1LPUA

Low temperature crystal structure of the apo-form of the catalytic subunit of protein kinase ck2 from zea mays
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase CK2
publication title Inclining the purine base binding plane in protein kinase CK2 by exchanging the flanking side-chains generates a preference for ATP as a cosubstrate.
pubmed doi rcsb
source organism Zea mays
total genus 115
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1lpuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1lpuA01
2XNBA 1NT2A 5A46A 3NGAA 2C5OA 3MVHA 3BLHA 4TYEA 3F2RA 4IAFA 3U6HA 2HY0A 2R3RA 2BZJA 5LMBA 3D9VA 2XK7A 2YDKA 4QPAA 3SD0A 1M52A 2WU6A 3BBWA 4DEEA 2ITOA 2DUVA 5H2UA 4DEBA 3TWJA 3VUMA 4FEXA 3ZM4A 2KTYA 3KXGA 1PRYA 3L8VA 4O82A 4R5SA 3QRUA 3NAXA 4L00A 5KBQA 4NM0A 3TKIA 3VRZA 1Q8TA 4D2PA 2E9UA 3QKMA 4F6UA 4D2VA 3IDPA 4FSWA 3R8MA 4CFFA 3AT4A 3AG9A 2BILB 1JAMA 2XNPA 4GCJA 2X7GA 4GL9A 4XV3A 2BVAA 3IW8A 5F4NA 4GYIA 4KRDA 4QMXA 4D1XA 2QG5A 2W1CA 1GIJA 4EBWA 3I7CA 1UWHA 2ITPA 4XG2A 2GSFA 5IH6A 3FMNA 5EHLA 1OECA 1YWRA 3O71A 4A06A 3ZEWA 2WTKB 3KRJA 4FZFB 4U80A 3WIGA 3DV3A 3TNPC 4D4RA 3A99A 3U54A 2PVHA 5DT0A 2OU7A 2C6MA 1H1SA 2VV9A 3DJ5A 3PA5A 3H9RA 4RLLA 5AV3A 3CQUA 5CNOA 2XCHA 2F7EE 4R7HA 2GTMA 5AUVA 2C30A 4I5MA 3WF8A 5EM8A 4IACA 4LL5A 4QP6A 3MA6A 3KXMA 2BHHA 1DS5A 4KS7A 2HAKA 1BL7A 4JX3A 4M67A 2R3HA 4U6RA 1XH8A 4R1YA 4OUCA 3TNQB 5IPJA 5KMNA 1H0VA 4IC8A 4P5ZA 1U59A 4FIGA 4FL3A 4ID7A 3A7GA 5E8TA 4QP1A 3ELJA 1LP4A 3MWUA 5AR2A 5DYJA 1M7QA 4GKIA 1ZYSA 3UMWA 1OIYA 1FPUA 4ANLA 4A9TA 3C51A 4CZTA 5GZAA 2CKOA 2PHKA 3UNKA 2X6DA 1OL7A 1OUKA 2OXDA 4GUEA 3EQPA 1RJBA 4QT1A 3HGKA 4JOAA 3ID6C 3KN5A 4KSQA 3EQDA 4YLJA 3LM0A 2IW8A 4FTNA 1Y91A 1LEWA 4HCUA 5H8GA 4ANBA 4QMQA 3N9XA 5DHJA 4AT5A 3KVWA 4YZMA 2QOOA 5IDNA 5TKDA 3G15A 2XJ1A 3BWJA 4FV2A 2GNHA 4GSBA 4TYJA 4W8DA 3TZ7A 4BZDA 1MQ4A 3GC9A 3PY1A 4D28A 4F9WA 1LPUA 3LFQA 4BKJA 4Y95A 2QOKA 5AP5A 2VO7A 3ATTA 2R9SA 1IR3A 3QTIA 3R01A 4U45A 4QTDA 2EB2A 4GH2A 5TOZA 4DEAA 2CMWA 2W7XA 5F94A 3IW5A 5LQFA 2XBJA 1QMZA 4TYIA 3HV6A 4UMPA 2O0UA 5DR6A 5IUGA 4TYHB 3VIDA 1A06A 5DWRA 1IA8A 3QTZA 2WTWA 2A1AB 4FSMA 5BNJA 2ZAZA 4BDAA 3LFEA 2VTLA 2AC3A 4MXZA 3M2WA 5IISA 3VBWA 3VHEA 1FVRA 4UMTA 3OXIA 3DAKA 1WCCA 5E8ZA 4DGLC 1PXIA 4O7LA 3A8WA 3AC8A 1VYWA 3QUEA 3VW8A 5TF9A 4C7TA 4WIHA 4BTFA 1URWA 5DVRA 3BGZA 2W1EA 2Z7QA 4EH6A 2XVDA 3MGYA 4O7NA 1XHAA 3G0FA 5T3QA 1PY5A 2X39A 2XK9A 2X9EA 4FKUA 3OT8A 4QP8A 5HBHA 2BROA 3FMMA 3OY3A 5KUPA 3HV5A 4C3FA 3ZFMA 4LG4A 4Y85A 3ZZEA 5EM6A 1YOLA 1W82A 3QHWA 4I94A 3SX9A 4EH9A 3FL5A 5A4LA 5IEXA 4V0GA 4JDJA 5K0XA 3W2QA 4RG0A 4EI4A 4EJNA 2J2IB 2PTKA 2ACXA 2WAJA 3Q9ZA 3MH2A 5CENA 3TNHA 5TT7A 3N4TA 4M12A 4DEDA 1X8BA 2PVYA 2YIQA 2RL5A 3NW5A 2CGVA 3HVCA 4NM5A 5KHWA 4CZYB 5FBNC 2W1HA 5AUTA 1ZOHA 4IWDA 3UZPA 1DAWA 4KIPA 3JVSA 4LL0A 2Z7SA 2YJRA 4C37A 2IN6A 3EN5A 4FNWA 3NPCA 5FM3A 3BCEA 1E9HA 3ZLYA 4AZFA 4C3RA 4D2WA 3FMJA 5KMMA 5LCJA 1UNLA 5KZIA 2QHNA 2VZ6A 5BYYA 5HTBA 2CKQA 2J90A 3JXWA 5HICA 2G2HA 4WO5A 3DS6A 5IKWA 1V0PA 3Q9WA 3GUBA 4F09A 1Q8ZA 1SVHA 2BDFA 3EYHA 4JDIA 3R7VA 2X2LA 3QF9A 2GQGA 2YN8A 4JL9A 4O0SA 3UOJA 5DR9A 1ZY5A 3UVRA 3BEGA 4MXOA 4FL1A 4W9WA 4YSMA 2JDTA 1JSVA 4J96A 3R8UA 1UU8A 4UBAA 3F5PA 3WBLA 5EI2A 2PYWA 3DPKA 1JVPP 5B0XA 1YI6A 1P5EA 4UB7A 3VQHA 4UWCA 1YXTA 5CLPA 2PMIA 4I21A 2W5BA 4L9IA 1YDSE 4RX7A 2ZDUA 4I23A 4LOOA 5HBEA 5KX8A 4TWOA 5FQDC 1Q24A 3VUHA 3F5XA 2B9JA 1PMUA 3QGWA 4CNHA 2PZRA 4FTIA 3MDYA 2R2PA 3HX4A 3FXXA 2JKOA 4GJ2A 3Q3BA 2WQNA 5J9YA 4AW1A 4GS6A 1YXSA 2BFXA 5D7VA 2W05A 4DFZE 4CKIA 2XMYA 5E90A 5HORA 2CSNA 4N6YA 3D7TB 1OL5A 2ONLC 4D58A 2C5NA 3MBLA 5IQIA 5D9HA 1U54B 5HBJA 2VGOA 2OICA 2UZOA 4QMPA 2CN5A 3ETAA 3FPMA 2WKMA 5KKRB 5E1EA 5EHYA 2YDJA 2VTNA 1K9AA 3ZXZA 3IDCA 2Y4IC 3JY9A 5C8KA 5IZFA 3UO6A 5CAOA 3QRJA 3A4PA 2REIA 1ZARA 4FV5A 4B8LA 5LVNA 2GQSA 2JDOA 4JBQA 3NNWA 5AIRA 3R9OA 2HXQA 3D15A 4ZTRA 4FTCA 4BDHA 2ETKA 3ZBFA 4FEWA 2JAVA 1YHWA 4OTFA 2XF0A 3WF5A 5IF1A 4KUJA 5EQYA 2JFLA 4NW6A 5HNBA 2BHEA 5CEOA 3VUIA 4QD6A 2H96A 1YWNA 1PMEA 5LWMA 2GDOA 3C50A 1L3RE 4BZOA 3R8PA 3TTIA 3FYJX 2XJ2A 4XLVA 4DGGA 3C4WA 5CEQA 2WMRA 4G6LA 3WIKA 4CFNA 4QPMA 4XCUA 5BX0A 2YLFA 3EWHA 4FZAB 3K54A 2QOBA 3OMVA 4UWYA 4RT7A 3V5QA 4RIYA 5HE1A 2HXLA 3FLNC 4U0IA 2QU5A 3RAHA 5HX8A 2V7OA 2HIWA 5FDXA 5AX9A 1YOMA 4L3PA 3RK7A 4F9YA 4DGOA 4L6QA 4UWBA 4W9XA 3F69A 3MIAA 2PE1A 3NS9A 4NCTA 4DEGA 4A9YA 2JDSA 3Q4TA 4AZVA 5E4HA 3KB7A 3Q2MA 4RFYA 4BL1A 2XIRA 4EHEA 4G6NA 5ANKA 3WE8A 4DF3A 1OIRA 2PZ5A 4M8TA 3RAWA 2YM4A 2WTIA 2GNJA 4L52A 5BPYA 2QURA 5JGDA 4ONAA 4WNPA 4ZIMA 4A9SA 3SA0A 4FOCA 1PYEA 1EH4A 4RWIA 4PL3A 5KMLA 3SLSA 4GG5A 3BV3A 4LGGA 3HMPA 5L8JA 5BVFA 1B39A 2BAQA 3NUNA 4X3FA 4UZDA 1UU9A 1WBSA 4C59A 5ANJA 2C5VA 1U4DA 2PZIA 5I9YA 2O2UA 1SNXA 3EKKA 1TQPA 1H1QA 3H9OA 2G15A 1SM2A 2XZSA 4FT5A 3G51A 4IANA 5HLNA 4AOTA 3BE9A 4RVLA 3TZ8A 3Q96A 4FZ7A 5DG5A 3UE4A 3BI6A 3QQKA 1A9UA 4M69B 5JFWA 5J5TA 5K9IA 4CMOA 3FLYA 3NCZA 5I9VA 4U41A 4FEUA 1Y57A 3HMMA 3FLQA 3R1YA 3RCDA 2ETMA 3QWKA 3OROA 3KFAA 3U6JA 1TQMA 3GFWA 3LCTA 3VUTA 2WMSA 3O7LD 2OIBA 4OTIA 3RVGA 4BGHA 1H27A 4QRCA 5M53A 4G5PA 3QAME 2W96B 4BTMA 3IONA 3WYYA 2JKMA 3HRFA 3LIJA 4I20A 4M68A 2CGXA 4F0FA 1E1VA 5LOHA 4RWJA 3GQLA 4R7BA 3P78A 3QGYA 3NUAA 3F5UA 2GFCA 2VU3A 4C02A 3S00A 1NXKA 4ERWA 4WUAA 4RRVA 4NFMA 1PXPA 3QC4A 1WZYA 4J97A 2XNEA 4QMOA 4RJ6A 5J95A 2XBAA 3M1SA 4ITIA 5G6VA 4F0GA 2BR1A 4FKWA 1S9IA 5LARA 2WOUA 4IZ7A 4KBAA 4ZTMA 2PE0A 4HGEA 4BBEA 4A07A 4JRVA 3OD6X 4OTQA 3DAJA 4EK6A 4C2WA 5AV2A 3QCQA 5KMIA 2YM6A 3ZC6A 3CKXA 3DY7A 4FV1A 3RMFA 4HVSA 4BIBA 4U3ZA 3TUCA 2YAAA 5JT2A 2FH9A 2XJ0A 3NSZA 3D83A 3KC3A 5LVLA 4FICA 2X7OA 4TL0A 3MJ1A 2O5KA 1OZ1A 3SV0A 5HNIX 1ZXEA 4ZLZA 1VZOA 3UIBA 5M51A 5CU2A 3UG1A 2OJGA 4IBMA 5K4JA 1U5QA 5IMXA 2OO8X 2EXMA 2HK5A 1TVOA 5GZ9A 1J7IA 4H3BA 4YBJA 5C8MA 3AC1A 5CU6A 2FB8A 3RPSA 4RVKA 2RGPA 4RIOA 4IB0A 4HYSA 1YWVA 2QCSA 3OXTA 4IWOA 2Z60A 4K9YA 4YJQA 4ASXA 4W4WA 3CIKA 4IXPA 3BIZA 5CAPA 3EN6A 3BYOA 2JAMA 2IZRA 3MV5A 2B9HA 3KF4A 4J8NA 2I0HA 2ZYBA 2CPKE 4A7CA 3LMGA 3UIUA 1SVGA 4D2TA 2HENA 4IW0A 2R64A 4UY9A 3MH3A 5A4TA 4FVPA 3CQWA 3U4WA 3MFUA 3BYUA 1XBAA 3PZEA 4NTSA 1HCKA 1W0XC 1XR1A 3ZBXA 3NNVA 4FE2A 3FXZA 5EKOA 3RZFA 3HRBA 4E1ZA 1JSUA 1XH7A 5I5ZA 3ZLSA 3SXSA 1YVJA 3FLWA 4BCFA 2UW3A 4GT5A 3SDJA 4O7SA 3DQXA 4ANOA 3RPVA 2IVVA 4FX3A 1G3NA 3LZBA 4R78A 4JVGA 4CGAA 1ZYCA 2UVZA 5M55A 4FIIA 2C1BA 4CTBA 5AUUA 5BQ0A 2W5HA 2PPQA 2C1AA 2PU8A 4HVIA 4GK4A 1G8SA 2UW4A 3QTXA 3OEFX 2Z02A 3AQVA 1M17A 3DKFA 3PXYA 4QNAA 2XKEA 4JIKA 3M42A 5A14A 4PPCA 1UVRA 4E5BA 2C69A 5E8YA 1BKXA 1J7LA 1NA7A 1JKTA 4OLIA 4GU9A 5FG8A 2FSTX 4I1ZA 2ITXA 2WGJA 2HOGA 4RQKA 5DN3A 3VJNA 3SVVA 3ZSGA 5IA5A 4BN1A 3MB6A 3QZHA 3PIZA 4F7LA 5L2WA 5CSXA 2XRUA 4IAZA 2WTDA 2R0IA 4L8MA 1ZAOA 5DOSA 3THBA 4GFOA 3ANRA 4QTCA 4TXCA 4RZWA 4ZZMA 3WE4A 3QCSA 3FZTA 3TEIA 4D9UA 1OUYA 4ZJIA 5CEMA 4J71A 4L01A 3CQEA 3E8CA 4JG6A 3WYXA 4F1TA 1CSNA 4JRNA 4K1BA 2PULA 1W7HA 1Q3WA 3OWPA 4D4YA 3L9LA 2B4SB 3REPA 3P7BA 4EK3A 4S33A 4ZZOA 1KE9A 5AUYA 3FAAA 3GC8A 2W1ZA 4E4XA 3PWYA 4G3FA 3ZTXA 4GVJA 4DH8A 4EH5A 5CF4A 2HZNA 3V5WA 4P5QA 2NRYA 4YTIA 4QMZA 3R9NA 4QTBA 2RG6A 4FSTA 4CFXA 2RIOA 4V0GB 4AN9A 5IH4A 3LE6A 4NWMA 1FQ1B 3W2PA 5CSVA 3VS5A 4EORA 3EFKA 4XOYA 5KHXA 4EK8A 1GOLA 1GNGA 5BVKA 3FMEA 3O23A 1BLXA 3MS9A 4C57A 4GIHA 1DI9A 3ORKA 4F9CA 4FTLA 3FYKX 2WQBA 3T9IA 5I3RA 2OBJA 3HV4A 5CEPA 3NVKI 4BCQA 1AQ1A 2I0EA 3I6WA 3KL8A 3A7HA 3V6SA 3VS1A 3FKOA 3RCJA 4I41A 5TR6A 1URCA 5K5XA 3QQLA 1ERKA 2ZDTA 2BRBA 3BWFA 3AGMA 3PIXA 5DT4A 1UU3A 5IA1A 5K5NA 4CG9A 1PXOA 2J51A 2QONA 3NZ0A 1R1WA 3HMIA 4DCEA 4OT5A 4J1RA 1FINA 4KINA 4QYHA 3MFSA 4FT9A 5BYZA 3R1QA 3RWQA 4DC2A 3ZFYA 4EH3A 2PVJA 3MN3A 4RFZA 4BWXA 4JXFA 3CPBA 4CLJA 2IZTA 4ASDA 4L53A 1GJOA 5HE3A 3UQCA 3BYMA 2GTNA 3DKOA 2R0UA 4UX9A 1P4OA 3EB0A 4KKHA 4TZRA 3NYVA 3DTCA 2RSVA 3W32A 3S1HA 3W1FA 5G1XA 4I0RA 1K3AA 5FRIA 3R83A 3RKBA 4CMTA 3FJQE 4RBLA 5IU2A 5IQFA 4BY9E 5FTOA 4CG8A 3L1SA 1ZMWA 1PKGA 3T3UA 3TN8A 3E87A 2BRHA 4YO6A 5EOLA 1KE6A 2V0DA 2PUPA 4O1OA 4PDYA 4IDTA 1OKYA 3O96A 4F7NA 2OXXA 3FL4A 3VJOA 2XIYA 4FTRA 3QHRA 1CM8A 4XX9A 5E8SA 4Q5EA 4ACMA 2PUUA 3G90X 2BZKB 3PE1A 2C0IA 3R73A 4M14A 4NH1A 3AMBA 4FA2A 4BICA 3E64A 3F88A 3LQ5A 4GVAA 4EKLA 2WTKC 4K8AA 4AZSA 3RJCA 4JAIA 2OJIA 4K6ZA 3LOKA 3E63A 5JZNA 5JN2A 3GENA 4O83A 3FZ1A 3H0YA 5D1JA 3CP9A 3UP2A 3O51A 4BGGA 3HL7A 4C4FA 5IA4A 3BHUA 2XYNA 4GK2A 3TUBA 2XK6A 3FKLA 2B54A 3ZMMA 4ZK5A 5EDQA 2I7QA 4BDKA 2VTTA 1KWPA 2G9XA 3EL8A 3OCTA 4I0TA 3CY2A 1MP8A 4OTPA 4MWIA 3S4QA 4GW8A 3AMAA 1W8CA 3ZZWA 3QXOA 3NWWA 4XRJA 3Q60A 4DH1A 4NYEA 2VWVA 2UZWE 4M66A 5M56A 2RFSA 4FODA 2BPMA 1PXLA 2ITQA 3O50A 2Y7JA 3PTGA 5C8NA 5CEKA 3DKGA 3P79A 3C4EA 4AGDA 2UW7A 4O84A 4A4LA 1ATPE 3POZA 3OEZA 3UVPA 2UZEA 5CQWA 3DNEA 1J3HA 4KSPA 2VRXA 2BFYA 4RIYB 4UMRA 2GCDA 4CQEA 5J9ZA 4YC6A 2VTOA 1IAJA 3C5UA 3N51A 5DBXA 5AAEA 5B2MA 4EOSA 4N70A 4CV8A 3VS2A 3I0OA 3KU2A 2BTRA 3GI3A 1OKVA 4RJ7A 4E4MA 4IH8A 4QNYA 3QBNA 3W2CA 5E8XA 4YJPA 2UVXA 2YM5A 5EYKA 3MB7A 2XKCA 4HCVA 2YLEA 4C8BA 3D5XA 3TIYA 4ACGA 2EXCX 4R3CA 4IJ9A 3HNGA 4FBXA 2R3NA 2ITTA 1H4LA 3QRKA 4IM3A 2XRWA 2G1TA 3MA3A 4X3FB 4GFMA 5EOBA 4S32A 1IG1A 2VWBA 3DBFA 4HPTE 4ALWA 2OH0E 1OPJA 5BMMA 4C0TA 4XBRA 2ZV9A 5M57A 1UA2A 3RK5A 4FKVA 4MCVA 4Y46A 3QTWA 2XIXA 2F49A 2J0JA 3P5KA 2YFXA 5AUZA 3D5VA 3FC2A 3IK3A 3QALE 3H9FA 3QX2A 4IWPA 2J6MA 4PRJA 3DBDA 4MK0A 4O38A 1Q4LA 3DTWA 3KQ7A 2C6TA 4OT6A 5AR3A 5GJFA 3EFJA 2ZJWA 4ZMFA 5CZIA 3QA8A 2OH4A 3PP0A 5ETFA 3VN9A 2ZM4A 3SXRA 4QYYA 3C13A 4TTHB 3TJCA 3V8WA 5L8KA 2JFMA 4EJ7A 3R71A 1Y6BA 3CLYA 5DFPA 5DEYA 3VS7A 3V04A 2CGWA 2OFUA 4NUSA 1Q61A 3RPOA 4IEBA 3GVUA 1UNGA 4IE9A 4F1MA 4FSZA 2VN9A 2C68A 3GU8A 4IVAA 4R3RA 2YZAA 4FT7A 3NUSA 4P7EA 4N57A 4FKOA 4FTKA 3MVMA 3W8QA 4CKRA 4ZZNA 1DM2A 5IUIA 4BDGA 3FQHA 3FUPA 4EOJA 5CWZA 3IW7A 4AGCA 2RKUA 1PMNA 2GNFA 1ZOEA 4U42A 5CU3A 4FGBA 4YTHA 4ZSAA 3DFCB 4EONA 4AQCA 5AV1A 5ACKA 4DCAA 5D7AA 4FSRA 3CY3A 4GU6A 2PVLA 4FKSA 3ZDIA 2IG7A 1V1KA 3RZBA 4WRSA 3ZO4A 4BYIA 2Y0AA 4I4EA 5FXQA 3BHTA 3E5AA 3GBZA 3NRMA 4QMSA 3RAKA 3VS4A 5TO8A 4ENXA 5HU3A 3UQFA 2PVNA 4A4XA 3FI3A 1JSTA 2ERKA 3R0TA 4JLCA 4NK9A 3LM5A 5J87A 5AAFA 3VQUA 4MNFA 3ZO1A 5JQ8A 3KGAA 3QZFA 3SC1A 4O0WA 1WMKA 2CCHA 4XV1A 2YWVA 3IPHA 1OVEA 3SQQA 3NIZA 2CJMA 3CD3A 1R39A 2EVAA 3HMNA 4KRCA 3TIZA 5CTPA 4WBOA 5FTQA 2C5XA 3QXPA 3NDMA 3GU4A 2C6OA 4QMWA 4X2GA 3Q5ZA 2A4LA 5BUIA 3VUGA 3MY0A 2Z7LA 4PMSA 4C61A 4DA5A 1Q8UA 1Y8GA 3L8XA 4EUUA 3CE3A 3I7BA 2WXVA 4AZWA 4DLIA 2R7IA 2VO0A 3MFRA 5HG9A 3S2PA 3UGCA 4O86A 4AT4A 3D5WA 3DNDA 4I93A 3RPYA 1GIHA 4EL9A 2WFYA 3LXPA 4LMUA 2NRUA 3DGKA 4FV0A 3KN6A 4WNOA 3VRYA 3ODYX 3KRWA 2OG8A 4P90A 4C4GA 4EWHA 2F2UA 4FF8A 5LMKA 4FKIA 2H8HA 1PHKA 3FXWA 1XH5A 2W1GA 5CZHA 4PP7A 3ZO2A 2XP2A 3FZSA 1IASA 4G31A 4ITJA 4N0SA 2C47A 4M84A 5HG7A 3SHEA 3QLFA 2BIYA 1QPCA 3TI1A 3I6UA 3IQ7A 3ZS5A 2OZOA 4OAUC 4DE4A 2J5FA 3WARA 5KKRC 2WIHA 2YITA 3A2CA 4RC3A 2OXYA 3VBXA 4F9AA 5IG1A 3DDPA 3C7QA 3DB6A 3PVGA 4RIWA 4YTFA 4O7RA 4ZS0A 3BBTB 3O8PA 4ZXTA 4FT0A 4OBPA 2UZNA 2GNLA 4QP3A 3VVHA 4BCMA 3WF6A 4WG3A 2J4ZA 2PMNX 3E3BX 1I44A 4X7QA 1W84A 2QR7A 4F08A 2P2HA 3PSBA 2VTHA 2R3PA 2YIYA 1Q8YA 4X3JA 5DNRA 3VF9A 4B8MA 4CYIA 4FV9A 5A6OA 3FBVA 2CLXA 3H3CA 4X6RA 3MTFA 2WELA 5E8UA 3CTQA 3QQUA 5FTGA 4PV0A 2B7AA 5HNGA 4KKEA 4G3CA 4XG8A 4TT7A 1BI7A 4AS0A 2CNUA 3HEGA 4FG9A 4C38A 3G6HA 4E6AA 3MPAA 3QL8A 1XH9A 3ORLA 3ZUVA 2UW5A 4XP0A 5LWNA 3OY1A 3VULA 4JT3A 4L44A 4PF4A 3BGQA 4NL0A 3FLSA 3TTJA 4M0YA 4QMLA 3SRVA 4J7BA 1M2QA 2PUNA 5EQEA 4FV8A 4TY1A 3NW7A 3OW4A 5D12A 4AN2A 4WHZA 2FGIA 3LMHA 5EG3A 4BKZA 2IZUA 3FZPA 3KXHA 2C3LA 3KA0A 2JLDA 1NY3A 2OF2A 3KY2A 3LFBA 3OF0A 3IECA 1Q97A 2WQMA 2XUUA 3DK7A 4NJ3A 5ANEA 4EC8A 1Z5MA 5CVGA 3EIDA 5L6WL 4PMMA 2B9FA 4FTTA 4AFJA 4N6ZA 4U9AA 1OM1A 3BHVA 5AR7A 5JGAA 5B7VA 3BU5A 3CCNA 2FO0A 3QQFA 3UO4A 3HDMA 2EWAA 2DQ7X 3AD6A 4YZDA 3I4BA 2R3FA 1SYKA 4LOPA 2ZV7A 5AR4A 5IQAA 3W2OA 1GZ8A 4L67A 4H1MA 4B9DA 5ANIA 4DH7A 5ICPA 4FUXA 4F99A 3COMA 4KS8A 1OPKA 3HA8A 4FNYA 3CBLA 3LVPA 2WMWA 4GEOA 3TNWA 4YR8A 4E7WA 3TZ9A 5FEDA 4I24A 4E4NA 5AMNA 4E5AX 5IMEA 4YLKA 4KBCA 3UG2A 4K0YA 4D55A 5M06A 3QUPA 3UYTA 3HV3A 3R02A 2NO3A 4C4IA 1OKWA 4XJ0A 3DU8A 2UW9A 3BU3A 3IGOA 4XOZA 4I6BA 4BDCA 1LUFA 4I92A 4OAVB 3FI4A 3IG7A 2XIZA 3EQFA 3ULIA 4QQJA 3I79A 3C4ZA 1H26A 4BCNA 4L68A 2OJFE 4DT8A 4PWNA 5AX3A 2O3PA 2UZVA 4EK4A 5BVDA 3UMXA 4MD8E 4J53A 5CI6A 2YIWA 2VTQA 4L7SA 2ZMCA 4GIIA 4OTWA 3C5IA 2E9PA 4QQ5A 4L3LA 2VX0A 1RW8A 2XEYA 2XK4A 4IC7A 4ACDA 3A62A 4CT1A 1YKRA 2E9NA 4E93A 5KZ0A 2GHLA 4FSNA 4AW5A 3FLZA 4GJ3A 4L42A 5HU9A 4QYGA 2ZM3A 2Q83A 4CEGA 5HO8A 4KIOA 4DTAA 4QMMA 5HG5A 4EOKA 3IOKA 3MW1A 3OZ6A 3W8LA 3RI1A 3NUXA 4EQMA 1PYXA 3TV6A 2JDVA 1UWJA 3QCYA 2V7AA 3RGFA 4TKSA 4DFLA 3TV7A 3FV8A 3GOPA 2PZPA 2R5TA 5I9ZA 5KNJA 4DINA 2C5YA 2WMUA 1XH4A 4XG3A 5I9WA 5L2IA 4RLKA 1JLUE 3D94A 2VTJA 3BLQA 4NKAA 3CD8A 3EQGA 2XH5A 2OW3A 4QQTA 3DDQA 5ETCA 4U81A 2X6EA 3BEAA 4ZSLA 4EQUA 4JS8A 5FM2A 3PVUA 1JPAA 4G9RA 2CKPA 5LVOA 2P55A 1H24A 1OL1A 1W83A 2QU6A 2YAKA 2R3JA 3TJDA 4M97A 4U43A 4BBFA 4FUYA 3ZEPA 5EDRA 1YXVA 2W9FB 4Y5HA 1SZMA 2PSQA 5HE0A 4BFMA 5FD2A 2SRCA 4E3CA 2A0CX 5FP6A 2R7BA 4ITHA 4QP2A 3AD4A 4G3EA 5DGZA 3ZCLA 3EN4A 4PPAA 3BPRA 1ZMVA 3QD3A 2GS6A 2YCQA 5T68A 2O63A 4XMOA 4A4OA 5EW9A 3GCQA 3IKAA 3LCSA 1PXMA 2QD9A 2WEVA 5IEYA 4O7YA 4FIJA 4R8QA 5HD7A 4E6DA 3NVMB 4F0IA 2QG7A 4LV8A 3KRLA 4O0XA 3IOPA 1XJDA 4II5A 4NIFA 3F9NA 2R3LA 3JVRA 2QOQA 4FC0A 1UKHA 2DS1A 2XA4A 4X2NA 4ZTNA 4F4PA 2J5EA 1OMWA 1VEBA 3NNUA 5AFVA 3VO3A 1XWSA 5CU0A 5CXHA 1IEPA 2BUJA 3QU0A 3PE2A 4WOVA 4XG9A 4A9UA 3F2AA 3GC7A 3FMKA 4YJTA 1CKIA 4RZVA 1KV1A 4YBKA 2QLUA 4GYGA 3UYSA 2YCRA 2WTCA 3COKA 3E7OA 4F65A 3QX4A 1YOJA 3TT0A 4APCA 2A2AA 4LRMA 4WSQA 1BYGA 1CTPE 1J1BA 1XBCA 1B6CB 3PFQA 4CCBA 1WVXA 3FHIA 5IQBA 3D2KA 4IAAA 2BRMA 4FTQA 3U6IA 4XG6A 3BQCA 2YM7A 4U79A 4CV9A 4XP2A 5HVYA 5AP4A 1NW1A 3R2BA 2CNQA 4IADA 2VX1A 2HY81 5DT3A 5AUWA 2AUHA 4RX5A 2Z7RA 2C0TA 4AZEA 1KE5A 1Q99A 3IW6A 1F0QA 3K5UA 3QLGA 5B2KA 3T9TA 4S34A 4ZJJA 3PYYA 1ZLTA 1KE7A 2I0VA 2VO3A 4FYNA 4MWHA 2ITUA 4PDPA 3SW7A 4DT9A 3LAUA 4YJNA 5FUTA 3RTPA 4IZAA 4LM5A 1H1RA 3I81A 4U44A 4UXQA 1CDKA 2R3IA 4O7WA 4DFNA 2B1PA 3BU6A 5IQHA 2IJMA 3IO7A 2WU7A 4L7FA 5AM7A 3S0OA 2P2IA 5E9EA 5LVMA 3ALOA 3RM6A 4BCHA 2GPHA 3QZIA 3EOCA 3S95A 5AWMA 3LFCA 4BDDA 4DHFA 2VWIA 5J7HA 5HZNA 2PMLX 4ANSA 5GIPE 4I6QA 4MF1A 4MYGA 4EBVA 4FGRA 2R3OA 4LUDA 5D11A 3Q4ZA 5E8WA 2CNVA 4EHZA 1TQIA 4HGTA 5ANOA 4F6WA 5BVOA 2QOHA 4G16A 1WBTA 2HELA 3FEGA 3W33A 4RJ3A 5FEQA 3ZLXA 1FOTA 4NU1A 4JQEA 2OI4X 2WMBA 2I1MA 2UW0A 4X2KA 5HCXA 1UKIA 3P7AA 4AE6A 5DRDA 2UZTA 3EQBA 5E7RA 3MH1A 2PL0A 3MJ2A 1WBOA 4IB3A 4XP3A 3F61A 4PTCA 2YA9A 3B8QA 3OWKA 4YJUA 3SOCA 5CF6A 3N4UA 4EUTA 4LGHA 3PPJA 4PMTA 3ACJA 4IVDA 4YNOA 5F1ZA 4C4EA 3V6RA 3U9CA 1PW2A 2W1IA 3O8UA 4OBQA 5CALA 2QOFA 2QKRA 1WBWA 3LXKA 4AE9A 3HP5A 4EZ3A 4XH6A 2ZB0A 2QOLA 4AT3A 5H8BA 4NW5A 4BZNA 1KOBA 2ZM1A 3OCSA 4FIFA 5HE2A 5ITAA 3Q9YA 3D4QA 2UW6A 4X2JA 5CVFA 4B4LA 1TKIA 4FTJA 4ZJVA 4ANQA 4IFGA 3I5ZA 2J50A 2YEXA 3F3VA 4FKTA 2IVSA 5DE2A 4JBPA 4FSYA 3R9HA 3QCXA 1DI8A 2O64A 5M44A 4FIHA 5CYIA 3VBVA 2YM3A 3PZHA 4Y8DA 3HAVA 4TYGA 1U46A 3LQ3A 4DFYA 5HKMA 4YPSA 5DEWA 3UIXA 4FSQA 1LEZA 1OBDA 4U7ZA 3LMIA 3CKWA 2GHGA 3ORNA 4N4SA 5C4LA 4IHPA 3G6GA 1XBBA 2YDIA 2P33A 3IS5A 3P0MA 2CN8A 1CKPA 3CC6A 3DCVA 3GU5A 4RJ5A 2O65A 1O6KA 3V8SA 4CFMA 1YDTE 1JWHA 4HNFA 4BYJA 4J8MA 3T8OA 3F7WA 4UALA 3UVQA 5CSPA 3OFMA 5GJGA 3RNIA 3NUUA 4O22A 2FA2A 4IZYA 4MH7A 4EOLA 4I4FA 4YHJA 3K3IA 2VGPA 3GNIB 2VWWA 2JKKA 1QPEA 4AACA 2XM8A 3AGLA 4RIWB 4O2ZA 4FKQA 4O0UA 5BVNA 1PXKA 5CAQA 2YIXA 4JG8A 4QMNA 1FGIA 3A4OX 2YHVA 4CFVA 4O6EA 4YO4A 4OGRA 3O17A 3TACA 4ASEA 2W17A 1JOWB 4ZY5A 4EZ5A 1PKDA 2GU8A 1MUOA 3DAEA 4BRXA 1OB3A 2BDJA 5A4EA 1NVRA 2JIIA 4EH4A 1QCFA 4FR4A 4H36A 3TG1A 1R78A 1ZZLA 4BWKA 5IQCA 5HTCA 3AC5A 4FKRA 4OBOA 5CT7A 1WVWA 3BYSA 3ALNA 3DK6A 3PJ8A 4X2FA 5K0KA 1STCE 4MVFA 5JZJA 4KD1A 5HG8A 3AC3A 3C0HA 3RP9A 3PG1A 3QYZA 4RIXA 3I5NA 2HW6A 4FNXA 1ZWSA 3EL7A 2A27A 3BHHA 3SRVB 3MVLA 5GINE 2PZYA 5CS6A 3QWJA 3RHXA 3V5TA 4X21A 5IQEA 3E3PA 5IUHA 3KRRA 4BDFA 4G17A 5CAVA 3GFEA 4JR7A 3TCPA 4BCGA 4BB4A 4IX6A 3W2SA 2PE2A 2XK8A 3C1XA 1YHVA 5ACBC 2RFNA 4DAWA 2R3QA 2W1DA 4L3JA 4D2RA 4CMUA 5JRQA 3G0EA 3LKMA 4QMTA 3FMLA 3MIYA 3R7OA 2I6LA 3GEQA 4FTOA 4KNBA 4HYHA 5FEEA 3F66A 3NUYA 3S3IA 2BRNA 4X3FC 4BC6A 4G34A 4E5WA 3DBEA 4YPDA 5C03A 4O0VA 2HYYA 2Z8CA 4WSYA 4ENYA 5AR8A 5T6KA 1WFCA 2GHMA 3K5VA 4RWLA 3OS3A 4YZCA 4DFXE 2PY3A 2BKZA 3DZOA 4FKLA 2BAJA 4KKGA 4MKCA 4C36A 5JFSA 5AIKA 2I0YA 4KABA 2BRGA 2VTSA 3PRIA 2QVSE 4O0TA 3VBTA 4IAKA 5K4IA 3NUPA 3HZTA 1AGWA 4F63A 4YZBA 5AP0A 4YUQA 1T45A 1UV5A 5K3YA 4X0MA 3FY2A 4BHNA 4CD0A 2YISA 4O7ZA 3Q5IA 4CVAA 3ROYA 3QD2B 1H00A 2C3IB 1JKKA 1ZOGA 4ZEGA 5TE0A 3Q6WA 3RINA 4B6LA 3LFNA 4PNKA 2C6LA 3JPVA 5EHOA 4MF0A 5M4FA 4MHAA 4EC9A 1QPJA 2YM8A 4JIAA 4Z7HA 3GOKA 4GUBA 5JRSA 4ZY6A 3R30A 3NYXA 5L6OA 4FV7A 4B0GA 2Z2WA 4W4VA 2F2CB 2V55A 4Q5HA 3ENHA 3PIYA 2ZVAA 4NSTA 5EYCA 3K2LA 5EI8A 3E88A 2ITWA 3QRTA 5KMKA 2YACA 4EEVA 5DA3A 1FMOE 2G01A 5HESA 1CKJA 4USEA 5LCKA 2UZLA 1P2AA 5GIOE 2GNGA 2WMXA 4MNEA 3U4UA 1M2RA 1Q62A 2J9MA 2UZBA 5JMSA 1FVVA 3BGPA 2VWYA 3E7VA 3EN9A 1B38A 2X8DA 3T3VA 4RFMA 4O7TA 4QP7A 3Q52A 4YSJA 1P14A 3R00A 4IVCA 5HO6A 3ZUTA 5C26A 3QTQA 4PDOA 1XKKA 4GK3A 4V05A 1AD5A 2ZOQA 2FSOX 5L2QA 2UZUE 4D0XA 2CCIA 3W18A 4DBXA 1KV2A 3R9DA 3SG9A 4WA9A 4QP4A 2ITVA 1Q8WA 2W99B 3BQRA 4YC3A 3UC3A 3P9JA 3VUDA 2GQRA 1O9UA 2VTAA 3EZVA 3ORXA 3FY0A 4R7IA 4ZSJA 5I4NA 2X1NA 1WBNA 3F6XA 2QC6A 4AWIA 3V5PA 4W8EA 2RFDA 3R8VA 4D2SA 3D14A 3L9MA 3H0ZA 4QO9A 2BMCA 5D41A 3WZUA 4HZSA 1E1XA 2JIVA 4JQ8A 3Q6UA 4FV6A 4EYMA 4WBBB 3CR0A 3GT8A 4UYNA 4YHFA 4JI9A 5E8VA 3I60A 4HJOA 3A60A 1F5QA 1Q3DA 3BX5A 4M3QA 3W55A 2QODA 4D5HA 3V8TA 4JR3A 5H3QA 4ZSGA 4HYUA 3V01A 1YRPA 5EFQA 5CT0A 2QKWB 4FVRA 3QD4A 4IX5A 3W2RA 4ERKA 2IPXA 3R1SA 4ZP5A 3ZC5A 3ET7A 4EQCA 5AEPA 3OUKA 4IAIA 3UNJA 3OHTA 4UN0C 4HVHA 4BGQA 2ONLA 5HIEA 4NIFB 2GMXA 4L46A 4QQCA 3OOMA 2IWIA 3FSFA 3PLSA 3A7JA 2X4ZA 3RBWA 5BMSA 2C3KA 1YHSA 1HOWA 1Q5KA 3EKNA 3WF7A 3F5GA 2W4KA 4BIEA 2NPQA 3EQHA 4QYEA 4IMYA 2AC5A 4BI1A 3VW6A 3TZMA 1WBPA 2WZJA 3UJGA 3LJ1A 5A4QA 3M11A 2C4GA 5GJDA 3DJ7A 2YZLA 2BKKA 4RJ4A 3EQIA 3WF9A 3Q53A 4C4HA 4F7SA 5BVWA 2OGVA 2QLQA 2WEIA 3GCUA 4J52A 4K77A 4BDJA 3W10A 4FSUA 5AAGA 3ZONA 5EKNA 3CSVA 3RAIA 1BX6A 3CTHA 3QTSA 3DJ6A 3KXXA 4FI1A 1IAHA 3OWLA 2EB3A 3JUHA 5AP6A 3ORIA 3R63A 3UPXA 1FBNA 4EHVA 4WNKA 4ZSEA 3NNXA 3AC4A 2O8YA 4JBOA 2VTRA 3R9RA 4G6OA 4FVQA 3SKCA 3UODA 4JDKA 4K11A 3UPZA 3FMHA 4F9BA 1R0EA 5JK3A 4LQMA 3E62A 3NX8A 2DYLA 2Y6OA 3R21A 3C4FA 3R28A 4LOQA 3V3VA 4ZLOA 5KCVA 3P86A 5I9XA 1LR4A 3KMWA 1YI3A 2W0JA 3BRBA 4ZLYA 4IQ6A 3R1NA 3L9PA 4UYAA 2VNWA 1BI8A 2E9OA 2WOTA 3NW6A 5HQ0A 3CJGA 3PJ1A 4MEDA 3KCKA 3R04A 4RVTA 2FYSA 3NMUF 3HMOA 3TDVA 2BZHB 2BALA 4ZTSA 4RVMA 4S2ZA 3O2MA 4EH2A 3QD0A 4USFA 3TL8A 5CASA 2GFSA 4LGDA 5JGBA 2H6DA 3ZSIA 3JR1A 5ETIA 3MY1A 3UZTA 5ANDA 2JD5A 1ZY4A 4BCPA 4DITA 4WG5A 3LFFA 4RJ8A 2G2FA 3COIA 3EN7A 3G9NA 2JDRA 3QKLA 3ZSHA 3BYVA 1O6YA 3W16A 4RSSA 4AA5A 3QQHA 3COHA 1QL6A 3VF8A 1OPLA 4IM0A 5EDPA 3R8ZA 4QMUA 3POOA 5HVJA 2Y4PA 3MESA 3UOLA 4AG8A 2WMTA 5FGKA 4C35A 1MRYA 3R7EA 4CRLA 3I1AA 4DFBA 1M14A 4LUEA 1MQBA 4DH5A 3A61A 3DK3A 3FWQA 4FK6A 2VTPA 4MBIA 4OW8A 2I40A 2OWBA 3KULA 3MSSA 4FIEA 4IJPA 2E2BA 5CU4A 5HO7A 3AT2A 5HLWA 1U5RA 3U9NA 1KSWA 4AX8A 3PXZA 2Y9QA 2F57A 4HCTA 4LV5A 4MX9A 3KMUA 4QMYA 3LCDA 3QKKA 4G1WA 2VWZA 3ZDUA 4TRLA 3ZYAA 4DEHA 5HX6A 2F7ZE 4YJSA 2RG5A 4C3PA 5F9EA 5FBOA 3RNYA 3VBQA 3LCOA 4O27B 3IW4A 4TNDA 3GU6A 5IH5A 5KO1A 2WO6A 3UO5A 2GS2A 3FE3A 2IZSA 2EXEA 3EZRA 4FL2A 4WRGA 3FQEA 4XLIA 4O2PA 4O1PA 2RF9A 2QO2A 4RA5A 4WKQA 4DYMA 4L43A 5EH0A 3UTOA 1ZYLA 2UW8A 4EHGA 5D10A 1T46A 4C58A 1JQHA 3BZ3A 2YCFA 3F3ZA 4PL4A 3LJ0A 4QMVA 2PVFA 3LFAA 4U8ZA 4USDA 5CXZA 3HA6A 4FEQA 4Q2AA 2OSCA 2HZ4A 3QTUA 3OTUA 3NIEA 5FP5A 3LXLA 3CS9A 3TDWA 3A7IA 5GZ8A 4HZRA 4IM2A 2ITZA 4F1OA 3ORTA 5KMOA 3BV2A 3MY5A 3V5JA 4RMZA 3FKNA 4BHZA 4YJRA 3PSDA 3RM7A 2QOCA 5F95A 4FEVA 2XNMA 4XG7A 5CSHA 4BCOA 5BYLA 1V0BA 3V5LA 3DFAA 5JFVA 3F3WA 3C9WA 3U51A 2WPAA 3JYAA 2NP8A 3EFLA 4I0SA 3FI2A 4M13A 2X2KA 4UMQA 2AYPA 4AOJA 1ZYJA 2WQEA 3RK9A 1SNUA 3F3TA 3I0QA 1WBVA 3KK9A 4OTDA 4O91A 5CNNA 1IA9A 1K2PA 3FMDA 4FT3A 5KMJA 2OLCA 4PX6A 5IQDA 4Z16A 3ORZA 3FPQA 4YNEA 4FKJA 4LRKA 2GNIA 5CVHA 4FG8A 1QPDA 4KIKA 1ND4A 4M7IA 3NEWA 4DN5A 4IWQA 3F2NA 4S30A 3B8RA 4E6CA 4DGNA 2F4JA 3B2TA 3ODZX 3MYGA 4JAJA 3UIMA 4RIXB 5C1QB 1ZMUA 2F9GA 3NYNA 4IB1A 4XS2A 4ZTQA 4R1VA 4KWPA 2HCKA 5EQPA 2WHBA 4O81A 4JX7A 3A7FA 4E6QA 3ATSA 3HYHA 2W1FA 5HI2A 2JBPA 2IW9A 4KB8A 2YABA 4E20A 3VHKA 2JIUA 2IVTA 2R4BA 4NZWB 3RALA 4F6SA 3OP5A 3PJCA 3LHJA 4ASZA 3ZFXA 4D9TA 3R22A 1H0WA 3DLSA 5HOAA 3IDBA 5IA0A 3PY3A 3QUDA 5CQUA 5F20A 3PP1A 3O8TA 3OXZA 3UOKA 2IVUA 2OIDA 4PTEA 2XKFA 4W4YA 2PWLA 2WD1A 3NR9A 4I5HA 4GKHA 4J98A 4EWQA 1RDQE 4LMNA 4ZY4A 1MRUA 4MXYA 4C33A 5LXMA 2C6DA 1R3CA 2WMAA 2X2MA 2FUMA 1SVEA 3FQSA 4Z55A 2E9VA 1OL2A 4Q9ZA 4TPTA 4DGMA 3QZGA 4K33A 4FZDB 4PY1A 4CTCA 3E92A 4MXAA 4MQ2A 4U5JA 3WZJA 4ANMA 4FOBA 3PRFA 2W9ZB 3FI8A 4XBUA 5IDPA 3SOAA 2XKDA 3KMMA 3DLZA 1G8AA 3OOGA 5J9LA 2ETRA 3NLBA 4ANNA 5LVPA 2OZAA 1I09A 3LW0A 3JS2A 3MFTA 4PL5A 2CLQA 3GB2A 1J7UA 5E1SA 2WMQA 4YC8A 5DLSA 3QFVA 4E4LA 4IFCA 5J5SA 5HCZA 4XG4A 1FVTA 4RQVA 1OITA 4XV9A 3KCFA 3DBCA 5EM7A 3D2IA 4H1JA 4BBMA 3PPZA 3K3JA 3D7ZA 2YERA 4W4XA 2VTIA 4DG0E 4RC2A 4PP9A 1ZRZA 4I6HA 4AA0A 1H1PA 5KE0A 3OW3A 5M4CA 5J7BA 5L8LA 4WT6A 4EOPA 3FDNA 2IO6A 5B2LA 3PG3A 1DAYA 5JSMA 3TNIA 4Y72A 4KAOA 3EFWA 3OG7A 4EZ7A 4YU2A 3DZQA 2PVMA 4MNEB 4OTGA 4DG3E 5A3XA 4RPVA 4YJOA 4HW7A 3G33A 3GQIA 4FV4A 4O6LA 5HHWA 3SAYA 4B7TA 5BUEA 4DTBA 5IQGA 3HRCA 3HAMA 1H28A 2XNGA 3V51A 4I5CA 3CGFA 4R6VA 2B53A 4MXCA 4GV1A 4FYOA 4RX9A 3TV4A 2C6IA 5LMAA 4CZUA 4AW2A 4RWKA 1GIIA 3HDNA 3U87A 3OCBA 1VR2A 3P7CA 5CAUA 3PXQA 2OIQA 5J8IA 3GXLA 3TKUA 3L9NA 1KOAA 1WAKA 4IZ5A 3VC4A 4F64A 5DMZA 4P4CA 4ORKA 4CRSA 3CPCA 4E8AA 3DXPA 2WTVA 1YDRE 5M07A 5IA2A 4JNWA 2J0LA 5C27A 2V62A 4WNMA 3WI6A 2BZIB 3G5DA 3HKOA 4OTRA 2GS7A 3UC4A 3PVBA 5L2TA 3TUDA 3VS0A 5ETAA 5CF8A 1IRKA 3PPKA 4CFUA 3EQCA 3UOHA 3AOXA 3H4JA 4C62A 3QC9A 1FMKA 3C0GA 4G3GA 4S31A 4ACCA 1KUTA 2CHLA 4AUAA 2VWXA 1YI4A 4L45A 5M4IA 5CSWA 1XH6A 3UZRA 1OL6A 5HD4A 4J99A 3MH0A 2XB7A 3QYWA 4FNZA 4YHTA 2R3MA 2W5AA 2ZMDA 3ITZA 3Q4CA 4I5PA 4NM7A 4RA4A 5DH3A 3LPBA 3WZDA 5DIAA 4ZTLA 3ZRMA 4EKKA 4B99A 2ZV2A 2YCSA 1V0OA 4FMQA 2QHMA 5EI6A 3ZLWA 1Z57A 3D0EA 4KA3A 4D1ZA 5LMKC 4G2FA 4O96A 4BTJA 1JBPE 4ALVA 4WD5A 2X0GA 4NTTA 3ZUUA 2Y4IB 3AMYA 2X7FA 4EOOA 4XV2A 3ENMA 2OF4A 3UQGA 4AA4A 3RHKA 4GMYA 1Z9XA 4NFNA 2OJJA 2X81A 4BF2A 4D5KA 3HUCA 4YJVA 1A48A 2LAVA 2VNYA 4CT2A 4Q9SA 4Y83A 3E8DA 4BCIA 1RQQA 2H34A 4GT3A 2CGUA 2WIPA 4YLLA 4Z7GA 4R77A 2XYUA 3KXZA 3ZU7A 4F7JA 5CY3A 5AM6A 2P3GX 4K2RA 3AC2A 2HWPA 1WVYA 3Q9XA 4FKPA 4ZOGA 5A9UA 5LJJA 4C4JA 1VYZA 3CTJA 3EQRA 3IGGA 4FTUA 4QYFA 4BDEA 4Z3VA 2PVRA 5JQ5A 3SG8A 3TM0A 1GY3A 2BIKB 3DKCA 4O21A 1O6LA 3TXOA 5DPVA 4I3ZA 2OK1A 3OBJA 1H1WA 1HCLA 1PMVA 5JFXA 4ACHA 2DWBA 3KXNA 4CQGA 2PVKA 5JEBA 1Y8YA 2XNNA 3CJFA 3BHYA 4UMUA 3R6XA 1BUHA 3H30A 2PK9A 4MBJA 3TKHA 4JBVA 1JKLA 3LCKA 4HNIA 4QTEA 3PJ3A 5AP2A 3KEXA 5AV4A 2J0KA 4PDSA 5HCYA 3VBYA 2FSLX 3HECA 4CSVA 3CXWA 4TN6A 2PMOX 2JITA 4E73A 2CKEA 3F82A 4NEUA 4C2VA 4DTKA 4V01A 4FK3A 3ANQA 4PQNA 3EH9A 4BI2A 5L3AA 4LRJA 4YGAA 4E26A 4XRLA 3JY0A 4DG2E 3ACKA 3PUPA 3OTVA 3NAYA 3MVJA 3WOWA 5FXSA 4O7VA 1MRVA 3ZO3A 2OKRA 4BDIA 3VS3A 5JH6A 5L6PA 5CX9A 4D4SA 3HV7A 5JKGA 1FGKA 4WG4A 4ZTHA 2Y8OA 3SXFA 4H3QA 2G2IA 2VUWA 3UP7A 3FZOA 2A19B 3NYOA 3OT3A 3KREA 3MPTA 5DRBA 4AP7A 2X8EA 2IW6A 2QOIA 1BMKA 3HP2A 5L4QA 2BDWA 3LFSA 4TYHA 2J0IA 4FG7A 4AFEA 4AU8A 4IB5A 4JQ7A 3N4VA 4I22A 4YZNA 3UDBA 5EW3A 3KRXA 4U3YA 2YIRA 1G5SA 3OC1A 4U97A 1J91A 3R7UA 3UBDA 4F70A 3OWJA 4A9RA 3QA0A 5HLPA 4YZ9A 3U55A 3DQWA 2JKQA 3ORPA 2CDZA 3Q32A 2J0MB 3QRIA 3WILA 1OKZA 3DA6A 1JNKA 2XNOA 2H9VA 2W4JA 4XUFA 4MXXA 3BE2A 3VWAA 1M2PA 4BCKA 4P2KA 3PJ2A 4NJDA 4PUZA 3KULB 2P4IA 5I9UA 3LXNA 4HOKA 4MD9E 1VJYA 4TW9A 4EOMA 2HZIA 5AA9A 1YW2A 4DLJA 5HVKA 5L2SA 4GG7A 2WMVA 3H10A 2WQOA 4MAOA 4H39A 4AGWA 4BIDA 4TWPA 4Z9LA 4C34A 5A4CA 1M7NA 3SW4A 3ZRLA 3PDTA 3OBGA 1P4FA 2BAKA 3MI9A 4PNIA 4I6FA 4JJRA 5FWKK 2JGZA 4G5JA 1REJA 2R3GA 4G3DA 4TNBA 4AGUA 2XM9A 3BKBA 3PA3A 1OIQA 4QPSA 3R7IA 1GAGA 5FLFA 2Q0BA 5IA3A 3Q2JA 4FTAA 3ZHPC 3CEKA 4MBLA 1L8TA 2UZDA 4HPUE 2QNJA 3Q4UA 5AV0A 3R7GA 4AF3A 4Y73A 3C4CA 4ZAUA 5AR5A 5A54A 4LYNA 2W4OA 4EOQA 4D0WA 1OGUA 3DBQA 5M08A 2C0OA 4EK5A 4YURA 5HGIA 3GC0A 1YQJA 2XIKA 5C9CA 5CI7A 3Q04A 3NCGA 3DOGA 3PXRA 5A6NA 3VS6A 4FKGA 3WZEA 4AOIA 2X9FA 3PXFA 4DEIA 1CMKE 4HVDA 2JEDA 1OBGA 3AT3A 2B9IA 5AP1A 1OIUA 2B0QA 2QR8A 2Q0NA 4UXLA 3ZRKA 3QTRA 3P23A 5AP3A 2VD5A 1H07A 4AZTA 4H3PA 4EH8A 3D5UA 4RGJA 4NCTC 4IVBA 2JC6A 5EK7A 4CKJA 4BCJA 1SMHA 2C6KA 2FVDA 1JKSA 1H8FA 3ERKA 3KKVA 1BL6A 5E92A 3P4KA 2QO7A 2BTSA 4BTKA 2EU9A 4IAYA 3VAPA 4YMJA 4AXAA 2ZB1A 3GCVA 3RPRA 5DI1A 4O0RA 2VTMA 3DB8A 3GP0A 2B52A 2OJ9A 2UV2A 5HTIA 2WNTA 5C4KA 2XS0A 2VAGA 4KIKB 4RC4A 3CGOA 5J1VA 2F7XE 3C4XA 3LFDA 4UEUA 5I0BA 4FTMA 4GFGA 5DR2A 4YP8A 3FC1X 3PWDA 2YWPA 3D7TA 5HIDA 4D1SA 1PXJA 3E93A 3HUBA 3KVXA 3LJ2A 4GT4A 1U54A 2UVYA 4G9CA 4MTAA 1NVQA 1R0PA 2P0CA 4CXAA 5J79A 3SGCA 4NM3A 2R3KA 3DXNA 4CCUA 4HVGA 1YXUA 5BVEA 4IDVA 4KIQA 2ERZE 2VWUA 4H58A 3UNZA 4JG7A 5AJQA 3LQ8A 3KF7A 3MPMA 4U40A 1W98A 3F7ZA 3G2FA 4QTAA 3II5A 3ZOSA 3O0GA 2Y6MA 3L8PA 4UZHA 1ZYDA 5EYDA 3R8LA 1UNHA 3KK8A 3QQJA 3LLAA 4HYIA 4BVUA 3L8SA 4BKYA 1GZKA 2UUEA 1KE8A 4LFIA 3EYGA 3DXQA 5BUJA 4DH3A 5GNKA 2ITYA 3ULZA 3QQGA 2XEZA 4EYJA 4D4VA 4HGLA 2HW7A 3HLLA 3R2YA 5EW8A 4TWCA 4CYJA 2V5QA 2ITNA 2RFEA 3A8XA 4MQ1A 4OTHA 1Q41A 1NVSA 1S9JA 5ANGA 2VX3A 3B2WA 5EM5A 4H05A 2VO6A 2B55A 5J1WA 4XNEA 3PVWA 2QO9A 4MD7E 5GHVA 4QP9A 1YXXA 2C6EA 2JBOA 4NKSA 3FHRA 1Y6AA 4UV0A 3EHAA 4ALUA 3AD5A 3OVVA 4ARKA 3PLAE 3DT1A 3EJ1A 3BELA 5FDPA 1APME 4PTGA 2X4FA 2FSMX 3FSKA 4KBKA 2QI8A 3AXWA 2V22A 3MTLA 3P08A 4M0ZA 2OZAB 3P1AA 3OUNB 2PUIA 3G9LX 3GU7A 2XCKA 1H25A 3ZXTA 4BR3A 1ZZ2A 3ZM9A 2HZ0A 4LI5A 4IIRA 5M4UA 2WTJA 3LLTA 4R5YA 4AN3A 1J1CA 5H9BA 2LGCA 3EMGA 1REKA 1PXNA 3BLRA 4XEYA 4ZMEA 1PF8A 1OI9A 4CLIA 2BCJA 5I3OA 1F3MC 4X6QC 3VNTA 3E8NA 2C3JA 1GZNA 4M15A 5H8EA 5KBRA 2HWOA 4K18A 4APPA 3PY0A 4CFWA 2XK3A 2J7TA 5AP7A 3VUKA 2X8IA 3PA4A 5AADA 4O0YA 4FZ6A 4IX3A 4XYFA 4EH7A 3ORMA 3ZH8A 1H08A 5HIBA 4YTCA 5HEZA 4QOXA 4PPBA 1XO2B 3R7YA 2NNWB 5CEIA 5EYMA 2WB8A 3OCGA 4TWNA 4BDBA 5CF5A 5CANA 4J95A 3RWPA 4M69A 4PMPA 5AA8A 4R3PA 3C0IA 4GRBA 4HGSA 4AW0A 5FXRA 3F3UA 4BI0A 4JDHA 3U8WA 5IEVA 3FZRA 3GCSA 2OFVA 2EUFB 2ESMA 3WZKA 5AUXA 4BWPA 1UU7A 2QQ7A 4IX4A 2W06A 1RE8A 4OR5A 4FV3A 4EOIA 5M09A 3O7LB 1PJKA 4NT4A 3PXKA 1XQZA 2YJSA 4V04A 4ZS4A 2ZV8A 3ROCA 5C01A 1GZOA 4Y5QA 4DFUA 4RX8A 3GGFA 2KULA 4AAAA 4DBNA 4WUNA 3PSCA 3GCPA 5E91A 3E8EA 4XHKB 1H01A
chains in the Genus database with same CATH superfamily
2XNBA 1NT2A 5A46A 3NGAA 2C5OA 3MVHA 3BLHA 4TYEA 3F2RA 4IAFA 3U6HA 2HY0A 2R3RA 2BZJA 5LMBA 3D9VA 2XK7A 2YDKA 4QPAA 3SD0A 1M52A 2WU6A 3BBWA 4DEEA 2ITOA 2DUVA 5H2UA 4DEBA 3TWJA 3VUMA 4FEXA 3ZM4A 2KTYA 3KXGA 1PRYA 3L8VA 4O82A 4R5SA 3QRUA 3NAXA 4L00A 5KBQA 4NM0A 3TKIA 3VRZA 1Q8TA 4D2PA 2E9UA 3QKMA 4F6UA 4D2VA 3IDPA 4FSWA 3R8MA 4CFFA 3AT4A 3AG9A 2XARA 2BILB 1JAMA 2XNPA 4GCJA 2X7GA 4GL9A 4XV3A 2BVAA 3IW8A 5F4NA 4GYIA 4KRDA 4QMXA 4D1XA 2QG5A 2W1CA 1GIJA 4EBWA 3I7CA 1UWHA 2ITPA 4XG2A 2GSFA 5IH6A 3FMNA 5EHLA 1OECA 1YWRA 3O71A 4A06A 3ZEWA 2WTKB 3KRJA 4FZFB 4U80A 3WIGA 3DV3A 3TNPC 4D4RA 3A99A 3U54A 2PVHA 5DT0A 2OU7A 2C6MA 1H1SA 2VV9A 3DJ5A 3PA5A 3H9RA 4RLLA 5AV3A 3CQUA 5CNOA 2XCHA 2F7EE 4R7HA 2GTMA 5AUVA 2C30A 4I5MA 3WF8A 5EM8A 4IACA 4LL5A 4QP6A 3MA6A 3KXMA 2BHHA 1DS5A 4KS7A 2HAKA 1BL7A 4JX3A 4M67A 2R3HA 4U6RA 1XH8A 4R1YA 4OUCA 3TNQB 5IPJA 5KMNA 1H0VA 4IC8A 4P5ZA 1U59A 4FIGA 4FL3A 4ID7A 3A7GA 5E8TA 4QP1A 3ELJA 1LP4A 3MWUA 5AR2A 5DYJA 1M7QA 4GKIA 1ZYSA 3UMWA 1OIYA 1FPUA 4ANLA 4A9TA 3C51A 4CZTA 5GZAA 2CKOA 2PHKA 3UNKA 2X6DA 1OL7A 1OUKA 2OXDA 4GUEA 3EQPA 1RJBA 4QT1A 3HGKA 4JOAA 3ID6C 3KN5A 4KSQA 3EQDA 4YLJA 3LM0A 2IW8A 4FTNA 1Y91A 1LEWA 4HCUA 5H8GA 4ANBA 4QMQA 3N9XA 5DHJA 4AT5A 3KVWA 1VLRA 4YZMA 2QOOA 5IDNA 5TKDA 3G15A 2XJ1A 3BWJA 4FV2A 2GNHA 4GSBA 4TYJA 4W8DA 3TZ7A 4BZDA 1MQ4A 3GC9A 3PY1A 4D28A 4F9WA 1LPUA 3LFQA 4BKJA 4Y95A 2QOKA 5AP5A 2VO7A 3ATTA 2R9SA 1IR3A 3QTIA 3R01A 4U45A 4QTDA 2EB2A 4GH2A 5TOZA 4DEAA 2CMWA 2W7XA 5F94A 3IW5A 5LQFA 2XBJA 1QMZA 4TYIA 3HV6A 4UMPA 2O0UA 5DR6A 5IUGA 4TYHB 3VIDA 1A06A 5DWRA 1IA8A 3QTZA 2WTWA 2A1AB 4FSMA 5BNJA 2ZAZA 4BDAA 3LFEA 2VTLA 2AC3A 4MXZA 3M2WA 5IISA 3VBWA 3VHEA 1FVRA 4UMTA 3OXIA 3DAKA 1WCCA 3W0SA 5E8ZA 4DGLC 1PXIA 4O7LA 3A8WA 3AC8A 1VYWA 3QUEA 3VW8A 5TF9A 4C7TA 4WIHA 4BTFA 1URWA 5DVRA 3BGZA 2W1EA 2Z7QA 4EH6A 2XVDA 3MGYA 4O7NA 1XHAA 3G0FA 5T3QA 1PY5A 2X39A 2XK9A 2X9EA 4FKUA 3OT8A 4QP8A 5HBHA 2BROA 3FMMA 3OY3A 5KUPA 3HV5A 4C3FA 3ZFMA 4LG4A 4Y85A 3ZZEA 5EM6A 1YOLA 1W82A 3QHWA 4I94A 3SX9A 4EH9A 3FL5A 5A4LA 5IEXA 4V0GA 4JDJA 5K0XA 3W2QA 4RG0A 4EI4A 4EJNA 2J2IB 2PTKA 2ACXA 2WAJA 3Q9ZA 3MH2A 5CENA 3TNHA 5TT7A 3N4TA 4M12A 4DEDA 1X8BA 2PVYA 2YIQA 2RL5A 3NW5A 2CGVA 3HVCA 4NM5A 5KHWA 4CZYB 5FBNC 2W1HA 5AUTA 1ZOHA 4IWDA 3UZPA 1DAWA 4KIPA 3JVSA 4LL0A 2Z7SA 2YJRA 4C37A 2IN6A 3EN5A 4FNWA 3NPCA 5FM3A 3BCEA 1E9HA 3ZLYA 4AZFA 4C3RA 4D2WA 3FMJA 5KMMA 5LCJA 1UNLA 5KZIA 2QHNA 2VZ6A 5BYYA 5HTBA 2CKQA 2J90A 3JXWA 5HICA 2G2HA 4WO5A 3DS6A 5IKWA 1V0PA 3Q9WA 3GUBA 4F09A 1Q8ZA 1SVHA 2BDFA 3EYHA 4JDIA 3R7VA 2X2LA 3QF9A 2GQGA 2YN8A 4JL9A 4O0SA 3UOJA 5DR9A 1ZY5A 3UVRA 3BEGA 4MXOA 4FL1A 4W9WA 4YSMA 2JDTA 1JSVA 4J96A 3R8UA 1UU8A 4UBAA 3F5PA 3WBLA 5EI2A 2PYWA 3DPKA 1JVPP 5B0XA 1YI6A 1P5EA 4UB7A 3VQHA 4UWCA 1YXTA 5CLPA 2PMIA 4I21A 2W5BA 4L9IA 1YDSE 4RX7A 2ZDUA 4I23A 4LOOA 5HBEA 5KX8A 4TWOA 5FQDC 1Q24A 3VUHA 3F5XA 2B9JA 1PMUA 3QGWA 4CNHA 2PZRA 4FTIA 3MDYA 2R2PA 3HX4A 3FXXA 2JKOA 4GJ2A 3Q3BA 2WQNA 5J9YA 4AW1A 4GS6A 1YXSA 2BFXA 5D7VA 2W05A 4DFZE 4CKIA 2XMYA 5E90A 5HORA 2CSNA 4N6YA 3D7TB 1OL5A 2ONLC 4D58A 2C5NA 3MBLA 5IQIA 5D9HA 1U54B 5HBJA 2VGOA 2OICA 2UZOA 4QMPA 2CN5A 3ETAA 3FPMA 2WKMA 5KKRB 5E1EA 5EHYA 2YDJA 2VTNA 1K9AA 3ZXZA 3IDCA 2Y4IC 3JY9A 5C8KA 5IZFA 3UO6A 5CAOA 3QRJA 3A4PA 2REIA 1ZARA 4FV5A 4B8LA 5LVNA 2GQSA 2JDOA 4JBQA 3NNWA 5AIRA 3R9OA 2HXQA 3D15A 4ZTRA 4FTCA 4BDHA 2ETKA 3ZBFA 4FEWA 2JAVA 1YHWA 4OTFA 2XF0A 3WF5A 5IF1A 4KUJA 5EQYA 2JFLA 4NW6A 5HNBA 2BHEA 5CEOA 3VUIA 4QD6A 2H96A 1YWNA 1PMEA 5LWMA 2GDOA 3C50A 1L3RE 4BZOA 4DHZA 3R8PA 3TTIA 3FYJX 2XJ2A 4XLVA 4DGGA 3C4WA 5CEQA 2WMRA 4G6LA 3WIKA 4CFNA 4QPMA 4XCUA 5BX0A 2YLFA 3EWHA 4FZAB 3K54A 2QOBA 3OMVA 4UWYA 4RT7A 3V5QA 4RIYA 5HE1A 2HXLA 3FLNC 4U0IA 2QU5A 3RAHA 5HX8A 2V7OA 2HIWA 2X0QA 5FDXA 5AX9A 1YOMA 4L3PA 3RK7A 4F9YA 4DGOA 4L6QA 4UWBA 4W9XA 3F69A 3MIAA 2PE1A 3NS9A 4NCTA 4DEGA 4A9YA 2JDSA 3Q4TA 4AZVA 5E4HA 3KB7A 3Q2MA 4RFYA 4BL1A 2XIRA 4EHEA 4G6NA 5ANKA 3WE8A 4DF3A 1OIRA 2PZ5A 4M8TA 3RAWA 2YM4A 2WTIA 2GNJA 4L52A 5BPYA 2QURA 5JGDA 4ONAA 4WNPA 4ZIMA 4A9SA 3SA0A 4FOCA 1PYEA 1EH4A 4RWIA 4PL3A 5KMLA 3SLSA 4GG5A 3BV3A 4LGGA 3HMPA 5L8JA 5BVFA 1B39A 2BAQA 3NUNA 4X3FA 4UZDA 1UU9A 1WBSA 4C59A 3BLAA 5ANJA 2C5VA 1U4DA 2PZIA 5I9YA 2O2UA 1SNXA 3EKKA 1TQPA 1H1QA 3H9OA 2G15A 1SM2A 2XZSA 4FT5A 3G51A 3PFYA 4IANA 5HLNA 4AOTA 3BE9A 4RVLA 3TZ8A 3Q96A 4FZ7A 5DG5A 3UE4A 3BI6A 3QQKA 1A9UA 4M69B 5JFWA 5J5TA 5K9IA 4CMOA 3FLYA 3NCZA 5I9VA 4U41A 4FEUA 1Y57A 3HMMA 3FLQA 3R1YA 3RCDA 2ETMA 3QWKA 3OROA 3KFAA 3U6JA 1TQMA 3GFWA 3LCTA 3VUTA 2WMSA 3O7LD 2OIBA 4OTIA 3RVGA 4BGHA 1H27A 4QRCA 5M53A 4G5PA 3QAME 2W96B 4BTMA 3IONA 3WYYA 2JKMA 3HRFA 3LIJA 4I20A 4M68A 2CGXA 4F0FA 1E1VA 5LOHA 4RWJA 3GQLA 3BL7A 4R7BA 3P78A 3QGYA 3NUAA 3F5UA 2GFCA 2VU3A 4C02A 3S00A 1NXKA 4ERWA 4WUAA 4RRVA 4NFMA 1PXPA 3QC4A 1WZYA 4J97A 2XNEA 4QMOA 4RJ6A 5J95A 2XBAA 3M1SA 4ITIA 5G6VA 4F0GA 2BR1A 4FKWA 1G8JA 1S9IA 5LARA 2WOUA 4IZ7A 4KBAA 4ZTMA 2PE0A 4HGEA 4BBEA 4A07A 4JRVA 3OD6X 4OTQA 3DAJA 4EK6A 4C2WA 5AV2A 3QCQA 5KMIA 2YM6A 3ZC6A 3CKXA 3DY7A 4FV1A 3RMFA 4HVSA 4BIBA 4U3ZA 3TUCA 2YAAA 5JT2A 2FH9A 2XJ0A 3NSZA 3D83A 3KC3A 5LVLA 4FICA 2X7OA 4TL0A 3MJ1A 2O5KA 1OZ1A 3SV0A 5HNIX 1ZXEA 4ZLZA 1VZOA 3UIBA 5M51A 5CU2A 3UG1A 2OJGA 4IBMA 5K4JA 1U5QA 5IMXA 2OO8X 2EXMA 2HK5A 1TVOA 5GZ9A 1J7IA 4H3BA 4YBJA 5C8MA 3AC1A 5CU6A 2FB8A 3RPSA 4RVKA 2RGPA 4RIOA 4IB0A 4HYSA 1YWVA 2QCSA 3OXTA 4IWOA 2Z60A 4K9YA 4YJQA 4ASXA 4W4WA 3CIKA 4IXPA 3BIZA 5CAPA 3EN6A 3BYOA 2JAMA 2IZRA 3MV5A 2B9HA 3KF4A 4J8NA 2I0HA 2ZYBA 2CPKE 4A7CA 3LMGA 3UIUA 1SVGA 4D2TA 2HENA 4IW0A 2R64A 4UY9A 3MH3A 5A4TA 4FVPA 3CQWA 3U4WA 3MFUA 3BYUA 1XBAA 3PZEA 4NTSA 1HCKA 1W0XC 1XR1A 3ZBXA 3NNVA 4FE2A 3FXZA 5EKOA 3RZFA 3VONA 3HRBA 4E1ZA 1JSUA 1XH7A 5I5ZA 3ZLSA 3SXSA 1YVJA 3FLWA 4BCFA 2UW3A 4GT5A 3SDJA 4O7SA 3DQXA 4ANOA 3RPVA 2IVVA 4FX3A 3W0OA 1G3NA 3LZBA 4R78A 4JVGA 4CGAA 1ZYCA 2UVZA 5M55A 4FIIA 2C1BA 4CTBA 5AUUA 5BQ0A 2W5HA 2PPQA 2C1AA 2PU8A 4HVIA 4GK4A 1G8SA 2UW4A 3QTXA 3OEFX 2Z02A 3AQVA 1M17A 3DKFA 3PXYA 4QNAA 2XKEA 4JIKA 3M42A 5A14A 4PPCA 1UVRA 4E5BA 2C69A 5E8YA 1BKXA 1J7LA 1NA7A 1JKTA 4OLIA 4GU9A 5FG8A 2FSTX 4I1ZA 2ITXA 2WGJA 2HOGA 4RQKA 5DN3A 3VJNA 3SVVA 3ZSGA 3UDTA 5IA5A 4BN1A 3MB6A 3QZHA 3PIZA 4F7LA 5L2WA 5CSXA 2XRUA 4IAZA 2WTDA 2R0IA 3AKJA 4L8MA 1ZAOA 5DOSA 3THBA 4GFOA 3ANRA 4QTCA 4FJVA 4TXCA 4RZWA 4ZZMA 3WE4A 3QCSA 3FZTA 3TEIA 4D9UA 1OUYA 4ZJIA 5CEMA 4J71A 4L01A 3CQEA 3E8CA 4JG6A 3WYXA 4F1TA 1CSNA 4JRNA 4K1BA 2PULA 1W7HA 1Q3WA 3OWPA 4D4YA 3L9LA 2B4SB 3REPA 3P7BA 4EK3A 4S33A 4ZZOA 1KE9A 5AUYA 3FAAA 3GC8A 2W1ZA 4E4XA 3PWYA 4G3FA 3ZTXA 4GVJA 4DH8A 4EH5A 5CF4A 4QDEA 2HZNA 3V5WA 4P5QA 2NRYA 4YTIA 4QMZA 3R9NA 4QTBA 2RG6A 4FSTA 4CFXA 2RIOA 4V0GB 4AN9A 5IH4A 3LE6A 4NWMA 1FQ1B 3W2PA 5CSVA 3VS5A 4EORA 3EFKA 4XOYA 5KHXA 4EK8A 1GOLA 1GNGA 5BVKA 3FMEA 3O23A 1BLXA 3MS9A 4C57A 4GIHA 1DI9A 3ORKA 4F9CA 4FTLA 3FYKX 2WQBA 3T9IA 3BL9A 5I3RA 2OBJA 3HV4A 5CEPA 3NVKI 4BCQA 1AQ1A 2I0EA 3I6WA 3KL8A 3A7HA 3V6SA 3VS1A 3FKOA 3RCJA 4I41A 5TR6A 1URCA 5K5XA 3QQLA 1ERKA 3P5JC 2ZDTA 2BRBA 3BWFA 3AGMA 3PIXA 5DT4A 1UU3A 5IA1A 5K5NA 4CG9A 1PXOA 2J51A 2QONA 3NZ0A 1R1WA 3HMIA 4DCEA 4OT5A 4J1RA 1FINA 4KINA 4QYHA 3MFSA 4FT9A 5BYZA 3R1QA 3RWQA 4DC2A 3ZFYA 4EH3A 2PVJA 3MN3A 4RFZA 4BWXA 4JXFA 3CPBA 4CLJA 2IZTA 4ASDA 4L53A 1GJOA 5HE3A 2NYAA 3PUFC 3UQCA 3BYMA 2GTNA 3DKOA 2R0UA 4UX9A 1P4OA 3EB0A 4KKHA 4TZRA 3NYVA 3DTCA 2RSVA 3W32A 3S1HA 3W1FA 5G1XA 4I0RA 1K3AA 5FRIA 3R83A 3RKBA 4CMTA 3FJQE 4RBLA 5IU2A 5IQFA 4BY9E 5FTOA 4CG8A 3L1SA 1ZMWA 3W0QA 1PKGA 3T3UA 3TN8A 3E87A 2BRHA 4YO6A 2XAMA 5EOLA 1KE6A 2V0DA 2PUPA 4O1OA 4PDYA 4IDTA 1OKYA 3O96A 4F7NA 2OXXA 3FL4A 3VJOA 2XIYA 4FTRA 1XMMA 4LDTA 3QHRA 1CM8A 4XX9A 5E8SA 4Q5EA 4ACMA 2PUUA 3G90X 2BZKB 3PE1A 2C0IA 3R73A 4M14A 4NH1A 3AMBA 4FA2A 4BICA 3E64A 3F88A 3LQ5A 4GVAA 4EKLA 2WTKC 4K8AA 4AZSA 3RJCA 4JAIA 2OJIA 4K6ZA 3LOKA 3E63A 5JZNA 5JN2A 3GENA 4O83A 3FZ1A 3H0YA 5D1JA 3CP9A 3UP2A 3O51A 4BGGA 3HL7A 4C4FA 5IA4A 3BHUA 2XYNA 4GK2A 3TUBA 2XK6A 3FKLA 2B54A 3ZMMA 4ZK5A 5EDQA 2I7QA 4BDKA 2VTTA 1KWPA 2G9XA 3EL8A 3OCTA 4I0TA 3CY2A 1MP8A 4OTPA 4MWIA 3S4QA 4GW8A 3AMAA 1W8CA 3ZZWA 3QXOA 3NWWA 4XRJA 3Q60A 4DH1A 4NYEA 2VWVA 2UZWE 4M66A 5M56A 2RFSA 4FODA 2BPMA 1PXLA 2ITQA 3O50A 2Y7JA 3PTGA 5C8NA 5CEKA 3DKGA 3P79A 3C4EA 4AGDA 2UW7A 4O84A 4A4LA 1ATPE 3POZA 3OEZA 3UVPA 2UZEA 5CQWA 3DNEA 1J3HA 4KSPA 4AAYA 2VRXA 2BFYA 4RIYB 4UMRA 2GCDA 4CQEA 5J9ZA 4YC6A 2VTOA 1IAJA 3C5UA 3N51A 5DBXA 5AAEA 5B2MA 4EOSA 4N70A 4CV8A 3VS2A 3I0OA 3KU2A 2BTRA 3GI3A 1OKVA 4RJ7A 4E4MA 4IH8A 4QNYA 3QBNA 3W2CA 5E8XA 4YJPA 1XMLA 2UVXA 2YM5A 5EYKA 3MB7A 2XKCA 4HCVA 2YLEA 4C8BA 3D5XA 3TIYA 4ACGA 2EXCX 4R3CA 4IJ9A 3HNGA 4FBXA 2R3NA 2ITTA 1H4LA 3QRKA 4IM3A 2XRWA 2G1TA 3MA3A 4X3FB 4GFMA 5EOBA 4S32A 1IG1A 2VWBA 3DBFA 4HPTE 4ALWA 2OH0E 1OPJA 5BMMA 4C0TA 4XBRA 2ZV9A 5M57A 1UA2A 3RK5A 4FKVA 4MCVA 4Y46A 3QTWA 2XIXA 2F49A 2J0JA 3P5KA 2YFXA 5AUZA 3D5VA 3FC2A 3IK3A 3QALE 3H9FA 3QX2A 4IWPA 2J6MA 4PRJA 3DBDA 4MK0A 4O38A 1Q4LA 3DTWA 3KQ7A 2C6TA 4OT6A 5AR3A 5GJFA 3EFJA 2ZJWA 4ZMFA 5CZIA 3QA8A 2OH4A 3PP0A 5ETFA 3VN9A 2ZM4A 3SXRA 4QYYA 3C13A 4TTHB 3TJCA 3V8WA 5L8KA 2JFMA 4EJ7A 3R71A 1Y6BA 3CLYA 5DFPA 5DEYA 3VS7A 3V04A 2CGWA 2OFUA 4NUSA 1Q61A 3RPOA 4IEBA 3GVUA 1UNGA 4IE9A 4F1MA 4FSZA 2VN9A 2C68A 3GU8A 4IVAA 4R3RA 2YZAA 4FT7A 3NUSA 4P7EA 4N57A 4FKOA 4FTKA 3MVMA 3W8QA 4CKRA 4ZZNA 1DM2A 5IUIA 4BDGA 3FQHA 3FUPA 4EOJA 5CWZA 3IW7A 4AGCA 2RKUA 1PMNA 2GNFA 1ZOEA 4U42A 5CU3A 3UDZA 4FGBA 4YTHA 4ZSAA 3DFCB 4EONA 4AQCA 5AV1A 5ACKA 4DCAA 5D7AA 4FSRA 3CY3A 4GU6A 2PVLA 4FKSA 3ZDIA 2IG7A 1V1KA 3RZBA 4WRSA 3ZO4A 4BYIA 2Y0AA 4I4EA 5FXQA 3BHTA 3E5AA 3GBZA 3NRMA 4QMSA 3RAKA 3VS4A 5TO8A 4ENXA 5HU3A 3UQFA 2PVNA 4A4XA 3FI3A 1JSTA 2ERKA 3R0TA 4JLCA 4NK9A 3LM5A 5J87A 5AAFA 3VQUA 4MNFA 3ZO1A 5JQ8A 3NFGB 3KGAA 3QZFA 3SC1A 4O0WA 1WMKA 2CCHA 4XV1A 2YWVA 3IPHA 1OVEA 3SQQA 3NIZA 2CJMA 3CD3A 1R39A 2EVAA 3HMNA 4KRCA 3TIZA 5CTPA 4WBOA 5FTQA 2C5XA 3QXPA 3NDMA 3GU4A 2C6OA 4QMWA 4X2GA 3Q5ZA 2A4LA 5BUIA 3VUGA 3MY0A 2Z7LA 4PMSA 4C61A 4DA5A 1Q8UA 1Y8GA 3L8XA 4EUUA 3CE3A 3I7BA 2WXVA 4AZWA 4DLIA 2R7IA 2VO0A 3MFRA 5HG9A 3S2PA 3UGCA 4O86A 4AT4A 3D5WA 3DNDA 4I93A 3RPYA 1GIHA 4EL9A 2WFYA 3LXPA 4LMUA 2NRUA 3DGKA 4FV0A 3KN6A 4WNOA 3VRYA 3ODYX 3KRWA 2OG8A 4P90A 4C4GA 4EWHA 2F2UA 4FF8A 5LMKA 4FKIA 2H8HA 1PHKA 3FXWA 1XH5A 2W1GA 5CZHA 4PP7A 3ZO2A 2XP2A 3FZSA 1IASA 4G31A 4ITJA 4N0SA 2C47A 4M84A 1W2CA 5HG7A 3SHEA 3QLFA 2BIYA 1QPCA 3TI1A 3I6UA 3IQ7A 3ZS5A 2OZOA 4OAUC 4DE4A 2J5FA 3WARA 5KKRC 2WIHA 2YITA 3A2CA 4RC3A 2OXYA 3VBXA 4F9AA 5IG1A 3DDPA 3C7QA 3DB6A 3PVGA 4RIWA 4YTFA 4O7RA 4ZS0A 3BBTB 3O8PA 4ZXTA 4FT0A 4OBPA 2UZNA 2GNLA 4QP3A 3VVHA 4BCMA 3WF6A 4WG3A 2J4ZA 2PMNX 3E3BX 1I44A 4X7QA 1W84A 2QR7A 4F08A 2P2HA 3PSBA 2VTHA 2R3PA 2YIYA 1Q8YA 4X3JA 5DNRA 3VF9A 4B8MA 4CYIA 4FV9A 5A6OA 3FBVA 2CLXA 3H3CA 4X6RA 3MTFA 2WELA 5E8UA 3CTQA 3QQUA 5FTGA 4PV0A 2B7AA 5HNGA 4KKEA 4G3CA 4XG8A 4TT7A 1BI7A 4AS0A 2CNUA 3HEGA 4FG9A 4C38A 3G6HA 4E6AA 3MPAA 3QL8A 1XH9A 3ORLA 3ZUVA 2UW5A 4XP0A 5LWNA 3OY1A 3VULA 4JT3A 4L44A 4PF4A 3BGQA 4NL0A 3FLSA 3TTJA 4M0YA 4QMLA 3SRVA 4J7BA 1M2QA 2PUNA 5EQEA 4FV8A 4TY1A 3NW7A 3OW4A 5D12A 4AN2A 4WHZA 2FGIA 3LMHA 5EG3A 4BKZA 2IZUA 2X0OA 3FZPA 3KXHA 2C3LA 3KA0A 2JLDA 1NY3A 2OF2A 3KY2A 3LFBA 3OF0A 3IECA 1Q97A 2WQMA 2XUUA 3DK7A 4NJ3A 5ANEA 4EC8A 1Z5MA 5CVGA 3KIOC 3EIDA 5L6WL 4PMMA 2B9FA 4FTTA 4AFJA 4N6ZA 4U9AA 1OM1A 3BHVA 5AR7A 5JGAA 5B7VA 3BU5A 3CCNA 2FO0A 3QQFA 3UO4A 3HDMA 2EWAA 2DQ7X 3AD6A 4YZDA 3I4BA 2R3FA 1SYKA 4LOPA 2ZV7A 5AR4A 5IQAA 3W2OA 1GZ8A 4L67A 4H1MA 4B9DA 5ANIA 4DH7A 5ICPA 4FUXA 4F99A 3COMA 4KS8A 1OPKA 3HA8A 4FNYA 3CBLA 3LVPA 2WMWA 4GEOA 3TNWA 4YR8A 4E7WA 3TZ9A 5FEDA 4I24A 4E4NA 5AMNA 4E5AX 5IMEA 3TMOA 4YLKA 4KBCA 3UG2A 4K0YA 4D55A 5M06A 3QUPA 3UYTA 3HV3A 3R02A 2NO3A 4C4IA 1OKWA 4XJ0A 3DU8A 2UW9A 3BU3A 3IGOA 4XOZA 4I6BA 4BDCA 1LUFA 4I92A 4OAVB 3FI4A 3IG7A 2XIZA 3EQFA 3ULIA 4QQJA 3I79A 3C4ZA 1H26A 4BCNA 4L68A 2OJFE 4DT8A 4PWNA 5AX3A 2O3PA 2UZVA 4EK4A 5BVDA 3UMXA 4MD8E 4J53A 5CI6A 2YIWA 2VTQA 4L7SA 2ZMCA 4GIIA 4OTWA 3C5IA 2E9PA 4QQ5A 4L3LA 2VX0A 1RW8A 2XEYA 2XK4A 4IC7A 4ACDA 3A62A 4CT1A 1YKRA 2E9NA 4E93A 5KZ0A 2GHLA 4FSNA 4AW5A 3FLZA 4GJ3A 4L42A 5HU9A 4QYGA 2ZM3A 2Q83A 4CEGA 5HO8A 4KIOA 4DTAA 4QMMA 5HG5A 4EOKA 3UDSA 3IOKA 3MW1A 3OZ6A 3W8LA 3RI1A 3NUXA 4EQMA 1PYXA 3TV6A 2JDVA 1UWJA 3QCYA 2V7AA 3RGFA 4TKSA 4DFLA 3TV7A 3FV8A 3GOPA 2PZPA 2R5TA 5I9ZA 5KNJA 4DINA 2C5YA 2WMUA 2AQXA 1XH4A 4XG3A 5I9WA 5L2IA 4RLKA 1JLUE 3D94A 2VTJA 3BLQA 4NKAA 3CD8A 3EQGA 2XH5A 2OW3A 4QQTA 3DDQA 5ETCA 4U81A 2X6EA 3BEAA 4ZSLA 4EQUA 4JS8A 5FM2A 3PVUA 1JPAA 4G9RA 2CKPA 5LVOA 2P55A 1H24A 1OL1A 1W83A 2QU6A 2YAKA 2R3JA 3TJDA 4M97A 4U43A 4BBFA 4FUYA 3ZEPA 5EDRA 1YXVA 2W9FB 4Y5HA 1SZMA 2PSQA 5HE0A 4BFMA 5FD2A 2SRCA 4E3CA 2A0CX 5FP6A 2R7BA 4ITHA 4QP2A 3AD4A 4G3EA 5DGZA 3ZCLA 3EN4A 4PPAA 3BPRA 1ZMVA 3QD3A 2GS6A 2YCQA 5T68A 2O63A 4XMOA 4A4OA 5EW9A 3GCQA 3IKAA 3LCSA 1PXMA 2QD9A 2WEVA 5IEYA 4O7YA 4FIJA 4R8QA 5HD7A 4E6DA 3NVMB 4F0IA 2QG7A 4LV8A 3KRLA 4O0XA 3IOPA 1XJDA 4II5A 4NIFA 3F9NA 2R3LA 3JVRA 2QOQA 4FC0A 1UKHA 2DS1A 2XA4A 4X2NA 4ZTNA 4F4PA 2J5EA 1OMWA 1VEBA 3NNUA 5AFVA 3VO3A 1XWSA 5CU0A 5CXHA 1IEPA 2BUJA 3QU0A 3PE2A 4WOVA 4XG9A 4A9UA 3F2AA 3GC7A 3FMKA 4YJTA 1CKIA 4RZVA 1KV1A 4YBKA 2QLUA 4GYGA 3UYSA 2YCRA 2WTCA 3COKA 3E7OA 4F65A 3QX4A 1YOJA 3TT0A 4APCA 2A2AA 4LRMA 4WSQA 1BYGA 1CTPE 1J1BA 1XBCA 1B6CB 3PFQA 4CCBA 1WVXA 3NFFB 3FHIA 5IQBA 3D2KA 4IAAA 2BRMA 4FTQA 3U6IA 4XG6A 3BQCA 2YM7A 4U79A 4CV9A 4XP2A 5HVYA 5AP4A 1NW1A 3R2BA 2CNQA 4IADA 2VX1A 2HY81 5DT3A 5AUWA 2AUHA 4RX5A 2Z7RA 2C0TA 4AZEA 1KE5A 1Q99A 3IW6A 1F0QA 3K5UA 3W0RA 3QLGA