4R7HA

Crystal structure of fms kinase domain with a small molecular inhibitor, plx3397
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
326
structure length
308
Chain Sequence
PKYQVRWKIIESYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCTYGDLLNFLRRKAEAMLGPSLGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDSVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQITSFLQEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-Guided Blockade of CSF1R Kinase in Tenosynovial Giant-Cell Tumor.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 308
sequence length 326
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r7hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r7hA01
3QBNA 1JSVA 3NYVA 4YMJA 4QTDA 3VC4A 4HNIA 5JZNA 5IUGA 3OFMA 2ZMDA 2B55A 2R3OA 5C4LA 2F7ZE 3DJ6A 2OF2A 4G3FA 3I7CA 3CS9A 4KKHA 5AM6A 4U7ZA 3R7EA 4FEUA 2OZOA 4IAZA 4G34A 3DZOA 2ZB0A 4XLVA 3PJ3A 3NR9A 1CM8A 2REIA 3I81A 4MD7E 4NM3A 2J5EA 4YBJA 5CEQA 3UOHA 3MW1A 3RHKA 4YUQA 5TOZA 4RA5A 5E8WA 4BBFA 4LV8A 4J53A 2X8EA 4RJ5A 2LAVA 4FSRA 2WMRA 2Z02A 3R8UA 4ITJA 2WOTA 4NT4A 4TY1A 5K0XA 3L9PA 5M07A 2BILB 1B38A 3OROA 4JT3A 3FSFA 3CJGA 5B0XA 2QO7A 3JVSA 4QNAA 3C4XA 1NY3A 2UZWE 2W9ZB 4RMZA 4ZY6A 2ONLA 3LFSA 3U9CA 3C0GA 2Z7SA 4IM2A 4DYMA 3DLZA 2FGIA 2C5YA 3Q3BA 2I7QA 4JI9A 5CEMA 4CKJA 2BRMA 2G2IA 4DGGA 5J5TA 3QRTA 4O6EA 5M4IA 3F66A 3KC3A 4K77A 4GIIA 4M8TA 1W0XC 2PYWA 1RE8A 4JBOA 4FOBA 2JDVA 2Z8CA 1OI9A 4IFCA 5EHLA 4C58A 3EFKA 4RX9A 3R8MA 4JG8A 3TACA 2OH0E 4EC8A 5BYLA 4YZ9A 4L46A 3OW4A 4EK4A 3H9RA 4CFFA 2PTKA 4FL2A 5IA4A 2BDFA 2PVYA 3NUUA 2QOKA 5IISA 3E93A 3BELA 4G3GA 3KEXA 4WIHA 5CT0A 5AUVA 1XR1A 4X3FA 4G5PA 3NUSA 3R7UA 5C8KA 5AM7A 2YAKA 3MS9A 5KMNA 3ORPA 4IH8A 4R3CA 4E6AA 3BHVA 4YO4A 3R9OA 3R9RA 2VGOA 3DTCA 4FC0A 5DLSA 1ZRZA 3R1QA 3Q9YA 4KABA 4B8MA 4IEBA 3QCQA 3ZUUA 4IIRA 4C34A 4NJ3A 4QPMA 4BZNA 3MPTA 4EYMA 5H9BA 1TQIA 2PE1A 2GNJA 1UVRA 3FQSA 4NU1A 2YEXA 3A7IA 3PXQA 4DH7A 5JRQA 2BTSA 2YM4A 3CY3A 3JXWA 5FBOA 4MF0A 2O64A 3EKNA 4Y72A 3K54A 4Y95A 2ETMA 4F63A 2XJ0A 2PWLA 4QP2A 5HX6A 2JC6A 3G9LX 2ONLC 3MA3A 3UVRA 3UQCA 1ATPE 4I6BA 2XVDA 3RINA 2ZM1A 3C7QA 3A4PA 4FNYA 3FZPA 2HW6A 4XH6A 4F7NA 4KRCA 4G6NA 4EHEA 2WD1A 3CE3A 3IO7A 5EHYA 4EH3A 5C9CA 4U81A 4ASDA 3S95A 1P5EA 4OTPA 3WBLA 4ANOA 2Y4PA 2YIQA 5M56A 1FVVA 4GK3A 3ZFYA 3CKXA 1SM2A 2W1FA 4R5SA 4EOOA 5IQAA 3KKVA 2IJMA 2VWYA 5GJGA 3BYMA 4FEQA 1VYZA 2UZTA 1YI3A 4FKRA 3ODYX 3QWJA 4APPA 3KMWA 3NRMA 3CTQA 4U3YA 3I0QA 3KXXA 2VTTA 5HLPA 4PL5A 4FTUA 2UZNA 3CQUA 3D9VA 1ZMUA 3G6HA 4ASZA 4AGDA 1YHVA 4FZ6A 5M51A 2RG5A 4X3FC 4UXLA 2W17A 1XH5A 4AF3A 4EL9A 3WE8A 3DU8A 2IVUA 3FLQA 3E87A 5KBQA 2YM6A 2C3JA 4GUBA 3V3VA 4EK8A 1ZYSA 2BHEA 2GNFA 2BAQA 2WTCA 3QGYA 4ENYA 3PJCA 2HZ0A 2GTMA 5HICA 5FTGA 5HGIA 1F3MC 4ZK5A 2WQNA 4L52A 5LWNA 2IG7A 3ZM9A 1YW2A 3I4BA 2WEVA 5J9ZA 1PY5A 5AAGA 3F82A 5TF9A 1OIYA 3ELJA 2G2HA 4XNEA 2W7XA 3Q9WA 4F0FA 4BIEA 2X7GA 4IWDA 4ACCA 5I9YA 2KULA 3IW5A 1PYXA 3DTWA 3VVHA 3UIUA 4XMOA 1ZLTA 3LCDA 2GFSA 3FHRA 5FXQA 1JOWB 4BDDA 3CD3A 4G17A 3HRFA 5ACBC 3FMEA 5BVKA 2BPMA 3V6RA 2WB8A 4AACA 3NDMA 3NAXA 3QCXA 4XG7A 3ZDIA 4IAFA 3RCJA 5L8LA 3D2IA 3PZHA 3K3JA 4F0GA 1FGKA 2UVZA 3A8WA 3LFFA 3RHXA 1XHAA 2ITNA 3PWDA 2W1ZA 1Q3WA 2X2KA 2XIKA 3F2AA 4GMYA 2QC6A 4PMMA 2XM8A 2C6KA 3A8XA 1FMKA 5AV2A 4B99A 2GMXA 3AC8A 1Q8ZA 3HMOA 4FSMA 4D55A 5J5SA 2J0JA 5DIAA 4M14A 5FD2A 5GHVA 3W2RA 2Y0AA 5LARA 3P78A 4DFZE 4YBKA 4CGAA 5L6WL 4KIKA 4I92A 4XCUA 1VYWA 4NYEA 3SG9A 3ZTXA 5HHWA 2LGCA 2B1PA 3G5DA 4AQCA 1MUOA 4LUDA 4AZFA 1P2AA 3ZRLA 5EM8A 4GKHA 2AC5A 2XMYA 3OHTA 4NL0A 3GQLA 2JKQA 4W4VA 4Z3VA 4YGAA 2BIYA 4BIBA 4GH2A 5KMKA 1U46A 4FIJA 3QUEA 4YZDA 1P14A 2PZRA 4LGHA 4O96A 4FGBA 5FP6A 1U59A 4FV1A 4L8MA 3OF0A 4MBIA 4FKGA 3UVPA 3UG2A 3GBZA 3DK6A 4DITA 4N70A 3WF5A 1Y6BA 3NX8A 4QYGA 4KKEA 4A7CA 3O8TA 3Q9ZA 2PVKA 5DMZA 4TYEA 1YRPA 4I0RA 4MKCA 4TZRA 3PXRA 2FA2A 4NM7A 3RM7A 2OZAA 3ORXA 3EWHA 4BDKA 4AZSA 2BKKA 3MFTA 1H25A 4WRSA 3EZRA 5HVYA 4MQ1A 1LEWA 4JXFA 3GU5A 4RLLA 5EHOA 3BLRA 4ZJIA 3B2WA 5AV0A 5DGZA 2O3PA 3BHTA 4E4NA 4QP7A 1REKA 1G3NA 4DGLC 2UZVA 1LEZA 3HUBA 3PPKA 2Y6MA 3PYYA 4IDVA 3CQEA 2YFXA 5I0BA 2YWVA 4AUAA 2Q0NA 2ITQA 3C50A 5T68A 2B53A 1UNLA 4G3CA 3COHA 4U6RA 4WBOA 4WUAA 1AGWA 2PVNA 3P08A 4X2NA 2GCDA 3FY0A 2W1GA 2UW5A 4XLIA 3TNQB 5HVKA 3C4ZA 4FEXA 4BWPA 3L8XA 4ZOGA 4F08A 1YXVA 4IANA 4ACGA 4LL0A 2VO7A 2DYLA 4CT1A 2WQMA 1JKTA 1B39A 5B2LA 5M4CA 5BYYA 2I1MA 5FUTA 5CSXA 3VS4A 3EQHA 4M97A 1MP8A 5AFVA 2CHLA 4UMRA 5EQEA 4QMSA 4M15A 2J4ZA 4JAIA 4AGWA 3F61A 5IMEA 5CU4A 1XH8A 2NNWB 3R7YA 4AN9A 4MXYA 4PDYA 4BDGA 3GP0A 3AD4A 2WMXA 4QD6A 4V0GB 3NMUF 3EMGA 2ITVA 4BGGA 3Q4UA 3R30A 2WTJA 4QYFA 4JLCA 4HYUA 4OAUC 3BI6A 3WZJA 3MPAA 1WAKA 5I5ZA 3U4WA 3BHYA 5A9UA 2PVFA 4DFBA 3PIZA 4BBMA 4DN5A 4Y73A 3C0IA 4IB0A 2QOHA 4XRLA 2B9HA 2CGUA 3SG8A 4AGCA 4Y8DA 3GOKA 5CS6A 2NO3A 2FSOX 2X2MA 3PXYA 5J87A 4X3FB 3U6HA 1YI6A 4QMWA 5IQDA 4MD9E 5LVPA 5EW3A 4AZTA 3AT4A 1OMWA 3KULA 3OC1A 3WOWA 3ZFXA 4ANBA 3QQLA 4C62A 5JMSA 2IW6A 1E9HA 1JLUE 2YIXA 5ANGA 2ITOA 2OXDA 2P55A 2WMWA 4HPUE 5T6KA 3HV6A 3I60A 3VQUA 5IU2A 3QCYA 4K18A 4ALUA 1UNHA 4IWPA 4PTCA 3VULA 1L3RE 4UZHA 4W8DA 4D9TA 3P7BA 4XG6A 2W1HA 2DQ7X 3WE4A 3MV5A 3MY0A 1H4LA 4FSWA 3BU5A 4GV1A 3SKCA 3ZBFA 5H8BA 4P5ZA 3F3UA 3Q6UA 3QQGA 2O0UA 4GT3A 1WBNA 2X9FA 4AA0A 2J7TA 4UYNA 4ZY4A 5D9HA 4O91A 4NJDA 4RIXA 4W4WA 4IJ9A 5IA1A 1K2PA 3SW4A 4CFVA 3DXQA 2PZIA 4BCKA 4C4EA 3SW7A 4FKJA 3FPQA 2ZYBA 4QQTA 1PMUA 3DGKA 4D4YA 4UY9A 4CNHA 4K11A 5M55A 1FBNA 4USFA 3FMDA 5I9WA 2V7OA 1OUKA 5HI2A 3RPRA 4G9RA 1M52A 3Q60A 3GENA 3EL7A 2QG5A 2GDOA 4FTRA 5FWKK 4DEHA 1QPCA 4L3JA 4F9AA 3VUHA 2BROA 5CVFA 5EOBA 3MB7A 4GEOA 3QQUA 3RGFA 4QO9A 4YTFA 4WT6A 4WOVA 3VBVA 1JVPP 2W0JA 4MNFA 5HCZA 4K33A 4Q5HA 3KU2A 2IPXA 2UZEA 2PUNA 3LJ1A 5EM6A 3PXFA 4W9XA 2JDSA 4B7TA 2P0CA 5KMMA 4B8LA 1G5SA 4J8NA 4FICA 2QONA 2FSTX 3EN9A 3QUDA 4LOPA 4W4XA 3DBCA 2YN8A 4AZWA 1OIQA 4F7SA 4K6ZA 2H96A 3ZLYA 2OSCA 3CQWA 4A9SA 4D2PA 3CXWA 5CT7A 4LYNA 3UIMA 4LUEA 5J1VA 4Z9LA 4DFYA 2R3QA 4D4VA 2X8IA 1XJDA 3PVUA 3FL5A 3KXGA 4CFMA 4C0TA 4TTHB 3LQ3A 4BRXA 3LE6A 3Q04A 4ERWA 3HMPA 1FVTA 4HW7A 3DS6A 4TWOA 2QHNA 4DT8A 5AUUA 3SXFA 4RG0A 3BZ3A 5KBRA 1U4DA 4YZMA 3QD2B 4A4OA 5GZ9A 4BHZA 1H00A 5J79A 3UP2A 3FXWA 1UKIA 5ITAA 1BMKA 1KV1A 3VUGA 3ROCA 1SNXA 1DAYA 4JDKA 5TKDA 4FZ7A 5JFVA 2PY3A 5HU3A 1MRYA 2UZDA 1IEPA 4L3PA 4XV1A 3ZXTA 2H34A 2YIYA 4V05A 2E9NA 4KBKA 5LXMA 3N4TA 3EYHA 4IX4A 4YJRA 2W1DA 5DR9A 4C4GA 4CTBA 2QOOA 1Q8YA 2CN8A 2R3GA 3QRIA 4AFJA 1SVEA 4KIKB 1ZWSA 1JQHA 3W16A 5CENA 4FKIA 5C01A 1NXKA 4ZLYA 2C68A 3GEQA 4JVGA 4C59A 5AP5A 2VNYA 2VO6A 4MBJA 4YNOA 4MWIA 4LV5A 4O2PA 3FYKX 3PY3A 4RIOA 4BBEA 3HYHA 4O0SA 4JL9A 2X4ZA 2C6TA 2YDKA 4EQUA 3HA6A 4V04A 3IONA 4I6QA 3T3UA 4I24A 2I0VA 4F64A 5KMJA 2XZSA 3RCDA 3S0OA 3H0ZA 3QYWA 4FK6A 2QODA 3KCKA 3WZEA 4FYNA 4FT0A 4PDSA 3BYOA 1W8CA 1XH6A 1J7UA 2CPKE 2FO0A 4FUYA 4BCPA 4O7TA 1JKLA 3OWJA 3T9IA 1H1RA 1PMEA 4M13A 4HVGA 2ZVAA 1ND4A 1GIHA 5C27A 4RWJA 2J5FA 5M09A 1PJKA 2XB7A 4FTCA 1K9AA 3OXZA 4FNXA 3GCVA 4LI5A 1BLXA 4B4LA 5HO8A 5FBNC 4A07A 4CXAA 4IX6A 3PVGA 1A06A 2E9OA 2C6IA 3C4CA 5T3QA 3LCTA 2HAKA 2OK1A 5IQEA 4HGTA 5J1WA 3SRVA 4IACA 3NNUA 3ODZX 3KRXA 3R8ZA 1P4FA 4O7SA 3EQGA 4EH4A 1H07A 1P4OA 3CSVA 3DJ5A 4FV0A 2PUPA 2PHKA 4E6QA 3LJ0A 5DRBA 4EOMA 3QRUA 4I4FA 3PTGA 3DBQA 3ZXZA 2ITXA 3O2MA 4D2RA 2BZJA 3OWKA 4FODA 3DV3A 1Q97A 3MY1A 3H30A 1ZZLA 2X39A 4MQ2A 4IB5A 2YM5A 3BKBA 5GNKA 2C0OA 2JKMA 4RLKA 4G6OA 2IVSA 4PX6A 5DWRA 3EQBA 5E8XA 1KE9A 1K3AA 4BDHA 1KE6A 5DRDA 3U8WA 1Y8GA 5JRSA 5A54A 2ERKA 3PA5A 3O7LD 4RA4A 4BVUA 4F6WA 3E64A 4FSTA 3R28A 3GCPA 3O50A 4QMZA 4CTCA 5CANA 5HE3A 5HZNA 5FLFA 3LXPA 3C4EA 4O22A 2WTVA 2FUMA 5CXHA 3RAHA 2JIIA 2ZM3A 5CSWA 2O5KA 1KSWA 5E8VA 5CU2A 2RIOA 5BUEA 2VGPA 3E3PA 4O86A 5CSVA 2QNJA 4YHFA 3E88A 4OTGA 4C4IA 4E4XA 4WO5A 4IC8A 3UE4A 3TI1A 1YI4A 3W2OA 1BL6A 4MEDA 1SVHA 4KKGA 3DK7A 3IW7A 4FT3A 3D7TA 1E1XA 3DKCA 2Y6OA 3U6IA 2JDRA 4BL1A 3QD4A 5L3AA 1JSTA 4CFXA 4FKVA 1W98A 2XKDA 2X2LA 3Q4TA 4XBRA 4I5CA 3ORKA 1UNGA 3PRFA 3I6WA 3AC4A 2HWPA 2UUEA 3AT2A 4M68A 5AIRA 5H2UA 3KULB 1DS5A 2IZRA 2YJRA 4YC3A 4FUXA 4CCUA 3TG1A 4RJ8A 5DN3A 3DBFA 4OGRA 3W8LA 4UALA 4BKYA 4GSBA 4TRLA 1LPUA 3LCSA 3PZEA 4MCVA 4JBPA 4BICA 3G9NA 4YC6A 2OF4A 5AP6A 5HNGA 2QCSA 4FSQA 3PJ2A 1KOAA 2GS7A 4O0RA 2GS6A 1CTPE 3QKLA 4IB3A 1NVRA 3LFEA 3Q52A 4CZTA 1L8TA 3KMUA 3SD0A 3ZOSA 4E5AX 3NLBA 2XNBA 5BUJA 4FV7A 3ZRKA 4IZ5A 4RIXB 4XX9A 4DEGA 4QYEA 5IG1A 2BAJA 4FNWA 5FM3A 3ZSGA 3BBTB 4C2VA 3CIKA 4CMTA 4E20A 2VTPA 4L42A 2QR8A 1ZYLA 4MXAA 3PY0A 5AR2A 1MQBA 4JG6A 5ANDA 3HDNA 3ZSIA 2QURA 4ITIA 4X3JA 4FIGA 3TJDA 4HGEA 2WFYA 2PK9A 1Z57A 2J0MB 2UVYA 4FKTA 3VAPA 1O6KA 3ZZEA 4KIOA 3KF4A 3UO6A 3LZBA 4FIEA 5BVFA 5JN2A 4FF8A 4U79A 5DE2A 5EG3A 2WELA 4AA4A 1FVRA 5HD4A 3ZO1A 3FBVA 4E26A 1OL7A 4D5KA 4P2KA 2VRXA 4X2KA 4F1MA 5CAUA 5HORA 5JSMA 4IM0A 4P5QA 3U55A 4HVSA 3BRBA 4D0XA 4JAJA 4XOYA 3NYOA 5HEZA 2UW3A 4FL1A 4I22A 3IGGA 5AJQA 3DAJA 3I7BA 4FVRA 4ZIMA 3Q6WA 2R0IA 2RSVA 5GIPE 3BX5A 3CR0A 4BCJA 3BBWA 3NNWA 1R78A 3F3VA 4G2FA 3RK5A 2GU8A 3UNKA 4QTCA 3R7IA 3FC2A 4CQGA 4I5MA 3DAEA 4J95A 3RAWA 3CPBA 3QL8A 2BCJA 4CYJA 2ERZE 3V5LA 4TT7A 3N4UA 2UVXA 4F09A 5CI7A 3O7LB 3QTRA 2R3FA 5JEBA 3KMMA 3QKMA 5EFQA 3HEGA 3HV5A 3NW6A 3WIKA 2V22A 4TWCA 4C33A 3QTZA 4MNEA 4EWQA 5AP3A 2WQOA 2BDJA 1SMHA 3HP5A 5IDNA 3NUNA 3LMIA 1GOLA 2IZSA 3FMHA 4IM3A 4ZZNA 2R3PA 3MVJA 3VBTA 2DWBA 3KVXA 3TIZA 4RVKA 4PV0A 2X81A 1CDKA 3R1YA 2UW8A 3LMHA 3MH3A 4RIYA 4O7WA 1TQPA 4IC7A 4FKPA 2QR7A 3KRWA 3QYZA 3V8WA 4CQEA 5CLPA 4P7EA 4AW1A 4L53A 5F94A 4R77A 3NEWA 4NIFA 4C35A 2C5OA 3D5UA 2P3GX 2C0TA 2QKRA 3V04A 2UZBA 4H1MA 2CN5A 3RKBA 4IZAA 4J71A 4V0GA 4EJ7A 4C7TA 2J90A 3A62A 3HECA 5HBEA 1X8BA 4MXOA 1IA9A 2XK9A 4AW2A 3GB2A 4C38A 2CKQA 5CF6A 3ID6C 1M14A 4WD5A 3GCQA 3TNPC 2Y8OA 4JQ7A 3HZTA 5M4FA 3AD5A 4MD8E 3RWQA 2VWZA 3LXNA 3IOKA 4PWNA 4YC8A 4EKKA 4BDJA 3I5ZA 2QOLA 2VTNA 4H39A 4OBOA 4XJ0A 4IX3A 3FI2A 4HPTE 2OWBA 4OUCA 4OT6A 2OJJA 2QOBA 2VNWA 2VWVA 3PXZA 4JRVA 2HENA 3D5VA 4K0YA 3PJ8A 3CP9A 3UOKA 3VUTA 4UMUA 4DFUA 1J91A 3DZQA 4GVJA 3TKHA 3MY5A 3R71A 3PIXA 1WBVA 4QQCA 5LVMA 3HAMA 3BV2A 5A3XA 1ZYCA 4R5YA 4ZTLA 2F4JA 3R00A 3QF9A 4D9UA 3NGAA 4FKWA 4F6SA 3SGCA 4DBXA 3KK9A 4O1OA 3SRVB 5KCVA 3VHKA 2P4IA 2IW8A 3U51A 5FXRA 3BQCA 3CPCA 3HDMA 4FV3A 4S32A 4DFNA 3R83A 3B8RA 3F3ZA 5LJJA 4F4PA 3BQRA 3O0GA 4O1PA 5JGDA 4D4SA 5AADA 5JGAA 3IOPA 3POZA 3PSDA 2JGZA 3C5UA 3QTWA 5DNRA 3IQ7A 2J9MA 5CU6A 3OOMA 4KSPA 2WO6A 2CLXA 3R22A 3E7VA 3ZONA 3DY7A 4TW9A 5CSPA 5CEKA 1JNKA 4EQMA 1DAWA 3BGQA 1KUTA 2VTLA 4NK9A 2HZIA 4R7HA 4UB7A 4L7FA 5A6OA 1Q8WA 2EXMA 3BWFA 3FE3A 2J0IA 5DPVA 2E9VA 3KY2A 4F99A 2RFEA 1H26A 5IMXA 4X6RA 3DNEA 3LVPA 3PPZA 4HGSA 4S31A 3QQHA 3SC1A 2BTRA 4LMNA 1YXSA 4X6QC 4ACDA 1S9JA 3QTSA 2YJSA 2F9GA 1PW2A 5KMIA 3G6GA 3FQHA 4BFMA 5D41A 4AE9A 4RJ6A 4DTAA 3UODA 5CAPA 4ZSGA 3ENMA 3VS5A 3F5PA 4ZSJA 4FMQA 5EYMA 3G2FA 3OY1A 5C03A 2OG8A 4KNBA 1MRUA 1FMOE 3F6XA 4EZ5A 3NUAA 5L8KA 3QQFA 4BI1A 2WMBA 4W9WA 4NFMA 5DHJA 4ANLA 4CG8A 3BEGA 4PMTA 2W1IA 3D7TB 3AQVA 5E8UA 1AD5A 2X6EA 2HZNA 5DT4A 5KMOA 2PMIA 3V5TA 4AZEA 4RVLA 4YTHA 2CGVA 1AQ1A 3ROYA 4M0ZA 4EOKA 3MI9A 3RAIA 4K8AA 5DYJA 3LM0A 5ANOA 4WG3A 3E8DA 3ZUVA 2XK7A 3WILA 5E8YA 1GZNA 3VS0A 4GJ3A 4XOZA 1KE5A 4IADA 1Y6AA 5M08A 2QU6A 3ACKA 2E9UA 1PKDA 4U40A 3QLGA 3QHRA 2VU3A 2F2UA 2EVAA 4I4EA 4PPBA 5LMKA 4LOOA 5LCJA 4F0IA 3GVUA 4QMNA 4CZYB 3PVBA 2QOFA 4X2GA 2CLQA 1PKGA 4JQ8A 4BTMA 4ZMFA 1ZYDA 1OL1A 3MGYA 2Y9QA 3FLNC 2B7AA 2XYUA 4GS6A 3PG3A 2J50A 3UGCA 4ALVA 2C1BA 4C36A 2I0EA 2P2IA 1RDQE 3FL4A 3LAUA 3FDNA 5ETCA 4E4LA 4QPSA 2C6OA 3QQKA 3VBYA 3I6UA 2YLFA 4H58A 4JJRA 3FXZA 4Q9ZA 2VWWA 2XIZA 5CZIA 3PLAE 1OKVA 3DBEA 2GNHA 1F5QA 1RW8A 3EH9A 4LFIA 3S1HA 4FKQA 4QMOA 2OKRA 4EK6A 4UWBA 4ZLZA 5K4JA 4FBXA 3W32A 1UKHA 5EYCA 1WZYA 4X2JA 3NIEA 5AP0A 2B9FA 3VUIA 4LGGA 3FKLA 4A4XA 4O6LA 2JLDA 2B54A 2OO8X 2WIHA 3K5UA 4PDPA 5HU9A 2ZJWA 4KA3A 4FV4A 3D0EA 5CVGA 3S00A 3AD6A 4BKZA 4EH7A 3CCNA 4JX3A 4YZBA 4EZ7A 2CSNA 2F7EE 3H9OA 4YPSA 2OGVA 5HCXA 4BDEA 4ANSA 3EN4A 5HBJA 3AMBA 3D2KA 5IEVA 4O81A 3EZVA 3PXKA 4FT5A 4IJPA 4N57A 3COMA 2R9SA 1OUYA 1QMZA 2RFSA 3ZYAA 5LMKC 3V51A 5BMSA 3DKGA 5F20A 3BHHA 4XV3A 4PTEA 3HV4A 1W84A 4TN6A 4JBVA 4ASXA 3RAKA 5HTCA 4JDJA 5AP4A 3QA0A 4FZDB 1DI9A 4EH2A 3QKKA 1Z5MA 4P4CA 4NW6A 4EBVA 4ZTMA 2NRUA 3FMLA 3NSZA 3DPKA 4GUEA 2PVLA 2WKMA 1QPDA 3OBJA 5CAQA 3ZEPA 4JBQA 4YPDA 5IH4A 5AUWA 5J7BA 4BYJA 4MNEB 1ZY5A 4XG8A 4XG9A 3AC2A 3V5JA 4N4SA 3VN9A 4WHZA 3FZOA 4X7QA 3COKA 2ZDUA 4Z7HA 1BL7A 2XKFA 4MAOA 4J97A 2GTNA 2ETKA 4O0XA 1ZZ2A 2G9XA 4OTQA 4QT1A 3V8SA 4E1ZA 2O2UA 4RX8A 4ZY5A 1YHSA 5KO1A 4BDCA 5C4KA 3MFRA 3QRJA 3KXNA 4FTKA 1H01A 4L43A 4RIYB 4WNMA 5CWZA 4NTSA 5EK7A 1M17A 4BWXA 2EB2A 3FI3A 3MH0A 2OLCA 2W05A 4FTNA 4OTWA 2R3KA 2VX1A 4FNZA 2YCSA 3MVHA 4MBLA 4I20A 2YIWA 2VTQA 4NIFB 3AC3A 3GI3A 5EW8A 3NYXA 2B9IA 4QYYA 3PSBA 4O2ZA 4ZMEA 3OVVA 2XRUA 4ZS0A 4C4JA 4QTEA 4B0GA 4EK3A 2BALA 5AUTA 2YCRA 2HOGA 3UIBA 1GJOA 2YIRA 5FEDA 3TNHA 4D28A 3F2RA 3FQEA 4DEBA 5HLNA 4FKOA 3R8PA 4B6LA 5IQCA 2B4SB 3AC5A 3MFUA 1ZARA 2GHGA 3P0MA 3P79A 5TO8A 3UMWA 1XO2B 5B7VA 4DEIA 2JFMA 3TWJA 1NW1A 1R1WA 3EQIA 5G6VA 2JD5A 1ZOEA 2WEIA 4WG4A 3II5A 2UW6A 2RFDA 2HZ4A 3A4OX 5K5XA 3BLHA 4YTCA 2Z7QA 1OKWA 3JS2A 4AA5A 2UW7A 2XP2A 5IA5A 1WMKA 4I94A 2X8DA 1FQ1B 3OXTA 4F70A 1NVQA 4BDIA 3GUBA 5A4LA 4KUJA 2W5BA 4XUFA 4ENXA 4GYIA 2QLQA 3H3CA 3HUCA 3HKOA 2VN9A 2C5VA 4EKLA 2GPHA 4UWYA 1J1CA 3IW4A 3OY3A 4IX5A 4PQNA 4QMPA 2XNOA 5B2MA 5FP5A 1APME 4CLJA 2RG6A 1XH9A 1ZOHA 4LRJA 3ORLA 1O6YA 4QP3A 3ZSHA 1HCKA 4OTFA 4ALWA 2PZ5A 1YXTA 3BEAA 2NPQA 5CEPA 3SAYA 4UZDA 3RTPA 3ZUTA 2WMUA 3E92A 4IHPA 2WTWA 1Q99A 3UZRA 3VS2A 5EM5A 4AOIA 4M12A 4N0SA 3TKIA 4G16A 5DEYA 1Y8YA 1NA7A 5EKNA 5J9YA 3OD6X 4OW8A 3HA8A 5H8EA 5AR4A 3ATSA 3IKAA 2VO0A 4DE4A 3WZUA 2R3HA 1YVJA 5CNNA 5L2IA 1FGIA 2AUHA 2CDZA 4H1JA 1OL2A 4TXCA 4IWOA 3CD8A 2XNGA 3UO4A 5AUZA 4ANMA 2A27A 1OIRA 3W55A 4NKSA 5AAEA 1STCE 2Y4IC 2C30A 4K2RA 1U5QA 4L44A 3IS5A 2C3KA 2A4LA 4JNWA 4ZSLA 3LLAA 3NZ0A 3FKOA 2OH4A 4QMLA 2OBJA 2UZUE 5ANIA 3OXIA 3NYNA 3TUBA 4BHNA 3ET7A 4S33A 1V0PA 3UP7A 4NFNA 5HCYA 5A4QA 1UU7A 1RJBA 3IG7A 4GT4A 4AN3A 4D1ZA 3DAKA 3UOLA 1XBBA 3FC1X 4BI0A 2Z2WA 5DA3A 3V5PA 3NPCA 4GT5A 1VEBA 4FTAA 2A1AB 4PF4A 3ZEWA 3PIYA 2XA4A 4OTHA 5K4IA 4ERKA 1XBCA 4FEWA 3IDPA 3NNXA 4ZTHA 3VW8A 3G90X 4RWIA 4OTDA 4BZDA 2XNMA 4ZTQA 3AOXA 1MRVA 4B9DA 4KBCA 3EFLA 4M0YA 5DT3A 3C1XA 3OCBA 4DLJA 2NRYA 4FL3A 5C26A 5DVRA 3G0FA 4TL0A 3N51A 3THBA 3TKUA 5BX0A 4W8EA 4U5JA 1PRYA 2R3LA 3QX2A 4O7VA 4C8BA 2OJGA 3VS7A 2VTJA 4GJ2A 3LOKA 5BMMA 3OEFX 4YSJA 3EQCA 2VTSA 4L9IA 4F6UA 2WNTA 2ZV7A 3SOAA 4O7ZA 2KTYA 4CD0A 2W5AA 4ZAUA 2C0IA 3HLLA 3C4FA 4MXZA 2VWBA 4NW5A 3U6JA 2R3MA 4JR3A 5LQFA 2YHVA 3QTXA 3CJFA 2C47A 3KRRA 3H10A 2PMLX 2QU5A 3H9FA 2UW4A 2W1CA 3DXNA 3O71A 3R2BA 3R7GA 3F7WA 2YLEA 4NM5A 2VTHA 3R8LA 3WIGA 3R73A 4G1WA 4G5JA 1J1BA 3T9TA 4NWMA 1WVWA 4JR7A 4YSMA 3ZC6A 3ZM4A 5JFSA 4KIPA 4RRVA 3EIDA 3ORMA 4GYGA 3W10A 4E3CA 3JR1A 3P7AA 1H08A 3MYGA 2C6MA 2PE2A 2PVHA 4U43A 2IO6A 2HELA 2ZMCA 3NAYA 4RC2A 3TNWA 5M44A 1WBSA 3RK7A 1HCLA 4BN1A 4L00A 3LW0A 3P86A 2VO3A 3W18A 5BPYA 2QQ7A 3JVRA 4AAAA 1U5RA 3QZHA 2W06A 4FR4A 4J52A 1J7LA 5JQ5A 4JQEA 4BC6A 3L9MA 4E5WA 2GQRA 4BR3A 3BCEA 2RFNA 4II5A 3U4UA 3FLYA 4U97A 4AXAA 3PA4A 1OBDA 1URWA 4GG5A 4S30A 3BWJA 1ZMWA 5ICPA 3RI1A 3D5XA 5IF1A 4O84A 3HAVA 4EONA 1JBPE 5IA2A 3FUPA 4EUUA 3Q9XA 3R9NA 2CNUA 3OT3A 3S4QA 2HXLA 3F5GA 2P2HA 3QAME 4JIKA 1PXIA 3UTOA 4DH1A 5LVOA 4K1BA 3R7VA 1OM1A 4WNKA 1UU9A 3B8QA 3MVMA 4PUZA 1YWRA 3KFAA 4XHKB 5C8MA 2GFCA 5TE0A 1CKJA 4D2TA 5HE0A 4QP4A 5HE1A 4FTMA 4A06A 1O6LA 3L8PA 4IAAA 5FG8A 2ETRA 3OOGA 4ZTRA 5KMLA 3QZIA 4TPTA 2HW7A 1F0QA 1QL6A 3GXLA 1KE7A 2GNIA 5FDPA 2ZAZA 3ATTA 4FG8A 4EOJA 4BF2A 4XV2A 2HYYA 4A4LA 4ZTNA 1IAJA 2PZYA 4CLIA 1EH4A 5HTIA 4ARKA 5JKGA 2PULA 5M4UA 2EB3A 4WSQA 3A7HA 3RZBA 3QA8A 1BI8A 4HCTA 4U8ZA 4FT7A 2CKEA 5EM7A 3RWPA 4FTTA 4C4HA 2X4FA 1CKPA 3ZBXA 3E3BX 4H3QA 2R3NA 3LFQA 5HVJA 4RT7A 3DCVA 4ACMA 3QTUA 2G01A 2XH5A 3D83A 4BGHA 4DBNA 4DINA 1ZAOA 4IAIA 1WBPA 4RJ4A 1PHKA 3N9XA 5CF5A 5IEXA 3KN6A 4XG4A 5CZHA 3QLFA 3VF9A 5HNIX 3DFCB 4EC9A 1M7QA 5B2KA 3DLSA 4KINA 4CKRA 2R0UA 3A2CA 2EXEA 5E1EA 4V01A 3OT8A 3TXOA 3Q32A 3F9NA 3M2WA 4IAYA 3O96A 4O7YA 1T46A 1FOTA 2V0DA 5AV1A 2QO2A 3F2NA 5LVNA 5IEYA 4FSUA 1YDSE 5D10A 4FV5A 2XKEA 1YWNA 3OTUA 2GHLA 2OIQA 4UV0A 5CF4A 5HIBA 5AP7A 2YM7A 3QZFA 5D7AA 4O7NA 3RALA 3T8OA 2X7FA 4UEUA 2OXXA 3R2YA 4BCFA 4FIFA 4G3DA 5M57A 3LKMA 4EOQA 3BYVA 4Y5HA 4FTQA 3VS3A 1PXMA 4IE9A 4NUSA 3Q4CA 5BVWA 4H05A 2PMOX 5AAFA 3UYSA 5ANEA 4QPAA 2UW9A 2WTKB 3NW5A 2ITTA 3QX4A 3EB0A 4GL9A 3IW6A 5ETFA 3WI6A 5ACKA 4F7LA 3TUDA 3TDWA 2X7OA 4FV8A 1ZMVA 2Y4IB 3HRBA 3DXPA 3C51A 3RM6A 4U44A 5L6PA 3QHWA 3BIZA 3GT8A 5HG8A 3S3IA 4DGMA 4EEVA 3WF6A 3AGLA 2Z7RA 5M53A 2C6EA 5EI2A 5LMBA 1Q3DA 4HYSA 4MK0A 5BYZA 4NKAA 1Q41A 3E62A 5J8IA 1PXPA 4O0WA 3WF8A 4A9RA 3JPVA 1PYEA 4HVDA 2CKOA 2PSQA 3EQPA 3VUDA 5E91A 3C9WA 4HVIA 1UA2A 5A4CA 3VRYA 2VTMA 4OR5A 3LMGA 4FE2A 4APCA 4G3EA 5IUHA 1YKRA 1Q24A 1TVOA 5K9IA 3DDPA 2ITUA 1LR4A 3G0EA 4M3QA 3K3IA 1R3CA 4ITHA 2WMSA 5I3OA 3Q2JA 2C3IB 2QD9A 4GRBA 4DHFA 5GINE 3OEZA 5CASA 5ETAA 4R7BA 4HOKA 5CAVA 4YJTA 2WU6A 4HCVA 4HYHA 3RZFA 1UU3A 1YQJA 4QMQA 4IBMA 4PDOA 5E8TA 4HCUA 3GCSA 2WQBA 4EWHA 5KX8A 3B2TA 4EOIA 4M84A 2ITYA 3RPYA 4XRJA 3OWLA 4DF3A 5G1XA 4GFGA 3SX9A 2GQGA 3D7ZA 4FYOA 4DAWA 5TT7A 3CC6A 4BYIA 2OFUA 3DT1A 4QYHA 5BVOA 4GW8A 5JK3A 4HZSA 3W33A 1R0PA 2CCHA 3E8NA 1PXNA 3QXPA 4YJOA 4DLIA 2YISA 3F5XA 4ZZOA 3OTVA 3ZRMA 3NCZA 4QMXA 1PMVA 5BQ0A 3NVMB 3SXSA 3TIYA 3I1AA 4UMTA 1Q4LA 3ETAA 2Z7LA 4BDAA 3MJ1A 2XK4A 1NVSA 3A7JA 4KB8A 4BCOA 4DFLA 5HIEA 1XQZA 4EORA 5CU0A 2OU7A 4TYJA 4S34A 2PZPA 1WBWA 2W99B 4EHGA 2C6LA 3ALNA 4Y83A 2I40A 3P23A 2PUIA 1V0OA 4I1ZA 3F7ZA 5H8GA 2RKUA 3E8CA 3IECA 3Q5ZA 3FPMA 1Y91A 2WMVA 3COIA 4JS8A 4MF1A 4E93A 3HGKA 5KKRB 1XWSA 2I6LA 3GCUA 4AS0A 4GK4A 2XK6A 3TM0A 3QQJA 2WAJA 5JGBA 3G15A 3DKFA 3POOA 4W4YA 4C02A 5CI6A 3M42A 3R02A 5DT0A 2C3LA 5BNJA 5IH5A 4YJNA 1MQ4A 4FZFB 4MYGA 5FTOA 3UNJA 5E4HA 4Q5EA 4JDHA 1Z9XA 3VNTA 1XKKA 2NP8A 4Z7GA 2IWIA 3AC1A 3OMVA 2OJ9A 2IW9A 3FZRA 4PTGA 3UVQA 5CEOA 3VWAA 4FSNA 4USEA 1H24A 3QTIA 3ORTA 4I0SA 2UZLA 3PP0A 4R3PA 5FTQA 3ZLSA 3OCGA 3TTIA 3DDQA 3KRLA 4FIIA 4L3LA 4YR8A 3DB8A 3EYGA 4O38A 3ITZA 4D2SA 5E92A 1GIIA 4JOAA 1WVYA 4HYIA 4O0TA 2B9JA 2EXCX 3W1FA 3ZLXA 3OUKA 3HMMA 5DG5A 4MHAA 3DJ7A 3UPXA 3V8TA 4AFEA 4EI4A 5L2QA 2GS2A 2W4JA 2VWUA 4WUNA 4BTJA 2BIKB 1OGUA 3ZMMA 4I0TA 3KXMA 3MJ2A 2XNNA 3LHJA 4JIAA 4RSSA 3EFWA 1G8SA 1Q8UA 4QQJA 3QUPA 4DCEA 1UWJA 4FVQA 4YLLA 4YZCA 3VBXA 5L2SA 4MVFA 3DB6A 3I5NA 4PMPA 3R8VA 4LM5A 2CCIA 3MH2A 3PPJA 2GHMA 4TKSA 2OJIA 2XYNA 1M2RA 3QD0A 2ACXA 4XP2A 3GC7A 2XM9A 4E6CA 4QQ5A 2C4GA 1OPKA 3ZC5A 1GY3A 5I9XA 3TL8A 5AA8A 2XRWA 4LL5A 2FSLX 2WQEA 5JT2A 3Q96A 1ZOGA 2HY0A 5CYIA 3W2SA 4CKIA 1KWPA 5AV4A 4E7WA 2WHBA 2A0CX 3LQ8A 2JAVA 3E5AA 1YOMA 3KA0A 5JH6A 3A61A 4R78A 5LMAA 3R0TA 2VX3A 3LIJA 5D1JA 2YITA 4U41A 3PJ1A 3MH1A 2X9EA 3LFAA 3QWKA 4FEVA 3U9NA 4D1SA 3VJNA 4YLJA 1H8FA 3P9JA 1H27A 4I93A 3UYTA 4R6VA 3LQ5A 3RJCA 5KUPA 2XJ2A 5LWMA 3OCSA 3BV3A 5AR8A 5KZ0A 3RNYA 2F49A 1M7NA 4IDTA 4FVPA 3F3TA 3I0OA 1YOJA 3OS3A 4U45A 4H3BA 5J95A 4CRLA 1O9UA 3FSKA 3LCKA 4C57A 5CAOA 1JKKA 3C4WA 3EQDA 5AEPA 1YHWA 2R3IA 3L8VA 1W7HA 5JZJA 4FG7A 5CQWA 3TCPA 2R7IA 4M66A 4C3RA 3OUNB 2FB8A 4AT3A 4KRDA 5D12A 2PPQA 3PSCA 4EYJA 3QGWA 4EH6A 3PA3A 2WTDA 1KE8A 3UZPA 3H4JA 5M06A 5ANJA 3QFVA 3EQFA 4Q2AA 5EQYA 1JPAA 2VTRA 4FX3A 4GVAA 4JRNA 3AGMA 2J6MA 3VBWA 1PXKA 2XCKA 3AXWA 1H28A 5HG7A 3A7GA 2BDWA 2P33A 4ID7A 3H0YA 4TYHB 5CVHA 1GNGA 4QTBA 2WGJA 4YO6A 3O51A 4IVCA 3JY0A 3Q53A 4ACHA 2BFYA 2Q83A 2I0YA 4UMPA 3EFJA 3HVCA 2C69A 3O8UA 3TZ7A 3ZO3A 3MN3A 5CX9A 5EDRA 4YURA 1Q61A 2EUFB 3PE2A 1XH4A 4Y46A 1WFCA 2RL5A 2VTIA 1PF8A 3DK3A 3GC8A 2R64A 3TNIA 4HGLA 3A99A 3IGOA 3VS6A 1KV2A 3VQHA 2OFVA 2PVJA 2CMWA 4PPCA 1FINA 1IAHA 4CSVA 1QPEA 3BLQA 2R7BA 4DC2A 4R7IA 1ZY4A 4NTTA 4AN2A 2PVMA 4LOQA 5TR6A 2OW3A 3GU4A 4KBAA 4AG8A 2ITPA 3UBDA 4AT5A 2ITZA 1Q5KA 3HNGA 1UWHA 4RJ3A 2BAKA 3FLWA 3GNIB 4M7IA 5EH0A 4BTFA 3REPA 3R21A 3C0HA 3LFCA 5F95A 2WIPA 1IASA 3FHIA 1YOLA 1XBAA 2F2CB 4ONAA 3SXRA 5ETIA 2O63A 4RWLA 3PVWA 4XBUA 5KZIA 5HLWA 2WU7A 5K5NA 3F5UA 3AG9A 3ORNA 4IFGA 4DFXE 3MDYA 4EHVA 4CRSA 3U54A 3GGFA 2W9FB 5GZAA 2XF0A 3F69A 3HX4A 1Y57A 3FV8A 4PY1A 5E8ZA 4DA5A 2UV2A 3OW3A 4NCTA 3ZHPC 5K0KA 4F9CA 3QCSA 3ZS5A 3HMNA 4Y85A 2JKKA 5E7RA 4DGNA 4YJSA 4ZSAA 4IW0A 3KVWA 3Q2MA 2QOCA 4P90A 3EQRA 4RIWA 3UG1A 5F9EA 5HX8A 5I9VA 1PXOA 4IVAA 2HK5A 2QO9A 3HRCA 4I41A 4YNEA 5CXZA 1VR2A 3QRKA 4ASEA 4KS7A 4RX7A 4DT9A 3KRJA 5CALA 3FMJA 4O21A 4YLKA 3WZDA 4QRCA 4FTLA 4YJPA 3RVGA 4O82A 2H6DA 4CV9A 1LUFA 3IK3A 4O27B 4C3PA 2IZUA 5D7VA 4MXCA 3IDBA 2XIXA 4WSYA 4BKJA 1Q62A 5J9LA 4EH5A 2R4BA 3MB6A 4MTAA 4YHJA 4XYFA 4HZRA 3HL7A 4DGOA 2W96B 4X0MA 4YTIA 4Q9SA 3TUCA 3KCFA 5DOSA 4DTKA 4BCQA 4EOSA 1REJA 5HG9A 4RVMA 4UN0C 5EW9A 5FEEA 1UV5A 2G15A 2X0GA 2O65A 3GFEA 4H36A 3K2LA 1YXUA 4D0WA 4JG7A 3NWWA 5EDPA 2PL0A 3EJ1A 2XEYA 4M69A 4DCAA 5HIDA 3L1SA 4FKSA 4I6HA 5LOHA 3QZGA 4QTAA 4LRMA 3RK9A 4E8AA 3UIXA 3SVVA 2BRNA 4F9BA 1GAGA 1WCCA 4FOCA 5IQIA 4U3ZA 4D2WA 3Q5IA 5EI8A 4NCTC 2JEDA 2VZ6A 4FV9A 4H3PA 1OECA 3OZ6A 3LXKA 5IPJA 4I3ZA 3ENHA 4A9YA 2HY81 5E90A 3A60A 4F1TA 2UZOA 2YAAA 3D14A 2V55A 1QPJA 4UXQA 3E7OA 4O7RA 2OICA 2X6DA 2JITA 5HO7A 4TWNA 4DG0E 4QMVA 4FKLA 1OPLA 2XNPA 4FKUA 4XG3A 4WKQA 4OT5A 5FQDC 5L8JA 2QOIA 3ORIA 3R63A 5HO6A 2OIBA 5IQHA 1H1QA 3KL8A 1IR3A 3LFNA 3C5IA 3NCGA 2R2PA 5CNOA 4AOJA 5LVLA 3OP5A 4IZ7A 1BYGA 5FDXA 1V0BA 5E8SA 5BVNA 3IDCA 5IKWA 2XS0A 4CMOA 4D58A 3UNZA 4DEEA 4J98A 3FLZA 2JBPA 3VS1A 4JDIA 3TZ9A 3VJOA 4GCJA 1BUHA 4R1YA 4E4MA 2ZDTA 3AT3A 5D11A 1ZXEA 3FMMA 4BCGA 4FK3A 2UW0A 2JIUA 4M67A 4AP7A 3C13A 3W8QA 3FAAA 2QI8A 3MVLA 2XBAA 4C2WA 4RJ7A 4I5HA 2ZM4A 4NSTA 3SV0A 3R6XA 2BKZA 1PXJA 3GU6A 3HV7A 3QXOA 4DH5A 4R3RA 1JWHA 3F3WA 4J1RA 2YDIA 4E6DA 3CTHA 5HOAA 3KB7A 2WXVA 4ZSEA 5EYDA 3T3VA 2CKPA 4N6YA 5FGKA 5JFWA 4G31A 1TKIA 5AP1A 4UWCA 5GIOE 5FXSA 3V5QA 1I44A 3UQGA 1PXLA 1SVGA 5E9EA 2VWXA 4BI2A 4MWHA 5C1QB 1YWVA 4DG3E 5A4EA 2WPAA 2H9VA 3WF9A 3BE9A 3MIAA 3CEKA 4KAOA 4L45A 4TNDA 3ALOA 2WTIA 3P4KA 3BPRA 3EN6A 3ZDUA 3TV4A 1HOWA 1U54A 3OG7A 3MIYA 4ZJJA 2QOQA 4ZJVA 4IWQA 4EH9A 1DM2A 3SDJA 3DNDA 3P5KA 4EJNA 5IA3A 4D1XA 5AR7A 2QHMA 4YJQA 5FM2A 3QU0A 2XJ1A 1SNUA 3UJGA 1H0WA 4N6ZA 3VHEA 4LMUA 4WA9A 3VIDA 4RPVA 4TWPA 4Y5QA 3FI8A 4CCBA 3PRIA 4IQ6A 4F7JA 3CY2A 5A46A 4PP9A 3LXLA 3OWPA 3MSSA 4AOTA 2JFLA 1A9UA 4FV6A 2ZB1A 3OCTA 3FY2A 5CF8A 4AT4A 4WG5A 5I9UA 1G8AA 4F9WA 4BDBA 2JAMA 2BZHB 5EOLA 4QP8A 4E5BA 4R1VA 2BR1A 3D15A 1ERKA 2WMTA 3DBDA 4QP1A 4KD1A 3DQXA 4IZYA 3MTFA 3WYYA 4U9AA 4FT9A 4CYIA 2W1EA 4FGRA 2W4KA 1VJYA 3KXZA 4A9UA 3QTQA 1CKIA 3W2PA 2BZKB 2YCFA 3S2PA 2BUJA 4NEUA 4C4FA 2OJFE 1T45A 3WF7A 3EN7A 5IH6A 4CG9A 3U87A 5I4NA 3FMKA 4I6FA 3FZTA 4LGDA 5EI6A 4BCNA 3TZ8A 2YA9A 4QP9A 4PNKA 2V5QA 3R1SA 1BX6A 4FI1A 2BRGA 4ANQA 2WTKC 4XP3A 5JFXA 5L2WA 4GU6A 4NZWB 2XNEA 4YU2A 4AE6A 2G2FA 4RC3A 4QNYA 2PMNX 4L6QA 3EN5A 5DBXA 3NNVA 5IA0A 1J3HA 3EOCA 1OITA 1URCA 4CZUA 4EBWA 2VAGA 4L68A 2W4OA 1UU8A 3KK8A 4XG2A 5LCKA 2SRCA 4BCHA 4ANNA 3RP9A 2VX0A 3UOJA 4XP0A 1OBGA 5KNJA 2HXQA 3VUMA 3SA0A 4ZLOA 4QMYA 2JDTA 3MBLA 5IQGA 3R9HA 4IMYA 4BDFA 2A2AA 2YZAA 4I23A 4K9YA 3KREA 4RWKA 5H3QA 4BTKA 2FH9A 2ZV9A 3GFWA 4RQKA 5HTBA 4U0IA 4WNPA 2Z60A 3TV6A 3LFDA 4RX5A 4KWPA 3TJCA 5A14A 4MXXA 2J51A 1WBOA 4WRGA 5KHXA 3ACJA 3L8SA 4AU8A 3PE1A 2ZOQA 4A9TA 5I3RA 3IPHA 4C3FA 1WBTA 2OI4X 4OTRA 3MA6A 3DKOA 4QMMA 4QOXA 2A19B 3KXHA 4RVTA 3BYSA 3EHAA 4GIHA 2FYSA 4RIWB 5K3YA 4AX8A 5BVDA 4J96A 4HVHA 4F9YA 2ZV2A 4XS2A 5CTPA 4TYGA 4GFMA 4BGQA 3GC0A 1BKXA 3V01A 5GJFA 3BU6A 3BU3A 2QVSE 4IVBA 4OBPA 3HV3A 1OL5A 3FZ1A 4OLIA 5CQUA 5HD7A 2EWAA 3TV7A 2CJMA 4BY9E 3GU8A 2IZTA 3L9NA 5FEQA 3EL8A 4WBBB 1R39A 2C1AA 2OIDA 3BGZA 3D94A 4IAKA 3ULIA 4FTIA 3WARA 4Z55A 5AWMA 5GJDA 5AUYA 1OB3A 1OIUA 4ZS4A 1FPUA 1JAMA 2C5NA 4FV2A 4BCMA 1V1KA 2EU9A 3PY1A 3GC9A 2J0KA 3RNIA 4OAVB 3CLYA 1ZYJA 3LM5A 3UC3A 4LG4A 5AR3A 1GZOA 4EZ3A 3PLSA 4L7SA 3W2CA 4FG9A 5EYKA 3FKNA 4FIHA 4YP8A 2QLUA 5KKRC 3P1AA 4O7LA 4M69B 5J7HA 4X21A 4CEGA 2F57A 4RFZA 3NUPA 4UBAA 5HQ0A 2XK8A 4LRKA 5AV3A 4JX7A 2GSFA 3PUPA 4KS8A 3G33A 3W2QA 3EKKA 2BRHA 3GU7A 2GNLA 4OBQA 2XCHA 3FJQE 3FLSA 4J7BA 4BB4A 3UC4A 3ZU7A 1OKZA 3V6SA 4Z16A 2VTAA 4FTJA 2X1NA 1SYKA 2BRBA 3R1NA 3HP2A 3NIZA 4MX9A 4PNIA 5A6NA 4AGUA 4XV9A 3CGFA 2B52A 2HCKA 5I9ZA 5KE0A 5BVEA 3M1SA 3D4QA 2IVVA 1W83A 3TZMA 4CT2A 1B6CB 3ANRA 3JY9A 2AC3A 3RPOA 3MTLA 2VWIA 2BVAA 2XEZA 4NM0A 4ZTSA 3RPSA 5L4QA 3FEGA 5AMNA 4DEDA 3UQFA 2YZLA 5BUIA 3TDVA 3PP1A 2JDOA 2E9PA 4EOPA 3R7OA 4RZWA 2OZAB 2OXYA 5HNBA 5IQFA 2J2IB 3V5WA 4AWIA 2PUUA 3E8EA 5CSHA 2VTOA 3FMNA 3BYUA 4QMUA 3TEIA 2J0LA 4YHTA 1TQMA 3CTJA 3QALE 2YM8A 3BE2A 4RFYA 3WYXA 4DTBA 3FXXA 2RF9A 5JQ8A 3LLTA 3FI4A 5IUIA 4TYHA 2PVRA 3M11A 4HJOA 3SQQA 1CSNA 1GIJA 5CY3A 5EDQA 4GFOA 5L2TA 3VW6A 4CVAA 5DR2A 3D5WA 3MWUA 4RC4A 2CNQA 2CGXA 1I09A 4RBLA 3PDTA 4GKIA 4ZEGA 4J99A 4PP7A 3R01A 2ITWA 1IRKA 4NH1A 4YJVA 4HNFA 4AW5A 4I21A 4EH8A 4ZZMA 3VBQA 1OVEA 1JKSA 5DFPA 5A4TA 1WVXA 4O83A 3VUKA 3NUYA 3G51A 2CNVA 4L01A 4LQMA 2BZIB 3KGAA 2W5HA 3PWYA 4BIDA 4C37A 1OL6A 1J7IA 3TTJA 4FZAB 4DG2E 1GZ8A 1YDTE 3Q4ZA 3ZO2A 5AUXA 3R04A 4C61A 4ORKA 1NT2A 2ZV8A 5EQPA 1Q8TA 1DI8A 1XH7A 4UYAA 3RMFA 3I79A 3JYAA 1U54B 1YDRE 4GK2A 4PL4A 5ANKA 3KF7A 1R0EA 2DS1A 4IVDA 4KIQA 4RQVA 3JUHA 3VRZA 1GZKA 5DH3A 2H8HA 2VV9A 4PMSA 4O0YA 4D2VA 3AMYA 1H1WA 3QC9A 4UMQA 1OPJA 1BI7A 2JKOA 3UPZA 2DUVA 3GQIA 1IG1A 3FYJX 1YXXA 3IW8A 3MESA 5AP2A 2R5TA 3NS9A 2YWPA 5AIKA 2QG7A 4YJUA 1OKYA 3PFQA 2AYPA 1OZ1A 3DA6A 3MFSA 3ORZA 3VF8A 1PMNA 5AX3A 4DH3A 2GNGA 5EKOA 2CGWA 2FVDA 1CMKE 3UDBA 3UMXA 4G9CA 2XKCA 3LFBA 4CFNA 5HESA 4RZVA 4YZNA 4CFUA 1M2QA 4UX9A 2V62A 3BHUA 4EK5A 4J8MA 3UO5A 3CKWA 4EHZA 4QMTA 1M2PA 1A48A 3K5VA 3R9DA 4FTOA 2XIRA 3F88A 3FWQA 4I5PA 4RGJA 2JBOA 2E2BA 2C5XA 5DEWA 1S9IA 2O8YA 5HG5A 3TN8A 2PU8A 5CU3A 2Q0BA 3O17A 3NVKI 3KN5A 4IB1A 4AW0A 3E63A 1IA8A 4EUTA 5KHWA 4BWKA 3CGOA 3ZO4A 3LJ2A 2YDJA 3SHEA 3PG1A 4RFMA 2QKWB 3VO3A 2Y7JA 4GU9A 2HIWA 3KQ7A 4R8QA 2C6DA 5IDPA 3AMAA 3NUXA 5HBHA 3CBLA 2IN6A 3ZCLA 1KOBA 3ZLWA 3O23A 2RGPA 4S2ZA 3P7CA 4CMUA 4X2FA 3ANQA 3NW7A 5DR6A 4TNBA 5IQBA 3N4VA 2XUUA 3DOGA 2G1TA 3LPBA 4ZP5A 3A7FA 2BFXA 4FSZA 3RBWA 4PPAA 3DQWA 4WNOA 2V7AA 3ERKA 2YABA 4BCIA 4U42A 4O0UA 2WMQA 2WOUA 5IZFA 5HKMA 4BZOA 4PL3A 2I0HA 4QP6A 4XEYA 3ZZWA 4D5HA 4D4RA 3RPVA 3QC4A 4DH8A 4EQCA 4FA2A 5L6OA 3ZH8A 3QD3A 2WZJA 4EOLA 5AX9A 2F7XE 3L9LA 2BMCA 3LCOA 5AA9A 1RQQA 1QCFA 3DFAA 5F4NA 4G6LA 3GOPA 1JSUA 4MH7A 3TT0A 4CFWA 2YERA 4F1OA 2IVTA 5DI1A 3BGPA 1H0VA 2PE0A 2YACA 2VUWA 1W82A 4GG7A 4AZVA 4F65A 2XIYA 3UZTA 1E1VA 2FSMX 1H1PA 2GQSA 4IXPA 5CEIA 4USDA 2YM3A 2XBJA 4U80A 4DEAA 1VZOA 2HWOA 5FRIA 4E73A 4FSYA 4ZXTA 5GZ8A 2B0QA 3O8PA 2VD5A 2YCQA 3ZFMA 4TYIA 3HMIA 4PRJA 3SLSA 3SOCA 2XK3A 4CV8A 2BHHA 1H1SA 5E1SA 5C8NA 4O0VA 4OTIA 5AR5A 2JIVA 4L67A 1LP4A 1SZMA 2WMAA 2R3JA 3FZSA 3MPMA 2ESMA 3OBGA 4KSQA 5HE2A 5F1ZA 3ULZA 2R3RA 3WZKA
chains in the Genus database with same CATH superfamily
3QBNA 1JSVA 3NYVA 4YMJA 4QTDA 3VC4A 4HNIA 5JZNA 5IUGA 3OFMA 2ZMDA 2B55A 2R3OA 5C4LA 2F7ZE 3DJ6A 2OF2A 4G3FA 3I7CA 3CS9A 4KKHA 5AM6A 4U7ZA 3R7EA 4FEUA 2OZOA 4IAZA 4G34A 3DZOA 2ZB0A 4XLVA 3PJ3A 3NR9A 1CM8A 2REIA 3I81A 4MD7E 4NM3A 2J5EA 4YBJA 5CEQA 3UOHA 3MW1A 3RHKA 4YUQA 5TOZA 4RA5A 5E8WA 4BBFA 4LV8A 4J53A 2X8EA 4RJ5A 2LAVA 4FSRA 2WMRA 2Z02A 3R8UA 4ITJA 2WOTA 4NT4A 4TY1A 5K0XA 3L9PA 5M07A 2BILB 1B38A 3OROA 4JT3A 3FSFA 3CJGA 5B0XA 2QO7A 3JVSA 4QNAA 3C4XA 1NY3A 2UZWE 2W9ZB 4RMZA 4ZY6A 2ONLA 3LFSA 3U9CA 2AEGA 3C0GA 2Z7SA 4IM2A 4DYMA 3DLZA 2FGIA 2C5YA 3Q3BA 2I7QA 4JI9A 5CEMA 4CKJA 2BRMA 2G2IA 4DGGA 5J5TA 3QRTA 4O6EA 5M4IA 3F66A 3KC3A 4K77A 4GIIA 4M8TA 1W0XC 2PYWA 3BL9A 1RE8A 4JBOA 4FOBA 2JDVA 2Z8CA 1OI9A 4IFCA 5EHLA 4C58A 3EFKA 4RX9A 3R8MA 4JG8A 2XALA 3TACA 2OH0E 4EC8A 5BYLA 4YZ9A 4L46A 3OW4A 4EK4A 3H9RA 4CFFA 2PTKA 4FL2A 5IA4A 2BDFA 2PVYA 3NUUA 2QOKA 5IISA 3E93A 3BELA 4G3GA 3KEXA 4WIHA 5CT0A 5AUVA 1XR1A 4X3FA 4G5PA 3NUSA 3R7UA 5C8KA 5AM7A 2YAKA 3MS9A 5KMNA 3ORPA 4IH8A 4R3CA 4E6AA 3BHVA 4YO4A 3R9OA 3R9RA 2VGOA 3DTCA 4FC0A 5DLSA 1ZRZA 3R1QA 3Q9YA 4KABA 4B8MA 4IEBA 3QCQA 3ZUUA 4IIRA 4C34A 4NJ3A 4QPMA 4BZNA 3MPTA 4EYMA 5H9BA 1TQIA 2PE1A 2GNJA 1UVRA 3FQSA 4NU1A 2YEXA 3A7IA 3PXQA 4DH7A 5JRQA 2BTSA 2YM4A 3CY3A 3JXWA 5FBOA 4MF0A 2O64A 3EKNA 4Y72A 3K54A 4Y95A 2ETMA 4F63A 2XJ0A 2PWLA 4QP2A 5HX6A 2JC6A 3G9LX 2ONLC 3MA3A 3UVRA 3UQCA 1ATPE 4I6BA 2XVDA 3RINA 2ZM1A 3C7QA 3A4PA 4FNYA 3FZPA 2HW6A 4XH6A 4F7NA 4KRCA 4G6NA 4EHEA 2WD1A 3CE3A 3IO7A 5EHYA 4EH3A 5C9CA 4U81A 4ASDA 3S95A 1P5EA 4OTPA 3WBLA 4ANOA 2Y4PA 2YIQA 5M56A 1FVVA 4GK3A 3ZFYA 3CKXA 1SM2A 2W1FA 4R5SA 4EOOA 5IQAA 3KKVA 2IJMA 2VWYA 5GJGA 3BYMA 4FEQA 1VYZA 2UZTA 1YI3A 4FKRA 3ODYX 3QWJA 4APPA 3KMWA 3NRMA 3CTQA 4U3YA 3I0QA 3KXXA 2VTTA 5HLPA 4PL5A 4FTUA 2UZNA 3CQUA 3D9VA 1ZMUA 3G6HA 4ASZA 4AGDA 1YHVA 4FZ6A 5M51A 2RG5A 4X3FC 4UXLA 2W17A 1XH5A 4AF3A 4EL9A 3WE8A 3DU8A 2IVUA 3FLQA 3E87A 5KBQA 2YM6A 2C3JA 4GUBA 3V3VA 4EK8A 1ZYSA 2BHEA 2GNFA 2BAQA 2WTCA 3QGYA 4ENYA 3PJCA 2HZ0A 2GTMA 5HICA 5FTGA 5HGIA 1F3MC 4ZK5A 2WQNA 4L52A 5LWNA 2IG7A 3ZM9A 1YW2A 3I4BA 2WEVA 5J9ZA 1PY5A 5AAGA 3F82A 5TF9A 1OIYA 3ELJA 2G2HA 4XNEA 2W7XA 3Q9WA 4F0FA 4BIEA 2X7GA 4IWDA 4ACCA 5I9YA 2KULA 3IW5A 1PYXA 3DTWA 3VVHA 3UIUA 4XMOA 1ZLTA 3LCDA 2GFSA 3FHRA 5FXQA 1JOWB 4BDDA 3CD3A 4G17A 3HRFA 5ACBC 3FMEA 5BVKA 2BPMA 3V6RA 2WB8A 4AACA 3NDMA 3NAXA 3QCXA 4XG7A 3ZDIA 4IAFA 3RCJA 5L8LA 3D2IA 3PZHA 3K3JA 4F0GA 1FGKA 2UVZA 3A8WA 3LFFA 3RHXA 1XHAA 2ITNA 3PWDA 2W1ZA 1Q3WA 2X2KA 2XIKA 3F2AA 4GMYA 2QC6A 4PMMA 2XM8A 2C6KA 3A8XA 1FMKA 5AV2A 4B99A 2GMXA 3AC8A 1Q8ZA 3HMOA 4FSMA 4D55A 5J5SA 2J0JA 5DIAA 4M14A 5FD2A 5GHVA 3W2RA 2Y0AA 5LARA 3P78A 4DFZE 4AXEA 4YBKA 4CGAA 5L6WL 4KIKA 4I92A 4XCUA 1VYWA 4NYEA 3SG9A 3ZTXA 5HHWA 2LGCA 2B1PA 3G5DA 4AQCA 1MUOA 4LUDA 4AZFA 1P2AA 3ZRLA 5EM8A 4GKHA 2AC5A 5BV3A 2XMYA 3OHTA 4NL0A 3GQLA 2JKQA 4W4VA 4Z3VA 4YGAA 2BIYA 4BIBA 4GH2A 5KMKA 1U46A 4FIJA 3QUEA 4YZDA 1P14A 2PZRA 4LGHA 4O96A 4FGBA 5FP6A 1U59A 4FV1A 4L8MA 3OF0A 4MBIA 4FKGA 3UVPA 3UG2A 3GBZA 3DK6A 4DITA 4N70A 3WF5A 1Y6BA 3NX8A 4QYGA 4KKEA 4A7CA 3O8TA 3Q9ZA 2PVKA 5DMZA 4TYEA 1YRPA 4I0RA 4MKCA 4TZRA 3PXRA 2FA2A 4NM7A 3RM7A 2OZAA 3ORXA 3EWHA 4BDKA 4AZSA 2BKKA 3MFTA 1H25A 4WRSA 3EZRA 5HVYA 4MQ1A 1LEWA 4JXFA 3GU5A 4RLLA 5EHOA 3BLRA 4ZJIA 3B2WA 5AV0A 5DGZA 2O3PA 3BHTA 4E4NA 4QP7A 1REKA 1G3NA 4DGLC 2UZVA 1LEZA 3HUBA 3PPKA 2Y6MA 3PYYA 4IDVA 3CQEA 2YFXA 5I0BA 2YWVA 4AUAA 2Q0NA 2ITQA 3C50A 5T68A 2B53A 1UNLA 4G3CA 3COHA 4U6RA 4WBOA 4WUAA 1AGWA 2PVNA 3P08A 4X2NA 2GCDA 3FY0A 2W1GA 2UW5A 3W0QA 4XLIA 3TNQB 5HVKA 3C4ZA 4FEXA 4BWPA 3L8XA 4ZOGA 4F08A 1YXVA 4IANA 4ACGA 4LL0A 2VO7A 2DYLA 4CT1A 2WQMA 1JKTA 1B39A 5B2LA 5M4CA 5BYYA 2I1MA 5FUTA 5CSXA 3VS4A 3EQHA 4M97A 1MP8A 5AFVA 2CHLA 4UMRA 5EQEA 4QMSA 4M15A 2J4ZA 4JAIA 4AGWA 3F61A 5IMEA 5CU4A 1XH8A 2NNWB 3R7YA 4AN9A 4MXYA 4PDYA 4BDGA 3GP0A 3AD4A 2WMXA 4QD6A 4V0GB 3NMUF 3EMGA 2ITVA 4BGGA 3Q4UA 3R30A 2WTJA 4QYFA 4JLCA 4HYUA 4OAUC 3BI6A 3WZJA 3MPAA 1WAKA 5I5ZA 3U4WA 3BHYA 5A9UA 2PVFA 4DFBA 3PIZA 4BBMA 4DN5A 4Y73A 4DDIA 3C0IA 4IB0A 2QOHA 4XRLA 2B9HA 2CGUA 3SG8A 4AGCA 4Y8DA 3GOKA 4O4BB 2NO3A 5CS6A 2FSOX 2X2MA 3PXYA 5J87A 4X3FB 3U6HA 1YI6A 4QMWA 5IQDA 4MD9E 5LVPA 5EW3A 4AZTA 3AT4A 1OMWA 3KULA 3OC1A 3WOWA 3ZFXA 4ANBA 3QQLA 4C62A 5JMSA 2NYAA 2IW6A 1E9HA 1JLUE 2YIXA 5ANGA 2ITOA 2OXDA 2P55A 2WMWA 4HPUE 5T6KA 3HV6A 3I60A 3VQUA 5IU2A 3QCYA 4K18A 4ALUA 1UNHA 4IWPA 4PTCA 3VULA 1L3RE 4UZHA 4W8DA 4D9TA 3P7BA 4XG6A 2W1HA 2DQ7X 3WE4A 3MV5A 3MY0A 1H4LA 4FSWA 3BU5A 4GV1A 3SKCA 3ZBFA 5H8BA 4P5ZA 3F3UA 3Q6UA 3QQGA 2O0UA 4GT3A 1WBNA 2X9FA 4AA0A 2J7TA 4UYNA 4ZY4A 5D9HA 4O91A 4NJDA 4RIXA 4W4WA 4IJ9A 5IA1A 1K2PA 3SW4A 4CFVA 3DXQA 2PZIA 4BCKA 4C4EA 3SW7A 4FKJA 3FPQA 2ZYBA 4QQTA 1PMUA 3DGKA 3PFYA 4D4YA 4UY9A 4CNHA 4K11A 5M55A 4QDVA 1FBNA 4USFA 3FMDA 5I9WA 2V7OA 1OUKA 5HI2A 3RPRA 4G9RA 1M52A 3Q60A 3GENA 3EL7A 2QG5A 2GDOA 4FTRA 5FWKK 4DEHA 1QPCA 4L3JA 4F9AA 3VUHA 2BROA 5CVFA 5EOBA 3MB7A 4GEOA 3QQUA 3RGFA 4QO9A 4YTFA 4WT6A 4WOVA 3VBVA 1JVPP 2W0JA 4MNFA 5HCZA 4K33A 4Q5HA 3KU2A 2IPXA 2UZEA 2PUNA 3LJ1A 5EM6A 3PXFA 4W9XA 2JDSA 4B7TA 2P0CA 5KMMA 4B8LA 1G5SA 4J8NA 4FICA 2QONA 2FSTX 3EN9A 3QUDA 4LOPA 4W4XA 3DBCA 2YN8A 4AZWA 1OIQA 4F7SA 4K6ZA 2H96A 3ZLYA 2OSCA 3CQWA 4A9SA 4D2PA 3CXWA 5CT7A 4LYNA 3UIMA 4LUEA 5J1VA 4Z9LA 4DFYA 2R3QA 4D4VA 2X8IA 1XJDA 3PVUA 3FL5A 3KXGA 4CFMA 4C0TA 4TTHB 3LQ3A 4BRXA 3LE6A 3Q04A 4ERWA 3HMPA 1FVTA 1W2FA 4HW7A 3DS6A 4TWOA 2QHNA 4DT8A 5AUUA 3SXFA 4RG0A 3BZ3A 5KBRA 1U4DA 4YZMA 3QD2B 4A4OA 5GZ9A 4BHZA 1H00A 5J79A 3UP2A 3FXWA 1UKIA 5ITAA 1BMKA 1KV1A 3VUGA 3ROCA 1SNXA 1DAYA 4JDKA 5TKDA 4FZ7A 5JFVA 2PY3A 5HU3A 1MRYA 2UZDA 1IEPA 4L3PA 4XV1A 3ZXTA 2H34A 4FJVA 2YIYA 4V05A 2E9NA 4KBKA 5LXMA 2X0PA 3N4TA 3EYHA 4IX4A 4YJRA 2W1DA 5DR9A 4C4GA 4CTBA 2QOOA 1Q8YA 2CN8A 2R3GA 3QRIA 4AFJA 1SVEA 4KIKB 1ZWSA 1JQHA 3W16A 5CENA 4FKIA 5C01A 1NXKA 4ZLYA 2C68A 3GEQA 4O4FA 4JVGA 4C59A 5AP5A 2VNYA 2VO6A 4MBJA 4YNOA 4MWIA 4LV5A 4O2PA 3FYKX 3PY3A 4RIOA 4BBEA 3HYHA 4O0SA 4JL9A 2X4ZA 2C6TA 2YDKA 4EQUA 3HA6A 4V04A 3IONA 4I6QA 3T3UA 4I24A 2I0VA 4F64A 5KMJA 2XZSA 3RCDA 3S0OA 3H0ZA 3QYWA 4FK6A 2QODA 3KCKA 3WZEA 4FYNA 4FT0A 4PDSA 3BYOA 1W8CA 1XH6A 1J7UA 2CPKE 2FO0A 4FUYA 4BCPA 4O7TA 1JKLA 3OWJA 3T9IA 1H1RA 1PMEA 4M13A 4HVGA 2ZVAA 1ND4A 1GIHA 5C27A 4RWJA 2J5FA 5M09A 1PJKA 2XB7A 4FTCA 1K9AA 3OXZA 4FNXA 3GCVA 4LI5A 1BLXA 4B4LA 5HO8A 5FBNC 4A07A 4CXAA 4IX6A 3PVGA 1A06A 2E9OA 2C6IA 3C4CA 5T3QA 3LCTA 2HAKA 2OK1A 5IQEA 4HGTA 5J1WA 3SRVA 4IACA 3NNUA 3ODZX 3KRXA 3R8ZA 1P4FA 4O7SA 3EQGA 4EH4A 1H07A 1P4OA 3CSVA 3DJ5A 4FV0A 2PUPA 2PHKA 4E6QA 3LJ0A 5DRBA 4EOMA 3QRUA 4I4FA 3PTGA 3DBQA 3ZXZA 2ITXA 3O2MA 4D2RA 2BZJA 3OWKA 4FODA 3DV3A 1Q97A 3MY1A 3H30A 1ZZLA 2X39A 4MQ2A 4IB5A 2YM5A 3BKBA 5GNKA 2C0OA 2JKMA 4RLKA 4G6OA 2IVSA 4PX6A 5DWRA 3EQBA 5E8XA 1KE9A 1K3AA 4BDHA 1KE6A 5DRDA 3U8WA 1Y8GA 5JRSA 5A54A 2ERKA 3PA5A 3O7LD 4RA4A 4BVUA 4F6WA 3E64A 4FSTA 3R28A 3GCPA 3O50A 4QMZA 4CTCA 5CANA 5HE3A 5HZNA 4AXCA 5FLFA 3LXPA 3C4EA 4O22A 2WTVA 2FUMA 5CXHA 3RAHA 2JIIA 2ZM3A 4QDEA 5CSWA 2O5KA 1KSWA 4DDGA 5E8VA 5CU2A 2RIOA 5BUEA 2VGPA 3E3PA 4O86A 5CSVA 2QNJA 4YHFA 3E88A 4OTGA 4C4IA 4E4XA 4WO5A 4IC8A 3UE4A 3TI1A 1YI4A 3W2OA 1BL6A 4MEDA 1SVHA 4KKGA 3DK7A 3IW7A 4FT3A 3D7TA 1E1XA 3DKCA 2Y6OA 3U6IA 2JDRA 4BL1A 3QD4A 5L3AA 1JSTA 4CFXA 4FKVA 1W98A 2XKDA 2X2LA 3Q4TA 4XBRA 4I5CA 3ORKA 1UNGA 3PRFA 3I6WA 3AC4A 2HWPA 2UUEA 3AT2A 4M68A 5AIRA 5H2UA 3KULB 1DS5A 2IZRA 2YJRA 4YC3A 4FUXA 4CCUA 3TG1A 4RJ8A 5DN3A 3DBFA 4OGRA 3W8LA 4UALA 4BKYA 4GSBA 4TRLA 1LPUA 3LCSA 3PZEA 4MCVA 4JBPA 4BICA 3G9NA 4YC6A 2OF4A 5AP6A 5HNGA 2QCSA 4FSQA 3PJ2A 1KOAA 2GS7A 4O0RA 2GS6A 1CTPE 3QKLA 4IB3A 1NVRA 3LFEA 3Q52A 4CZTA 1L8TA 3KMUA 3SD0A 3ZOSA 4E5AX 3NLBA 2XNBA 5BUJA 4FV7A 3ZRKA 4IZ5A 4RIXB 4XX9A 4DEGA 4QYEA 5IG1A 2BAJA 4FNWA 5FM3A 3ZSGA 3BBTB 4C2VA 3CIKA 4CMTA 4E20A 2VTPA 4L42A 2QR8A 1ZYLA 4MXAA 3PY0A 5AR2A 1MQBA 4JG6A 5ANDA 3HDNA 3ZSIA 2QURA 4ITIA 4X3JA 4FIGA 3P5JC 3TJDA 4HGEA 2WFYA 2PK9A 1Z57A 2J0MB 2UVYA 4FKTA 3VAPA 1O6KA 3ZZEA 4KIOA 3KF4A 3UO6A 3LZBA 4FIEA 5BVFA 5JN2A 4FF8A 4U79A 5DE2A 5EG3A 2WELA 4AA4A 1FVRA 5HD4A 3ZO1A 3FBVA 4E26A 4QEBA 1OL7A 4D5KA 4P2KA 2VRXA 4X2KA 4F1MA 5CAUA 5HORA 5JSMA 4IM0A 4P5QA 3U55A 4HVSA 3BRBA 4D0XA 4JAJA 4XOYA 3NYOA 5HEZA 2UW3A 4FL1A 4I22A 3IGGA 5AJQA 3DAJA 3I7BA 4FVRA 4ZIMA 3Q6WA 2R0IA 2RSVA 5GIPE 3BX5A 3CR0A 4BCJA 3BBWA 3NNWA 1R78A 3F3VA 4G2FA 3RK5A 2GU8A 3UNKA 4QTCA 3R7IA 3FC2A 4CQGA 4I5MA 3DAEA 4J95A 3RAWA 3CPBA 3QL8A 2BCJA 4CYJA 2ERZE 3V5LA 4TT7A 3N4UA 2UVXA 4F09A 5CI7A 3O7LB 2X0OA 3QTRA 2R3FA 5JEBA 3KMMA 3QKMA 5EFQA 3HEGA 3HV5A 3NW6A 3WIKA 2V22A 4TWCA 4C33A 3QTZA 4MNEA 4EWQA 5AP3A 2WQOA 2BDJA 1SMHA 3HP5A 5IDNA 3NUNA 3LMIA 1GOLA 2IZSA 3FMHA 4IM3A 4ZZNA 4FRFA 2R3PA 3MVJA 3VBTA 2DWBA 3KVXA 3TIZA 4RVKA 4PV0A 2X81A 1CDKA 1G8JA 3R1YA 2UW8A 3LMHA 3MH3A 4RIYA 4O7WA 1TQPA 4IC7A 4FKPA 2QR7A 3KRWA 3QYZA 3V8WA 4CQEA 5CLPA 4P7EA 4AW1A 4L53A 5F94A 4R77A 3NEWA 4NIFA 2AQXA 4C35A 2C5OA 3D5UA 2P3GX 2C0TA 2QKRA 3V04A 2UZBA 4H1MA 2CN5A 3RKBA 4IZAA 4J71A 4V0GA 4EJ7A 4C7TA 2J90A 3A62A 3HECA 5HBEA 1X8BA 4MXOA 1IA9A 2XK9A 4AW2A 3GB2A 4C38A 2CKQA 5CF6A 3ID6C 1M14A 4WD5A 3GCQA 3TNPC 2Y8OA 4JQ7A 3HZTA 5M4FA 3AD5A 4MD8E 3RWQA 2VWZA 3LXNA 3IOKA 4PWNA 4YC8A 4EKKA 4BDJA 3I5ZA 2QOLA 2VTNA 4H39A 4OBOA 4XJ0A 4IX3A 3FI2A 4HPTE 2OWBA 4OUCA 4OT6A 2OJJA 1W2CA 2QOBA 2VNWA 2VWVA 3PXZA 2HENA 3D5VA 4JRVA 3PJ8A 3CP9A 4K0YA 3UOKA 3VUTA 4UMUA 1J91A 3DZQA 4GVJA 3TKHA 3MY5A 3R71A 3PIXA 1WBVA 4QQCA 5LVMA 3HAMA 3BV2A 5A3XA 1ZYCA 4R5YA 4ZTLA 2F4JA 3R00A 3QF9A 1XMLA 4D9UA 3NGAA 4FKWA 4F6SA 3SGCA 4DBXA 3KK9A 4O1OA 3SRVB 5KCVA 3VHKA 2P4IA 2IW8A 3U51A 5FXRA 3BQCA 3CPCA 3HDMA 4FV3A 4S32A 4DFNA 3R83A 3B8RA 3F3ZA 5LJJA 4F4PA 3BQRA 3O0GA 4O1PA 5JGDA 4D4SA 5AADA 5JGAA 3IOPA 3POZA 3PSDA 2JGZA 3C5UA 3QTWA 5DNRA 3IQ7A 2J9MA 5CU6A 3OOMA 4KSPA 2WO6A 3AKJA 2CLXA 3R22A 3E7VA 3ZONA 3DY7A 4TW9A 5CSPA 5CEKA 1JNKA 4EQMA 1DAWA 3BGQA 1KUTA 2VTLA 4NK9A 2HZIA 4R7HA 4UB7A 4L7FA 5A6OA 1Q8WA 2EXMA 3BWFA 3FE3A 2J0IA 5DPVA 2E9VA 3KY2A 4F99A 2RFEA 1H26A 5IMXA 4X6RA 3DNEA 3LVPA 3PPZA 4HGSA 4S31A 3QQHA 3SC1A 2BTRA 4LMNA 1YXSA 4X6QC 4ACDA 1S9JA 3QTSA 2YJSA 2F9GA 1PW2A 5KMIA 3G6GA 3FQHA 4BFMA 5D41A 4AE9A 4RJ6A 4DTAA 3UODA 5CAPA 4ZSGA 3ENMA 3VS5A 3F5PA 4ZSJA 4FMQA 5EYMA 3G2FA 3OY1A 5C03A 2OG8A 4KNBA 1MRUA 1FMOE 3F6XA 4EZ5A 3NUAA 5L8KA 3QQFA 4BI1A 2WMBA 4W9WA 4NFMA 5DHJA 4ANLA 4CG8A 3BEGA 4PMTA 2W1IA 3D7TB 3AQVA 5E8UA 1AD5A 2X6EA 2HZNA 2X0QA 5DT4A 5KMOA 4DHIB 2PMIA 3V5TA 4AZEA 4RVLA 4YTHA 2CGVA 1AQ1A 3ROYA 4M0ZA 4EOKA 3MI9A 3RAIA 4K8AA 5DYJA 3LM0A 5ANOA 4WG3A 3AKKA 3E8DA 3ZUVA 2XK7A 3WILA 5E8YA 1GZNA 3VS0A 4GJ3A 4XOZA 1KE5A 4IADA 1Y6AA 5M08A 2QU6A 3ACKA 2E9UA 1PKDA 4U40A 3QLGA 3QHRA 2VU3A 2F2UA 2EVAA 4I4EA 4PPBA 5LMKA 4LOOA 5LCJA 4F0IA 3GVUA 4QMNA 4CZYB 3VONA 3PVBA 2QOFA 4X2GA 2CLQA 1PKGA 4JQ8A 4BTMA 4ZMFA 1ZYDA 1OL1A 3MGYA 2Y9QA 3FLNC 2B7AA 2XYUA 4GS6A 3PG3A 2J50A 3UGCA 4ALVA 2C1BA 4C36A 2I0EA 2P2IA 1RDQE 3FL4A 3LAUA 3FDNA 5ETCA 4E4LA 4QPSA 2C6OA 3UDSA 3QQKA 3VBYA 3I6UA 2YLFA 4H58A 4JJRA 3FXZA 4Q9ZA 3O5AA 2VWWA 2XIZA 5CZIA 3PLAE 1OKVA 3DBEA 2GNHA 1F5QA 1RW8A 3EH9A 4LFIA 3S1HA 4FKQA 4QMOA 2OKRA 4EK6A 4UWBA 4ZLZA 5K4JA 4FBXA 3W32A 1UKHA 5EYCA 1WZYA 4X2JA 3NIEA 5AP0A 2B9FA 3VUIA 4LGGA 3FKLA 4A4XA 4O6LA 2JLDA 2B54A 2OO8X 2WIHA 3K5UA 4PDPA 5HU9A 2ZJWA 4KA3A 4FV4A 3D0EA 5CVGA 3S00A 3AD6A 4BKZA 4EH7A 3CCNA 4JX3A 4YZBA 4EZ7A 2CSNA 2F7EE 3H9OA 4YPSA 2OGVA 5HCXA 4BDEA 4ANSA 3EN4A 5HBJA 3AMBA 3D2KA 5IEVA 4O81A 3EZVA 3PXKA 4FT5A 4IJPA 4N57A 3COMA 2R9SA 1OUYA 1QMZA 2RFSA 3ZYAA 5LMKC 3V51A 5BMSA 3DKGA 5F20A 3BHHA 4XV3A 4PTEA 3HV4A 1W84A 4TN6A 4JBVA 4ASXA 3RAKA 5HTCA 4JDJA 5AP4A 3QA0A 4FZDB 1DI9A 4EH2A 3QKKA 1Z5MA 4P4CA 4NW6A 4EBVA 4ZTMA 2NRUA 3FMLA 3NSZA 3DPKA 4GUEA 2PVLA 2WKMA 1QPDA 3OBJA 5CAQA 3ZEPA 4JBQA 4YPDA 5IH4A 5AUWA 5J7BA 4BYJA 4MNEB 1ZY5A 4XG8A 4XG9A 3AC2A 3V5JA 4N4SA 3VN9A 4WHZA 3FZOA 4X7QA 3KIOC 3COKA 2ZDUA 4Z7HA 1BL7A 1OGYA 2XKFA 4MAOA 4J97A 2GTNA 2ETKA 4O0XA 1ZZ2A 2G9XA 4OTQA 4QT1A 3V8SA 4E1ZA 2O2UA 4RX8A 4ZY5A 1YHSA 5KO1A 4BDCA 3BL7A 5C4KA 3MFRA 3QRJA 3KXNA 4FTKA 1H01A 4L43A 4RIYB 4WNMA 5CWZA 4NTSA 5EK7A 1M17A 4BWXA 2EB2A 3FI3A 3MH0A 2OLCA 2W05A 4FTNA 4OTWA 2R3KA 2VX1A 4FNZA 2YCSA 3MVHA 4MBLA 4I20A 2YIWA 2VTQA 4NIFB 3AC3A 3GI3A 5EW8A 3NYXA 2B9IA 4QYYA 3PSBA 4O2ZA 4ZMEA 3OVVA 2XRUA 4ZS0A 4C4JA 4QTEA 4B0GA 4EK3A 2BALA 5AUTA 2YCRA 2HOGA 3UIBA 1GJOA 2YIRA 5FEDA 3TNHA 4D28A 3F2RA 3FQEA 4DEBA 5HLNA 4FKOA 3R8PA 4B6LA 5IQCA 2B4SB 3AC5A 3MFUA 1ZARA 2GHGA 3P0MA 3P79A 5TO8A 3UMWA 1XO2B 5B7VA 4DEIA 2JFMA 3TWJA 1NW1A 1R1WA 3EQIA 5G6VA 2JD5A 1ZOEA 2WEIA 4WG4A 3II5A 1ST4A 2UW6A 2RFDA 4AXFA 2HZ4A 3A4OX 5K5XA 3BLHA 4YTCA 2Z7QA 1OKWA 3JS2A 4AA5A 2UW7A 2XP2A 5IA5A 1WMKA 4I94A 2X8DA 1FQ1B 3OXTA 4F70A 1NVQA 4BDIA 3GUBA 5A4LA 4KUJA 2W5BA 4XUFA 4ENXA 4GYIA 2QLQA 3H3CA 3HUCA 3W0SA 3HKOA 2VN9A 2C5VA 4EKLA 2GPHA 4UWYA 1J1CA 3IW4A 3OY3A 4IX5A 4PQNA 4QMPA 2XNOA 5B2MA 5FP5A 1APME 4CLJA 2RG6A 1XH9A 1ZOHA 4LRJA 3ORLA 1O6YA 4QP3A 3ZSHA 1HCKA 4OTFA 4ALWA 2PZ5A 1YXTA 3BEAA 2NPQA 5CEPA 3SAYA 4UZDA 3RTPA 3ZUTA 2WMUA 3E92A 4IHPA 2WTWA 1Q99A 3UZRA 3VS2A 5EM5A 4AOIA 4M12A 4N0SA 3TKIA 4G16A 5DEYA 1Y8YA 1NA7A 5EKNA 5J9YA 3OD6X 4OW8A 3HA8A 5H8EA 5AR4A 3ATSA 3IKAA 2VO0A 4DE4A 3WZUA 2R3HA 1YVJA 5CNNA 5L2IA 1FGIA 2AUHA 2CDZA 4H1JA 1OL2A 4TXCA 4IWOA 3CD8A 2XNGA 3UO4A 5AUZA 4ANMA 2A27A 1OIRA 3W55A 4NKSA 5AAEA 1STCE 2Y4IC 2C30A 4K2RA 1U5QA 4L44A 3IS5A 2C3KA 2A4LA 4JNWA 4ZSLA 3LLAA 3NZ0A 3FKOA 2OH4A 4QMLA 2OBJA 2UZUE 5ANIA 3OXIA 3NYNA 3TUBA 4BHNA 3ET7A 4S33A 1V0PA 3UP7A 4NFNA 5HCYA 5A4QA 1UU7A 1RJBA 3IG7A 4GT4A 4AN3A 4D1ZA 3DAKA 3UOLA 1XBBA 3FC1X 4BI0A 2Z2WA 5DA3A 3V5PA 3NPCA 4GT5A 1VEBA 4FTAA 2A1AB 4PF4A