA 4CG8A 4FT3A 5ANEA 5AR7A 5DE2A 4GW8A 4Y5HA 2B1PA 5IISA 2NRYA 3UGCA 2I0HA 2AUHA 4UALA 4F6UA 4ZK5A 4YJOA 4DF3A 4RC3A 4OLIA 2Q0BA 3DKOA 3OW4A 1M17A 3A60A 4OGRA 1VZOA 5CT7A 1M2QA 4FEUA 2PE1A 1IA8A 4D58A 4GL9A 3CD3A 2IW9A 5AR2A 3VS0A 3T9TA 5AV4A 2XH5A 2FGIA 3AMBA 2Z8CA 3BGQA 3GQLA 4P2KA 4JRVA 3T3UA 2BAJA 4D0WA 2R3GA 4FV4A 2J4ZA 4GFMA 5G1XA 2W4OA 3SG9A 1FGIA 3AT4A 3BV2A 4FV0A 1GZOA 2F7XE 1OI9A 5GJFA 5IA0A 3C0HA 2XKEA 1QPEA 2GHGA 4QMYA 4TPTA 5ANDA 4C4IA 1ZYSA 1OUYA 3BE9A 4UMRA 4DH5A 2V5QA 2C3IB 2F9GA 3CGFA 3HMIA 3P1AA 4BCMA 1L3RE 1SVGA 4AT4A 5KCVA 4E4MA 2JGZA 2Z7SA 3PJ8A 4PMTA 2IZSA 2UZTA 2X6EA 4FV8A 1LEWA 2QOIA 2W05A 4IB1A 4BCPA 3E93A 2X8DA 3QTQA 4UXLA 5B7VA 4B99A 2B7AA 4K9YA 4M69B 1XR1A 2XM8A 3JVSA 3CTQA 3EZVA 5J87A 3OUNB 4JDKA 4IADA 4EQCA 2ZV9A 3F88A 3TNPC 3SXFA 2YERA 5IH5A 4NL0A 3DBFA 3FZSA 5AEPA 3KRXA 5DFPA 3V04A 3TCPA 4FL3A 1BLXA 4PUZA 5EKOA 5FDPA 3HV6A 3V5PA 1OGUA 3HV7A 3ZOSA 4QPSA 3UNJA 2YIWA 3MH2A 3G0EA 3P9JA 3UMWA 1R1WA 4AGWA 4MNFA 4MF1A 4UMQA 2YCRA 3TNQB 4I6HA 2V62A 5HU9A 3GOPA 4JQ8A 4WO5A 5ETFA 3ULZA 3UP2A 4YMJA 4QTBA 2C68A 3MIYA 3Q4CA 4IJ9A 3FY0A 2WQBA 5HTIA 3CP9A 4IX6A 2C3JA 4QMNA 2BVAA 2P2HA 5CF8A 5I3RA 1PF8A 3ZBXA 2NNWB 4K0YA 5M4IA 1URWA 4YHJA 3S1HA 4ANMA 3JPVA 4I0TA 4RLLA 4DEHA 3DT1A 4FSTA 2OXXA 4JI9A 3VS2A 3SD0A 5JEBA 3RK9A 5HOAA 5HNIX 4W4YA 3OZ6A 2JAVA 3U54A 1WBWA 5DEWA 1OKVA 2WMVA 1Z9XA 3RK5A 3GVUA 3VBWA 4YJNA 4RG0A 4Z3VA 3FZPA 4FOCA 5FEDA 4X3JA 5E8TA 2V55A 3T3VA 4EI4A 5CAUA 1RE8A 2XK8A 3QF9A 4JAJA 4A9YA 4DGMA 3BRBA 4QP1A 3PP1A 3QQKA 4FKJA 2E9OA 4RT7A 3UJGA 3FC1X 5ACKA 4GG7A 2E9UA 5G6VA 3MB7A 1GJOA 4FT9A 4GEOA 4F6WA 5EDRA 2I40A 3DB6A 2GS6A 2VNWA 3ODYX 1DI9A 4O2ZA 4O7NA 4JL9A 3CGOA 4M69A 4YHTA 3G51A 4XBUA 3VF9A 4FZDB 3ACJA 5KMJA 4IC8A 3WIKA 3BEGA 2ZV8A 4F65A 2E2BA 3NVMB 5GHVA 3TDWA 2BIYA 2BAKA 3TZMA 5HQ0A 2QO9A 1XH5A 1MQ4A 2HENA 5CSWA 1U54B 5IQHA 4BGQA 3GCQA 1ZY4A 4IFCA 5L6OA 2EXEA 3GQIA 1V0BA 4QRCA 4TT7A 4CYIA 4TXCA 3W2OA 5AAGA 4IACA 1IASA 1H01A 4IX3A 4BDJA 1TQPA 4L3LA 3QRJA 4GIIA 3QQLA 3R6XA 2IVUA 3GU6A 2UZUE 4MF0A 1YXXA 4RA5A 3QAME 4BCKA 3EYHA 5J9ZA 4ZTNA 1OIRA 2EWAA 5AP7A 2XF0A 4ZSAA 4ZS0A 1P14A 5EW3A 4U8ZA 1U46A 4WOVA 5FQDC 2ZM3A 4FIGA 1KV2A 3EMGA 3HP5A 2GFSA 5HVJA 5DN3A 1I44A 4FSQA 2BPMA 3THBA 4USDA 4LG4A 4DA5A 5J7BA 1UWHA 2IO6A 4WSQA 3DLZA 2R3NA 4E93A 2WMQA 2YITA 3BYVA 4R1YA 3P23A 3C5UA 3OHTA 3OXIA 3IGOA 5IZFA 4KKEA 3NYVA 4NSTA 4D28A 4XMOA 3MVJA 2JEDA 5ETCA 2G1TA 1JNKA 5IQEA 3NZ0A 3FLQA 2HZ0A 3DQWA 3GFEA 3HV5A 4RBLA 1URCA 3KN6A 3PVBA 4K2RA 5EK7A 2ZDUA 3PG1A 4D2TA 5C4LA 2W1GA 4OTDA 3VAPA 3Q60A 2B9FA 2RGPA 5J95A 3MFUA 1YXTA 4IM2A 3UMXA 3TNWA 4YU2A 5M07A 4C33A 3R8PA 3FXZA 2ETRA 3EKKA 2A4LA 2X39A 3EQRA 4XV2A 1NVSA 5HHWA 3SHEA 5EOLA 4YR8A 4M67A 3LFFA 4ZLOA 5EI8A 3VO3A 4R7BA 3VQHA 3NPCA 5GJDA 3QC9A 3R7YA 4G31A 2RG6A 3R1YA 4DN5A 2CDZA 3RMFA 2FSTX 5HG5A 4B4LA 5J7HA 3KRWA 4U79A 4LFIA 5CEKA 1U54A 3BYOA 3EKNA 2XNMA 1IR3A 3EB0A 2ITUA 5AR8A 5AIRA
chains in the Genus database with same CATH superfamily
4F7SA 2WMAA 2LAVA 4EORA 3NUYA 4CLJA 3FKOA 2F2CB 4IB5A 4JOAA 5DRBA 3OW3A 3CQWA 4GYIA 3JXWA 2PU8A 4U6RA 3QX4A 2OBJA 3U6HA 4BFMA 4XHKB 2XK9A 3QRIA 2PUIA 3II5A 4GK3A 4CKJA 2OJFE 1J7LA 4FNWA 2Z7LA 5CI7A 3TZ9A 5HI2A 1G8SA 1JKKA 2H9VA 3HVCA 5LVNA 4GT5A 4Y72A 1YWRA 1XJDA 2WTDA 2AQXA 4BI2A 3Q9YA 3V5QA 4FV9A 4U40A 2HCKA 1KE7A 3F5UA 3QRTA 3PJCA 4YNOA 5EHLA 5CF4A 3W2SA 3MVMA 4DFYA 3C51A 2GCDA 3QTWA 4JG6A 1QMZA 4K6ZA 4XH6A 4FSUA 4DGLC 2EXCX 3FKNA 4FSMA 5DPVA 4ALWA 2R0UA 3QBNA 4C37A 4IC7A 3SW7A 5AIKA 3QA8A 2QOQA 4OT5A 3RHXA 4BZOA 1BL6A 3PP0A 4E20A 4UX9A 4F78A 4KBKA 4RJ7A 4A9TA 1H00A 4UBAA 4ACGA 5M51A 4NM0A 2HYYA 3FE3A 5EW8A 1KOBA 2RFNA 3B8RA 3COHA 3TKUA 2JDRA 4QNAA 4DHIB 1Q99A 4UMTA 3Q4TA 4KIOA 5CALA 3RM6A 4UWYA 5AMNA 3F2AA 3MESA 3HMNA 3FYJX 3GC8A 4IX4A 3HP2A 1O9UA 2C0TA 4FT5A 4FYOA 5EM8A 2RFEA 2PZPA 4IB3A 5D1JA 4RWJA 3UYTA 5FXQA 3ZONA 4EOQA 4R3RA 1QPCA 2OKRA 5M4UA 3PFQA 1VYZA 4X0MA 5KMLA 1XH4A 3KK8A 3CJGA 4IIRA 1GIIA 5TR6A 4O0WA 3LKMA 4PP7A 3QLFA 5DYJA 1H8FA 4LDTA 2PMOX 4F0GA 1B38A 3NMUF 1T45A 2ZMDA 3R7GA 3C13A 4FL1A 4QQJA 4EEVA 4M14A 3HA8A 2R7IA 2VTPA 3VS7A 2PUUA 3RPVA 5I9ZA 5J9YA 5BVEA 3UQGA 4ZTSA 2BFXA 2R0IA 4EHEA 1OPJA 1SMHA 2GNGA 4I92A 2Y4IC 3GEQA 4O4BB 3EYGA 2JFMA 5DVRA 3NYOA 2ZAZA 4FF8A 4FG7A 3PUFC 4C2VA 4EOSA 2J5FA 3NNWA 2ITQA 3LMGA 4RJ3A 2Y8OA 2PVFA 3W0MA 2HXLA 2WU7A 3FMEA 4O0VA 4A4XA 4F70A 4CZYB 3COKA 3PE1A 4M13A 4WG4A 2XS0A 1W8CA 5BQ0A 5DEYA 3BCEA 4BYJA 3O23A 5AADA 5K5NA 4IBMA 3OT3A 4WHZA 1HCLA 4G5PA 2O63A 4LGDA 4R3PA 2FVDA 4RC2A 4YBKA 5H2UA 1LPUA 3R83A 1B6CB 4CFNA 3R8LA 1OECA 4DFXE 4F08A 5LMKA 3Q52A 2BZHB 3BI6A 5T68A 4O1PA 3GNIB 5CLPA 3VS1A 2W1HA 3FQSA 4LUDA 4QTAA 1OM1A 1Q62A 1VJYA 4KSPA 1OL7A 4YZMA 5TO8A 3GI3A 4FGRA 4JRNA 3EQHA 4ZSJA 4BF2A 3RAKA 4MD7E 4A4OA 3D2IA 4DCAA 5HNBA 4DLIA 4YTCA 1R3CA 3QD0A 2BAQA 4K18A 4YZ9A 3SVVA 1BL7A 3QTZA 4N6ZA 3BL9A 4IB0A 2IW8A 4DYMA 2Z2WA 4PWNA 3PIZA 3RBWA 4FSRA 3AC2A 3W16A 4L44A 3LLTA 4XG9A 5FLFA 4BTKA 4A9SA 3MPAA 3MJ1A 4FRFA 2ACXA 4CT1A 3R8UA 3RWPA 4D9TA 3NCZA 2ONLA 4M66A 5LMAA 1O6LA 5J9LA 4FKLA 1VYWA 4YZDA 4YC8A 5DBXA 2WMBA 4HPUE 2BKKA 3OVVA 5J8IA 4QMXA 4NJDA 5BUEA 1PXJA 3O8PA 4KRCA 2P0CA 2ITTA 4GU6A 3L8XA 3G2FA 4S31A 3RNYA 2JD5A 3ZZWA 4FBXA 5DT4A 1IA9A 3ZCLA 3BHTA 4GIHA 1V1KA 1YWVA 3A4PA 4ITHA 3ANRA 3FMMA 1CKJA 3R9DA 4MNEA 3EN4A 1GIHA 4QO9A 2C47A 3WI6A 3P5JC 2ZYBA 3OD6X 3E7OA 3H0ZA 4JDHA 4L67A 4GSBA 4P90A 2C1AA 2CN8A 2O2UA 4FTLA 3CXWA 2HK5A 5K0KA 2OJ9A 5JFXA 4LI5A 2EB2A 5AFVA 2AC3A 2HELA 4ANBA 4PDOA 4Z9LA 1OKYA 1VLRA 2NYAA 4M7IA 5IEXA 4AXEA 4BBFA 2WQMA 3UZPA 3I0OA 3OFMA 4FVRA 4BCNA 4I21A 3TIYA 2PSQA 5CSPA 4H36A 4DEIA 1H1SA 4FKIA 5EH0A 5JH6A 1SNUA 2RG5A 5FGKA 5CAVA 3P86A 3BWJA 3KMUA 4LV7A 4ZSLA 3FHRA 2WMTA 2PVYA 3GENA 4O0XA 5ANGA 4RVLA 1Y8YA 4LGHA 4HVHA 3BE2A 3F7WA 2OIBA 3W0OA 3BIZA 2QU5A 3TUCA 5L8JA 1YI4A 2C3LA 4ZY4A 3FLNC 4O22A 5LVOA 3PFYA 4CGAA 3NWWA 1U5QA 3EHAA 2H96A 3ZBFA 4E5AX 4I6LA 3D0EA 4H3BA 4FEVA 2NO3A 2REIA 1F5QA 2PE2A 4D9UA 2PVLA 4D1ZA 4RWKA 4W9WA 2GTMA 2PVNA 3C4ZA 3CY2A 5HU3A 3I7BA 4QP9A 3SW4A 5BMSA 4H3QA 4A9RA 4X2JA 3UPXA 4EOPA 3H9OA 3LJ0A 3PXKA 3E87A 3IDCA 3DKFA 1PYEA 1W83A 4EH8A 2H8HA 4TYHB 4NCTA 4PDYA 5I9YA 4U3YA 3PZHA 4AN9A 4DEDA 3QCSA 2VD5A 4QPAA 5CS6A 2UUEA 2V7AA 4HVDA 4APPA 3FMDA 2QC6A 4NTSA 2PMNX 2CSNA 3OBGA 4L43A 4FTUA 1TFFA 2CMWA 3TTIA 5KHXA 1H1RA 3DU8A 4FEWA 4FV5A 2E9NA 4R8QA 4CMUA 4AAYA 3MY0A 4KSQA 4I4FA 5AV1A 4CMOA 4PDPA 4OTPA 4CFVA 5CI6A 5IU2A 1G8KA 1E1XA 3NW6A 3EOCA 4AWIA 5BVDA 4CKIA 3ORMA 5KKRC 1YOJA 3EFWA 4J1RA 4N0SA 4EHZA 2QQ7A 3QD4A 5E8WA 5FEEA 5JKGA 1ZOGA 4G3DA 5M57A 4AF3A 4XV3A 3VUIA 2J6MA 3M42A 5ACBC 3TYKA 4QYFA 5M44A 4EOJA 2YIRA 1ZOEA 2ZJWA 3HAVA 4FUXA 1GY3A 3QTRA 4A06A 2C6MA 4GCJA 5HE2A 2OLCA 2X4FA 4MQ1A 4O6LA 1IAJA 3E88A 4EH3A 4ASXA 3CQEA 2G01A 3C1XA 3E63A 1QCFA 1KSWA 4FC0A 5A9UA 3LLAA 3GGFA 3FKLA 1M2PA 1LR4A 1OIYA 4FIFA 2BTRA 2B53A 4WG3A 5CU2A 1JSVA 3G9NA 3ZUTA 3UZTA 3FSFA 2ITOA 1J1CA 2A19B 4IAZA 4U9AA 4C57A 1OB3A 4OAUC 2WMSA 1RQQA 3Q9XA 4EHVA 3FV8A 4BB4A 4UY9A 4YJVA 4YP8A 4YO6A 3S95A 3IW8A 4MX9A 3U6JA 4XYFA 2Y7JA 4BWKA 3POOA 2W1EA 3IQ7A 3Q6WA 4ZJIA 1WFCA 2QHNA 3MY5A 4F7LA 1H07A 3AT3A 3VNTA 2AC5A 4BCOA 5B2KA 2UW8A 1OL1A 5DWRA 3RZBA 3JY9A 3OWKA 4DLJA 4MQ2A 2J0KA 4J8NA 3W10A 4TW9A 3CY3A 3FLWA 4V0GB 5DIAA 5A54A 3FC2A 3VRZA 3P7BA 3NGAA 4HVGA 4LOQA 5FEQA 1OUKA 5CU6A 1J91A 3PIXA 5L6WL 4C3PA 4C4EA 4EZ5A 2FA2A 5AP3A 4PMSA 2GNFA 4RIWA 4FKWA 4DGNA 5KMKA 4ACMA 5HD7A 1KE6A 1Z5MA 3LFCA 5CU3A 1UU3A 4NTTA 3VN9A 4ZSEA 4FTOA 3FWQA 4XRLA 3DV3A 1PMEA 3RWQA 5IQDA 5E7RA 3SKCA 3G5DA 3L8PA 4QP6A 3D4QA 4QPMA 4A7CA 3NAYA 2XCHA 4ZZNA 4HGTA 5DI1A 2CCIA 3BHHA 4JJRA 3WBLA 4FKTA 5I5ZA 4ORKA 3E64A 2Z60A 2F49A 1Q41A 3V8TA 5F9EA 5AV0A 4QDVA 4HZRA 3R71A 2NPQA 1ST4A 4DCEA 3MA6A 3RTPA 4EOIA 3H30A 3IKAA 5AX3A 4CMTA 4X21A 5IQCA 4MHAA 4EK5A 4AZSA 3QCYA 4MBLA 4G1WA 4FKVA 3OTVA 5BX0A 2WTKB 4O6EA 2QOHA 1NT2A 4HVSA 1P4FA 4MVFA 4OW8A 2YZLA 4YLJA 4FZAB 3DQXA 4RSSA 3TZ8A 2VWBA 3VBYA 2OG8A 1Y6AA 4FV3A 5DT0A 4KS8A 1UKIA 2BCJA 2VWVA 5CEIA 1WVXA 4RIYB 4IWOA 1FPUA 4YSMA 4BDKA 3FI3A 4DHZA 4XV9A 2HW7A 3TMOA 2BROA 4I5CA 1DI8A 3BX5A 3HEGA 5AUYA 3G9LX 4WG5A 3QZGA 3DBEA 3EFLA 3ZS5A 3W0RA 4TNBA 4O0UA 2FB8A 2X7GA 4S34A 5D7AA 3TNHA 3KA0A 4KRDA 5L2TA 5A4TA 2YM4A 4FEXA 4GS6A 4WRGA 3SOCA 3V5LA 3PY0A 4B0GA 3BU3A 3V6RA 4MYGA 3C5IA 5A4EA 2C5XA 2VTRA 4H3PA 3I6WA 1OL5A 3HMOA 4D5KA 3H3CA 1WBTA 2IVSA 3MH3A 2WMRA 1BI8A 2FO0A 4AZFA 2XNEA 4WIHA 5AA9A 4ZTMA 4U42A 3PZEA 1L8TA 4IXPA 4Y95A 4I24A 3F3TA 4XBRA 4IZYA 5IF1A 2W5AA 4JT3A 3ATTA 3GT8A 3NCGA 1CKIA 3QQJA 2VTMA 3R0TA 3PRFA 4QMSA 3UG2A 1NVQA 4ZMFA 2W1DA 5BPYA 3BBTB 3OOMA 2BZKB 2WU6A 5AUXA 1Q4LA 4RQVA 5HLNA 4XG6A 3ZM9A 5DR2A 4A4LA 1OPKA 3RAWA 1PMVA 2VGOA 3DS6A 3G6HA 3W55A 1WZYA 3DDPA 4O7RA 2J5EA 4DITA 3RCJA 5HLPA 2VO7A 3CPBA 4QQTA 2WOUA 1W2CA 1M7NA 2OXDA 4J99A 1K9AA 4BVUA 4AX8A 3NLBA 5FG8A 3V5JA 3VUGA 5HZNA 3DKGA 4DTAA 3PVWA 3SG8A 4GU9A 4PPCA 3KULB 3V5WA 4BBMA 1ZYLA 3G90X 1ZMVA 2YCQA 2Y4IB 3EQDA 3DZQA 4NFNA 4FV7A 1SM2A 2VV9A 5CENA 4I94A 4C0TA 2ITWA 4L01A 3E8EA 4RVKA 5ETAA 5GZ9A 4X3FC 4XLVA 2QOKA 5LVLA 4FNYA 3AC5A 3R9RA 3DXNA 2EXMA 5I3OA 1PXOA 3D7TA 1R39A 2VN9A 4WRSA 3SLSA 3VJOA 4FA2A 4QP3A 2W99B 4FNZA 5HBHA 3NX8A 4YBJA 2DWBA 5F1ZA 3RKBA 2QOLA 4V05A 4QTDA 2BRNA 2QONA 3FMLA 4X2KA 4ANOA 4CD0A 1FVVA 1Q3WA 2WGJA 3FDNA 3D94A 3HRFA 4HYSA 4EBVA 3D7ZA 2IN6A 3IW7A 3A8XA 2OI4X 5KUPA 4WT6A 3QA0A 2J50A 4HGEA 4LV5A 4AA5A 5CEPA 2B54A 3RAHA 1WVWA 2BILB 4D0XA 4GKIA 4XG7A 3A61A 2W96B 3Q04A 1YHSA 4CQEA 4CZTA 4L3PA 5I9XA 4DTBA 2QKRA 5C4KA 3LFAA 1H24A 4LYNA 3RZFA 3NIZA 3DPKA 5FTQA 1ND4A 3GU8A 2B0QA 4AXDA 5AP0A 5HGIA 5L8KA 3E3BX 2XJ1A 4BDGA 1H26A 2XK3A 2X8EA 2CPKE 5L8LA 3BLAA 2F2UA 2PK9A 4YNEA 3AC1A 1GIJA 4QYYA 1WCCA 4FSYA 2E9PA 5JMSA 4AGUA 3U4UA 3PA3A 3EQBA 2QOFA 3KC3A 2BDJA 3C9WA 4JBPA 2WB8A 4M15A 1PY5A 3AMAA 4Y8DA 4AN3A 2BHEA 2WEIA 5CEOA 3PA5A 4KIPA 3BLHA 4P5ZA 3NYXA 3DZOA 5GZAA 2W1FA 5FP6A 3AMYA 2OJJA 1XMMA 4PV0A 4I3ZA 4DG2E 5DR6A 3SOAA 2BKZA 4AT5A 4R6VA 2PE0A 4BZNA 4YC3A 2KTYA 2BALA 3BV3A 4OTQA 5CXHA 2VWIA 4O7LA 3KULA 4DGGA 2HIWA 4FG9A 3HDMA 4O0SA 3DJ5A 1OL2A 1H1WA 4FTAA 1I09A 2X1NA 4MCVA 3K3JA 2J0MB 2IG7A 1W0XC 2QLQA 1WBPA 1W2FA 4YSJA 3MTFA 4ZSGA 3RNIA 5CTPA 5HTCA 2HZ4A 4IFGA 1P2AA 3U51A 2C0IA 2G2FA 3PY3A 4TKSA 4QP8A 3VW8A 3WZEA 4BL1A 4HCVA 5E8VA 5CSXA 3RALA 3B2TA 4Y46A 4Z7GA 2WHBA 4OT6A 5EYKA 4GMYA 3UBDA 3G6GA 4OBQA 1G8AA 2XNGA 4AQKA 4KKGA 3R8ZA 4F6SA 3PXYA 3QYWA 4B6LA 1UU8A 3OOGA 4KIKB 2HZNA 1W98A 5IMXA 2VGPA 3EFKA 3PPKA 3OCGA 4L42A 1YDRE 3EQCA 4R3CA 2BRGA 4ASDA 4EH5A 4QMUA 1YW2A 2BFYA 4EK3A 1YKRA 4NK9A 3D5UA 4C2WA 4OTHA 2VTIA 4BGHA 4MXOA 3CQUA 5L4QA 4NH1A 4LV8A 4EC9A 3MPMA 4PF4A 4EH7A 4QP4A 1KE9A 1CSNA 2C4GA 2OICA 3CR0A 3F3VA 3QGYA 3RI1A 3DXPA 3O96A 5BUIA 3QC4A 1XHAA 3QQUA 4C4FA 2WQNA 4D2PA 4LL5A 5E8UA 4DEAA 4EH6A 1V0OA 4KNBA 3PRIA 3GCVA 2HZIA 4I93A 3TL8A 2XBAA 4FGBA 4DE4A 4CEGA 3VVHA 3ZO2A 2O65A 2ZV7A 5H8GA 3DAEA 4ZOGA 3M11A 1OITA 3MY1A 4C3RA 5L2SA 4YUQA 2WO6A 2WTWA 3PSBA 3ZLWA 3LCTA 3UDZA 3FZTA 3ZZEA 2BR1A 4PRJA 4MD9E 4EWQA 5KKRB 2JIVA 4B8MA 2G9XA 3QRKA 5EQEA 3O8TA 5F4NA 4CV9A 4I5PA 2F7EE 2YIYA 5CZIA 2CKEA 4MXXA 1YI3A 2YA9A 2BZJA 3AOXA 4O4FA 3VRYA 5AUTA 3P7CA 1ZWSA 2OJGA 3COIA 1WMKA 5T3QA 2W1ZA 2WNTA 1ZY5A 3R73A 4I1ZA 4NZWB 2X2LA 3AKLA 4FKRA 4Y73A 5DT3A 4PL5A 5BYZA 4NEUA 3CTJA 5KZIA 1AQ1A 4R1VA 3W0PA 3DK6A 3RPRA 3V51A 4RFYA 5HE0A 2X7FA 5EFQA 3QUDA 4UWCA 1XH9A 1NVRA 2ZOQA 3CPCA 3QTUA 4KB8A 4RGJA 4E7WA 5CEMA 5J5SA 4XOZA 5EQYA 4EH2A 2XEYA 3TEIA 4GRBA 5CU4A 2QVSE 3HLLA 3MDYA 3V3VA 3UOHA 4TYJA 3ZO4A 3FHIA 4I0RA 4RZWA 2YAKA 5CF5A 4U80A 2UW3A 4RX5A 3E3PA 2V22A 5HCZA 3KCFA 5FBNC 5IUIA 3FZ1A 4JG7A 4M3QA 3ZTXA 3KEXA 4ITIA 5F20A 3VS6A 4HYIA 1Y6BA 3D83A 3ZH8A 5IA3A 1XH6A 2BRMA 4O7SA 2R3FA 3O7LB 3LFQA 3DXQA 3R04A 4CRLA 4L7FA 5J1WA 4AW0A 4N57A 4NM7A 2UZEA 5LWMA 5IPJA 1MP8A 3TZ7A 1LP4A 2W1IA 2XANA 4Z7HA 1E9HA 3R30A 1PKGA 1Q8WA 2VNYA 3R63A 4LRKA 2XIKA 3TXOA 2OZAB 5F94A 4O38A 4D2VA 5HTBA 5L6PA 5M08A 3ZO1A 3R00A 2E9VA 3Q2MA 3OXTA 3A8WA 3NVKI 2YHVA 3PJ3A 4TWCA 5C8MA 2X9EA 3R9NA 3N4TA 4YO4A 2IWIA 2VTAA 4AS0A 4EC8A 1YQJA 3MBLA 2X6DA 3F7ZA 4JIAA 4NKAA 5HESA 1XQZA 3BYMA 1BUHA 3RPSA 3KGAA 4Z16A 4CSVA 4YURA 2RFSA 3BWFA 3NUAA 2G2IA 4CVAA 4J8MA 3LQ8A 4TZRA 5DGZA 5M09A 3ORTA 3UZRA 2X2MA 5KMOA 4JNWA 3OXZA 3RCDA 1OBDA 5DHJA 1JSTA 2R2PA 2BRBA 4G6NA 1MRUA 2R7BA 5HKMA 2OXYA 4ARKA 4IX5A 3A4OX 1FQ1B 4I23A 2W4JA 4ZS4A 3ET7A 3I0QA 4FTMA 3WF5A 5EM6A 3EJ1A 3TV4A 4AFJA 1MRYA 2JIIA 3HRBA 3QHRA 2PUNA 4FKUA 2YIQA 3K5VA 3Q5ZA 4FTJA 3LVPA 1U4DA 2XRUA 3K3IA 3AC3A 2R3IA 4ASZA 5HIBA 2ETMA 2UZDA 4P4CA 3MWUA 4JX7A 2YDKA 4UN0C 1STCE 3ERKA 2VO6A 3UQFA 1H1QA 4ENXA 3P7AA 4J7BA 4FKOA 2J2IB 2Z7QA 2OZOA 2ZM1A 1ZXEA 2VTHA 4UMUA 4C58A 3FI4A 2LGCA 2O5KA 4IVDA 3BZ3A 3DFAA 2WIPA 2VTNA 5JZJA 3W0SA 4RPVA 2XUUA 5BVWA 2PYWA 2PZIA 2R64A 4YZCA 4QMLA 4F1MA 4IHPA 4J98A 2B9JA 3UO5A 3L1SA 3LHJA 3OY1A 3U9CA 3IK3A 3O51A 3P5KA 4LL0A 3F5XA 2BHHA 1APME 3HZTA 4N6YA 4WNPA 2ESMA 2ITPA 4C36A 3OCBA 4ERKA 3RP9A 4DH8A 5K5XA 2OU7A 3QTXA 5JQ8A 1PMUA 4O83A 2A0CX 2C5OA 2JKKA 2WPAA 3LM0A 4FG8A 4J53A 1PXKA 3TACA 4EQUA 4E4XA 2XVDA 3DBDA 2GQRA 5EI6A 4E5WA 5IEYA 3SXRA 4DFNA 4O7VA 1FINA 2O64A 2BRHA 3Q9WA 4CKRA 1XMLA 2YJSA 2YM6A 3ORNA 3PVUA 2H6DA 3IONA 3F3ZA 2OFUA 1CTPE 4PX6A 3VUDA 4EOKA 4DG0E 2XK4A 4TYGA 5BVNA 2XKCA 3BEAA 4GJ3A 3PWYA 1FVTA 4QQ5A 3W32A 4AU8A 3OUKA 2YACA 4WA9A 3DTWA 1VEBA 5CWZA 3GCUA 3EQGA 1U5RA 2QU6A 4G6OA 3ZHPC 3V8WA 4BIEA 5LXMA 2XARA 2SRCA 2NRUA 2Y9QA 2B4SB 5KZ0A 3S2PA 2R5TA 1YOMA 5IH6A 1W2DA 2PZYA 4FV2A 5AR3A 1PKDA 2JBPA 5GZ8A 5M55A 1RDQE 4YJRA 3W8QA 2DUVA 2UW4A 3HNGA 5EDPA 5IUHA 4PPAA 3NR9A 4Q5HA 2GS2A 1YDTE 3AD4A 1CKPA 1SNXA 4QQCA 4R5YA 3R7EA 3TJDA 4DAWA 3FMJA 1XH7A 3HYHA 4ID7A 4AOIA 4XCUA 3NRMA 4XG2A 4EZ3A 2WTJA 4DH3A 2UVYA 4CNHA 3BYSA 3C4EA 1YOLA 3F3UA 5EW9A 1M7QA 2Y0AA 2X0PA 1PXIA 4PL4A 3UDBA 2PULA 2XNOA 2W17A 3N4UA 2YLEA 1NW1A 4QD6A 3QKKA 3PXZA 4QTCA 4AZWA 3VS5A 4I41A 2ZB0A 3GUBA 3R1SA 5LCJA 3A7FA 4EK4A 3GB2A 4CCBA 2WMUA 4O4EA 5E92A 4H05A 3SC1A 4KAOA 2W4KA 3TUDA 3RHKA 3TDVA 3ZO3A 5T6KA 4ZXTA 3NDMA 1XH8A 5A46A 3O2MA 4UB7A 1B39A 2ZM4A 3O7LD 3VS3A 4BIDA 2QO7A 1GOLA 3K2LA 3GBZA 5HBEA 2XMYA 3TNIA 2W9FB 2JDTA 3WYYA 2BMCA 3PXQA 4HCTA 1ZRZA 5AP5A 5EYMA 2QKWB 5IDPA 4BZDA 1ZZLA 4H39A 4RJ8A 2Z02A 2QR8A 5K9IA 4FL2A 4LGGA 4Q9SA 3KU2A 4EH4A 4OTRA 3CKWA 2ITYA 1U59A 4WNMA 3ZC5A 3UVPA 4QMMA 3OEZA 3IO7A 2GTNA 2F57A 3G0FA 2UZOA 2UZNA 3VS4A 3PJ2A 1YXSA 3MTLA 2WTVA 4C02A 1SVHA 3QLGA 3DAKA 2Y4PA 3QTSA 4AXAA 5TKDA 4DFBA 3FSKA 4RQKA 4X6RA 4WBBB 3FPQA 3H0YA 2W5HA 2JKQA 4KS7A 3UNKA 4KUJA 3OEFX 4PTGA 3ORKA 4ALUA 4L6QA 3TM0A 3E92A 3KMMA 3LQ3A 5D41A 1XWSA 3WILA 5IA1A 3CTHA 3M1SA 2ITXA 2GU8A 3AG9A 3QUEA 4XNEA 2GFCA 1O6KA 4K8AA 5CYIA 3IS5A 5H3QA 3QZHA 5D11A 4O7ZA 2B9HA 2PL0A 2J51A 2JKMA 2WOTA 3FBVA 4LUEA 3ENHA 1PXLA 1UNGA 2PTKA 3BKBA 3UG1A 4WSYA 1KV1A 1CDKA 1K2PA 3VHKA 3VBTA 3P0MA 3QYZA 5A6NA 2C1BA 3N51A 1H0VA 4C35A 4QYHA 4AZTA 3UC3A 3I1AA 1ZYDA 3H9FA 4YJSA 2VO3A 5M4FA 4JR7A 2XIXA 3PJ1A 5CANA 2VWUA 4FTNA 4OBOA 4E6DA 4DHJA 4DG3E 3WF9A 3OCTA 5CF6A 1FVRA 5C9CA 2ZVAA 5LOHA 4IW0A 5BVFA 3PA4A 5JT2A 4KBCA 4NYEA 4CG9A 4WNOA 2BZIB 3DLSA 4APCA 3UDSA 3C4WA 3KF7A 3Q32A 4HNIA 4U3ZA 1XO2B 3GXLA 3M2WA 3MFTA 4JBVA 3GU5A 4JLCA 4RX7A 4RWLA 2XIYA 4KKHA 4YZNA 3RVGA 3PLSA 5E1EA 4UYNA 3DTCA 5DOSA 5AA8A 1FMKA 1FBNA 4TTHB 2QG5A 5AV3A 2CGUA 4EJ7A 5DRDA 3ZLYA 3REPA 5JK3A 3UPZA 5HEZA 4AOTA 3JUHA 1IAHA 1BX6A 4MWIA 5IA4A 3Q5IA 3LM5A 5IDNA 4UYAA 3R1QA 2GSFA 2I0VA 1ZZ2A 2CGVA 3Q3BA 2RSVA 4BHNA 2QO2A 4KBAA 2UW6A 4FKQA 2PZRA 3DBQA 5DH3A 4YZBA 4USFA 2CJMA 2FUMA 2C69A 3VF8A 3F2NA 3ORIA 3WZJA 1Q3DA 4F9YA 3Q6UA 1Q97A 2XNBA 3P78A 1MQBA 4AACA 4QMVA 2J7TA 2V7OA 4RC4A 3CCNA 3LCKA 2VUWA 2VX1A 3FMHA 4GJ2A 1OMWA 3TV6A 4PY1A 3QFVA 5CEQA 2OJIA 1HCKA 1P4OA 2UVXA 1T46A 4I4EA 5K4IA 2OIQA 2XIRA 3D14A 1NXKA 3FZOA 4HW7A 2ITNA 1W84A 4EWHA 5JRQA 4L9IA 4ACDA 5FM2A 1PHKA 3L8VA 3DKCA 3DK7A 4UWBA 4O7TA 3F6XA 4IAAA 3B8QA 4O0RA 4RJ5A 4CFXA 3ZSGA 4QTEA 2G15A 3LMHA 3LE6A 1YHWA 5CNOA 5D12A 3UODA 1E1VA 2GHLA 4OTIA 1VR2A 1UVRA 3O50A 3TV7A 3A99A 5HX6A 1X8BA 2QI8A 4FICA 4MD8E 3FMNA 4HZSA 4RLKA 4G3EA 1NY3A 1ZLTA 3R2YA 4QMZA 4TYEA 3BLRA 2EVAA 4AFEA 3W0NA 3IOKA 4C34A 5CASA 4O4CA 5HNGA 5KX8A 4FMQA 5IH4A 2OF4A 1WBVA 4TYHA 2YCFA 3Q9ZA 4BCQA 4U97A 3OF0A 2CNUA 5L3AA 4X2NA 3RJCA 4WBOA 4JMQA 2WTIA 5BUJA 1G3NA 5CVHA 4XG4A 3CSVA 3IECA 1BMKA 3TIZA 2EU9A 3KRRA 4CFUA 4G3GA 2YWPA 4F0IA 5JN2A 3D5VA 4DH1A 1XBAA 3HRCA 3MFRA 4G6LA 5IG1A 4FJVA 2C5NA 2XNPA 2O3PA 4GH2A 2W06A 5ANIA 3DFCB 3W2PA 3PPJA 4RWIA 1YWNA 5A4CA 4ZZOA 4TNDA 5K0XA 4G34A 3KRLA 3HMPA 3O71A 2GDOA 1DAYA 2OF2A 4M12A 4ENYA 5JRSA 3T8OA 2PVHA 3ROCA 3UO6A 2BDFA 2ZB1A 4K77A 3UIUA 2Q0NA 1PYXA 3PWDA 4EQMA 2YDJA 3OTUA 3WE4A 4DFZE 4BDDA 3BHUA 4R77A 2J0IA 2VWYA 4LRJA 3TT0A