5EM8A

Egfr kinase domain with pyridone compound 13: 4-[(2-methoxyphenyl)amino]-~{n}-[4-(4-methylpiperazin-1-yl)phenyl]-2-oxidanylidene-1~{h}-pyridine-3-carboxamide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
323
structure length
303
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Pyridones as Highly Selective, Noncovalent Inhibitors of T790M Double Mutants of EGFR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 303
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5em8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5em8A01
1QPEA 2V5QA 2OZAB 5HO8A 5FXRA 3ZHPC 4BTMA 3UC3A 3GT8A 3KRRA 3UP2A 3P1AA 5M53A 4RWLA 5IQFA 3N51A 3BGZA 3IW7A 1P5EA 5IMXA 4UMPA 1Q3DA 2R9SA 4C3RA 3OP5A 2BR1A 3OUKA 1WMKA 3SV0A 3UE4A 5HO7A 4ANOA 2GNHA 2PZYA 3ODZX 4O82A 5FG8A 3CC6A 3VNTA 3R7VA 2P0CA 4Z7GA 4DG0E 1KWPA 2JFMA 3VUDA 2B0QA 2W1CA 2YZAA 4Y8DA 1XKKA 2C5OA 4RMZA 3OWPA 4ZS0A 4DT9A 2QHMA 3OT8A 3RAKA 1P2AA 5L2SA 2X7GA 3TZ9A 5DT3A 5I9YA 5K4JA 3UNJA 1EH4A 4P7EA 1I09A 3I7BA 4IZYA 1W82A 5CY3A 4F6SA 2ZOQA 4XMOA 4XG8A 2WO6A 3W2RA 5CANA 3GC8A 2Y4PA 2XKDA 4NWMA 4P90A 1CKJA 1GZOA 4BIBA 4L8MA 3HMIA 1WCCA 1YRPA 4O7VA 3NWWA 4FKGA 4IAZA 3VAPA 4YPSA 4D28A 5BVDA 2XKCA 3AC4A 3IK3A 5CXZA 3P79A 4RLKA 5IQDA 3KB7A 4CQGA 2HZIA 2C6TA 1QPJA 1BMKA 2KULA 3OCTA 3LFBA 3OWKA 3KF7A 5FLFA 4O7SA 3VRYA 1PXOA 3WF8A 2OXDA 3WYXA 4DEAA 4L01A 2ZDTA 1WZYA 3FYJX 3PXQA 3QTZA 2NRYA 4WRGA 3IW6A 3QCYA 5C27A 2YM3A 1OB3A 2WTKB 1JPAA 4EKLA 5BNJA 1V0OA 3BU6A 3QWKA 4Y83A 5CVFA 3ULZA 4BDIA 3A8XA 4DFZE 3U6HA 5AUUA 4RJ5A 3RK5A 3MFUA 4FIHA 4NK9A 5F94A 1J7LA 2WMTA 4N0SA 1MUOA 4EORA 3BRBA 5GZ9A 4A7CA 2FSTX 2JDRA 3HP5A 4JX7A 4QMLA 3V8TA 4RIWB 1MP8A 3BYUA 3PG1A 4UMQA 4UBAA 3RKBA 4XP3A 3KXMA 4YUQA 4LG4A 4TTHB 3LCTA 4PTCA 3EQIA 5DLSA 1OIQA 4AXAA 1ZYCA 3UOLA 3PRIA 5CF6A 2WAJA 3EN9A 2VWUA 5TF9A 1UU9A 2C3IB 4KB8A 5FBOA 3NX8A 1QPCA 3R8UA 4CFMA 1R0PA 3HV7A 5BUIA 2WIHA 3F5GA 3AMBA 3LJ1A 2OH0E 3R2YA 1YXVA 3ET7A 3QKLA 1WBOA 2VTPA 3BYOA 1SNUA 4IC8A 5E7RA 2X9EA 2C69A 4AW5A 4X6QC 3UOHA 2BKKA 3E3BX 1OIYA 3OVVA 4GKIA 4I41A 4HVSA 4CT2A 5IG1A 5M4FA 1A9UA 2I0EA 4FV2A 5LMBA 1J7UA 4YZ9A 4ZTHA 3W2OA 3E62A 4HNFA 4FZAB 4RFMA 3ALNA 5AP7A 3MN3A 4WNPA 1MQ4A 2WELA 3R9DA 4ZOGA 4FT7A 4K1BA 1UU8A 4HYHA 3C4EA 4BDHA 4YO6A 5GIPE 4JDKA 1YI3A 3CQUA 4BN1A 4FNYA 5GHVA 4DA5A 3ZMMA 4FK3A 3LLAA 3FQEA 2A0CX 5FQDC 3FLNC 1PXJA 4QYHA 1U46A 4D2PA 3MB7A 4FIFA 4CTCA 4W4VA 5A14A 1ZZ2A 4O2ZA 2OJFE 2UVXA 5K0KA 2PY3A 4L42A 3LFCA 3VQHA 2P3GX 4FOCA 1PXKA 2YERA 3RAHA 4TYIA 2W1FA 3RM7A 4YZNA 1PXMA 5AA9A 5LWMA 3ALOA 3FMMA 2R3OA 4BWKA 3OEFX 3AD5A 1J1CA 5IUGA 2OF2A 3LXKA 3ATSA 2PVHA 2XYUA 4EEVA 1OECA 3VULA 3V04A 4ASDA 3T9IA 4BZOA 4MYGA 3AC3A 4QMUA 1YDSE 4QPAA 5HKMA 4D4VA 4XCUA 4ZTLA 5IA4A 3DKCA 5A6NA 3TV7A 2ITPA 4IX3A 3VW6A 3MVMA 5DFPA 4JNWA 3DLSA 4ZJJA 3OY1A 5ACBC 1MRVA 1U5RA 2H9VA 4KWPA 1OL7A 4PL3A 2VWVA 4ZP5A 3MH2A 2YCSA 1GJOA 1Q8YA 4OR5A 5HTBA 3ORIA 5L2TA 1PMEA 4PTEA 3HRCA 5AUXA 3GU7A 3Q32A 4CRLA 5JQ8A 4EK5A 4YJTA 1JBPE 4QMPA 4MXXA 3GU4A 2E9NA 4D9UA 4F1TA 3KREA 3H9RA 3ZYAA 2B9IA 3DZQA 4EUTA 5EG3A 3UO5A 3KN6A 5FTOA 5HVYA 1APME 4OGRA 2GNGA 3OTVA 5D9HA 3SDJA 3I4BA 1XH7A 2F7EE 2ERZE 3AC2A 3ZEPA 5HIEA 2J0JA 4E5AX 3F9NA 3VHEA 5A6OA 5EYKA 3A60A 3QQHA 3PA3A 4LGGA 4F0GA 2HELA 1OIUA 3E64A 3S1HA 1GIJA 1XBCA 4YZMA 2ETRA 3EKNA 5KHWA 2BVAA 2X7FA 4O86A 2YCQA 4NFNA 2R3FA 5DA3A 1OL2A 2YCRA 3VUIA 3PIXA 4AG8A 4J53A 4IANA 2UZDA 4BI0A 4CLIA 5FEDA 2QD9A 2VO7A 4K11A 1QCFA 4MAOA 3POZA 3FLWA 4GEOA 3A7GA 4IFCA 2ONLC 4FNZA 2CKPA 1U4DA 4BCHA 4BHNA 4J52A 3F7WA 4I6QA 5DOSA 5EQEA 1OL5A 5CQWA 3HGKA 4E4MA 2IZRA 3D7TA 5CU0A 3Q2JA 4MNEA 5HCZA 2P2IA 4AT3A 2WMRA 4FT9A 2GS2A 3OOMA 4FL3A 5M55A 5KCVA 3F3UA 4AGCA 4YTIA 3ANQA 4G34A 3DV3A 3WI6A 4D2WA 3LKMA 2BIKB 2UW4A 4ALVA 5L2WA 2OZOA 3FC1X 4IX6A 4TWNA 3QCSA 4K2RA 4ZTQA 2FB8A 5C9CA 1NA7A 2QR8A 3NW5A 3EN4A 4XOZA 4M69B 2UW5A 2OJGA 3PIZA 4RFZA 3MY0A 4HJOA 4BGQA 1T46A 4KIQA 4AN9A 3FXZA 2CCIA 4Q5HA 3OBGA 2AYPA 3DGKA 3ZSHA 4LRKA 5CU3A 3A2CA 3GQLA 3V8SA 2WTCA 5C4LA 3BU5A 2Y4IC 2A19B 2OXXA 4IHPA 5HE3A 4A4OA 1LP4A 3WOWA 3PJCA 3WF6A 4C02A 3RM6A 5IQEA 1DAWA 4APPA 2V7OA 4N6YA 2Y9QA 4PPBA 4YGAA 3WIGA 3GENA 2ZYBA 3GNIB 5TT7A 3PY0A 3OCGA 3LFFA 4IVBA 4YZDA 1UNHA 2C68A 3KFAA 3ENMA 3PJ3A 5HG7A 4WNMA 1E9HA 4JRVA 2CN5A 3Q60A 3S0OA 3GOKA 5M08A 4QQCA 3MVJA 3H9OA 3NVKI 3VS1A 3TWJA 2C0OA 3OROA 3QBNA 3R71A 4AU8A 1Y6BA 2ITOA 4G3DA 2JBOA 3D94A 1H28A 1UA2A 2IW6A 4IZAA 2REIA 3PXFA 1AGWA 4XS2A 3UQFA 1WBWA 1ZY4A 2OO8X 3QQLA 4JG6A 3UDBA 3FXWA 5IEYA 3PYYA 4G5PA 4R3PA 3KXNA 4BR3A 2Q0BA 4C33A 4D55A 2XIZA 4DINA 1GOLA 4ANLA 4USEA 4TKSA 1DM2A 1ERKA 3QZFA 3FHIA 5AAEA 4HCVA 2Q0NA 1NVSA 5EQPA 4RIYA 3K5VA 2RL5A 3UOJA 5DYJA 4AZEA 3DZOA 3E93A 3UYSA 3NMUF 4RBLA 4M7IA 4BFMA 3LHJA 3ZZEA 4HGLA 3FZTA 4X2JA 3PPZA 3ZO4A 1XH8A 3OT3A 4O0WA 3MDYA 1I44A 5AAFA 3E8CA 2JDTA 3BLQA 2W1ZA 4QMWA 4YC3A 4BKYA 3G33A 3LOKA 4XOYA 3JXWA 2WMBA 3BEGA 2WQOA 4MXOA 4FV3A 1FMOE 3FAAA 4GCJA 2RG6A 3GC9A 5EH0A 5J9ZA 5LXMA 4O0XA 2PMIA 4Z9LA 4YNOA 1M2PA 5B2LA 1V0PA 4IMYA 4J7BA 4BKJA 3FZRA 4V0GB 5IUHA 1XBAA 3ZFMA 1Q4LA 2V62A 2X81A 4U6RA 5CVGA 5J9LA 2YIXA 3PSDA 2H8HA 4HYUA 5HQ0A 2RG5A 4FICA 4Y5HA 3MH3A 5HLWA 4FTRA 3W8QA 4C36A 2B9FA 4GT5A 3LM0A 2FYSA 4QTEA 4CFUA 5K4IA 1PKGA 4I5CA 4D58A 5IUIA 4DT8A 2JIIA 3WARA 4O27B 2R0UA 4RVMA 3ZRMA 2BZKB 2QG7A 2WMUA 5IA3A 2O3PA 2J4ZA 1W8CA 1YQJA 2XBAA 4ZK5A 2XS0A 1L3RE 2GU8A 4FSNA 5CTPA 1OL1A 3AC5A 5FXSA 4EI4A 3R7GA 4XJ0A 4PPCA 5L6OA 3CY2A 5TR6A 1XHAA 3B2WA 5AP5A 4RZWA 1H1WA 4J1RA 3WILA 3QQKA 4JDHA 3DAJA 2B53A 4S2ZA 5KZ0A 4DTKA 4I92A 2C3JA 1CKPA 4LMNA 4O6LA 5EW8A 5C03A 4YBKA 3ODYX 5AV1A 2ITUA 4A06A 3FQSA 4XG9A 3PFQA 3EFLA 3RPSA 1ZYJA 3ZONA 4IJ9A 3R1SA 4L3JA 2VTHA 1G5SA 4W4YA 5CYIA 1UNGA 3COIA 2WMQA 1O6KA 2B55A 4FZDB 4E93A 2EVAA 4OBPA 2W1HA 4BCGA 2WU7A 4BTFA 5EOLA 2CGUA 4G31A 4ID7A 2YAAA 2WTKC 4I4FA 1BI8A 3OBJA 4ZXTA 5CU4A 4JBPA 4RVKA 4TYGA 3UBDA 3GFWA 4GKHA 1JSUA 3WIKA 1FGKA 3HUBA 3WYYA 4AZFA 4UN0C 4QQ5A 5B2MA 4BGHA 3QYZA 4NW6A 3DBQA 1ZARA 1FPUA 3NRMA 4Q9SA 3ZLWA 3R9OA 3LCDA 5M07A 5BYZA 3RTPA 3OC1A 4ERWA 3LMGA 3H4JA 4FUYA 3O50A 2FUMA 2QONA 3Q53A 3DS6A 4FG7A 4FKJA 2PVJA 3JUHA 3SRVB 3K54A 2OIBA 2QCSA 4FZ6A 4PUZA 1QL6A 4O83A 3UQCA 5HCXA 4KINA 1QPDA 1E1XA 3CR0A 2CLQA 4FBXA 3TZ7A 1ZOHA 3RK7A 4XH6A 5LVLA 4O0YA 4CMOA 4IQ6A 1V0BA 1HCLA 3DU8A 2NP8A 4J96A 4RJ7A 4DG3E 1XH9A 2XK7A 4FTAA 4PX6A 4UY9A 5JZJA 4I21A 4GK2A 4TNDA 2WMSA 2YLEA 5HG5A 5HNBA 4OAUC 3QD3A 5BQ0A 4GG5A 2QQ7A 4FKRA 4DH5A 4CXAA 3OXIA 4PY1A 3ORXA 4I93A 4LQMA 1CM8A 2R3MA 4AWIA 4AA0A 3FMHA 4UWCA 3EMGA 4YJUA 3II5A 3QQUA 5AV0A 2R3GA 4CT1A 2CLXA 5KMNA 3PVWA 4UXLA 5DNRA 2Z02A 5HBHA 5FDPA 1SYKA 4FTUA 5JZNA 1H24A 4JL9A 1FVVA 3R7YA 3TCPA 4J8MA 2GHMA 5ANOA 1BYGA 4KA3A 3GCVA 1H1RA 3V5WA 4AOJA 3E8DA 5M44A 1GY3A 4CTBA 1YHWA 5J7HA 4EQUA 2G2FA 1HCKA 2QOIA 5HORA 3L1SA 3ORZA 2XVDA 5HO6A 5E92A 4R6VA 5JGAA 2YEXA 4DCEA 4FG8A 1OL6A 4G6LA 4FMQA 2W06A 4WKQA 3SW4A 2VTJA 2PUPA 2XNPA 3F5XA 4DN5A 4QMQA 3P5KA 4CKIA 2BROA 5HEZA 5GINE 5AFVA 5HTCA 4OLIA 2CHLA 4PTGA 5LMAA 5IH6A 5KMIA 2WPAA 4O1PA 4EHZA 2VTRA 4OTPA 4ANQA 4FSWA 2ITVA 3F5PA 4KBKA 3VHKA 4RWIA 2VGPA 3E5AA 3PSBA 3VQUA 4MXAA 2O5KA 2J9MA 3R00A 5IA0A 2VZ6A 4BCMA 2X7OA 3MYGA 4GJ3A 4D5HA 1Z57A 1BL6A 2RSVA 1WBTA 2YHVA 3KKVA 3BBWA 3EQRA 2IN6A 4PP9A 2XNNA 2OSCA 3V51A 4BDCA 5A4TA 4D4RA 2XZSA 1BL7A 1H8FA 3ZBFA 3HEGA 4R3CA 2J90A 4KAOA 3I6WA 5I9VA 5JT2A 2PMOX 2OBJA 3A8WA 5KE0A 4EYJA 1J1BA 4MK0A 4O7WA 2Z7RA 4XV9A 3VJOA 5A46A 3F3VA 4FE2A 3I60A 3AMYA 3QUPA 2R64A 3OTUA 4S31A 3RPOA 2XBJA 4O7YA 5HG9A 2BALA 2EXMA 2XYNA 2BDFA 2WTDA 4FNXA 3FUPA 3MIYA 1KE7A 4MCVA 3A7HA 3R63A 3SXRA 3GEQA 4QP3A 3H0YA 3NLBA 3BHYA 4TYHB 1CDKA 1K2PA 2BZIB 3I1AA 3PJ1A 3DJ7A 4MD9E 5CZHA 3Q4CA 2PE1A 3KCKA 2BPMA 2F7XE 2G01A 3EKKA 4TY1A 3EYGA 4PL4A 5JQ5A 4BY9E 2ZM4A 5IF1A 3M11A 4OBOA 3DA6A 3FLZA 4MWIA 2UW9A 2XK3A 4DFYA 2RFSA 4JBQA 2XKEA 4EJNA 2YDIA 4R77A 4IXPA 4O81A 4DFBA 1JWHA 3QUDA 5DHJA 4EBWA 3DY7A 2PVFA 4R7BA 1YW2A 1SM2A 2VTOA 4HCTA 3MJ2A 4MTAA 4ZTMA 1Q8WA 2F57A 2PPQA 2R5TA 3I6UA 1Q3WA 3D5VA 4BVUA 4FTNA 4GUBA 3NEWA 2UW8A 3F88A 3LQ8A 3SD0A 5M4UA 2E9UA 4P5QA 4EH2A 3ZXZA 4XLIA 4F7JA 3F3WA 3DKFA 5EKNA 3F82A 4DEBA 5A4QA 4LRMA 2WTVA 4YJNA 4EQCA 2DUVA 4TN6A 3LM5A 3TUCA 2C6OA 1NY3A 3GQIA 2ACXA 3L9LA 3R0TA 2CPKE 2DS1A 3OY3A 3QC4A 4U7ZA 4YURA 2BAJA 5I9UA 2EU9A 4I24A 4DTBA 4BTJA 4U0IA 2WOUA 3VS3A 3S00A 5TKDA 2AUHA 4AE9A 3Q9WA 4DBXA 3C4WA 3DXPA 5T6KA 4ITHA 3CSVA 3P23A 3SG8A 3UMWA 4KSQA 4E4XA 3OXZA 3JY9A 2C30A 3KMWA 4EH8A 4HVGA 3R01A 3R7UA 2QOLA 2PUNA 2JGZA 4MH7A 1H07A 3IQ7A 1IR3A 3AG9A 4QNAA 2C4GA 4J98A 4TW9A 4BI2A 3BCEA 2PZRA 5LMKA 4FC0A 4BCFA 4N6ZA 3R7OA 3R1NA 4KS7A 3ZC6A 2A2AA 3M1SA 4GYGA 4FGRA 5H2UA 4OAVB 4R1YA 5CU6A 1UWJA 5AP1A 3OG7A 4PDOA 5JRSA 2IW8A 3LFDA 3ZXTA 5K9IA 3C9WA 3O0GA 3EIDA 3HZTA 2HAKA 4M0YA 4W9XA 4WSQA 4FV5A 3ROCA 3VUKA 5JH6A 2HY0A 5L8KA 3PA5A 2JITA 5AR4A 1OKZA 3CE3A 5B2KA 2HY81 5LCKA 1YOLA 2ETMA 3C4FA 2W1IA 2FVDA 2O65A 2E9OA 4EK8A 4K18A 4CYJA 4HGTA 5D11A 3AD6A 4MD7E 2HZ0A 5HCYA 4K33A 2X9FA 5JFSA 3IGGA 2YLFA 3IONA 4BCQA 5TE0A 2QODA 2V55A 4S32A 4GVAA 3LFAA 3V3VA 4XX9A 4UZDA 1Q61A 3BQCA 3C1XA 3N4TA 3FY2A 3L9MA 4NKAA 3ORNA 3EHAA 5AP3A 2PVMA 4IEBA 4NCTA 4O0VA 4RSSA 3VN9A 2EXEA 4MD8E 5EW3A 4D2TA 4DEIA 3G9NA 3QFVA 4JS8A 1O6LA 3EQPA 1VYZA 2VO6A 2EUFB 1IASA 3O51A 4XLVA 1LUFA 2PWLA 4RT7A 4C4GA 1JSTA 4G3GA 2C6KA 4R5YA 1P4FA 3NYVA 5FEEA 3VUMA 1U54B 3GU6A 3ORPA 4X3FA 4E5WA 5J9YA 5EHYA 3O8PA 5GJGA 1SZMA 3PPJA 2JLDA 5ITAA 3LW0A 4KUJA 4U79A 3LLTA 3W2SA 3HNGA 3QQJA 4Y72A 4I1ZA 4XG4A 1OZ1A 2WQEA 3ENHA 4AA5A 3PWDA 5HOAA 1YOJA 2C1AA 2CDZA 1TKIA 3IG7A 5KMOA 4BIEA 5KMMA 1H00A 1NT2A 4U9AA 5C4KA 3D9VA 4GW8A 4TPTA 3FKOA 5D7AA 4XG6A 4CV9A 1IAHA 4ZZMA 5FXQA 2EXCX 2VD5A 5AIKA 3ZSGA 3ZUTA 1G8SA 2B52A 3Q52A 4RJ3A 4EYMA 3Q2MA 5K5NA 1YHSA 2HWPA 5M4IA 1OVEA 3G9LX 3HRBA 4QYYA 3VBXA 3G5DA 5IH5A 3FLSA 4A9RA 4E6AA 5JFWA 4BYJA 2E9PA 4X6RA 3P08A 3FEGA 5AUTA 3BLRA 5ETAA 3S95A 5I3RA 4PF4A 1PXPA 2YACA 4FV8A 4K0YA 5LVMA 4ANSA 3G0FA 2UZOA 2HIWA 3EFKA 3QLFA 3UIXA 4USFA 5H8GA 1UVRA 2VRXA 5J5SA 4ZMEA 4QRCA 4FV7A 4WUAA 3VUGA 4BZNA 2GPHA 3TI1A 2PL0A 1JAMA 4EOOA 2CKEA 2C5NA 3IPHA 5CQUA 3W8LA 2IVVA 4NH1A 1PKDA 3O71A 3VS7A 1XR1A 2XEZA 3GXLA 2X8DA 3RNIA 4A9UA 3G0EA 4NUSA 1KSWA 3FDNA 1JNKA 1Q24A 4F6WA 5LWNA 2XF0A 2WKMA 4XP0A 3OCSA 2RIOA 4LYNA 4YPDA 4AAAA 3FI3A 3U4WA 2YM5A 4HNIA 5IKWA 2HK5A 4FSQA 4E6QA 4FF8A 4APCA 2QO9A 5BPYA 3UZRA 1Y91A 2I0YA 3W33A 3TT0A 4BZDA 5I9XA 2NRUA 2JDVA 3QZIA 4RWKA 4FSTA 2YISA 3O96A 4OT6A 4BIDA 2I7QA 1B38A 3G6GA 5EDQA 4MBLA 3OHTA 4F1MA 3FZPA 2G15A 1LEWA 4EHEA 4NL0A 1TQMA 2OLCA 2OKRA 4DFUA 3C4ZA 3P4KA 4X2KA 3GCQA 3MH1A 4LI5A 1F5QA 2ZM1A 1KOBA 3HAMA 4E5BA 5AIRA 3QTSA 1XH6A 2GDOA 5IDPA 1TQPA 2CSNA 1GZNA 4C59A 2W4OA 4NU1A 4RPVA 2JDSA 3D0EA 4CCUA 1UWHA 4RZVA 2J0MB 3PXYA 3CLYA 4IB3A 1KV1A 2GQGA 3E7VA 3EWHA 4ZIMA 4H05A 2WQMA 4EOSA 4E4LA 3O8TA 1Q99A 3P78A 2Z60A 2QOQA 3FL4A 3LE6A 3EQBA 4CCBA 3QX4A 3D4QA 1BUHA 2Z8CA 4QQTA 3COHA 4KIPA 3MIAA 3WF5A 1NVQA 1ZLTA 1W0XC 4YSMA 5M57A 4U81A 3MSSA 4FIJA 4ZJIA 4QPMA 4WT6A 5CF4A 4FTQA 4ASEA 5HVKA 1H26A 3EL8A 4EJ7A 2PE2A 3ZS5A 4BDJA 1UV5A 2BZJA 4DHFA 4D1ZA 1R78A 3BE2A 1IAJA 2ZV2A 2I0HA 2RF9A 4ZLOA 3PVBA 4EOQA 2H34A 5BMSA 2PVKA 1R0EA 3DBCA 3RHKA 3EQHA 4M14A 2J5FA 2XK8A 1V1KA 2PMLX 4NJ3A 5C8MA 4D9TA 4UMRA 5AX3A 3P7AA 3V01A 5BYLA 2QI8A 3CCNA 5F20A 3KQ7A 1Q62A 3CD8A 4U5JA 5FEQA 3TKUA 3NW7A 4MKCA 5DIAA 2JAVA 2XUUA 1AQ1A 4OTFA 5ANGA 4F70A 4QT1A 1U59A 5EDPA 4E73A 1GAGA 4YC8A 4BRXA 4IWDA 4IE9A 4ACDA 3GFEA 5LARA 1NVRA 5AP2A 4EH5A 3NNVA 3FLQA 4EH6A 4DGMA 3SHEA 3OW3A 2JAMA 4LUEA 4D1XA 4DAWA 3ERKA 3Q96A 4I0RA 3IW5A 5AEPA 3C51A 3RALA 4LL0A 3DT1A 3Q9YA 2QR7A 3LPBA 3LFQA 3QKKA 5E90A 4L6QA 4GMYA 4RWJA 5DT0A 4F9YA 1STCE 5AAGA 5L4QA 3V5TA 2BCJA 4B6LA 5LVPA 3QGWA 3KVXA 3QXPA 4IWPA 3PJ8A 4MQ2A 3I5NA 4UXQA 4RLLA 5CEMA 5K0XA 2X39A 4IDTA 3MA6A 3R7EA 3TDWA 2R3HA 4F7LA 3P7CA 3OWLA 2C5VA 3CXWA 1BLXA 1RQQA 2FSOX 2NPQA 3A4OX 4K8AA 4EC9A 3TKIA 4F65A 4ZTSA 5ANDA 1S9IA 3NZ0A 4FKSA 4DFXE 2BTSA 2J7TA 3DAKA 2GFSA 2W5AA 4YHJA 4F4PA 4J97A 4JRNA 4L7SA 2X2MA 2BFYA 3VRZA 2WTJA 4CGAA 3ZOSA 4FTLA 4L67A 4BGGA 1OMWA 4FR4A 5CAQA 4XHKB 3TJCA 2IJMA 5DRBA 3GI3A 4PMSA 1IA8A 4JQ8A 4FEWA 3QQGA 4KSPA 5CNNA 3VF8A 3LCOA 2QURA 3C5UA 2XKFA 3MFTA 5GJDA 4MQ1A 2C6EA 2VN9A 3RHXA 5JRQA 2DYLA 2IVTA 3VBYA 5B0XA 4ZJVA 4M67A 2O8YA 3UQGA 4S33A 4RVTA 4HZRA 4I5PA 2EB2A 4JVGA 4ENYA 3FMKA 3FY0A 2B9HA 4YBJA 5EHLA 4EK6A 4RJ6A 5AR8A 3TNPC 3DCVA 4AS0A 4EQMA 3DJ5A 1OI9A 3BQRA 3EJ1A 4ALWA 3L9PA 2WFYA 2C6MA 1JKKA 2IZTA 3AC1A 4EH4A 4I22A 4LOOA 4CFXA 2J0IA 2VO0A 5EKOA 2Y8OA 4CFFA 3PWYA 4PMPA 4R78A 2B9JA 3QTXA 4O2PA 2WGJA 4UEUA 4ZTRA 4BCPA 4EK4A 4NZWB 4B9DA 3D7TB 4KABA 3D5XA 3NCGA 4FUXA 4MNEB 3LJ2A 2HOGA 2OXYA 2X6EA 3UPZA 1ZMWA 2JDOA 3NW6A 4DEEA 3JVRA 3TG1A 2VWIA 4L3LA 4E26A 1PYEA 3KXHA 3HA8A 3LXNA 4KKEA 5CF8A 1M2RA 4O7RA 3EFJA 2WXVA 2ZMDA 3AT3A 4H36A 4IAKA 2QOCA 3TTJA 4LOQA 2JIVA 4B99A 4MX9A 1SVHA 4M8TA 4HYIA 4N4SA 2EWAA 3NSZA 2R3RA 1CMKE 3COKA 3KY2A 4D1SA 5IQHA 4O96A 5CSHA 3RCDA 3QD2B 5DR9A 4QP8A 4IAAA 4RX9A 2QLUA 3WBLA 5FTQA 4FIIA 4QMNA 4AOTA 2QOKA 3U8WA 4CFWA 1XJDA 3I0QA 4XG7A 4FV0A 3LFSA 2ESMA 5GNKA 5IU2A 4LOPA 4QO9A 1Q97A 1RE8A 3TZ8A 2GS7A 4O22A 4NTSA 3TIYA 5DR2A 4F9AA 3FL5A 4I0SA 4F7SA 2F49A 4S30A 3DBFA 2HZ4A 3QRJA 3SOCA 3AC8A 5F1ZA 4DLIA 1R3CA 2YM7A 3DXNA 5FP6A 3HX4A 4F0FA 5AR7A 3QD0A 4W4WA 2G1TA 3RZBA 4EONA 5ANEA 3UVPA 4KKHA 2WTIA 1BX6A 2XP2A 3FYKX 2ITNA 3EQDA 4JIKA 5AR3A 3TNIA 4CQEA 3MA3A 2IVUA 2OFUA 2C1BA 3K3JA 4YJSA 4HW7A 4HVDA 2IO6A 5M06A 4H3QA 4ZSAA 2W5BA 3JPVA 4QP2A 4CG8A 5DRDA 1PMVA 1VZOA 3QYWA 3Q9ZA 2C6IA 3U51A 2W17A 3MPTA 2WQBA 3R8LA 4C58A 3A7IA 4I5MA 4D2SA 5LMKC 2FSLX 2QG5A 3FMNA 4KBAA 3UG1A 4ZMFA 3OW4A 1JVPP 4AGWA 1F0QA 2HENA 4RIYB 4B0GA 2LAVA 5KMLA 2X8IA 4FVQA 2A1AB 3ZLSA 2RGPA 4ZAUA 3WZUA 4ZEGA 2OJIA 4OTHA 1O9UA 1ATPE 3DFAA 3MY1A 5JGDA 3QRTA 5KO1A 3NVMB 3L8SA 2QHNA 4LRJA 3QHRA 4YC6A 2BRMA 5EYMA 4KNBA 3RCJA 3C5IA 3GBZA 2BFXA 2F2UA 2IZUA 5EW9A 4XEYA 2W7XA 5DI1A 2YCFA 2PTKA 4KBCA 2R7BA 1X8BA 4FTMA 4MHAA 3W10A 2ITTA 3MVHA 1W83A 3UOKA 2XMYA 2C6DA 5KHXA 4I6HA 3VBWA 5FRIA 4K77A 2X2LA 2ZM3A 2QNJA 5IA5A 3RP9A 2CMWA 3IDPA 3DNEA 3T9TA 2BRNA 3RPYA 4DLJA 3DOGA 5EHOA 3I0OA 2OGVA 2W4JA 3O2MA 2WMWA 4XUFA 4BCIA 1R39A 4QOXA 4YJRA 4R1VA 3IW8A 4U43A 4PV0A 5I3OA 4G9CA 5H9BA 2OK1A 3C7QA 3SOAA 5ICPA 1JSVA 4G16A 3R83A 4TRLA 2JKKA 3H3CA 5J1WA 3BHHA 4GS6A 4X3FC 4YZBA 3Q3BA 2UZNA 5AADA 4ENXA 2VNWA 2W9ZB 3UZPA 1IA9A 4I6BA 4ZY5A 4A9YA 3HECA 3L8VA 1CSNA 4P5ZA 4FKPA 4ASZA 4BWPA 3MPAA 5AWMA 4AUAA 2BUJA 3C0IA 5I4NA 3HV5A 3NAXA 3CTJA 4RIXA 3KXXA 3LZBA 2Z7SA 4QP1A 3R30A 4RX7A 4TXCA 4ZY4A 3W55A 4EH7A 4YTHA 3ORKA 2WQNA 1ZOGA 5HE0A 4QMZA 4AW2A 3BELA 2R3LA 4AX8A 3KA0A 4FX3A 4IB0A 4MBJA 5FBNC 4EWQA 1OUYA 4IWOA 3ZRKA 3QXOA 4IB1A 2R3KA 3OEZA 3VS4A 4XRLA 1DAYA 1HOWA 2JC6A 4IM2A 5LCJA 1M17A 2B7AA 4WBOA 4TL0A 1M7QA 4GUEA 4FNWA 4I6FA 3CPBA 4ACGA 4DH3A 4CKRA 4YSJA 5EOBA 4DH8A 3GCUA 2BDWA 3O7LB 4F63A 3NYOA 4CVAA 2G9XA 3TZMA 3RINA 4RVLA 3MGYA 2YIYA 3O8UA 4FZFB 3BHUA 1PXIA 5JMSA 3LJ0A 1M52A 2OWBA 4C38A 4DC2A 4DGOA 5DGZA 3ROYA 5CAPA 4DF3A 2GS6A 3NAYA 4PDYA 4Z55A 1MRYA 4F08A 3QTQA 1Y57A 5DWRA 1OKYA 1PY5A 2YM6A 3DK6A 2ZB0A 4BDAA 5KBQA 3QRKA 5BVOA 1OIRA 1KOAA 2A4LA 4CLJA 1H0WA 2UZWE 1DI9A 3V6SA 5AV4A 5CAUA 2QVSE 2JEDA 4PRJA 5FTGA 3ZO2A 2PK9A 3BLHA 4Q2AA 4TYEA 3DJ6A 4AN3A 4NJDA 5E8YA 4FT3A 4BB4A 4II5A 3V5LA 2XJ1A 3DKGA 4YJQA 4FT0A 3R8ZA 5E8WA 3QRUA 1W7HA 4ZSEA 5IA2A 1XH5A 1DS5A 3CEKA 3GVUA 3QQFA 4L3PA 3UTOA 2FSMX 5EM6A 2UVZA 5AM6A 4E6CA 4GT3A 3IKAA 1XO2B 3MVLA 4FV9A 4H1MA 2V0DA 3D14A 5HD7A 3RNYA 4EOPA 4FTIA 2VWXA 2W0JA 5C26A 3CS9A 3MS9A 4FSUA 3NCZA 1PMUA 4OTWA 2HW7A 5EDRA 5HIDA 4XNEA 4AF3A 4G1WA 4FSRA 4AFEA 2WEVA 5ANIA 4CG9A 3K5UA 4CMTA 3DQXA 3MH0A 1Z5MA 3RVGA 3ORMA 1F3MC 1YKRA 1OKVA 4IVDA 3ZO1A 4FKIA 3PE2A 4BKZA 3PSCA 2RFEA 2P55A 1KE8A 3P7BA 4TT7A 5E8XA 4PDSA 2PSQA 3HMNA 3MV5A 4KS8A 4X0MA 5A4EA 1LEZA 3IDCA 3Q4ZA 3PJ2A 3PXRA 4IX5A 2YJRA 2G2HA 3OUNB 3GU5A 4L68A 5CAVA 5GIOE 5CT0A 2J2IB 2F7ZE 2ONLA 3K3IA 4GVJA 4QP7A 5EK7A 5FDXA 5AV3A 4LL5A 3WF7A 4JOAA 1PXNA 2X4FA 5HE2A 3EFWA 5C1QB 3NDMA 2F9GA 2WD1A 2X1NA 1REKA 4JXFA 4D2RA 5I9ZA 4EKKA 5T68A 2OW3A 4ACMA 5A9UA 2BIYA 3RAWA 2PULA 4G3FA 3QD4A 3HYHA 5J1VA 5M56A 4YJVA 5JK3A 1NXKA 3ANRA 3P0MA 2DWBA 5IZFA 3T3UA 4QYGA 4OTIA 1GZ8A 2AC3A 3MBLA 3LCSA 3BKBA 1H0VA 1PMNA 3CKWA 3PPKA 3R04A 5M51A 4C4HA 3THBA 3REPA 4G3CA 5E8VA 3WZEA 5IEXA 4JDIA 2BHHA 2WMVA 4PWNA 4EOLA 3ZBXA 5EYCA 4GFMA 5LOHA 4C3FA 4WG4A 3QTIA 3ZRLA 3FPMA 2O0UA 3DAEA 4WRSA 4FYOA 3NPCA 4NFMA 3BHVA 4FKLA 4LMUA 4ZSJA 4BDKA 3F61A 3KULA 4TYJA 5DE2A 2UZUE 2XK9A 4E1ZA 3F3TA 1J7IA 3SLSA 4CD0A 5EFQA 2O63A 2XJ0A 3MFRA 4PNIA 5E1SA 4C4FA 1IEPA 2YIWA 4JLCA 2E9VA 3IOKA 2P2HA 4FSZA 2XH5A 4ZZOA 2X6DA 3UG2A 5IISA 4YLLA 4AGDA 4F09A 4U45A 3UIMA 3CJGA 3TN8A 5DPVA 2R7IA 2VTQA 1NW1A 2H6DA 2OFVA 3RI1A 3C50A 4O91A 4ZSLA 3C4CA 4MXCA 1H01A 1UKHA 3ACJA 3I79A 3PP0A 5BVWA 2QO2A 4BDBA 5J87A 3TUDA 5HG8A 5EM8A 4IADA 2WU6A 3FSKA 2PUUA 3ORTA 5J95A 5DT4A 5IMEA 3TDVA 3TNWA 4DE4A 1ZOEA 1XH4A 3RK9A 3SC1A 4X2NA 5CX9A 5TOZA 3KK8A 4AQCA 2ETKA 5HVJA 4CFNA 3R28A 3UC4A 4XV1A 4CZTA 4JQ7A 2ITYA 5CSPA 2XRUA 1YWNA 2J5EA 3HRFA 3K2LA 3LAUA 5J7BA 2C3KA 2CNUA 4RQKA 4QPSA 1VR2A 3ZSIA 2V7AA 4MVFA 3FBVA 1MQBA 3FI2A 4Y95A 3ZH8A 4DYMA 4D5KA 3DDQA 4XRJA 3DB8A 5KZIA 4BDDA 2X8EA 1FINA 2ITQA 4GK3A 4FA2A 4U3ZA 3E92A 1JKLA 3AGMA 2IW9A 5HX6A 5LQFA 2J0LA 2BTRA 3VBVA 4DITA 2XIKA 3MB6A 2P4IA 2UV2A 3BV3A 3F3ZA 5E1EA 3HV3A 2BDJA 4WBBB 5K3YA 1REJA 2WMAA 3F66A 5BVNA 3OWJA 4S34A 5KMKA 4ZS4A 1JOWB 1OITA 3DKOA 4O38A 2IPXA 2QU6A 5FM3A 3QTRA 4EWHA 3TNQB 5HBEA 4L46A 2ZB1A 2OZAA 3FZSA 5CSXA 3F2RA 5KUPA 3VW8A 4KRCA 4EBVA 3FLYA 4FL1A 5J79A 4QP9A 3BI6A 4U80A 5HNGA 3AQVA 5CASA 3ZFYA 3S2PA 3MJ1A 4PP7A 5KKRB 2BRHA 2X0GA 3QKMA 4GK4A 5GZAA 4LUDA 4QMYA 1OM1A 1VJYA 1WVXA 4ACHA 3CJFA 3KK9A 2W5HA 2HZNA 3FPQA 5CEQA 4AGUA 4BF2A 5IEVA 3NNXA 4YHTA 1TVOA 5BUEA 3R2BA 4I20A 3V6RA 3RPRA 2OF4A 3EN7A 1YOMA 2OG8A 1E1VA 3CY3A 3EH9A 4U44A 4C35A 5BUJA 3DBEA 4R3RA 4F9WA 5ACKA 4RC3A 5DH3A 3FSFA 2BILB 1JKTA 5FUTA 2YWVA 4FKUA 3B8QA 4M13A 2QKRA 5DVRA 3NIZA 1UNLA 1H25A 2UW6A 4FSYA 4H3PA 4IJPA 1ZYSA 4O0RA 5L2QA 3RMFA 1KE9A 1Z9XA 2YIRA 4ACCA 4QTCA 4ZZNA 4XYFA 4C61A 1SVEA 5T3QA 4PL5A 4AW0A 5D1JA 3RBWA 5AUYA 3OZ6A 4BI1A 4G17A 1YI6A 3QALE 5AV2A 2FH9A 2HXLA 4F0IA 4IB5A 4DFNA 4K9YA 3KL8A 3CKXA 3Q9XA 4H1JA 2HWOA 1XQZA 3F2NA 1B6CB 2JKMA 4BCNA 1OGUA 3GOPA 3ACKA 4WA9A 1T45A 3DK7A 3BV2A 3LVPA 3SX9A 4QQJA 3W2QA 4MF0A 5E91A 4F9CA 5KMJA 1DI8A 1BI7A 4RA5A 2YDKA 4E20A 4RIOA 5CZIA 3HKOA 4XBRA 2QOFA 3O7LD 3OF0A 3SQQA 4NTTA 2QU5A 4X3FB 3R8VA 3HUCA 3E3PA 3OXTA 4H3BA 4L7FA 2UZLA 3BU3A 4RIWA 4TWCA 4UWYA 4WD5A 4CSVA 5L2IA 2GQRA 5IQBA 3A7FA 4YZCA 1FBNA 4HVHA 5LVNA 2AC5A 5FWKK 2RKUA 4FTKA 1H27A 4I5HA 4XG3A 4KRDA 2XCHA 5EM5A 5JFVA 3EB0A 5JEBA 4U97A 2UZVA 4BL1A 3NNWA 3E8NA 2GFCA 4UB7A 1KV2A 3V8WA 3MY5A 3R1QA 1WBSA 4G6NA 2YA9A 3OD6X 3JS2A 4IH8A 3RPVA 3IS5A 4PDPA 4HPTE 4W9WA 3CTQA 3G2FA 3QA0A 2R4BA 5CVHA 4DBNA 1UU7A 3EZRA 2W1EA 3FMEA 2O64A 4QP4A 3TTIA 1M14A 4WOVA 5ANJA 3PLAE 4BDEA 3FMDA 2IZSA 3HL7A 4GL9A 1FGIA 2VWWA 4RFYA 4A9TA 4H39A 3A61A 4EH3A 2Y7JA 3FKNA 3KCFA 5L3AA 3LQ5A 5B7VA 2BMCA 5AP4A 4CV8A 5HLNA 3I7CA 3JR1A 3Q5ZA 3NNUA 4OW8A 3BX5A 4IIRA 5ETCA 3LFEA 4TZRA 5AMNA 5JGBA 1R1WA 1KUTA 4GSBA 2WTWA 4GFOA 3VUHA 4IAIA 1ZYLA 4C0TA 1CTPE 3A62A 5JKGA 4GV1A 2QLQA 3PUPA 4CFVA 3CTHA 3G51A 2XNGA 4HYSA 3SA0A 1SNXA 4LV5A 1JLUE 3TV6A 5LVOA 4UYAA 2GMXA 3D7ZA 5CALA 3DPKA 4DEGA 1H1PA 1OUKA 5A3XA 5AP6A 1RDQE 4HPUE 4QTDA 4NM0A 1Q8TA 3WE8A 2CCHA 4LGHA 4LGDA 4ARKA 3C0GA 1CKIA 4EUUA 2XM8A 5CXHA 4QD6A 2ZDUA 3Q5IA 4YO4A 3WZKA 3C0HA 2CGXA 3BEAA 4HZSA 4UYNA 4I0TA 4I3ZA 4D0XA 4NM7A 4BBMA 4PNKA 5IH4A 4B8MA 5CWZA 3T3VA 1BKXA 3O23A 2UZEA 3QLGA 4V04A 4B8LA 4F99A 1WBPA 3NUYA 4AA4A 2FA2A 4ANBA 5EI8A 4F64A 2G2IA 3PLSA 3SGCA 3GCSA 4JR7A 5GZ8A 4FVRA 3ZUVA 4A4XA 3OS3A 2YM8A 2BKZA 2I1MA 5C01A 4AFJA 4CZUA 4BYIA 3M2WA 4D2VA 1PF8A 5CENA 4RG0A 4GU6A 2PUIA 4PMTA 4QMVA 2W96B 3ZC5A 1ZXEA 2GCDA 3O17A 2GNIA 2YITA 2E2BA 4IZ7A 1ZRZA 2Z2WA 4ZSGA 4DGLC 4HOKA 5D12A 2OJJA 4YR8A 3VS2A 3RZFA 2C5YA 3R9NA 5IA1A 3CD3A 1WBNA 4L52A 4RX8A 4CKJA 1Y8GA 2IWIA 4WHZA 4LFIA 4GT4A 4U3YA 2PVLA 3EQGA 4NIFA 2Y6MA 5AUVA 2C47A 4C4JA 5HU3A 2A27A 1OKWA 2OIDA 2NO3A 3QU0A 3EN5A 4QTBA 3VBQA 3FQHA 4UMUA 3LMHA 5IQAA 3ZU7A 3R8PA 2BRGA 2VTMA 3MPMA 4KD1A 3MI9A 3SW7A 5H3QA 3HV6A 4Y5QA 4MXYA 3GU8A 5AJQA 2OJ9A 3OFMA 3PA4A 3R22A 4HGEA 2WOTA 2CKOA 2JFLA 3V5PA 1GNGA 2XIYA 3BE9A 5E8SA 5BMMA 5CI7A 1FMKA 4DGNA 3KRXA 2XK4A 3BHTA 3ITZA 4O7LA 1YWRA 3CBLA 1PW2A 4M0ZA 3HDMA 4K6ZA 2VV9A 4FV1A 4O7ZA 3W1FA 2QOOA 4L9IA 4DEHA 3KMUA 4W8EA 4JQEA 4QMXA 2W1GA 4JG8A 1OPLA 3W18A 4QMOA 2C0IA 4RJ8A 4AT5A 4C7TA 4JBVA 5JFXA 4C3PA 5HTIA 3HVCA 3F2AA 4NIFB 3QX2A 4FG9A 2YWPA 3ZZWA 3QL8A 2VGOA 4WO5A 4LM5A 4U42A 4PPAA 2HXQA 2J50A 4M69A 5HLPA 2OU7A 3E87A 4XV3A 5GJFA 4UV0A 2X2KA 3TUBA 4D0WA 2J0KA 4QYEA 5D10A 2B4SB 1Q5KA 1S9JA 3QC9A 3TXOA 5BVEA 5LJJA 2NNWB 4XG2A 5EI6A 3UO6A 3DQWA 5HE1A 3Q6UA 2ZV7A 4J99A 4L44A 1PYXA 2VTLA 3HMPA 3R02A 4ITIA 4RC2A 2R2PA 2WIPA 3IO7A 2XIRA 3FWQA 3AOXA 3IDBA 4R7IA 1A06A 4RRVA 5CSVA 5FM2A 4FTCA 5E9EA 4R7HA 3T8OA 4C4IA 5CEOA 4KIKA 5J8IA 3QCQA 1VYWA 4HCUA 2YJSA 3BGQA 5CI6A 1YVJA 1PHKA 4A9SA 2UZTA 4QMTA 4WSYA 4U40A 4JT3A 2YDJA 4F6UA 5EYDA 2XNOA 2XJ2A 4EHGA 1AD5A 4A4LA 5CAOA 5I0BA 3UIBA 1ZMVA 3ZLXA 3B2TA 2GNLA 4OT5A 3F69A 4B4LA 3R8MA 3TNHA 2VTNA 4C4EA 3ULIA 5KNJA 4IDVA 2VTIA 1H4LA 5L6WL 2XEYA 2KTYA 1ZAOA 2FO0A 3BIZA 3CGOA 4V01A 5HIBA 5I9WA 3D83A 5AP0A 2VTAA 4RGJA 4EHVA 2UW0A 2IVSA 1Q8UA 5F4NA 4YLJA 5CLPA 5D7VA 4G5JA 2GHLA 3UGCA 2SRCA 3GC0A 3BYMA 3VS6A 4DH7A 1RW8A 2BHEA 3EN6A 3UO4A 1OPKA 2JKOA 3DTCA 3UVQA 2IG7A 5BX0A 3CIKA 3UJGA 3EQCA 4GG7A 4TWPA 3UIUA 3HDNA 4XP2A 4FKWA 5L6PA 1U5QA 4B7TA 2J51A 4BICA 3S4QA 3EQFA 4EK3A 4KIKB 4O0UA 5JSMA 5AX9A 3VC4A 3UNZA 3HMOA 3ELJA 4WIHA 3N4UA 1IG1A 1URWA 4IZ5A 3KF4A 4L00A 2VNYA 3ZEWA 3WZDA 3UNKA 4RJ4A 3NYXA 4ZY6A 3BGPA 2VAGA 4QMSA 4YTCA 4FYNA 2XNBA 3E8EA 4X21A 3H9FA 4EOKA 1FQ1B 2YFXA 5CU2A 3VIDA 4U8ZA 4UWBA 5K5XA 2GTNA 3QTWA 3KRLA 3TKHA 5DEYA 2PE0A 5F9EA 1PXLA 5IPJA 3HV4A 2ZVAA 4O0SA 1SVGA 2C0TA 4G9RA 5CF5A 4FT5A 1KE5A 2ERKA 5HD4A 4V0GA 2Z7QA 3FE3A 4I23A 4Y46A 5DMZA 4W4XA 3PDTA 2PZ5A 2GSFA 3UODA 3VF9A 3NUXA 3ZDUA 5HESA 3HAVA 3U55A 3VJNA 2WNTA 4ONAA 5KKRC 5IQCA 2YABA 3MTFA 1QMZA 2WZJA 3U6IA 4BDGA 3DB6A 5DN3A 2V22A 1Y6AA 1YXUA 4NW5A 3ETAA 3S3IA 3UYTA 4AZTA 3ZM9A 3U6JA 2ITZA 2J6MA 1YDRE 4GJ2A 4C62A 2F2CB 4V05A 5G1XA 4C34A 1FVTA 4GU9A 4IFGA 4M84A 3NYNA 3E88A 4YU2A 2QO7A 2EB3A 2W1DA 4FEVA 4P2KA 4O7TA 3PVGA 4U41A 5IDNA 5E4HA 5BYYA 5HX8A 4C8BA 4IBMA 4CMUA 1H08A 3CPCA 4M97A 2VWZA 3JVSA 3OMVA 3MW1A 3HMMA 3WF9A 3SVVA 2QC6A 4FIGA 3BWFA 3KRJA 1LPUA 2PVRA 4WG5A 4CRSA 3UVRA 3Q4UA 4JBOA 4FKVA 3D15A 1L8TA 2XK6A 4Q5EA 2B1PA 1IRKA 3D2IA 2OH4A 3BYSA 4GYIA 1MRUA 4C57A 4GRBA 3ZO3A 4FTJA 2WMXA 3ZCLA 5JN2A 2UW3A 3AGLA 3LFNA 1A48A 3VVHA 2XA4A 3FMJA 4JX3A 5AM7A 1P4OA 3PP1A 4EC8A 4YP8A 3KC3A 3TACA 3TEIA 3N4VA 3R6XA 3FC2A 3RGFA 2CN8A 2XIXA 4NCTC 3UZTA 4ZLYA 2P33A 4Q9ZA 5CEKA 1JKSA 1W84A 4CZYB 3L8XA 4FEXA 4CEGA 3R9HA 3MTLA 1XWSA 1RJBA 1WVWA 2UZBA 3QAME 3UMXA 4AW1A 4ERKA 5I5ZA 5HHWA 4I4EA 3D2KA 5FD2A 5BVFA 4FEQA 3OOGA 4FODA 5A4LA 2CGWA 3NUAA 4AT4A 4CYIA 3RAIA 3FHRA 4PQNA 3C4XA 3F6XA 3PRFA 3ZTXA 2ZAZA 4BDFA 4ASXA 1H1SA 4Y85A 4IACA 1YHVA 4ALUA 4QMMA 3SRVA 4GH2A 4JG7A 4DTAA 4NSTA 2R3QA 4DFLA 4R5SA 5A54A 3A4PA 2QOBA 4DG2E 4E6DA 4OTGA 3KXZA 3R73A 2I6LA 5AUZA 5L8JA 4UMTA 3GC7A 3VBTA 4AN2A 3ZLYA 5C8NA 2XNMA 4XBUA 3IW4A 4D4YA 3TJDA 3L8PA 1GZKA 3W16A 1YXSA 4OBQA 4HGSA 5DBXA 4IM3A 2R0IA 3IOPA 4Z3VA 3MESA 3FV8A 4O0TA 4O7NA 3BWJA 1PJKA 3JYAA 4FIEA 4FGBA 3D5WA 4FK6A 4R8QA 4IX4A 3M42A 4YJPA 3ZUUA 4AOIA 4QNYA 2GQSA 5HBJA 3AD4A 5AR5A 3U87A 2VTTA 3TL8A 5M09A 5D41A 1Q8ZA 4AZSA 3KEXA 3PE1A 3D5UA 3U54A 1WAKA 4RC4A 4G3EA 4IAFA 2JBPA 3A7JA 4YTFA 4D4SA 3NGAA 2ZJWA 3SXFA 3A99A 3V5QA 2YAKA 3KVWA 2YN8A 3GCPA 3BYVA 3PY1A 4M68A 4AZWA 2W9FB 2BRBA 4WG3A 4RIXB 4E8AA 1J3HA 4TWOA 4MWHA 4ANNA 5M4CA 3QF9A 5FGKA 1H1QA 2C5XA 2C6LA 3QZGA 4AP7A 3W2PA 3EL7A 4WNKA 4DEDA 2CGVA 2VX1A 4IVCA 2RFNA 3BZ3A 4GIHA 5AUWA 3DNDA 3AT4A 3VS5A 4EZ5A 2FGIA 1ND4A 3MWUA 4EZ7A 3AT2A 4X2GA 3E7OA 3RWPA 2JIUA 3WZJA 5DEWA 4C2VA 4BCKA 3FJQE 2GNJA 4YLKA 3VO3A 2PVNA 1G8AA 2XCKA 1W98A 4QP6A 1WVYA 2DQ7X 4BC6A 5TO8A 3R21A 5CT7A 4JR3A 2HYYA 2BAKA 2VO3A 2R3IA 3Q04A 3G6HA 5BVKA 3NUSA 4Z16A 4BWXA 3KMMA 4IWQA 2RFDA 2UUEA 3FKLA 3MFSA 5EQYA 4RQVA 4GFGA 5DG5A 1G3NA 4JJRA 4L45A 5CEIA 4YHFA 3CQEA 3FI8A 2ZV9A 1ZY5A 5H8BA 1O6YA 4GIIA 4UALA 1UU3A 4X7QA 4PMMA 3DLZA 5ETFA 3TV4A 3QWJA 3EYHA 4BCJA 4J95A 4CNHA 4MNFA 1J91A 1K3AA 2XB7A 4KIOA 4QTAA 4USDA 3R7IA 4OTDA 4FV4A 3R1YA 3L9NA 3U9CA 5L8LA 1Q41A 3PY3A 4X3JA 3PZEA 5HICA 3PXZA 2OIQA 1JQHA 1LR4A 2QOHA 3LIJA 4NYEA 4E3CA 5HZNA 1OBGA 4MXZA 3TM0A 4J8NA 4DGGA 1K9AA 4DCAA 2QKWB 5IQGA 3B8RA 4EOIA 3PZHA 4FTTA 5J5TA 2OI4X 1YDTE 3P86A 3U9NA 2Q83A 2R3PA 2ITXA 3EZVA 5F95A 2UW7A 2R3NA 4M3QA 1YWVA 2R3JA 3N9XA 5EI2A 3QRIA 3R9RA 3KRWA 4ORKA 5KX8A 4OTRA 4ZLZA 5CSWA 4IW0A 1Y8YA 4NEUA 3Q6WA 3FI4A 4TYHA 2W99B 4WNOA 4RA4A 1B39A 4RX5A 3LXPA 4EZ3A 4UX9A 2PU8A 5HI2A 3RWQA 3GP0A 4AE6A 4E7WA 3HP2A 2PVYA 4FV6A 3KU2A 4J71A 4MBIA 3G15A 2OICA 2XRWA 1FOTA 4M12A 3NR9A 3QUEA 2ITWA 5CEPA 5ANKA 4UZHA 5DR6A 2VUWA 2WHBA 2I40A 1URCA 4AACA 4EH9A 5AA8A 3SXSA 4X2FA 1WBVA 2Y0AA 4MF1A 2HW6A 2B54A 3QTUA 4JIAA 3U4UA 4BHZA 1PRYA 3V5JA 3COMA 3W2CA 3AXWA 4XV2A 4JDJA 3H10A 3OCBA 5EM7A 4IM0A 4JI9A 4NM3A 2O2UA 2YIQA 4E4NA 4L43A 3CP9A 4F7NA 5IQIA 4FKTA 3GGFA 3POOA 2CKQA 3TIZA 4EOJA 1WFCA 4G6OA 3SAYA 4O1OA 2VWYA 3BPRA 4ANMA 3LCKA 4TNBA 4DH1A 3QCXA 1ZMUA 2VX3A 3JY0A 1XBBA 3P9JA 3VUTA 1UKIA 2VWBA 1FVRA 1TQIA 1P14A 3QA8A 2W05A 4ZTNA 3W32A 3HLLA 3CGFA 4NM5A 3FXXA 4NT4A 5E8UA 2PMNX 4YMJA 2PHKA 2CNVA 3NUPA 2YZLA 1GIHA 3Q4TA 5FP5A 4C37A 2PYWA 5A4CA 5HU9A 3PIYA 3PXKA 1ZZLA 5CNOA 4G2FA 1OBDA 4OTQA 5HGIA 2CNQA 1VEBA 4M66A 1ZYDA 4H58A 4C2WA 2Y4IB 2YM4A 4FZ7A 2CJMA 2I0VA 2XNEA 4NKSA 3VWAA 4FOBA 2ZMCA 4EOMA 3VS0A 3KULB 4IAYA 3H30A 4O84A 4EL9A 2Z7LA 3DFCB 4Y73A 5C8KA 2VTSA 3ZDIA 4JAJA 3PVUA 4FTOA 4F9BA 4KKGA 2GTMA 2PZPA 3QHWA 3LMIA 4BTKA 3DDPA 2WEIA 3F7ZA 5H8EA 3PTGA 4N57A 4FSMA 3GUBA 3EOCA 1SMHA 3KGAA 3RJCA 1M7NA 3BBTB 3CQWA 2HCKA 2Y6OA 3DK3A 2BAQA 3HA6A 4FKOA 2PZIA 3UP7A 3ATTA 5ETIA 3IGOA 1YI4A 4FL2A 4W8DA 4BCOA 4N70A 3QGYA 3I5ZA 3SKCA 4HVIA 2JD5A 5E8ZA 3GB2A 2VX0A 3AMAA 5HNIX 2BZHB 3KXGA 4A07A 4BBFA 4L53A 4IC7A 4QYFA 3E63A 2X4ZA 2GNFA 5AR2A 4JAIA 3ID6C 3IECA 3F5UA 4OUCA 5E8TA 2W4KA 3NUNA 3ORLA 3ZFXA 4BBEA 3NUUA 3DXQA 1M2QA 1OPJA 3H0ZA 2VU3A 2WB8A 4FEUA 1U54A 2XM9A 3SG9A 4MEDA 2C3LA 4M15A 3I81A 3DTWA 5KBRA 4FI1A 3DBDA 3KN5A 2LGCA 4LV8A 1YXTA 4ITJA 3LQ3A 4YJOA 2UVYA 3NIEA 1GIIA 1KE6A 2ZV8A 4FVPA 4YNEA 2JKQA 3G90X 3UPXA 4FKQA 4IVAA 3ZM4A 4O21A 5G6VA 4F1OA 3LXLA 5CS6A 3WE4A 4Z7HA 3FZOA 1ZWSA 2F4JA 3PG3A 4I94A 3QZHA 2H96A 3FMLA 3C13A 4P4CA 4O6EA 2GHGA 4WUNA 1YXXA 3NS9A 4AZVA 3FZ1A
chains in the Genus database with same CATH superfamily
1QPEA 2V5QA 2OZAB 5HO8A 3W0RA 5FXRA 3ZHPC 4BTMA 3UC3A 3GT8A 3KRRA 3UP2A 3P1AA 5M53A 4RWLA 5IQFA 3N51A 3BGZA 3IW7A 1P5EA 5IMXA 4UMPA 1Q3DA 2R9SA 4C3RA 3OP5A 2BR1A 3OUKA 1WMKA 3SV0A 3UE4A 5HO7A 4ANOA 2GNHA 2PZYA 3ODZX 4O82A 5FG8A 3CC6A 3VNTA 3R7VA 2P0CA 4Z7GA 4DG0E 1KWPA 2JFMA 3VUDA 2B0QA 2W1CA 2YZAA 4Y8DA 1XKKA 2C5OA 4RMZA 3OWPA 4ZS0A 4DT9A 2QHMA 3OT8A 3RAKA 1P2AA 5L2SA 2X7GA 3TZ9A 5DT3A 5I9YA 5K4JA 3UNJA 1EH4A 4P7EA 1I09A 3I7BA 4IZYA 1W82A 5CY3A 4F6SA 2ZOQA 4XMOA 4XG8A 2WO6A 3W2RA 5CANA 3GC8A 2Y4PA 2XKDA 4NWMA 4P90A 1CKJA 1GZOA 4BIBA 3P5JC 4L8MA 3HMIA 1WCCA 1YRPA 4O7VA 3NWWA 4FKGA 4IAZA 3VAPA 4YPSA 4D28A 5BVDA 2XKCA 3AC4A 3IK3A 5CXZA 3P79A 4RLKA 5IQDA 3KB7A 4CQGA 2HZIA 2X0OA 2C6TA 5BV3A 1QPJA 1BMKA 2KULA 3OCTA 3LFBA 3OWKA 3KF7A 5FLFA 4O7SA 3VRYA 1PXOA 3WF8A 2OXDA 3WYXA 4DEAA 4L01A 2ZDTA 1WZYA 3FYJX 3PXQA 3QTZA 2NRYA 4WRGA 3IW6A 3QCYA 5C27A 2YM3A 1OB3A 2WTKB 1JPAA 4EKLA 5BNJA 1V0OA 3BU6A 3QWKA 4Y83A 5CVFA 3ULZA 4BDIA 3A8XA 4DFZE 3U6HA 5AUUA 4RJ5A 3RK5A 3MFUA 4FIHA 4NK9A 5F94A 1J7LA 2WMTA 4N0SA 1MUOA 4EORA 3BRBA 5GZ9A 4A7CA 2FSTX 2JDRA 3HP5A 4JX7A 4QMLA 3V8TA 4RIWB 1MP8A 3BYUA 3PG1A 4UMQA 4UBAA 3RKBA 4XP3A 3KXMA 4YUQA 4LG4A 4TTHB 3LCTA 4PTCA 3EQIA 5DLSA 1OIQA 4AXAA 1ZYCA 3UOLA 3PRIA 5CF6A 2WAJA 3EN9A 2VWUA 5TF9A 1UU9A 2C3IB 4KB8A 5FBOA 3NX8A 1QPCA 3R8UA 4CFMA 1R0PA 3HV7A 3PUFC 5BUIA 2WIHA 3F5GA 3AMBA 3LJ1A 2OH0E 3R2YA 1YXVA 3ET7A 3QKLA 1WBOA 2VTPA 3BYOA 1SNUA 4IC8A 5E7RA 2X9EA 2C69A 4AW5A 4X6QC 3UOHA 2BKKA 3E3BX 1OIYA 3OVVA 4GKIA 4I41A 4HVSA 4CT2A 5IG1A 5M4FA 1A9UA 2I0EA 4FV2A 5LMBA 1J7UA 5HTBA 4YZ9A 4ZTHA 3W2OA 3E62A 4HNFA 4FZAB 4RFMA 3ALNA 5AP7A 3MN3A 4WNPA 1MQ4A 2WELA 3R9DA 4ZOGA 4FT7A 4K1BA 1UU8A 4HYHA 3C4EA 4BDHA 4YO6A 5GIPE 4JDKA 1YI3A 3CQUA 4BN1A 4FNYA 5GHVA 4DA5A 3ZMMA 4FK3A 3LLAA 3FQEA 2A0CX 5FQDC 3FLNC 1PXJA 4QYHA 1U46A 4D2PA 3MB7A 4FIFA 4CTCA 4W4VA 5A14A 1ZZ2A 4O2ZA 2OJFE 2UVXA 3KIOC 5K0KA 2PY3A 4L42A 3LFCA 3VQHA 2P3GX 4FOCA 1PXKA 2YERA 3RAHA 4TYIA 2W1FA 3RM7A 4YZNA 1PXMA 5AA9A 5LWMA 3ALOA 3FMMA 2R3OA 4BWKA 3OEFX 3AD5A 1J1CA 5IUGA 2OF2A 3LXKA 3ATSA 2PVHA 3UDSA 2XYUA 4EEVA 1OECA 3VULA 3V04A 4ASDA 3W0SA 3T9IA 4BZOA 4MYGA 3AC3A 4QMUA 1YDSE 4QPAA 5HKMA 4D4VA 4XCUA 4ZTLA 5IA4A 3DKCA 5A6NA 3TV7A 2ITPA 4IX3A 3VW6A 3MVMA 5DFPA 4JNWA 3DLSA 4ZJJA 3OY1A 5ACBC 1MRVA 1U5RA 2H9VA 4KWPA 1OL7A 4PL3A 2VWVA 4ZP5A 3MH2A 2YCSA 1GJOA 1Q8YA 4OR5A 2IEWA 3ORIA 5L2TA 1PMEA 4PTEA 3HRCA 4AXEA 5AUXA 3GU7A 3Q32A 4CRLA 5JQ8A 4EK5A 4YJTA 1JBPE 4QMPA 4MXXA 3GU4A 2E9NA 4D9UA 4F1TA 3KREA 3H9RA 3ZYAA 2B9IA 3DZQA 4EUTA 5EG3A 3UO5A 3KN6A 5FTOA 5HVYA 1APME 4OGRA 2GNGA 3OTVA 5D9HA 3SDJA 3I4BA 1XH7A 2F7EE 2ERZE 3AC2A 3ZEPA 5HIEA 2J0JA 4E5AX 3F9NA 3VHEA 5A6OA 5EYKA 3A60A 3QQHA 3PA3A 4LGGA 4F0GA 2HELA 1OIUA 3E64A 3S1HA 1GIJA 1XBCA 4YZMA 2ETRA 3EKNA 5KHWA 2BVAA 2X7FA 4O86A 2YCQA 4NFNA 2R3FA 5DA3A 1OL2A 2YCRA 3VUIA 3PIXA 4AG8A 4J53A 4IANA 2UZDA 4BI0A 4CLIA 5FEDA 2QD9A 2VO7A 4K11A 1QCFA 4MAOA 3POZA 3FLWA 4GEOA 3A7GA 4IFCA 2ONLC 4FNZA 2CKPA 1U4DA 4BCHA 4BHNA 4J52A 3F7WA 4I6QA 5DOSA 5EQEA 1OL5A 5CQWA 3HGKA 4E4MA 2IZRA 3D7TA 5CU0A 3Q2JA 4MNEA 5HCZA 2P2IA 4AT3A 2WMRA 4FT9A 2GS2A 3OOMA 4FL3A 5M55A 5KCVA 3F3UA 4AGCA 4YTIA 3ANQA 4G34A 3DV3A 3WI6A 4D2WA 3LKMA 2BIKB 2UW4A 4ALVA 5L2WA 2OZOA 3FC1X 4IX6A 4TWNA 3QCSA 4K2RA 4ZTQA 2FB8A 5C9CA 1NA7A 2QR8A 3NW5A 3EN4A 4XOZA 4M69B 2UW5A 2OJGA 3PIZA 4RFZA 3MY0A 4HJOA 4BGQA 1T46A 4KIQA 4AN9A 3FXZA 2CCIA 4Q5HA 3OBGA 2AYPA 3DGKA 3ZSHA 4LRKA 5CU3A 3A2CA 3GQLA 3V8SA 2WTCA 5C4LA 3BU5A 2Y4IC 2A19B 2OXXA 4IHPA 5HE3A 4A4OA 1LP4A 3WOWA 3PJCA 3WF6A 4C02A 3RM6A 5IQEA 1DAWA 4APPA 2V7OA 4N6YA 2Y9QA 4PPBA 4YGAA 3WIGA 3GENA 2ZYBA 3GNIB 5TT7A 3PY0A 3OCGA 3LFFA 4IVBA 4YZDA 2X0QA 1UNHA 2C68A 3KFAA 3ENMA 3PJ3A 5HG7A 4WNMA 1E9HA 4JRVA 2CN5A 3Q60A 3S0OA 3GOKA 5M08A 4QQCA 3MVJA 3H9OA 3NVKI 3VS1A 3TWJA 2C0OA 3OROA 3QBNA 3R71A 4AU8A 1Y6BA 2ITOA 4G3DA 2JBOA 3D94A 1H28A 1UA2A 2IW6A 4IZAA 2REIA 3PXFA 1AGWA 4XS2A 3UQFA 1WBWA 1ZY4A 2OO8X 3QQLA 4JG6A 3UDBA 3FXWA 5IEYA 3PYYA 4G5PA 4R3PA 3KXNA 4BR3A 2Q0BA 4C33A 4D55A 2XIZA 4DINA 1GOLA 4ANLA 4USEA 4TKSA 1DM2A 1ERKA 3QZFA 3FHIA 5AAEA 4HCVA 2Q0NA 1NVSA 5EQPA 4RIYA 3K5VA 2RL5A 3UOJA 5DYJA 4AZEA 3DZOA 3E93A 3UYSA 3NMUF 4RBLA 3W0PA 4M7IA 4BFMA 3LHJA 3ZZEA 4HGLA 3FZTA 4X2JA 3PPZA 3ZO4A 1XH8A 3OT3A 4O0WA 3MDYA 1I44A 5AAFA 1TFFA 3E8CA 2JDTA 3BLQA 2W1ZA 4QMWA 4YC3A 4BKYA 3G33A 3LOKA 4XOYA 3JXWA 2WMBA 3BEGA 2WQOA 4MXOA 4FV3A 1FMOE 3FAAA 4GCJA 2RG6A 3GC9A 5EH0A 5J9ZA 5LXMA 4O0XA 2PMIA 4Z9LA 4YNOA 1M2PA 5B2LA 1V0PA 4IMYA 4J7BA 4BKJA 3FZRA 4V0GB 5IUHA 1XBAA 3ZFMA 1Q4LA 2V62A 2X81A 4U6RA 5CVGA 5J9LA 2YIXA 3PSDA 2H8HA 4HYUA 5HQ0A 2RG5A 4FICA 4Y5HA 3MH3A 5HLWA 4FTRA 3W8QA 4C36A 2B9FA 4GT5A 3LM0A 2FYSA 4QTEA 4CFUA 5K4IA 1PKGA 4I5CA 4D58A 5IUIA 4DT8A 2JIIA 3WARA 4O27B 2R0UA 4RVMA 3ZRMA 2BZKB 2QG7A 2WMUA 5IA3A 2O3PA 2J4ZA 1W8CA 1YQJA 2XBAA 4ZK5A 2XS0A 1L3RE 2GU8A 4FSNA 5CTPA 1OL1A 3AC5A 5FXSA 4EI4A 3R7GA 4XJ0A 4PPCA 5L6OA 3CY2A 5TR6A 1XHAA 3B2WA 5AP5A 4RZWA 1H1WA 4J1RA 3WILA 2XANA 3QQKA 4JDHA 3DAJA 2B53A 4S2ZA 5KZ0A 4DTKA 4I92A 2C3JA 1CKPA 2AQXA 4LMNA 4O6LA 5EW8A 5C03A 4YBKA 3ODYX 5AV1A 2ITUA 4A06A 3FQSA 4XG9A 3PFQA 3EFLA 3RPSA 1ZYJA 3ZONA 4IJ9A 3R1SA 4L3JA 2VTHA 1G5SA 4W4YA 5CYIA 1UNGA 3COIA 2WMQA 1O6KA 2B55A 4FZDB 4E93A 2EVAA 4OBPA 2W1HA 4BCGA 2WU7A 4BTFA 1XMLA 5EOLA 2CGUA 4G31A 4ID7A 2YAAA 2WTKC 4I4FA 1BI8A 3OBJA 4ZXTA 5CU4A 4JBPA 4RVKA 4TYGA 3UBDA 3GFWA 4GKHA 1JSUA 3WIKA 1FGKA 3HUBA 3WYYA 4AZFA 4UN0C 4QQ5A 5B2MA 4BGHA 3QYZA 4NW6A 4QDVA 3DBQA 1ZARA 1FPUA 3NRMA 4Q9SA 3ZLWA 3R9OA 3LCDA 5M07A 5BYZA 3RTPA 3OC1A 4ERWA 3LMGA 3H4JA 4FUYA 3O50A 2FUMA 2QONA 3Q53A 3DS6A 4FG7A 4FKJA 2PVJA 3JUHA 3SRVB 3K54A 2OIBA 2QCSA 4FZ6A 4PUZA 1QL6A 4O83A 3UQCA 5HCXA 4KINA 1QPDA 1E1XA 3CR0A 4F78A 2CLQA 4FBXA 3TZ7A 1ZOHA 3RK7A 4XH6A 5LVLA 4O0YA 4CMOA 4IQ6A 1V0BA 1HCLA 3DU8A 2NP8A 4J96A 4RJ7A 4DG3E 1XH9A 2XK7A 4FTAA 4PX6A 4UY9A 5JZJA 4I21A 4GK2A 4TNDA 2WMSA 2YLEA 5HG5A 5HNBA 4OAUC 3QD3A 5BQ0A 4GG5A 2QQ7A 4FKRA 4DH5A 4CXAA 3OXIA 4PY1A 3ORXA 4I93A 4LQMA 1CM8A 2R3MA 4AWIA 4AA0A 2XARA 3FMHA 4UWCA 3EMGA 4YJUA 3II5A 3QQUA 5AV0A 2R3GA 4CT1A 2CLXA 5KMNA 3PVWA 4UXLA 4BJJB 5DNRA 2Z02A 5HBHA 5FDPA 1SYKA 4FTUA 5JZNA 1H24A 4JL9A 1FVVA 3R7YA 3TCPA 2XAMA 4J8MA 2GHMA 5ANOA 3AKLA 1BYGA 4KA3A 3GCVA 1H1RA 3V5WA 4AOJA 3E8DA 5M44A 1GY3A 4CTBA 1YHWA 5J7HA 4EQUA 2G2FA 1HCKA 2QOIA 5HORA 3L1SA 3ORZA 2XVDA 5HO6A 5E92A 4R6VA 5JGAA 4O4DA 2YEXA 4DCEA 4FG8A 1TZDA 1OL6A 4G6LA 4FMQA 2W06A 4O4BB 4WKQA 2VTJA 3SW4A 2XNPA 3F5XA 4DN5A 2PUPA 4QMQA 3P5KA 4CKIA 2BROA 5HEZA 5GINE 5AFVA 5HTCA 4OLIA 2CHLA 4PTGA 5LMAA 5IH6A 5KMIA 2WPAA 4O1PA 4EHZA 2VTRA 4OTPA 4ANQA 4FSWA 2NYAA 2ITVA 3F5PA 4KBKA 3VHKA 4RWIA 2VGPA 3E5AA 3PSBA 3VQUA 4MXAA 2O5KA 2J9MA 3R00A 5IA0A 2VZ6A 4BCMA 2X7OA 3MYGA 4GJ3A 4D5HA 1Z57A 1BL6A 2RSVA 1WBTA 2YHVA 3KKVA 3BBWA 3EQRA 2IN6A 4PP9A 2XNNA 2OSCA 3V51A 4BDCA 5A4TA 4D4RA 2XZSA 1BL7A 1H8FA 3ZBFA 3HEGA 4R3CA 2J90A 4KAOA 3I6WA 5I9VA 5JT2A 2PMOX 2OBJA 3A8WA 5KE0A 4EYJA 1J1BA 4MK0A 4O7WA 2Z7RA 4XV9A 3VJOA 5A46A 3F3VA 4FE2A 3I60A 3AMYA 3QUPA 2R64A 3OTUA 4S31A 3RPOA 2XBJA 4O7YA 5HG9A 2BALA 2EXMA 2XYNA 2BDFA 2WTDA 4FNXA 3FUPA 3MIYA 1KE7A 4MCVA 3A7HA 3R63A 3SXRA 3GEQA 4QP3A 3H0YA 3NLBA 3BHYA 4TYHB 1CDKA 1K2PA 2BZIB 3I1AA 3PJ1A 3DJ7A 4MD9E 4FJVA 5CZHA 3Q4CA 2PE1A 3KCKA 2BPMA 2F7XE 2G01A 3EKKA 4TY1A 3EYGA 4PL4A 5JQ5A 4BY9E 2ZM4A 5IF1A 3M11A 4OBOA 3DA6A 3FLZA 4MWIA 2UW9A 2XK3A 4DFYA 2RFSA 4JBQA 2XKEA 4EJNA 2YDIA 4R77A 4IXPA 4O81A 4DFBA 1JWHA 3QUDA 5DHJA 4EBWA 3DY7A 2PVFA 4R7BA 1YW2A 1SM2A 2VTOA 4HCTA 3MJ2A 4MTAA 4ZTMA 1Q8WA 2F57A 2PPQA 2R5TA 3I6UA 1Q3WA 3D5VA 4BVUA 4FTNA 4GUBA 3NEWA 2UW8A 3F88A 3LQ8A 3SD0A 5M4UA 2E9UA 4P5QA 4EH2A 3ZXZA 4XLIA 4F7JA 3F3WA 3DKFA 5EKNA 3F82A 4DEBA 5A4QA 4LRMA 2WTVA 4YJNA 4EQCA 2DUVA 4TN6A 3LM5A 3TUCA 2C6OA 1NY3A 3GQIA 2ACXA 3L9LA 3R0TA 2CPKE 2DS1A 3OY3A 3QC4A 4U7ZA 4YURA 2BAJA 5I9UA 2EU9A 4I24A 4DTBA 4BTJA 4U0IA 2WOUA 3VS3A 3S00A 5TKDA 2AUHA 4AXDA 4AE9A 3Q9WA 4DBXA 3C4WA 3DXPA 5T6KA 4ITHA 3CSVA 3P23A 3SG8A 3UMWA 4KSQA 4E4XA 3OXZA 3JY9A 2C30A 3KMWA 4EH8A 4HVGA 3R01A 3R7UA 2QOLA 2PUNA 2JGZA 4MH7A 1H07A 3IQ7A 1IR3A 3AG9A 4QNAA 2C4GA 4J98A 4O4CA 4TW9A 3BCEA 2PZRA 4BI2A 5LMKA 4FC0A 4BCFA 4N6ZA 3R7OA 3R1NA 4KS7A 3ZC6A 2A2AA 3M1SA 4GYGA 4FGRA 5H2UA 4OAVB 4R1YA 5CU6A 1UWJA 5AP1A 3OG7A 4PDOA 5JRSA 2IW8A 3LFDA 3ZXTA 5K9IA 3C9WA 3O0GA 3EIDA 3HZTA 2HAKA 4M0YA 4W9XA 4WSQA 4FV5A 3ROCA 3VUKA 5JH6A 2HY0A 5L8KA 3PA5A 2JITA 5AR4A 1OKZA 3CE3A 5B2KA 2HY81 5LCKA 1YOLA 2ETMA 3C4FA 2W1IA 2FVDA 2O65A 2E9OA 4EK8A 4K18A 4CYJA 4HGTA 5D11A 3AD6A 4MD7E 2HZ0A 5HCYA 4K33A 2X9FA 5JFSA 3IGGA 2YLFA 3IONA 4BCQA 5TE0A 2QODA 2V55A 4S32A 4GVAA 3LFAA 3V3VA 4XX9A 4UZDA 1Q61A 3BQCA 3C1XA 3N4TA 3FY2A 3L9MA 4NKAA 3ORNA 3EHAA 5AP3A 2XAOA 2PVMA 4IEBA 4NCTA 4O0VA 4RSSA 3VN9A 2EXEA 4MD8E 5EW3A 4D2TA 4DEIA 3G9NA 3QFVA 4JS8A 1O6LA 3EQPA 1VYZA 2VO6A 2EUFB 1IASA 3O51A 4XLVA 1LUFA 2PWLA 4RT7A 4C4GA 1JSTA 4G3GA 2C6KA 4R5YA 1P4FA 3NYVA 5FEEA 3VUMA 1U54B 3W0MA 3GU6A 3ORPA 4X3FA 4E5WA 5J9YA 5EHYA 3O8PA 5GJGA 1SZMA 3PPJA 2JLDA 5ITAA 3LW0A 4KUJA 4U79A 3LLTA 3W2SA 3HNGA 3QQJA 4Y72A 4I1ZA 4XG4A 1VLRA 1OZ1A 2WQEA 3ENHA 4AA5A 3PWDA 5HOAA 1YOJA 2C1AA 2CDZA 1TKIA 3IG7A 5KMOA 4BIEA 5KMMA 1H00A 1NT2A 4U9AA 5C4KA 3D9VA 4GW8A 4TPTA 3FKOA 5D7AA 4XG6A 4CV9A 1IAHA 4ZZMA 5FXQA 2EXCX 2VD5A 5AIKA 3ZSGA 3ZUTA 1G8SA 2B52A 3Q52A 4RJ3A 4EYMA 3Q2MA 5K5NA 1YHSA 2HWPA 5M4IA 1OVEA 3G9LX 3HRBA 4QYYA 3VBXA 3G5DA 5IH5A 3FLSA 4A9RA 4E6AA 5JFWA 4BYJA 2E9PA 4X6RA 3P08A 3FEGA 5AUTA 3W0OA 3BLRA 5ETAA 3S95A 5I3RA 4PF4A 1PXPA 2YACA 4FV8A 4K0YA 5LVMA 4ANSA 3G0FA 2UZOA 2HIWA 3EFKA 3QLFA 3UIXA 4USFA 5H8GA 1UVRA 2VRXA 5J5SA 4ZMEA 4QRCA 4FV7A 4WUAA 3VUGA 4BZNA 2GPHA 3TI1A 2PL0A 1JAMA 4EOOA 2CKEA 2C5NA 3IPHA 5CQUA 3W8LA 2IVVA 4NH1A 1PKDA 3O71A 3VS7A 1XR1A 2XEZA 3GXLA 2X8DA 3RNIA 4A9UA 3G0EA 4NUSA 1KSWA 3FDNA 1JNKA 1Q24A 4F6WA 5LWNA 2XF0A 2WKMA 4XP0A 3OCSA 2RIOA 4LYNA 4YPDA 4AAAA 3FI3A 3U4WA 2YM5A 4HNIA 5IKWA 2HK5A 4FSQA 4E6QA 4FF8A 4APCA 2QO9A 5BPYA 3UZRA 1Y91A 2I0YA 3W33A 3TT0A 4BZDA 5I9XA 2NRUA 2JDVA 3QZIA 4RWKA 4FSTA 2YISA 3O96A 4OT6A 4BIDA 2I7QA 1B38A 3G6GA 5EDQA 4MBLA 3OHTA 4F1MA 3FZPA 2G15A 1LEWA 4EHEA 4NL0A 1TQMA 2OLCA 2OKRA 4DFUA 3C4ZA 3P4KA 4X2KA 3UDTA 3GCQA 3MH1A 4LI5A 1F5QA 2ZM1A 1KOBA 3HAMA 4E5BA 5AIRA 3QTSA 1XH6A 2GDOA 5IDPA 1TQPA 2CSNA 1GZNA 4C59A 2W4OA 4NU1A 4RPVA 2JDSA 3D0EA 4CCUA 1UWHA 4RZVA 2J0MB 3PXYA 3CLYA 4IB3A 1KV1A 2GQGA 3E7VA 3EWHA 4ZIMA 3NFGB 2WQMA 4EOSA 4H05A 4E4LA 3O8TA 1Q99A 3P78A 2Z60A 2QOQA 3FL4A 3LE6A 3EQBA 4CCBA 3QX4A 3D4QA 1BUHA 2Z8CA 4QQTA 3COHA 4KIPA 3MIAA 3WF5A 1NVQA 1ZLTA 1W0XC 4YSMA 5M57A 4U81A 3MSSA 4FIJA 4ZJIA 4QPMA 4WT6A 5CF4A 4FTQA 4ASEA 5HVKA 1H26A 3EL8A 4EJ7A 2PE2A 3ZS5A 4BDJA 4AXFA 1UV5A 2BZJA 4DHFA 4D1ZA 1R78A 3BE2A 1IAJA 2ZV2A 2I0HA 2RF9A 4ZLOA 3PVBA 4EOQA 2H34A 5BMSA 2PVKA 1R0EA 3DBCA 3RHKA 3EQHA 4M14A 2J5FA 2XK8A 1V1KA 2PMLX 4NJ3A 5C8MA 4D9TA 4UMRA 5AX3A 3P7AA 3V01A 5BYLA 2QI8A 3CCNA 5F20A 3KQ7A 1Q62A 3CD8A 4U5JA 5FEQA 3TKUA 3NW7A 4MKCA 5DIAA 2JAVA 2XUUA 1AQ1A 4OTFA 5ANGA 4F70A 4QT1A 1U59A 5EDPA 4E73A 1GAGA 4YC8A 3TMOA 4BRXA 4IWDA 4IE9A 4ACDA 3GFEA 5LARA 1NVRA 5AP2A 4EH5A 3NNVA 3FLQA 4EH6A 4DGMA 3SHEA 3OW3A 2JAMA 4LUEA 4D1XA 4DAWA 3ERKA 3Q96A 4I0RA 3IW5A 5AEPA 1G8JA 3C51A 3RALA 4LL0A 3DT1A 3Q9YA 2QR7A 3LPBA 3LFQA 3QKKA 5E90A 4L6QA 4GMYA 4RWJA 5DT0A 4F9YA 1STCE 5AAGA 5L4QA 3V5TA 2BCJA 4B6LA 5LVPA 3QGWA 3KVXA 3QXPA 4IWPA 3PJ8A 4MQ2A 3I5NA 4UXQA 4RLLA 5CEMA 5K0XA 2X39A 4IDTA 3MA6A 3R7EA 1OGYA 3O5AA 2R3HA 4F7LA 3P7CA 3OWLA 2C5VA 3CXWA 1BLXA 1RQQA 2FSOX 2NPQA 3A4OX 4K8AA 4EC9A 3TKIA 4F65A 4ZTSA 5ANDA 1S9IA 3NZ0A 4FKSA 4DFXE 2BTSA 2J7TA 3DAKA 2GFSA 2W5AA 4YHJA 4F4PA 4J97A 4JRNA 4L7SA 2X2MA 2BFYA 3VRZA 2ZFYA 2WTJA 3BL7A 3ZOSA 4CGAA 4FTLA 4L67A 4BGGA 1OMWA 1W2CA 4FR4A 5CAQA 4XHKB 3TJCA 2IJMA 5DRBA 3GI3A 4PMSA 1IA8A 4JQ8A 4FEWA 3QQGA 4KSPA 5CNNA 3W0QA 3VF8A 3LCOA 2QURA 3C5UA 2XKFA 3MFTA 5GJDA 1W2FA 4MQ1A 2C6EA 2VN9A 3RHXA 5JRQA 2DYLA 2IVTA 3VBYA 5B0XA 4ZJVA 4M67A 2O8YA 3UQGA 4S33A 4RVTA 3PFYA 4HZRA 4I5PA 2EB2A 4JVGA 4ENYA 3FMKA 3FY0A 2B9HA 4YBJA 5EHLA 4EK6A 4RJ6A 5AR8A 3TNPC 3DCVA 4AS0A 4EQMA 3DJ5A 1OI9A 3BQRA 3EJ1A 4ALWA 3L9PA 2WFYA 2C6MA 1JKKA 2IZTA 3AC1A 4EH4A 4I22A 4LOOA 4CFXA 2J0IA 2VO0A 5EKOA 2Y8OA 4CFFA 3PWYA 4PMPA 4R78A 2B9JA 3QTXA 4O2PA 2WGJA 4UEUA 4ZTRA 4BCPA 4EK4A 4NZWB 4B9DA 3D7TB 4KABA 3D5XA 3NCGA 4FUXA 4MNEB 3LJ2A 2HOGA 2OXYA 2X6EA 3UPZA 1ZMWA 2JDOA 3NW6A 4DEEA 3JVRA 3TG1A 2VWIA 4L3LA 4E26A 1PYEA 3KXHA 3HA8A 3NFFB 3LXNA 4KKEA 5CF8A 1M2RA 4O7RA 3EFJA 2WXVA 2ZMDA 3AT3A 4H36A 4IAKA 2QOCA 3TTJA 4LOQA 2JIVA 4B99A 4MX9A 1SVHA 4M8TA 4HYIA 4N4SA 2EWAA 3NSZA 2R3RA 1CMKE 3COKA 3KY2A 4D1SA 5IQHA 4O96A 5CSHA 3RCDA 3QD2B 5DR9A 4QP8A 4IAAA 4RX9A 2QLUA 3WBLA 5FTQA 4FIIA 4QMNA 4AOTA 2QOKA 3U8WA 4CFWA 3AKKA 1XJDA 3I0QA 4XG7A 4FV0A 3LFSA 2ESMA 5GNKA 5IU2A 4LOPA 4QO9A 1Q97A 1RE8A 3TZ8A 2GS7A 4O22A 4NTSA 3TIYA 5DR2A 4F9AA 3FL5A 4I0SA 4F7SA 2F49A 4S30A 3DBFA 2HZ4A 3QRJA 3SOCA 3AC8A 5F1ZA 4DLIA 1R3CA 2YM7A 3DXNA 5FP6A 3HX4A 4F0FA 5AR7A 3QD0A 4W4WA 2G1TA 3RZBA 4EONA 5ANEA 3UVPA 4KKHA 2WTIA 1BX6A 2XP2A 3FYKX 2ITNA 3EQDA 4JIKA 5AR3A 3TNIA 4CQEA 3MA3A 2IVUA 2OFUA 2C1BA 3K3JA 4YJSA 4HW7A 4HVDA 2IO6A 5M06A 4H3QA 4ZSAA 2W5BA 3JPVA 4QP2A 4CG8A 5DRDA 1PMVA 1VZOA 3QYWA 3Q9ZA 2C6IA 3U51A 2W17A 3MPTA 2WQBA 3R8LA 4C58A 3A7IA 4I5MA 4D2SA 5LMKC 2FSLX 2QG5A 3FMNA 4KBAA 3UG1A 4ZMFA 3OW4A 1JVPP 4AGWA 1F0QA 2HENA 4RIYB 4B0GA 2LAVA 5KMLA 2X8IA 4FVQA 2A1AB 3ZLSA 2RGPA 4ZAUA 3WZUA 4ZEGA 2OJIA 4OTHA 1O9UA 1ATPE 3DFAA 3MY1A 5JGDA 3QRTA 5KO1A 3NVMB 3L8SA 2QHNA 4LRJA 3QHRA 4YC6A 2BRMA 5EYMA 4KNBA 3RCJA 3C5IA 3GBZA 2BFXA 2F2UA 2IZUA 5EW9A 4XEYA 2W7XA 5DI1A 2YCFA 2PTKA 4KBCA 4MUQA 2R7BA 1X8BA 4FTMA 4MHAA 3W10A