4R7HA

Crystal structure of fms kinase domain with a small molecular inhibitor, plx3397
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
326
structure length
308
Chain Sequence
PKYQVRWKIIESYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCTYGDLLNFLRRKAEAMLGPSLGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDSVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQITSFLQEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-Guided Blockade of CSF1R Kinase in Tenosynovial Giant-Cell Tumor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 308
sequence length 326
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r7hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r7hA01
3O51A 5I9UA 3FXWA 3NW6A 5FTGA 3P7AA 4YU2A 2UZWE 3GU7A 4PQNA 4W4WA 4C8BA 4EOMA 3O8UA 4UYAA 4UWCA 3IW4A 5KUPA 5DR2A 2VTOA 2CGVA 2ITQA 3OC1A 4N0SA 3BBTB 3F88A 3AGMA 3H30A 3ZBXA 3F5PA 3QXPA 5J87A 2BIKB 1REKA 2WIHA 4JJRA 1UWJA 5EI6A 4A7CA 2BCJA 4IVDA 4FI1A 4ASEA 3I0OA 3TZMA 1BI7A 2UZNA 4CMTA 4DC2A 2I1MA 4RJ7A 5EG3A 4IVAA 2JDTA 4HJOA 4R5SA 1WBOA 1FQ1B 4WHZA 4ZSAA 1WVWA 4XEYA 1ZOHA 2QU5A 3JXWA 2E9NA 5FEDA 2XMYA 4G9CA 4IVBA 4U81A 4N57A 5EW3A 2C6MA 4RC3A 4LMUA 1QCFA 5EM7A 3R1SA 2QU6A 2YM8A 4JI9A 4D4SA 2WOTA 2BZJA 1TQIA 2YIRA 3N9XA 3RZBA 3WF5A 2GS7A 3MFRA 3ZONA 2CNQA 5HCYA 2RFSA 4BCHA 2WAJA 4FL3A 3H0ZA 3FQEA 4DEBA 3ZSGA 4KUJA 2Q83A 2YIXA 4EK3A 3NAYA 2Y6OA 4DTBA 2RSVA 4O6LA 3R7UA 4IZYA 4CQEA 1F5QA 4EKLA 2EVAA 1YI3A 3KB7A 4E4NA 2J0IA 1JPAA 2X8IA 4FV6A 2VTLA 4QMOA 5DT3A 2QR7A 5GNKA 4UZHA 4D9UA 4ERWA 3I6WA 3CE3A 4FSNA 3PG1A 4EHEA 2IVSA 2PMLX 4FZ6A 5BVNA 4E6QA 4HYUA 4M15A 4W9WA 2EWAA 5EDQA 3IKAA 1SNUA 3BV2A 3PJ8A 4IB3A 4MF0A 4A9YA 5JGDA 4FZFB 4NT4A 5AP2A 5JGBA 4ORKA 4IX6A 2R3HA 4LOQA 4D2SA 4H3QA 5CLPA 3BEAA 3NS9A 4AWIA 4F9CA 3R7IA 1H00A 4XV3A 4EORA 3PXFA 4X7QA 4FV2A 3VRZA 3E64A 3PJ2A 3DB8A 4ITJA 1BL6A 3MH2A 1REJA 4B7TA 2WHBA 5EFQA 4W8EA 2VRXA 5L6OA 2ZM4A 2PTKA 3CPCA 5AP5A 5KMOA 1O6YA 2O5KA 1A06A 4YMJA 2PVRA 3A7JA 4K77A 4J7BA 3KQ7A 4RBLA 3PXYA 4M69B 4AN2A 4F1TA 4IFCA 3R7OA 3VS4A 3BLQA 3LCKA 3UYSA 3UVRA 4D2TA 2E9PA 3RINA 3NPCA 4YC8A 4BDBA 3CIKA 5CXZA 3MJ2A 3EL7A 3JY9A 1YXUA 4X3FB 2XJ2A 5F94A 4GK2A 3WZUA 2BMCA 1MRYA 2V62A 3FMLA 2RKUA 4BCFA 4Y5QA 2WU7A 4DTAA 5AP4A 4L52A 3GNIB 3KK8A 3TZ8A 2IZTA 4H36A 4CFMA 4MEDA 4TKSA 3D0EA 4NCTC 3DJ6A 4NWMA 2QURA 5C01A 4BCQA 3FC2A 2XKFA 4JG8A 2XBJA 3MB6A 4DE4A 1FOTA 2NRUA 5IEYA 3E7VA 4ZY6A 3A8XA 4F9WA 5E8UA 4ANOA 4PV0A 3BQRA 1LR4A 4I94A 5BVWA 1PXMA 2FSLX 5H3QA 1K2PA 1GIHA 3ORXA 2GHMA 2DWBA 2JDSA 4E20A 1IEPA 2XEYA 4HVIA 1JBPE 4L3PA 3V5PA 2CJMA 4R3CA 3QUEA 5D9HA 3ATSA 5C26A 3E8EA 4TW9A 4UXLA 2IW8A 4NYEA 3PFQA 4EZ7A 4G3GA 4C62A 2X1NA 4QYGA 1BI8A 2VTQA 3GQLA 4IAYA 2GNJA 4ALUA 3R7YA 3MDYA 4MBJA 4FKQA 2HY81 2OF2A 2XNNA 2W4JA 4FIIA 4EBWA 1UU9A 4Z7GA 4ZZOA 4Y83A 3OWPA 4M0ZA 4FV5A 2UW8A 4BDIA 4S32A 4GL9A 1PYXA 5LCKA 1H1SA 3OT3A 1A48A 5AUVA 3LFNA 1ZOGA 2PL0A 5IQIA 2BR1A 2H96A 2WQOA 3H9OA 3F5GA 1B6CB 4L68A 5AM7A 1OITA 4ZMFA 2QO7A 4F6SA 3RHKA 5ANEA 3T9IA 2G15A 4MXXA 2VTAA 4QNYA 1GOLA 5A4CA 1ZWSA 3W32A 4XS2A 4I6HA 3ORZA 2C1BA 4FL2A 3QA8A 3FI2A 2R3OA 2PWLA 3VJNA 5CALA 4U40A 5FP5A 2WTKC 3KULB 5FTQA 4FTKA 4O91A 4CG8A 3V01A 3Q3BA 4IB0A 4RIWA 4PL5A 2F9GA 3TEIA 4ONAA 4JAIA 4AGCA 2CHLA 4QD6A 4X0MA 4CMUA 5HLNA 4QYEA 4CYJA 2I0HA 3PG3A 1IRKA 1VJYA 4CYIA 5AV0A 4DYMA 2NRYA 4O96A 5IH4A 4DEAA 4FEWA 3HRBA 3O96A 1XH9A 4CRLA 1OIYA 4NSTA 4RJ5A 4GG7A 2YM4A 3OP5A 4D0XA 3GP0A 3TUCA 3CSVA 4HZSA 4RA4A 1OL2A 3FKLA 2FB8A 3ORMA 4FT3A 4D2PA 3QAME 3E3BX 5KMJA 5CEQA 3DZOA 2Y7JA 4IZ7A 4G31A 4EC8A 1ZYSA 2GDOA 5EQEA 4JAJA 3RTPA 4BKYA 4FZDB 1SVGA 4EZ3A 3UZPA 5JZNA 1QMZA 4YZBA 1JQHA 4TNBA 3LJ0A 4UMUA 4W4XA 3EFKA 4ZS0A 1W0XC 3NUPA 2GQRA 1X8BA 3OMVA 5HO6A 4FEUA 3LXPA 4FV7A 5CT0A 3PLAE 4GYIA 2FSMX 4FKWA 3TNHA 4BCIA 3VQUA 1FGIA 5AUXA 3VBTA 4WT6A 3TNQB 2IO6A 3R2BA 3FL4A 3S95A 3A4OX 3D83A 4AX8A 4L01A 3VS7A 5K4JA 5C4LA 1DAWA 4EOJA 4EKKA 4IX5A 2W96B 4D4RA 4QP3A 4AA5A 2BKKA 5LXMA 5IEXA 3UJGA 5KNJA 3QC4A 5AR4A 4MVFA 3GBZA 3FAAA 3I6UA 4XRLA 4FSMA 3V5JA 4E93A 1Q41A 2P55A 2QKRA 1BYGA 1BMKA 4ZXTA 4FOCA 2BDWA 3NZ0A 4L45A 5IA2A 4TYIA 1KE5A 2F2UA 3I0QA 3NNVA 3NLBA 3CXWA 3A60A 4R7HA 4R3PA 5JK3A 4CZUA 4FKLA 5CI7A 2JIUA 4LRJA 2Q0NA 5CU6A 4EYMA 5HU3A 1OL1A 4JBPA 4RIXB 3DXQA 4XG9A 1YQJA 3LQ8A 5D1JA 4FGRA 2WO6A 4YLLA 3F3VA 1H01A 3FLQA 4TY1A 3ZLXA 4DFBA 4G3DA 2X4ZA 4MBIA 5FQDC 4DAWA 4DH8A 1PMUA 3QQFA 4FL1A 4CT2A 2BVAA 2OFVA 3DJ7A 5EHYA 4R78A 2OW3A 3DV3A 3NYXA 3MTLA 3NWWA 4GEOA 3C4CA 4M68A 3V5TA 3II5A 2R3FA 4EOIA 2BTRA 3QCSA 3FSKA 5HBJA 4DBNA 4RA5A 3UC3A 4QMPA 4F08A 1CMKE 4MD9E 2W06A 2B9FA 3EQDA 3MSSA 3WIKA 3PRIA 4YJNA 3FY2A 2EB2A 4EOQA 4UX9A 5CT7A 3ZFYA 4ZTMA 3PVWA 5KHWA 5J8IA 2PHKA 4FG7A 4ZSLA 2IG7A 1JLUE 3QF9A 4J1RA 3TI1A 2OWBA 2PVYA 4KBCA 3TV6A 3BHYA 3HGKA 5T3QA 3AD6A 3UP2A 5A6OA 2PE1A 1CKIA 1PXJA 2Y4IB 3DS6A 3E5AA 2R9SA 1U4DA 2XP2A 3IW6A 2IJMA 4RRVA 1BUHA 2XM8A 3AOXA 5I5ZA 4U9AA 3M2WA 2Y9QA 3ROCA 4PF4A 5H8BA 1CTPE 2XEZA 4GW8A 3C4XA 4FNWA 4V05A 3DAJA 4IAZA 3IO7A 1PYEA 2GU8A 3KXGA 2WMWA 4KA3A 5HBHA 4RC2A 3NYOA 3SD0A 2ERKA 3EQIA 5DH3A 1V0PA 1OVEA 4I1ZA 3NEWA 3OT8A 5F9EA 3EZVA 3EH9A 4EOLA 4KKGA 3SOCA 3Q4CA 1QL6A 2BDJA 3KXNA 1GJOA 2XJ0A 3SG8A 2ZJWA 2WTWA 4IC8A 2C6LA 4R7BA 1K9AA 3A61A 2UZUE 5IDNA 3R1YA 3DKOA 4LL5A 4I21A 3F2NA 4U44A 3QFVA 3BEGA 5AR2A 4AT3A 4EBVA 5K0KA 2GS2A 4L42A 5DI1A 3NGAA 3RPOA 3ZEWA 4D2WA 3IPHA 3RAWA 5AUWA 4DEEA 1YXTA 3CD8A 5HI2A 1ZYLA 1P5EA 3QTZA 4EQUA 1KOBA 2FYSA 1NT2A 1ZYDA 3ACJA 3FMMA 4J98A 2C5NA 1Q8UA 5C03A 1Q62A 3LM5A 3M1SA 3PSDA 4PDOA 5I0BA 4FK3A 1F3MC 1OM1A 5IA4A 4BCGA 4RX7A 2Z60A 2GQSA 1PHKA 1Y57A 1ZYJA 2GTNA 3AT3A 4GUEA 4KS7A 4UBAA 4W4VA 1YWRA 1YXVA 5AUYA 3F2AA 3WBLA 5KMLA 1XJDA 3OHTA 4IWPA 4E3CA 3CKWA 4NIFB 3W8QA 4D28A 4UMPA 2ITOA 1E1VA 2XJ1A 3BU3A 3VS3A 1KOAA 2W1HA 1APME 3DGKA 4RX9A 4V0GA 3FMKA 3FEGA 1KE8A 4X21A 4XG3A 3LOKA 4O21A 2X0GA 4QTCA 4XG7A 2A2AA 4OW8A 4ZSGA 1OUKA 4C3RA 4LFIA 4MAOA 4M7IA 3RJCA 5M06A 2A19B 2R3IA 4W4YA 3PA3A 5EQYA 4F1MA 5IU2A 2B7AA 3QTQA 4XG4A 5LWMA 3SGCA 2UW3A 4JQ7A 3PSBA 3Q5IA 4TYHB 2C4GA 2WKMA 5L8LA 4FKOA 5HTIA 3MPTA 2YWPA 4QTDA 5CEMA 4YJUA 3S0OA 1Q8WA 4JIKA 2OJJA 1RJBA 3D7TB 2WQBA 4U41A 4IC7A 1YHWA 4FX3A 4OTWA 3DBDA 2PVFA 4ZZMA 2P33A 2VTJA 2R3MA 3H9RA 3DLZA 2OJGA 2PE0A 3LFQA 2YJRA 5ANIA 4EH8A 4FUXA 3R8ZA 3U4WA 3MY0A 5HOAA 1GAGA 3GCPA 3PP0A 4AW5A 1IG1A 2B1PA 4ANMA 2VWVA 3UNKA 4DFXE 1P14A 4IB5A 4DG2E 3FMEA 4K2RA 5EYMA 4IXPA 3EOCA 3PXQA 4ZLYA 3Q9ZA 3E8NA 3W10A 5M53A 3W2SA 4OTPA 4A06A 4RVTA 5E8TA 2Y0AA 5DA3A 5EDRA 1YOLA 4RIOA 5G6VA 4I20A 3GI3A 3G9LX 2ZDTA 3OD6X 2PZPA 5AR3A 2WEVA 3BGQA 4O0YA 1Y6BA 4TT7A 4WUAA 5JKGA 5E8SA 4HYIA 4L00A 3W2RA 4EK4A 4M14A 5KHXA 4CT1A 4EH6A 2VV9A 3FMDA 4AUAA 3MY5A 2DQ7X 3DPKA 1W7HA 3VS1A 3QQUA 4AXAA 5AUUA 3GU5A 5AA9A 2HW6A 4J99A 4YO6A 3A99A 4EOKA 3BYSA 3VS5A 4KSQA 1M2RA 3VF8A 1TQMA 3FHIA 3DB6A 1UNLA 4JLCA 4FGBA 4MF1A 4AE9A 2OH0E 3UE4A 4D5KA 2R64A 1OPLA 3JS2A 3Q96A 3QHRA 5CZHA 4JG7A 1L8TA 4YUQA 3VN9A 4C4GA 2NO3A 5I9YA 5KMIA 4FSUA 5EDPA 1PJKA 2Y4PA 2BRGA 4NH1A 2XNBA 2VGPA 3WZKA 2YEXA 4NM3A 4BB4A 3SQQA 4PMPA 2VX0A 3FMHA 4UMQA 3SHEA 2E2BA 4TYJA 2QOIA 1I09A 3FLSA 2WMVA 3EFJA 2HY0A 2ZM1A 3MFUA 3MN3A 4L43A 4QYHA 4Z9LA 1LUFA 3W18A 5KO1A 4RFYA 2W1FA 4DH3A 1ZMWA 4GT5A 2XNMA 1OZ1A 4ZLZA 3RPVA 3PP1A 3Q2JA 3LFDA 4TZRA 2UZVA 4WSQA 2XKDA 4ZMEA 2PUUA 4ANLA 4MKCA 4QMLA 3VULA 5E92A 4ANBA 2H6DA 2CSNA 3P5KA 4Y72A 3UOHA 1ERKA 4MYGA 4JBOA 3GU8A 3FBVA 2ZV2A 1VYWA 2WMTA 3TV4A 3VBYA 4JDKA 3OWLA 3FPQA 2R5TA 3A7FA 2CLXA 4JXFA 5AUTA 5GZ8A 4BDCA 2XZSA 3E92A 1QPCA 5J7HA 2GHLA 1H4LA 3QGWA 4QP7A 3GCUA 3RMFA 1U54B 3BYVA 5LQFA 4BWPA 4FV8A 5GJFA 4ZS4A 3DXNA 5HKMA 4IADA 3LJ1A 3POOA 3SRVA 3R2YA 4WG4A 4XOZA 4M97A 5AV2A 4FSZA 3MB7A 3CGFA 3SC1A 5IISA 3ULIA 4CCBA 1OIRA 1XBAA 4ZJIA 1NA7A 4M0YA 4APCA 4BI1A 2WGJA 2LAVA 3O8TA 2PVKA 3PIZA 3FSFA 3D94A 3FQHA 2XK7A 4XLIA 5B2KA 3GQIA 3VUTA 3D2KA 4LGDA 5AM6A 2IVUA 3G2FA 4AT4A 2PUIA 5C9CA 3W2OA 2CKEA 5I9WA 3ORIA 2X8DA 4FSRA 4YHFA 3QLGA 5ETFA 3NIEA 2WTJA 5L4QA 4GU9A 3ZZWA 3W2QA 3EQGA 3CJFA 3KVWA 2G9XA 3MTFA 3R01A 3QZFA 4G5JA 5AX3A 5HTCA 2KTYA 2B55A 2WTIA 4E8AA 3TTIA 1I44A 5A9UA 3RALA 4F63A 4O0TA 4U80A 4C34A 1XQZA 4ZTQA 3FZTA 3QRIA 5FUTA 2XK4A 3CJGA 3V5WA 4B8MA 3PVUA 3R22A 3MGYA 3KULA 2OXXA 2CDZA 3UIMA 2B0QA 3MVLA 4KKEA 4QRCA 1GZOA 4QQ5A 5A4EA 5GINE 3EN5A 1QPDA 4FSQA 4OBPA 1Q61A 2PU8A 3KGAA 2OIDA 2YIYA 3D2IA 2XRWA 3U54A 4ACHA 3DKFA 4B9DA 4EUTA 2I7QA 3RK7A 2OI4X 2CGWA 5A4QA 1ZXEA 2J7TA 2ZAZA 5D11A 2WQNA 3TL8A 3VUMA 4DFYA 3C4ZA 3ET7A 4NJ3A 4BDEA 3AG9A 3C50A 4E5WA 2DS1A 4XV9A 5JRSA 3R0TA 4YR8A 4O7NA 4FTOA 4HZRA 5M51A 2CKQA 2BRBA 5A4LA 5DMZA 4CZYB 2IN6A 2UZDA 5BVFA 3R8LA 3PJCA 5KKRB 3KVXA 3HL7A 1S9JA 5AUZA 3UO4A 3BPRA 3F3TA 4C58A 4QP8A 3NRMA 5CAVA 4YTCA 1OL7A 2CCIA 4EHZA 4PNKA 3KEXA 5EKNA 4Z3VA 4OBQA 5TOZA 2HZNA 3GC0A 4AOJA 4BGGA 3FZ1A 3EN7A 3VQHA 5B7VA 2OJ9A 2H8HA 4OTQA 4HVGA 3SDJA 5J95A 3BYOA 3ZYAA 3C0IA 4JDJA 3VHKA 4OT6A 3FJQE 1XH8A 3FL5A 4JX3A 4UMTA 3U9NA 1T46A 2I0VA 3UC4A 1OUYA 4YPSA 4CLIA 3D14A 2J6MA 2J0MB 3CBLA 4FKPA 3KMWA 4CFVA 5LMKC 3FQSA 3UVQA 4DN5A 5FEQA 2HOGA 4MNFA 2YM6A 3P23A 2JBOA 2VWYA 4FEQA 4OAVB 3HUCA 4EK8A 2WFYA 3VIDA 3O0GA 2HYYA 4FZAB 3DK6A 5JFXA 2R0IA 3VUDA 3VUIA 4C33A 4EOSA 3GENA 2WMQA 3FY0A 3CTHA 4EL9A 4FIGA 4HPUE 5FDXA 2CPKE 2ZV9A 4RIXA 1MUOA 5EOBA 3SX9A 5LVLA 2G2IA 4FTQA 4E5BA 4CLJA 4FV9A 5C8MA 3EL8A 4DGLC 4II5A 3UIBA 4J71A 5EI2A 3EQFA 4BCMA 4GRBA 1TVOA 1XH7A 2Y4IC 5IEVA 4IAFA 5LMKA 2IWIA 2C68A 3LVPA 5CS6A 3RWQA 3KA0A 2HZ0A 3E3PA 3F7WA 4JBVA 3UMXA 5LCJA 3EN4A 3UODA 4AFJA 4YTFA 2F57A 4FKTA 3D5WA 3KN6A 5J9YA 3QU0A 2BAQA 3E93A 3LXKA 3VS6A 4QMZA 4FOBA 3V8WA 3CGOA 2PVHA 2G01A 5EW9A 1SVEA 1M7NA 3WE4A 5BQ0A 5BUEA 3OEZA 3Q9YA 4AG8A 2R7BA 4I4FA 4O0RA 3Q32A 4CMOA 1H28A 4APPA 4FIFA 4XMOA 5FXRA 2J0JA 4H58A 2JITA 4E4LA 3C1XA 3JYAA 5HICA 2V22A 1V0OA 2J5EA 2V0DA 1O6KA 1R1WA 1ZMVA 3RK5A 2RFNA 5I9XA 2E9UA 5DIAA 5B2LA 4IJ9A 2XYNA 3FI3A 4K1BA 4QPAA 4LUEA 5HZNA 2OZAB 3UVPA 3OEFX 5DBXA 3GC7A 3R00A 3DNEA 1U5RA 4XLVA 3OS3A 5HE3A 3R9DA 3L9LA 3LFBA 3TIYA 3EB0A 4D58A 4D4YA 4F99A 5HD4A 5L2TA 3AMYA 3ID6C 3THBA 3TNIA 5DOSA 1WBVA 2VTSA 2JFMA 3BHHA 5DR9A 2YDJA 1Q3WA 1Q8TA 4OR5A 4J53A 3DBFA 5I3RA 4LV8A 2O65A 1Q5KA 4XX9A 4RMZA 5EOLA 2IZRA 3QTXA 2YLFA 3UIXA 4CZTA 4LOPA 1OMWA 4IAKA 3LMGA 5HCZA 3MFSA 3DQWA 3OUKA 4IHPA 3SW4A 5CSPA 3PY3A 3LMHA 2WMUA 4FNXA 2V55A 2OU7A 4O2PA 2QNJA 3REPA 2R3QA 3QHWA 3NCGA 2RL5A 4GCJA 3QL8A 3HAVA 2YWVA 4C61A 1QPJA 3E8CA 3FI8A 2Q0BA 4O6EA 5E1SA 1PXNA 4O7RA 3QTUA 4RSSA 5BX0A 2GMXA 4AZVA 3COHA 4BYIA 3L9PA 3V8TA 3QZHA 4WSYA 1RDQE 5M4IA 2QKWB 3OZ6A 4RIYB 4YJSA 3TZ7A 5L6PA 4O7YA 4FTLA 2UW5A 2O8YA 2YDKA 5GIOE 1P4FA 2JGZA 4NUSA 2FSOX 4MBLA 2R3GA 5E90A 2CN5A 1U5QA 2XS0A 4BYJA 4RT7A 4DEIA 2PUPA 1PKDA 3W1FA 3CD3A 1W84A 5FP6A 3NUNA 4EH7A 4DCEA 3R7VA 5IQDA 3POZA 4FV0A 2IPXA 4JDIA 3VAPA 4MWHA 3NNUA 2HENA 5BUJA 5CAOA 4K8AA 4FIHA 2XNGA 5F95A 4USEA 2GTMA 5IQBA 3G6HA 4IWOA 1CKPA 2UZOA 4BF2A 4RFZA 4FTNA 2C69A 3LW0A 4IM3A 4GK4A 1R78A 4TYHA 4P4CA 4BKZA 4YSMA 2ONLC 3OCBA 2I0EA 2J5FA 4YO4A 1H0VA 3QYWA 4M8TA 3TUBA 3UYTA 5CZIA 4RWLA 3TM0A 4UXQA 3VVHA 4TRLA 5IQEA 3DTCA 1V0BA 4X2JA 2QD9A 5EYDA 4XYFA 3U4UA 2G2HA 2O0UA 2YA9A 2JKOA 4EK5A 5IQAA 4GJ2A 3GXLA 2W99B 3D9VA 4AZEA 3F5UA 5HVYA 3ERKA 4GVJA 5LVOA 3FDNA 4FG9A 4AN3A 3RM6A 3Q9XA 3FZRA 2F7EE 2F7ZE 4EYJA 2X39A 4JX7A 3G6GA 3F7ZA 4JVGA 3W2PA 5EM8A 3GC9A 2J0KA 4MQ1A 3FMJA 4YC3A 5LWNA 2RGPA 5TO8A 4YC6A 5EKOA 1AD5A 2ONLA 4RVMA 3TKUA 5CXHA 1WVYA 4GFGA 1MP8A 4AP7A 2W1DA 4BGHA 3KMUA 3NUAA 2AC5A 1MQ4A 3BWFA 3ODZX 1YDRE 4FT7A 4O0UA 1OKYA 4RZWA 2JDVA 4NW5A 4TYGA 3ZFMA 4Y46A 3A7GA 2RIOA 4BCOA 2VO7A 1ZMUA 1G3NA 5D10A 1R3CA 3IDPA 4PDSA 4XG8A 2UW0A 5EW8A 3HNGA 3QQJA 3TN8A 4PUZA 4RVLA 4BTJA 2HAKA 3KFAA 2YM7A 2BROA 1WMKA 3WF8A 3ATTA 3DFCB 3UMWA 4L6QA 5CAUA 4XP3A 3RBWA 2E9OA 2C6TA 5K3YA 3WILA 2HIWA 4KRDA 3ZRLA 3B8QA 5JT2A 4B99A 3HMMA 3NAXA 2C5VA 2ERZE 4LQMA 4R3RA 3CEKA 3G5DA 2X6EA 3IS5A 4ASZA 5CQWA 2BZHB 2VAGA 4YZCA 5AR7A 1PRYA 3SXSA 3PA4A 4AACA 3GCSA 3GB2A 3NX8A 2SRCA 2QOHA 4AU8A 5I9VA 3NR9A 4L46A 4ZEGA 4FA2A 3BBWA 4KINA 1WBPA 2C3KA 4P2KA 3W16A 1DI8A 3O17A 5M57A 4IWDA 1WBWA 2IZUA 4I3ZA 1OGUA 3QD4A 2HXLA 3LCDA 1RE8A 4N6YA 2PZRA 4IIRA 3LFAA 3HAMA 2YABA 2V7OA 3MWUA 5DNRA 5TKDA 3WYYA 3TUDA 3G9NA 3S00A 3MS9A 3EYGA 4U3YA 4C36A 2BRHA 2YIQA 3MPAA 3TDVA 3FWQA 2B52A 3ZZEA 3ENHA 4FKVA 4AOIA 2WQMA 2WNTA 4MK0A 1OBDA 3OXIA 2XRUA 2YLEA 4ERKA 3QCXA 1YHVA 2YDIA 5ETCA 4N70A 3VBXA 3Q9WA 3RAIA 2XKEA 3ACKA 4MXAA 4BBFA 5DLSA 3LLTA 3EYHA 4JT3A 4E6AA 3R9RA 3DK7A 5HESA 4FTIA 4RJ8A 1YW2A 2CMWA 3V6RA 2QO9A 1SMHA 2ITWA 3LFSA 1GZ8A 4GKIA 4QNAA 4ACCA 1OPJA 1U54A 4U43A 2OH4A 4W9XA 5JFWA 2IW6A 2XNEA 3TJDA 3V8SA 4Y95A 3VW8A 5FM2A 2O3PA 4KSPA 3P4KA 3PIYA 5HE0A 2XM9A 1NXKA 4F09A 3VJOA 4IB1A 3TNWA 3DXPA 2YN8A 4JIAA 4XCUA 5J5SA 3SOAA 5FBNC 4I4EA 3DTWA 5A3XA 3PXZA 4JL9A 4QP2A 3R83A 3PPZA 4KNBA 4E6CA 5IQFA 3LQ5A 3N4UA 4NZWB 5FXQA 3IQ7A 4DEHA 1UU7A 3AC8A 4NM7A 4Z16A 1B39A 3Q6UA 3W2CA 4O86A 3MPMA 5HO7A 3UOKA 5K4IA 1JSVA 3OW3A 1VR2A 3LXNA 5AIRA 3PYYA 3SXFA 3QKLA 5ETIA 2BTSA 3AC5A 4ACMA 1NW1A 3IK3A 4D2RA 3QQGA 1FVTA 1U46A 4F7SA 3DDQA 3FLWA 2GHGA 3HZTA 4DFLA 4ZZNA 1ZY5A 3KXHA 4UY9A 5DWRA 5LJJA 1LEZA 4XG2A 2GNGA 3WF6A 3ITZA 3COMA 4R6VA 3EIDA 5CU2A 1GY3A 3BWJA 3QRKA 3A2CA 4GFMA 4RGJA 5DRDA 4AAAA 4AZWA 2P4IA 4KRCA 4YBJA 5CANA 5L6WL 4C38A 4YJTA 3I79A 4R77A 3OOGA 2BFYA 3IDBA 4HNFA 2BIYA 4OTGA 5E7RA 4BWXA 4A4LA 4USDA 1OPKA 2OK1A 1FPUA 1Q4LA 4QTAA 5BVKA 4I0TA 3K5UA 3NNXA 4FEVA 1PW2A 2HZ4A 3U87A 2PMOX 4MHAA 5LMBA 3C4WA 4AZFA 1URWA 2VZ6A 3C5IA 2R3KA 4FG8A 2WMBA 4EZ5A 4A4OA 2WD1A 4QP9A 2QOFA 4CKJA 2Z2WA 2IZSA 3NIZA 4FNZA 1ZYCA 3FZOA 2CGUA 4J95A 1LPUA 5D7VA 4F9YA 4JQ8A 4RVKA 4E7WA 2C0IA 2W1IA 4AA0A 3HEGA 5T6KA 3ZBFA 4F64A 3PSCA 5FGKA 2QG7A 2OIQA 4A07A 4F6UA 4ASDA 2UZBA 4KIOA 4TWPA 1U59A 3MI9A 4YP8A 3LQ3A 1Q8ZA 5F4NA 5CAPA 4UMRA 3TDWA 4G16A 4QOXA 2R7IA 4RLKA 4DGGA 3U6HA 4YPDA 5DHJA 4I5CA 3QUDA 5HG9A 4WNOA 2PULA 3EKKA 5ANDA 4FT0A 4DG3E 3R6XA 1YDTE 4BDAA 3ZSIA 2UW6A 1WBSA 2YM5A 5IUGA 5JFVA 2YCFA 5JRQA 3SG9A 2VX1A 2WEIA 5KZIA 2YITA 3R21A 4QYFA 4L3JA 2HWOA 4RWKA 5GZ9A 1AQ1A 3AC2A 3EFLA 3F3ZA 3QYZA 3ZO4A 5M09A 4R8QA 3RCDA 3Q04A 4NKSA 4DG0E 5AV4A 4X6QC 1BL7A 5A4TA 5J9ZA 4U97A 3OY1A 1H1RA 3H4JA 4FE2A 4LGGA 1H26A 4NJDA 1G5SA 3ZC5A 3SV0A 2FUMA 3AQVA 2YCRA 1JVPP 3PRFA 3S3IA 3LE6A 3E62A 1OKWA 4QQTA 5FRIA 3TWJA 1LEWA 3CQWA 1R0PA 4KWPA 4A9UA 4IAIA 5M55A 3ORNA 5E4HA 3VUHA 4FT5A 4XRJA 3S1HA 2GNHA 3TKHA 3PDTA 2JKMA 4HGEA 3L9MA 3Q2MA 4L44A 4NFMA 4BCKA 3U6IA 4FSTA 3Q60A 3G0FA 4BN1A 2I0YA 2QOBA 3SKCA 3WE8A 5IG1A 1YKRA 2JD5A 2PVLA 2XBAA 3QZIA 3UOJA 3LFEA 5HO8A 4EJNA 4UB7A 2XK6A 3QTWA 3K2LA 1JSUA 4H39A 1PXOA 4X2FA 5AP3A 3OW4A 3OCSA 4M84A 4RQKA 5A54A 3UQCA 3E8DA 5J79A 2W9FB 2Z7SA 4JBQA 4TNDA 2W0JA 5EHLA 3WZEA 4R1VA 4BDHA 4HVSA 3HMNA 5AIKA 1OIUA 4JG6A 1Z5MA 4L7SA 4RZVA 5TF9A 4JS8A 3VS2A 2OJFE 5HQ0A 2R3NA 3PWYA 1J3HA 3E88A 1PXPA 3BYMA 3I7BA 3KCFA 4A4XA 3COKA 2WQEA 5EM6A 4QMTA 4UV0A 3LCSA 2QHNA 1JOWB 4ZSJA 5J1WA 4BDFA 1KE7A 4FKJA 1TQPA 3GVUA 3P86A 4FTRA 2WMXA 3T8OA 3PVBA 2UZTA 2X2LA 2ZM3A 5L3AA 4ZIMA 1Y91A 2VWXA 4CFFA 3KXZA 2CLQA 3ZUTA 4XJ0A 3HMOA 2VTNA 4J96A 3GU6A 2XIXA 3B2TA 5CF4A 5HIEA 3DKGA 3MY1A 5KBQA 5CNNA 4IACA 1GIIA 4YTHA 4ZJVA 1GZNA 4AGDA 2OZAA 4FUYA 1W82A 2WELA 5ICPA 2ETRA 1WVXA 3HRCA 3CY2A 3QD0A 4PMSA 2C5YA 4P90A 5LVNA 4DGNA 1MQBA 3ZOSA 4AQCA 4TL0A 4GV1A 4LUDA 2H9VA 4ZTNA 4ZTLA 4UYNA 3ZRMA 4EQCA 4M12A 3Q53A 4PX6A 3C0HA 3EHAA 4IH8A 1ZAOA 4P7EA 3QXOA 3DBCA 3EN6A 3MJ1A 4Y73A 4E4MA 5LMAA 4C2VA 4X3FC 3UOLA 5AAEA 4X2GA 4O7WA 4KKHA 5CF5A 4BCPA 2ITXA 3C4EA 4F0IA 2YISA 5H8EA 3I5ZA 3VBVA 3ZUVA 1WBNA 2ETKA 3A7IA 3RHXA 3RPRA 2ZB1A 5M56A 3HMIA 1XBCA 4UWYA 4Z7HA 1FBNA 3TNPC 2B9JA 2VWUA 3PY0A 4RQVA 4WIHA 5CVHA 3QA0A 4IW0A 3RPYA 5GJDA 5GJGA 2ZVAA 4M69A 4MXOA 5J5TA 2UVZA 2W7XA 4QMNA 4BWKA 3FXZA 4RIYA 4BR3A 4OBOA 4F7JA 3GOPA 5K5NA 2X7GA 4E5AX 3ZXZA 4X3FA 4K0YA 4F70A 5ITAA 2B54A 3BIZA 4C2WA 3KU2A 3H10A 3JY0A 3QWKA 2C5OA 2QC6A 4YNOA 2BFXA 1CM8A 4PRJA 2JBPA 3EZRA 4Y8DA 2W1CA 4OUCA 2FVDA 2B9HA 4B4LA 2QLQA 1M2QA 5LOHA 2JFLA 4G6NA 4CSVA 4AF3A 4I23A 3BCEA 4A9SA 3FYKX 4YGAA 4FV3A 4EH5A 3HP2A 2ZDUA 3D4QA 3IW8A 4H3PA 3PZEA 4KIKB 5DE2A 3OBGA 3LFFA 4MX9A 4R7IA 3TJCA 2OKRA 4BBMA 3MYGA 3OUNB 4AW0A 5JGAA 1WCCA 3JUHA 4HYHA 4EOPA 4QMQA 2IVTA 4FTMA 3R1QA 3O2MA 2VO0A 5CU3A 2C0TA 1PMVA 4DEDA 4DGOA 3NUYA 1IA8A 2BAJA 3FKNA 2FGIA 3M42A 4FNYA 3CKXA 3SAYA 4FEXA 1H25A 2GSFA 3BLRA 4Q5EA 4ZJJA 2PUNA 3Q4TA 4GFOA 3EQCA 4P5QA 1UWHA 4D1XA 4PP9A 3U51A 3L1SA 5IA1A 3E87A 3B8RA 4ZTSA 4A9RA 3WI6A 2OBJA 5KX8A 5CU4A 3BGZA 2C0OA 5D12A 1UNHA 5AJQA 2OG8A 3KREA 3VRYA 1W98A 4TTHB 2XIZA 3BX5A 4G34A 3QQLA 4CEGA 2VUWA 4YJOA 1TKIA 3RP9A 5C4KA 4RFMA 1M2PA 3AD4A 4P5ZA 2QG5A 5AP7A 5A46A 3HX4A 4GUBA 3V6SA 5TE0A 4WKQA 3HP5A 3VBWA 4G1WA 5CSXA 4HOKA 2VTPA 5E8YA 2CGXA 2ITYA 4GKHA 4AGUA 1XO2B 1J1BA 4QTBA 4D55A 3ZRKA 3DT1A 4BVUA 5JZJA 1YOJA 1J7LA 3PXKA 2BRNA 5BPYA 3IONA 4IAAA 4RX5A 4PL4A 4CNHA 4FKUA 1KV1A 1Q3DA 1UNGA 4AS0A 2WU6A 3ORKA 3O23A 3UTOA 3ODYX 4YHJA 4EONA 3EQPA 2OZOA 4WA9A 3ZM9A 4WNPA 5FD2A 3F69A 4C4HA 3ALOA 4CV8A 1SM2A 3OXTA 5BYYA 1JKLA 5HG7A 4RC4A 5C27A 4FICA 3K3IA 2JKQA 3KY2A 2VO3A 4S30A 3UG2A 3RVGA 4S33A 2ACXA 1P2AA 1IASA 3DNDA 3ZUUA 4Q5HA 3HV4A 3WF7A 3HRFA 5H8GA 5IH6A 1S9IA 4JOAA 3L9NA 1HCKA 2RG5A 3F66A 4PDYA 1M7QA 3KXMA 1ZOEA 2BALA 3P78A 4OGRA 4DF3A 1DS5A 4R5YA 2IVVA 4I0RA 2XH5A 2NNWB 3A7HA 3LFCA 3HVCA 3KRWA 5AMNA 4AA4A 3LZBA 5EI8A 3C5UA 3HUBA 2GCDA 1PMEA 4FTAA 2QQ7A 3Q6WA 2P3GX 2W5HA 4G6LA 3HYHA 5HG8A 1ZLTA 4V04A 2QOCA 3DKCA 5HNBA 3R8PA 4DT9A 2YAAA 3QRTA 1J1CA 2R4BA 4J8MA 2X2KA 2O64A 2G1TA 2PMIA 4O82A 3LHJA 2A27A 5GIPE 2GNFA 1P4OA 3ETAA 2VNYA 4K11A 4FMQA 1Z57A 5E8WA 3F3WA 5ANGA 1H1PA 5CEPA 2QI8A 4FIEA 4H1MA 4MD8E 4XV1A 3RK9A 3TKIA 2JDOA 1YI6A 5IUHA 3CLYA 4WBBB 1YXXA 1SNXA 4IX3A 4KB8A 5CX9A 1XWSA 3F9NA 3PPKA 4I5PA 2WMAA 3MVJA 5IF1A 3OTUA 4WD5A 4EWHA 3KKVA 1B38A 4BDDA 1W8CA 4FK6A 4FVRA 3BHTA 5E9EA 3ZHPC 5CU0A 5FM3A 4ITHA 1PXKA 4MXZA 5AV3A 4CQGA 3IOPA 3O7LD 4ENYA 4ZLOA 4B8LA 3F5XA 3NUSA 1QPEA 2QVSE 4YLKA 4EJ7A 4XOYA 3ZC6A 3ELJA 4EC9A 3AMBA 5L2QA 5AAFA 3OCTA 4O7LA 5FDPA 4CKIA 4XV2A 2ZYBA 4IMYA 4BDKA 4FYNA 3QD2B 2X9EA 3SXRA 2R3RA 2JDRA 5KE0A 1KV2A 4K33A 2GPHA 1CKJA 3DA6A 3EJ1A 3FV8A 4KBAA 4MQ2A 2VO6A 5CNOA 2QOKA 2W17A 4GU6A 4NM5A 3NW5A 2PK9A 1SVHA 1H07A 1Y8GA 2BILB 2C6DA 3NUXA 4BDGA 2BPMA 2OF4A 3BU6A 3FZSA 3GCVA 4BI0A 4L8MA 3G0EA 1XH6A 1DM2A 3AD5A 4G6OA 3QTIA 2Z7RA 4TPTA 4BBEA 3OVVA 4GH2A 4CTBA 4G17A 2UVXA 3DFAA 2Z8CA 4S31A 3H0YA 2KULA 4WRSA 3VWAA 3F6XA 5HEZA 2GFCA 5HE1A 3AXWA 4YZ9A 1PMNA 4I22A 3RAHA 3WARA 4ACDA 4FTCA 5T68A 3KK9A 2ITUA 5DPVA 1R0EA 3NUUA 1PY5A 3ZS5A 5CF6A 3UZRA 2EXMA 3KF7A 4HYSA 4D2VA 2BHEA 4IE9A 4ZTRA 4D1ZA 4YZMA 3UNZA 4UN0C 4QPMA 4M66A 2PVNA 4I6QA 4HCVA 4PPBA 3ZO1A 2X4FA 4L53A 3QRJA 2ITVA 2XB7A 3RNIA 4BI2A 3KL8A 1AGWA 2PZIA 3TV7A 5B2MA 4S34A 5J9LA 4DHFA 2W05A 5M4CA 4CV9A 3OG7A 2XIKA 3L8XA 2ITNA 3LM0A 4FIJA 2BUJA 2BRMA 3VS0A 2B9IA 4A9TA 3KF4A 2WXVA 3DBQA 3MW1A 4CFXA 1KUTA 4IQ6A 3C7QA 3R30A 4LV5A 5ANOA 4F9AA 1H0WA 2BAKA 5HVKA 3UQFA 3NVKI 3AC1A 4WNKA 4ZP5A 4EHGA 4IZAA 3V51A 3ZLSA 1ZRZA 2JC6A 4BCNA 3KCKA 5KBRA 2HW7A 2J2IB 4FZ7A 5JSMA 1VYZA 3ENMA 4E6DA 4D4VA 5H9BA 4N4SA 3OROA 1IR3A 4LL0A 2HELA 2NP8A 2ZOQA 3P9JA 5LARA 4NIFA 3VUKA 4IFGA 4PPAA 4QMYA 4G5PA 4C3FA 3C0GA 4ZOGA 4TN6A 3PUPA 5IDPA 4K18A 4O22A 3PE1A 2VD5A 4LYNA 1L3RE 1PXLA 2XA4A 4I6FA 2XVDA 2C6KA 2R2PA 5CAQA 1YRPA 3IG7A 3PLSA 3QCQA 4EUUA 4O7TA 4PTGA 3WZDA 4BC6A 5L2SA 2P0CA 4LGHA 3MA3A 2JIVA 2EB3A 4U5JA 3CR0A 4G3EA 4RWJA 3PE2A 3ZU7A 1Z9XA 5BVDA 2QODA 3MH3A 4QMSA 3QC9A 3HA6A 4LI5A 5ETAA 4AW2A 3S2PA 4YJPA 4I41A 1WAKA 2FA2A 3CTJA 3QGYA 3SVVA 2NPQA 4U79A 5JQ8A 5DGZA 3DCVA 3LIJA 2HCKA 1OL5A 1KSWA 3D7TA 1IAHA 4XBRA 3IGGA 4C35A 4YZNA 4J52A 4G3FA 4G9RA 3QTRA 5IUIA 3R8VA 2BDFA 4ALVA 5IZFA 5DVRA 3SA0A 1ATPE 1XR1A 2BHHA 2W4KA 3ANRA 4FODA 4HNIA 4KABA 4GK3A 4BIBA 4TXCA 1GZKA 5AADA 5HNIX 3BE9A 5CQUA 2ZB0A 3R8UA 2FO0A 1J91A 2A4LA 5CEIA 1HOWA 2WTDA 2Y6MA 3FUPA 4QP4A 3RI1A 3S4QA 3UNJA 4BRXA 5I9ZA 2OIBA 3ZLWA 4Y85A 2J9MA 3RKBA 2PZ5A 5LVMA 3HLLA 4C02A 3AC3A 3SRVB 3G15A 4IANA 4U45A 3W55A 2YHVA 2VN9A 1M14A 3CS9A 3RCJA 4F1OA 5M4FA 4PP7A 3D5VA 2PVJA 3I60A 3WOWA 4BDJA 4O7VA 4BY9E 2XK9A 2C3JA 2OJIA 4MNEB 2XYUA 2WMRA 4DH7A 4FKIA 3G33A 4F4PA 3GU4A 4GT3A 3R63A 1EH4A 4NCTA 5HBEA 3MFTA 4KIPA 1URCA 5CSHA 1YDSE 2PVMA 3MH0A 4L7FA 1RW8A 2R0UA 1NY3A 4YZDA 1UKHA 3GEQA 3IW7A 2JIIA 2WB8A 4GT4A 4IEBA 5DG5A 3V04A 3LCOA 3ZDIA 4DFNA 2OLCA 3NVMB 4GYGA 5BUIA 5EHOA 2HK5A 2VTTA 1STCE 1MRUA 4DLIA 3D5UA 3FZPA 5DEWA 2J0LA 3IOKA 4CGAA 4O38A 2QOQA 5BVOA 2UW9A 2X2MA 3SW7A 3MH1A 3NMUF 2X9FA 3DZQA 3OOMA 4FSYA 2FH9A 3R1NA 1E1XA 2BZIB 2JKKA 4GJ3A 4FBXA 4RJ3A 3ZXTA 4BGQA 5CI6A 2ZV7A 2JAMA 2Z7QA 2UV2A 3UIUA 1OECA 4IDVA 3C13A 5M07A 2EUFB 4AN9A 2C6EA 4V01A 5HVJA 2QCSA 5E1EA 1YWVA 4EK6A 2LGCA 3RM7A 4Q9ZA 4HCTA 2H34A 4C3PA 2UUEA 2VWWA 4WOVA 1FVVA 4CRSA 4PMTA 3BI6A 3W33A 5C1QB 5CEKA 3F61A 5DR6A 4FV4A 4C4JA 2J90A 1F0QA 1T45A 3D5XA 3IECA 4QQJA 5A6NA 2AC3A 1XKKA 1VZOA 2PZYA 2W9ZB 3D7ZA 3DJ5A 3QD3A 4Y5HA 4C37A 5K5XA 1XH5A 4JNWA 4RWIA 4AZTA 4WUNA 4BIEA 2PSQA 3GCQA 5DN3A 1OB3A 3IGOA 1OIQA 1ZZ2A 3HV7A 2VTHA 3KXXA 2B53A 3H9FA 3AGLA 4XP0A 4D9TA 3BGPA 3RAKA 5JN2A 3VHEA 4XP2A 5BYLA 4LM5A 1YHSA 5KMMA 5ACKA 5CYIA 3CCNA 2WIPA 5KMKA 1H1WA 4FV1A 1W83A 3KC3A 1KWPA 2RFDA 2OICA 2WOUA 2JLDA 4IBMA 4FT9A 3D15A 5G1XA 4MD7E 4X2KA 5HNGA 2VTIA 3AT2A 4YJVA 3KN5A 2HXQA 2ITPA 4OTIA 4KIKA 4OT5A 3QWJA 3VF9A 1FGKA 4DTKA 4JDHA 4TWCA 4IZ5A 3TG1A 5AA8A 2P2HA 2YERA 2PE2A 2YIWA 3OFMA 4L9IA 5DT0A 5TR6A 3UBDA 4BHNA 4DITA 4ZAUA 4OAUC 2UW4A 4ANNA 3LXLA 4DT8A 2CKOA 2ZMCA 3EN9A 4J8NA 3KRJA 4LRKA 4QO9A 3TTJA 4AOTA 1JKTA 5AP1A 5AP0A 4ENXA 5AV1A 3R8MA 4H05A 2OGVA 4H3BA 3HMPA 4HGSA 5IA3A 5HD7A 2OFUA 5EYCA 2J4ZA 2WTCA 2C30A 2QOOA 2V7AA 4E73A 2W1ZA 3DK3A 5IQGA 2XIYA 2ITZA 4O0XA 1OBGA 3PJ3A 4PDPA 4D1SA 1ZY4A 5EM5A 5BMSA 3EWHA 3OWJA 5IA0A 3QALE 4EH4A 3ORTA 3JVSA 3V5QA 3PA5A 2JAVA 3UPZA 3QRUA 3QKMA 4FKSA 5K0XA 4O0WA 3DAEA 2CNUA 4WNMA 5C8KA 4ITIA 4LMNA 4YLJA 2YCSA 5KMNA 1UKIA 4O83A 3FMNA 5HE2A 4PY1A 4B6LA 2QLUA 2W1EA 5KKRC 3OTVA 2GFSA 5BVEA 4PNIA 4USFA 3MV5A 5CWZA 2ITTA 3GFEA 5FBOA 2HZIA 2VTMA 2VWZA 3ZMMA 3ZO3A 3ZLYA 2EXEA 3K5VA 3K3JA 2GNIA 5HCXA 1O9UA 4UWBA 2GQGA 2X8EA 2Y8OA 1H08A 2YFXA 3F3UA 4MCVA 3A8WA 4MXYA 5CTPA 3R7EA 5ANKA 1BLXA 1JAMA 5DRBA 3H3CA 1DI9A 4ANQA 5FEEA 4KIQA 2YM3A 3M11A 4DFZE 5AAGA 4DEGA 5DYJA 5AR8A 4BTMA 3G90X 3TACA 3VUGA 2X6DA 3HDNA 5L8KA 5J1VA 4DLJA 4YURA 3U6JA 4CVAA 3WIGA 3P79A 4O27B 3A4PA 1YI4A 2I40A 2V5QA 2X7OA 4FTTA 3VW6A 4AW1A 5AFVA 3FPMA 2F7XE 4X3JA 4U3ZA 4NKAA 5BYZA 4FVQA 2JEDA 2UZEA 3JPVA 4XH6A 3DBEA 3R9HA 3ULZA 2W5BA 3HA8A 4EEVA 4EH3A 1FVRA 3I4BA 1IA9A 2OO8X 4GG5A 4F65A 3CC6A 5FWKK 2VTRA 4C7TA 1ND4A 5CVGA 3G51A 1XBBA 4I5HA 3E63A 4PMMA 4AZSA 5AX9A 4MTAA 2YZLA 1BX6A 1YWNA 4GSBA 3R9NA 3VNTA 4O0VA 1JNKA 3OBJA 1NVSA 3P1AA 4HGLA 4I5MA 4PTCA 3F2RA 3I7CA 3HV3A 1JWHA 3R04A 1UV5A 4WBOA 1JSTA 1YXSA 4ID7A 3VO3A 5KCVA 3TIZA 4BZDA 3PVGA 3ANQA 3HDMA 3MIAA 3R9OA 3MBLA 5AEPA 4OLIA 5IKWA 3GOKA 4JR3A 3UDBA 4C0TA 4CFNA 4N6ZA 5CVFA 3T9TA 4DBXA 3FKOA 1J7IA 3OWKA 4L3LA 2RFEA 3JR1A 3RZFA 1GNGA 4FKGA 2YZAA 4KAOA 1SZMA 5CENA 3QX2A 4AT5A 4C4IA 4QMUA 2J50A 2WMSA 2PY3A 2RG6A 3AT4A 4WRGA 2ZMDA 5HLPA 1Y8YA 3DAKA 4EQMA 2Z02A 3QTSA 3FYJX 4K6ZA 2B4SB 3BZ3A 3PIXA 2WPAA 1LP4A 3LJ2A 4LG4A 5AWMA 3BHUA 4ZY5A 3IDCA 4RJ6A 1J7UA 2BZKB 1BKXA 3EQHA 3C4FA 3OCGA 4E26A 3HECA 2VX3A 3EKNA 2XNOA 5FLFA 5LVPA 4IWQA 3FI4A 5CY3A 3BLHA 4AE6A 3DU8A 4DH1A 2PYWA 4I93A 2IW9A 3ZDUA 3QBNA 2W1GA 2C3LA 3KRRA 1MRVA 4S2ZA 3KRXA 4W8DA 5CSVA 4I6BA 5JEBA 1CDKA 1PKGA 4FYOA 3VC4A 4LOOA 4XNEA 4I0SA 3N4TA 2XKCA 4Z55A 3EFWA 4NU1A 1PXIA 3N51A 3HKOA 4BICA 3U55A 3NYVA 5IQHA 4NFNA 4CD0A 2QO2A 5DT4A 5D41A 3L8PA 4KD1A 3OY3A 3LPBA 5JFSA 5JH6A 5C8NA 3KMMA 4BFMA 1FMOE 3P7BA 5HU9A 3DOGA 3UO6A 4BCJA 3N4VA 3U9CA 4NTSA 5M4UA 1JKKA 1FMKA 1UA2A 4IVCA 4GVAA 4U7ZA 4MH7A 3WYXA 2W4OA 1YVJA 4AGWA 3BU5A 4CXAA 3UZTA 2XK8A 3R71A 4FTJA 4UALA 3QX4A 4XBUA 3RPSA 3DDPA 2J51A 4CFUA 1E9HA 3BELA 3V5LA 5BMMA 1UU8A 4ARKA 3FHRA 5IPJA 1ZARA 3PJ1A 3ZFXA 4TYEA 4BIDA 3GUBA 4DGMA 4BL1A 1OKVA 3DY7A 5ANJA 3R28A 4G2FA 2R3PA 1G8AA 3W8LA 3GC8A 3T3UA 2REIA 1H8FA 3NNWA 4F7NA 5HIDA 5E8ZA 4O1OA 3MIYA 3CQUA 5TT7A 3Q4UA 4F7LA 3QQKA 4FR4A 2QHMA 2XCKA 2C1AA 4JQEA 3U8WA 4U0IA 4M67A 2BKZA 2YAKA 4ZK5A 1VEBA 4RJ4A 4RX8A 2CN8A 4Q2AA 3O7LB 2E9VA 4HW7A 3ORPA 5HG5A 4E4XA 2A0CX 4O7ZA 2YJSA 3BYUA 2QR8A 1XH4A 3TXOA 3O8PA 4RIWB 1CSNA 4JRVA 5HHWA 2VNWA 4OTRA 4PL3A 3ZSHA 4IM2A 4ASXA 3B2WA 4XHKB 3NDMA 5IMEA 4MXCA 4ALWA 4QYYA 2RF9A 3EQRA 3RGFA 1G8SA 2CKPA 4YHTA 4EOOA 4QQCA 3JVRA 4KS8A 5J7BA 3L8VA 1H1QA 5IQCA 3SLSA 3I1AA 3UP7A 1FINA 4FKRA 2R3LA 4FF8A 3BRBA 3GFWA 4BZOA 5D7AA 3TCPA 3AMAA 2XK3A 4NK9A 4C4EA 3ZM4A 3R02A 3MESA 1Q8YA 3PTGA 3K54A 3TZ9A 2FSTX 1KE9A 3EQBA 2EU9A 2VGOA 3PY1A 2WTKB 3F82A 3QUPA 4FC0A 4IDTA 4EH9A 4YJQA 1UU3A 4ZTHA 2F2CB 3PWDA 3COIA 4AFEA 4QMWA 4F9BA 3FC1X 4J97A 4GS6A 4M3QA 2C3IB 2G2FA 4U42A 4X2NA 3VBQA 5E8VA 5L2IA 2GS6A 2WZJA 5AP6A 3E7OA 4NTTA 4U8ZA 1OL6A 3QZGA 1H27A 2QONA 1Q99A 3LAUA 4QMXA 5M08A 1WZYA 4NEUA 2P2IA 4CTCA 4I92A 1O6LA 5GHVA 2YCQA 2F4JA 1M52A 4Q9SA 2HWPA 3HV6A 4BTFA 1PF8A 4L67A 5CASA 2C5XA 2CCHA 4O84A 3C51A 3CTQA 4HPTE 4O2ZA 3R7GA 1DAYA 4YBKA 5FXSA 4OTDA 4RPVA 3I81A 4C57A 5K9IA 5L2WA 5IH5A 4HVDA 5IA5A 4FVPA 4IJPA 3WZJA 4QPSA 1XHAA 4YNEA 4E1ZA 4B0GA 5GZAA 2X7FA 5HLWA 3T3VA 3NCZA 1M17A 4H1JA 3BKBA 4BTKA 4O7SA 3A62A 5I4NA 5CEOA 3FE3A 2PMNX 1WBTA 3CPBA 4QP1A 3LMIA 2XCHA 2OSCA 4NM0A 3QQHA 5EK7A 2O63A 4UEUA 3CQEA 4WG5A 1K3AA 4I24A 3NSZA 5ACBC 5EQPA 5CSWA 3DQXA 3UPXA 2GNLA 2VU3A 4DH5A 1RQQA 2C47A 5AR5A 4C59A 5CF8A 3GT8A 1KE6A 4EI4A 3RNYA 4F0GA 4R1YA 4YJRA 1SYKA 5EH0A 3PZHA 5H2UA 4MWIA 4MNEA 3WF9A 4C4FA 2F49A 5FG8A 3LKMA 5A14A 4DCAA 3IW5A 2ZV8A 5JMSA 3NYNA 2XIRA 3MVHA 4OTFA 2PPQA 5L8JA 2I6LA 4LRMA 4GIIA 3P7CA 4HGTA 3L8SA 4PPCA 1OKZA 3O71A 2CNVA 1A9UA 3FLZA 3UGCA 3GGFA 4OTHA 4WG3A 3ZCLA 3ROYA 1NVRA 3DLSA 5EYKA 4DFUA 3BQCA 3OF0A 2VWBA 4HCUA 4ZY4A 4NL0A 2C6OA 1H24A 3BE2A 4EHVA 3OXZA 4BKJA 2AYPA 2OXDA 5IMXA 4BZNA 1Y6AA 5KZ0A 2XNPA 3ORLA 1OI9A 4F0FA 2AUHA 3UG1A 2QOLA 2UW7A 3UQGA 3LLAA 4DINA 2UVYA 4TWNA 3QKKA 3UO5A 3RWPA 1Q97A 4DA5A 5HORA 1ZZLA 3PXRA 3BV3A 5E8XA 4EWQA 4QMMA 5F1ZA 4CFWA 1HCLA 2W5AA 3MVMA 4QT1A 2VWIA 4IM0A 3TT0A 4O1PA 4ACGA 2ESMA 3FXXA 5HTBA 4D0WA 1IAJA 1YOMA 3O50A 3Q4ZA 1GIJA 4WO5A 5M44A 4XUFA 3KRLA 5B0XA 2OXYA 5DEYA 3CY3A 2XUUA 3HV5A 2A1AB 3V3VA 3MA6A 4RLLA 3FLYA 1Q24A 2O2UA 2XF0A 4QMVA 3ZH8A 3AC4A 3Q5ZA 3R73A 5DFPA 5E91A 2EXCX 5HX8A 4NW6A 4KBKA 4G3CA 3BHVA 3CP9A 4UZDA 5HIBA 4EH2A 3ZEPA 4QTEA 3FLNC 4FTUA 5HX6A 4JR7A 4O81A 3Q52A 5FTOA 4YSJA 1UVRA 4K9YA 4PWNA 4XG6A 2YACA 3QLFA 4YTIA 2R3JA 2C6IA 3EMGA 4F6WA 4BHZA 3C9WA 4RG0A 1NVQA 3NW7A 5BNJA 3ALNA 4D5HA 2DUVA 3LCTA 2ETMA 4QP6A 5I3OA 4ANSA 4ZSEA 3ZTXA 4X6RA 4FSWA 4HVHA 5JQ5A 1JKSA 5HGIA 3P0MA 4IX4A 2UZLA 3P08A 2DYLA 4CG9A 1V1KA 2WTVA 4TWOA 4CCUA 1WFCA 4M13A 1R39A 2Z7LA 3PPJA 4GMYA 4V0GB 3ZO2A 3QCYA 2X81A 4O0SA 4U6RA 4GIHA 4CKRA 3I5NA 4JRNA 4PTEA 5F20A
chains in the Genus database with same CATH superfamily
3O51A 5I9UA 3FXWA 3NW6A 3W0SA 5FTGA 3P7AA 4YU2A 4AXDA 2UZWE 3GU7A 4PQNA 4W4WA 4C8BA 4EOMA 3O8UA 4UYAA 4UWCA 3IW4A 5KUPA 5DR2A 2VTOA 2CGVA 2ITQA 3OC1A 4N0SA 3BBTB 3F88A 3AGMA 3H30A 3ZBXA 3F5PA 3QXPA 5J87A 2BIKB 1REKA 2WIHA 4JJRA 1UWJA 5EI6A 4A7CA 2BCJA 4IVDA 4FI1A 4ASEA 3I0OA 3TZMA 3NFGB 1BI7A 2UZNA 4CMTA 4DC2A 2I1MA 4RJ7A 5EG3A 4IVAA 2JDTA 4HJOA 4R5SA 1WBOA 1FQ1B 4WHZA 4ZSAA 1WVWA 4XEYA 1ZOHA 2QU5A 3JXWA 2E9NA 5FEDA 2XMYA 4G9CA 4IVBA 4U81A 4N57A 5EW3A 2C6MA 4RC3A 4LMUA 1QCFA 5EM7A 3R1SA 2QU6A 2YM8A 4JI9A 4D4SA 2WOTA 2BZJA 1TQIA 2YIRA 3N9XA 3RZBA 3WF5A 2GS7A 3MFRA 3ZONA 2CNQA 5HCYA 2RFSA 4BCHA 2WAJA 4FL3A 3H0ZA 3FQEA 4DEBA 3ZSGA 4KUJA 2Q83A 2YIXA 4EK3A 3NAYA 2Y6OA 4DTBA 2RSVA 4O6LA 3R7UA 4IZYA 4CQEA 1F5QA 4EKLA 2EVAA 1YI3A 3KB7A 4E4NA 2AQXA 2J0IA 1JPAA 2X8IA 4FV6A 2VTLA 4QMOA 5DT3A 2QR7A 5GNKA 4UZHA 4D9UA 4ERWA 4DHIB 3I6WA 3CE3A 4FSNA 3PG1A 4EHEA 2IVSA 2PMLX 4FZ6A 5BVNA 4E6QA 3NFFB 4HYUA 4M15A 4W9WA 2EWAA 5EDQA 3IKAA 1SNUA 3BV2A 3PJ8A 4IB3A 4MF0A 2AEGA 4A9YA 5JGDA 4FZFB 4NT4A 5AP2A 5JGBA 4ORKA 4IX6A 2R3HA 4LOQA 4D2SA 4H3QA 5CLPA 3BEAA 3NS9A 4AWIA 4F9CA 3R7IA 1H00A 4XV3A 4EORA 3PXFA 4X7QA 4FV2A 3VRZA 3E64A 3PJ2A 3DB8A 4ITJA 1BL6A 3MH2A 1REJA 4B7TA 2WHBA 5EFQA 4W8EA 2VRXA 5L6OA 2ZM4A 2PTKA 3CPCA 5AP5A 5KMOA 1O6YA 2O5KA 1A06A 4YMJA 2PVRA 3A7JA 4K77A 4J7BA 3KQ7A 4RBLA 3PXYA 4M69B 4AN2A 4F1TA 4IFCA 3R7OA 3VS4A 3BLQA 3LCKA 4DDGA 3UYSA 3UVRA 4D2TA 2E9PA 3RINA 3NPCA 4YC8A 4BDBA 3CIKA 5CXZA 3MJ2A 3EL7A 3JY9A 1YXUA 4X3FB 2XJ2A 5F94A 4BJJA 4GK2A 3WZUA 2BMCA 1MRYA 4I6LA 2V62A 3FMLA 2RKUA 4BCFA 4Y5QA 2WU7A 4DTAA 5AP4A 4L52A 3GNIB 3KK8A 3TZ8A 2IZTA 4H36A 4CFMA 4MEDA 4TKSA 3D0EA 4NCTC 3DJ6A 4NWMA 2QURA 5C01A 4BCQA 3FC2A 2XKFA 4JG8A 2XBJA 3MB6A 4DE4A 1FOTA 2NRUA 5IEYA 3E7VA 4ZY6A 3A8XA 4F9WA 5E8UA 4ANOA 4PV0A 3BQRA 1LR4A 4I94A 5BVWA 1PXMA 2FSLX 5H3QA 1K2PA 1GIHA 3ORXA 2GHMA 2DWBA 2JDSA 4E20A 1IEPA 2XEYA 4HVIA 1JBPE 4L3PA 3V5PA 2CJMA 4R3CA 3QUEA 5D9HA 3ATSA 5C26A 3E8EA 4TW9A 4UXLA 2IW8A 4NYEA 3PFQA 4EZ7A 4G3GA 4C62A 2X1NA 4QYGA 1BI8A 2VTQA 3GQLA 4IAYA 2GNJA 4ALUA 3R7YA 3MDYA 4MBJA 4FKQA 2HY81 2OF2A 2XNNA 2W4JA 4FIIA 4EBWA 1UU9A 4Z7GA 4ZZOA 4Y83A 3OWPA 4M0ZA 4FV5A 2UW8A 4BDIA 4S32A 4GL9A 1PYXA 5LCKA 1H1SA 3OT3A 1A48A 5AUVA 3LFNA 1ZOGA 2PL0A 5IQIA 2BR1A 2H96A 2WQOA 3H9OA 3F5GA 1B6CB 4L68A 5AM7A 1OITA 4ZMFA 2QO7A 4F6SA 3RHKA 5ANEA 3T9IA 2G15A 4MXXA 2VTAA 4QNYA 1GOLA 5A4CA 1XMMA 1ZWSA 3W32A 4XS2A 4I6HA 3ORZA 2C1BA 4FL2A 3QA8A 3FI2A 2R3OA 2PWLA 3VJNA 5CALA 4U40A 5FP5A 2WTKC 3KULB 5FTQA 4FTKA 4O91A 4CG8A 3V01A 3Q3BA 4IB0A 4RIWA 4PL5A 2F9GA 3TEIA 4ONAA 4JAIA 4AGCA 2CHLA 4QD6A 4X0MA 4CMUA 5HLNA 4QYEA 4CYJA 2I0HA 3PG3A 1IRKA 1VJYA 4CYIA 5AV0A 4DYMA 2NRYA 4O96A 5IH4A 4DEAA 4FEWA 3HRBA 3O96A 1XH9A 4CRLA 1OIYA 4NSTA 4RJ5A 4GG7A 2YM4A 3OP5A 4D0XA 3GP0A 3TUCA 3CSVA 4HZSA 4RA4A 1OL2A 3FKLA 2FB8A 3ORMA 4FT3A 4D2PA 3QAME 3E3BX 5KMJA 5CEQA 3DZOA 2Y7JA 4IZ7A 4G31A 4EC8A 1ZYSA 2GDOA 5EQEA 4JAJA 3RTPA 4BKYA 4FZDB 1SVGA 4EZ3A 3UZPA 5JZNA 1QMZA 4YZBA 1JQHA 4TNBA 3LJ0A 4UMUA 4W4XA 3EFKA 4ZS0A 1W0XC 3NUPA 2GQRA 1X8BA 3OMVA 5HO6A 4FEUA 3LXPA 4FV7A 5CT0A 3PLAE 4GYIA 2FSMX 4FKWA 3TNHA 4BCIA 3VQUA 1FGIA 5AUXA 3VBTA 4WT6A 3TNQB 2IO6A 3R2BA 3FL4A 3S95A 3A4OX 3D83A 4AX8A 4L01A 3VS7A 5K4JA 5C4LA 1DAWA 4EOJA 4EKKA 4IX5A 2W96B 4D4RA 4QP3A 4AA5A 2BKKA 5LXMA 5IEXA 3UJGA 5KNJA 3QC4A 5AR4A 4MVFA 3GBZA 3FAAA 3I6UA 4XRLA 4FSMA 3V5JA 4E93A 1Q41A 2P55A 2QKRA 1BYGA 4LDTA 1BMKA 4ZXTA 4FOCA 2BDWA 3NZ0A 4L45A 5IA2A 4TYIA 1KE5A 2F2UA 3I0QA 3NNVA 3NLBA 3CXWA 3A60A 4R7HA 4R3PA 5JK3A 4CZUA 4FKLA 5CI7A 2JIUA 4LRJA 2Q0NA 5CU6A 4EYMA 5HU3A 1OL1A 4JBPA 4RIXB 3DXQA 4XG9A 1YQJA 2IF8A 3LQ8A 5D1JA 4FGRA 2WO6A 4YLLA 3F3VA 1H01A 3FLQA 4TY1A 3ZLXA 4DFBA 4G3DA 2X4ZA 4MBIA 5FQDC 4DAWA 4DH8A 1PMUA 3QQFA 4FL1A 4CT2A 2BVAA 2OFVA 3DJ7A 5EHYA 4R78A 2OW3A 3DV3A 3NYXA 3MTLA 3NWWA 4GEOA 3C4CA 4M68A 3V5TA 3II5A 2R3FA 4EOIA 2BTRA 3QCSA 3FSKA 5HBJA 4DBNA 1TFFA 3PFYA 4RA5A 3UC3A 4QMPA 4F08A 1CMKE 4MD9E 2W06A 2B9FA 3EQDA 3MSSA 3WIKA 3PRIA 4YJNA 3FY2A 2EB2A 4EOQA 4UX9A 5CT7A 3ZFYA 4ZTMA 5BV3A 3PVWA 5KHWA 5J8IA 2PHKA 4FG7A 4ZSLA 2IG7A 1JLUE 3QF9A 4J1RA 3TI1A 2OWBA 2PVYA 4KBCA 3TV6A 3BHYA 3HGKA 5T3QA 3AD6A 3UP2A 5A6OA 2PE1A 1CKIA 1PXJA 2Y4IB 3DS6A 3E5AA 2R9SA 1U4DA 2XP2A 3IW6A 2IJMA 4RRVA 1BUHA 2XM8A 3AOXA 5I5ZA 4U9AA 3M2WA 2Y9QA 3ROCA 4PF4A 5H8BA 1CTPE 2XEZA 4GW8A 3C4XA 4FNWA 4V05A 3DAJA 4IAZA 3BL7A 3IO7A 1PYEA 2GU8A 3KXGA 2WMWA 4KA3A 5HBHA 4RC2A 3NYOA 3SD0A 2ERKA 3EQIA 5DH3A 1V0PA 1OVEA 4I1ZA 3NEWA 3OT8A 5F9EA 3EZVA 3EH9A 4EOLA 4KKGA 3SOCA 3Q4CA 1QL6A 2BDJA 3KXNA 1GJOA 2XJ0A 3SG8A 2ZJWA 2WTWA 4IC8A 2C6LA 4R7BA 1K9AA 3A61A 2UZUE 5IDNA 3R1YA 3DKOA 4LL5A 4I21A 3F2NA 4U44A 3QFVA 3BEGA 5AR2A 4AT3A 4EBVA 5K0KA 2GS2A 4L42A 5DI1A 3NGAA 3RPOA 3ZEWA 4D2WA 3IPHA 3RAWA 4O4CA 5AUWA 1YXTA 3CD8A 5HI2A 1ZYLA 1P5EA 3QTZA 4DEEA 4EQUA 1KOBA 2FYSA 1NT2A 1ZYDA 3ACJA 3FMMA 4J98A 2C5NA 1Q8UA 5C03A 1Q62A 3LM5A 3M1SA 3PSDA 4PDOA 5I0BA 4FK3A 1F3MC 1OM1A 5IA4A 4BCGA 4RX7A 2Z60A 2GQSA 1PHKA 1Y57A 1ZYJA 2GTNA 3AT3A 4GUEA 4KS7A 4UBAA 4W4VA 1YWRA 1YXVA 5AUYA 3F2AA 3WBLA 5KMLA 1XJDA 3OHTA 4IWPA 4E3CA 3CKWA 4NIFB 3W8QA 4D28A 4UMPA 2NYAA 2ITOA 1E1VA 2XJ1A 3BU3A 3VS3A 1KOAA 2W1HA 1APME 3DGKA 4RX9A 4DDIA 4V0GA 3FMKA 3FEGA 3UDTA 1KE8A 4X21A 4XG3A 3LOKA 4O21A 2X0GA 4QTCA 4XG7A 2A2AA 4OW8A 4ZSGA 1OUKA 4C3RA 4LFIA 4MAOA 4M7IA 3RJCA 5M06A 2A19B 2R3IA 4W4YA 3PA3A 5EQYA 4F1MA 5IU2A 2B7AA 3QTQA 4XG4A 5LWMA 3SGCA 2UW3A 4JQ7A 3PSBA 3Q5IA 4TYHB 2C4GA 2WKMA 5L8LA 4FKOA 5HTIA 3MPTA 2YWPA 4QTDA 5CEMA 4YJUA 3S0OA 4O4FA 1Q8WA 4JIKA 2OJJA 1RJBA 3D7TB 2WQBA 4U41A 4IC7A 1YHWA 4FX3A 4OTWA 3DBDA 2PVFA 4ZZMA 2P33A 2VTJA 2R3MA 3H9RA 3DLZA 2OJGA 2PE0A 3LFQA 2YJRA 5ANIA 4EH8A 4FUXA 3R8ZA 3U4WA 3MY0A 5HOAA 1GAGA 3GCPA 3PP0A 4AW5A 1IG1A 2B1PA 4ANMA 2VWVA 3UNKA 4DFXE 1P14A 4IB5A 4DG2E 3FMEA 4K2RA 5EYMA 4IXPA 3EOCA 3PXQA 4ZLYA 3Q9ZA 3E8NA 3W10A 5M53A 3W2SA 4OTPA 4A06A 4RVTA 5E8TA 2Y0AA 5DA3A 5EDRA 1YOLA 4RIOA 5G6VA 4I20A 3GI3A 3G9LX 2ZDTA 3OD6X 2PZPA 5AR3A 2WEVA 3BGQA 4O0YA 1Y6BA 4TT7A 4WUAA 5JKGA 5E8SA 4HYIA 4L00A 3W2RA 4EK4A 4M14A 5KHXA 4CT1A 4EH6A 2VV9A 3FMDA 4AUAA 3MY5A 2DQ7X 3DPKA 1W7HA 3VS1A 3QQUA 4AXAA 5AUUA 3GU5A 5AA9A 2HW6A 4J99A 4YO6A 3A99A 4EOKA 3BYSA 3VS5A 4KSQA 1M2RA 3VF8A 1TQMA 3FHIA 3DB6A 1UNLA 4JLCA 4FGBA 4MF1A 4AE9A 2OH0E 3UE4A 4D5KA 2R64A 1OPLA 2X0OA 3JS2A 3Q96A 3QHRA 5CZHA 4JG7A 1L8TA 4YUQA 3VN9A 4C4GA 2NO3A 5I9YA 5KMIA 4FSUA 5EDPA 1PJKA 2Y4PA 2BRGA 4NH1A 2XNBA 2VGPA 3WZKA 2YEXA 4NM3A 4BB4A 3SQQA 4PMPA 2VX0A 3FMHA 4UMQA 3SHEA 2E2BA 4TYJA 2QOIA 1I09A 3FLSA 2WMVA 3EFJA 2HY0A 2ZM1A 3MFUA 3MN3A 4L43A 4QYHA 4Z9LA 1LUFA 3W18A 5KO1A 4RFYA 2W1FA 4DH3A 1ZMWA 4GT5A 2XNMA 1OZ1A 4ZLZA 3RPVA 3PP1A 3Q2JA 3LFDA 4TZRA 2UZVA 4WSQA 2XKDA 4ZMEA 2PUUA 4ANLA 4MKCA 4QMLA 3VULA 5E92A 4ANBA 2H6DA 2CSNA 3P5KA 4Y72A 3UOHA 1ERKA 4MYGA 4JBOA 3GU8A 3FBVA 2ZV2A 1VYWA 2WMTA 3TV4A 3VBYA 4JDKA 3OWLA 3FPQA 4F78A 2R5TA 3A7FA 2CLXA 4JXFA 5AUTA 5GZ8A 4BDCA 2XZSA 3E92A 1QPCA 5J7HA 2GHLA 2ZFYA 1H4LA 3QGWA 4QP7A 3GCUA 3RMFA 1U54B 4FJVA 3BYVA 5LQFA 4BWPA 4FV8A 5GJFA 4ZS4A 3DXNA 5HKMA 4IADA 3LJ1A 3POOA 3SRVA 3R2YA 4WG4A 3W0MA 4XOZA 4M97A 5AV2A 4FSZA 3MB7A 3CGFA 3SC1A 5IISA 3ULIA 4CCBA 1OIRA 1XBAA 4ZJIA 1NA7A 4M0YA 4APCA 4BI1A 2WGJA 2LAVA 3O8TA 2PVKA 3PIZA 3FSFA 3D94A 3FQHA 2XK7A 4XLIA 5B2KA 3GQIA 4O4EA 3VUTA 3D2KA 4LGDA 5AM6A 2IVUA 3G2FA 4AT4A 2PUIA 5C9CA 3W2OA 2CKEA 5I9WA 3ORIA 2X8DA 4FSRA 4YHFA 3QLGA 4QDEA 5ETFA 3NIEA 2WTJA 5L4QA 4GU9A 3ZZWA 3W2QA 3EQGA 3CJFA 3KVWA 4DHJA 2G9XA 3MTFA 3R01A 3QZFA 4G5JA 5AX3A 5HTCA 2KTYA 2B55A 2WTIA 4E8AA 3TTIA 1I44A 5A9UA 3RALA 2XALA 4F63A 4O0TA 4U80A 4C34A 4AQKA 1XQZA 4ZTQA 3FZTA 3QRIA 5FUTA 2XK4A 3CJGA 3V5WA 4B8MA 3PVUA 3R22A 3MGYA 3KULA 2OXXA 2CDZA 3UIMA 2B0QA 3MVLA 4KKEA 4QRCA 1GZOA 4QQ5A 5A4EA 5GINE 3EN5A 1QPDA 4FSQA 4OBPA 1Q61A 2PU8A 3KGAA 2OIDA 2YIYA 3D2IA 2XRWA 3U54A 4ACHA 3DKFA 4B9DA 4EUTA 2I7QA 3RK7A 2OI4X 2CGWA 5A4QA 1ZXEA 2J7TA 2ZAZA 5D11A 2WQNA 3TL8A 3VUMA 4DFYA 3C4ZA 3ET7A 4NJ3A 4BDEA 3AG9A 3C50A 4E5WA 2DS1A 4XV9A 5JRSA 3R0TA 4YR8A 4O7NA 4FTOA 4HZRA 5M51A 2CKQA 2BRBA 5A4LA 5DMZA 4CZYB 2IN6A 2UZDA 5BVFA 3R8LA 3PJCA 5KKRB 3KVXA 3HL7A 1S9JA 5AUZA 3UO4A 3BPRA 3F3TA 4C58A 4QP8A 3NRMA 5CAVA 4YTCA 1OL7A 2CCIA 4EHZA 4PNKA 3TMOA 3KEXA 5EKNA 4Z3VA 4OBQA 5TOZA 2HZNA 3GC0A 4AOJA 4BGGA 3FZ1A 3EN7A 3VQHA 5B7VA 2OJ9A 2H8HA 4OTQA 4HVGA 3SDJA 5J95A 3VONA 1TZDA 3BYOA 3ZYAA 3C0IA 4JDJA 3VHKA 4OT6A 3FJQE 1XH8A 3FL5A 4JX3A 4UMTA 3U9NA 1T46A 2I0VA 3UC4A 1OUYA 4YPSA 4CLIA 3D14A 2J6MA 2J0MB 3CBLA 4FKPA 3KMWA 4CFVA 5LMKC 3FQSA 3UVQA 4DN5A 5FEQA 2HOGA 4MNFA 2YM6A 3P23A 1ST0A 2JBOA 2VWYA 4FEQA 4OAVB 3HUCA 4EK8A 2WFYA 3VIDA 3O0GA 2HYYA 4FZAB 4AXEA 3DK6A 5JFXA 2R0IA 3VUDA 3VUIA 4C33A 4EOSA 3GENA 2WMQA 3FY0A 3CTHA 4EL9A 4FIGA 4HPUE 5FDXA 2CPKE 2ZV9A 4RIXA 1MUOA 5EOBA 3SX9A 5LVLA 2G2IA 4FTQA 4E5BA 4CLJA 4FV9A 5C8MA 3EL8A 4DGLC 4II5A 3UIBA 4J71A 5EI2A 3EQFA 4BCMA 4GRBA 1TVOA 1XH7A 2Y4IC 5IEVA 4IAFA 5LMKA 2IWIA 2C68A 3LVPA 5CS6A 3RWQA 3KA0A 2HZ0A 3E3PA 3F7WA 4JBVA 3UMXA 5LCJA 3EN4A 3UODA 4AFJA 4YTFA 4QEBA 2F57A 4FKTA 3D5WA 3KN6A 5J9YA 3QU0A 2BAQA 3E93A 3LXKA 3VS6A 4QMZA 4FOBA 3V8WA 3CGOA 2PVHA 2G01A 5EW9A 1SVEA 1M7NA 3WE4A 5BQ0A 5BUEA 3OEZA 3Q9YA 4AG8A 2R7BA 4I4FA 4O0RA 3Q32A 4CMOA 1H28A 4APPA 4FIFA 4XMOA 5FXRA 2J0JA 4H58A 2JITA 4E4LA 3C1XA 3JYAA 5HICA 2V22A 1V0OA 2J5EA 2V0DA 1O6KA 1R1WA 1ZMVA 3RK5A 2RFNA 5I9XA 2E9UA 5DIAA 5B2LA 4IJ9A 2XYNA 3FI3A 4K1BA 4QPAA 4LUEA 5HZNA 2OZAB 3UVPA 3OEFX 5DBXA 3GC7A 3R00A 3DNEA 1U5RA 4XLVA 3OS3A 5HE3A 3R9DA 3L9LA 3LFBA 3TIYA 3EB0A 4D58A 4D4YA 4F99A 5HD4A 5L2TA 3AMYA 3ID6C 3THBA 3TNIA 5DOSA 1WBVA 2VTSA 2JFMA 3BHHA 5DR9A 2YDJA 1Q3WA 1Q8TA 4OR5A 4J53A 3DBFA 5I3RA 4LV8A 2O65A 1Q5KA 4XX9A 4RMZA 5EOLA 2IZRA 3QTXA 2YLFA 3UIXA 4CZTA 4LOPA 1OMWA 4IAKA 3LMGA 5HCZA 3MFSA 3DQWA 3OUKA 4IHPA 3SW4A 5CSPA 3PY3A 3LMHA 2WMUA 4FNXA 2V55A 2OU7A 4O2PA 2QNJA 3REPA 2R3QA 3QHWA 3NCGA 2RL5A 4GCJA 3QL8A 3HAVA 2YWVA 4C61A 1QPJA 3E8CA 3FI8A 2Q0BA 4O6EA 5E1SA 1PXNA 4O7RA 3QTUA 4RSSA 5BX0A 2GMXA 4AZVA 3COHA 4BYIA 3L9PA 3V8TA 3QZHA 4WSYA 1RDQE 5M4IA 2QKWB 3OZ6A 4RIYB 4YJSA 3TZ7A 5L6PA 4O7YA 4FTLA 2UW5A 2O8YA 2YDKA 5GIOE 1P4FA 2JGZA 4NUSA 2FSOX 4MBLA 2R3GA 5E90A 2CN5A 1U5QA 2XS0A 4BYJA 4RT7A 4DEIA 2PUPA 1PKDA 3W1FA 3CD3A 1W84A 5FP6A 3NUNA 4EH7A 4DCEA 3R7VA 5IQDA 3POZA 4FV0A 2IPXA 4JDIA 3VAPA 4MWHA 3NNUA 2HENA 5BUJA 5CAOA 4K8AA 4FIHA 2XNGA 5F95A 4USEA 2GTMA 5IQBA 3G6HA 4IWOA 1CKPA 2UZOA 4BF2A 4RFZA 4FTNA 2C69A 3LW0A 4IM3A 4GK4A 1R78A 4TYHA 4P4CA 4BKZA 4YSMA 2ONLC 3OCBA 2I0EA 2J5FA 4YO4A 1H0VA 3QYWA 1XMLA 4M8TA 3TUBA 3UYTA 5CZIA 4RWLA 3TM0A 4UXQA 3VVHA 4TRLA 5IQEA 3DTCA 1V0BA 4X2JA 2QD9A 5EYDA 4XYFA 3U4UA 2G2HA 2O0UA 2YA9A 2JKOA 4EK5A 5IQAA 4GJ2A 3GXLA 2W99B 3D9VA 4AZEA 3F5UA 5HVYA 3ERKA 4GVJA 5LVOA 3FDNA 4FG9A 4AN3A 3RM6A 3Q9XA 3FZRA 2F7EE 2F7ZE 4EYJA 2X39A 4JX7A 3G6GA 3F7ZA 4JVGA 3W2PA 5EM8A 3GC9A 2J0KA 4MQ1A 3FMJA 4YC3A 5LWNA 2RGPA 5TO8A 4YC6A 5EKOA 1AD5A 2ONLA 4RVMA 3TKUA 5CXHA 1WVYA 4GFGA 1MP8A 4AP7A 2W1DA 4BGHA 3KMUA 3NUAA 2AC5A 1MQ4A 3BWFA 3ODZX 1YDRE 4FT7A 4O0UA 1OKYA 4RZWA 2JDVA 4NW5A 4TYGA 3ZFMA 4Y46A 3A7GA 2RIOA 4BCOA 2VO7A 1ZMUA 1G3NA 5D10A 1R3CA 3IDPA 4PDSA 4XG8A 2UW0A 5EW8A 3HNGA 3QQJA 3TN8A 4PUZA 4RVLA 4BTJA 2HAKA 3KFAA 2YM7A 2BROA 1WMKA 3WF8A 3ATTA 3DFCB 3UMWA 4L6QA 5CAUA 4XP3A 3RBWA 2E9OA 2C6TA 5K3YA 3WILA 2HIWA 4KRDA 3ZRLA 3B8QA 5JT2A 4B99A 3HMMA 3NAXA 2C5VA 2ERZE 4LQMA 4R3RA 3CEKA 3G5DA 2X6EA 3IS5A 4ASZA 5CQWA 2BZHB 2VAGA 4YZCA 5AR7A 1PRYA 3SXSA 3PA4A 4AACA 3GCSA 3GB2A 3NX8A 2SRCA 2QOHA 4AU8A 5I9VA 3NR9A 4L46A 4ZEGA 4FA2A 3BBWA 4KINA 1WBPA 2C3KA 4P2KA 3W16A 1DI8A 3O17A 5M57A 4IWDA 1WBWA 2IZUA 4I3ZA 1OGUA 3QD4A 2HXLA 3LCDA 1RE8A 4N6YA 2PZRA 4IIRA 3LFAA 3HAMA 2YABA 2V7OA 3MWUA 5DNRA 5TKDA 3WYYA 3TUDA 3G9NA 3S00A 3MS9A 3EYGA 4U3YA 4C36A 2BRHA 2YIQA 3MPAA 3W0OA 3TDVA 3FWQA 2B52A 3ZZEA 3ENHA 4FKVA 4AOIA 2WQMA 2WNTA 4MK0A 1OBDA 3OXIA 2XRUA 2YLEA 4ERKA 3QCXA 1YHVA 2YDIA 5ETCA 4N70A 3VBXA 3Q9WA 3RAIA 2XKEA 3ACKA 4MXAA 4BBFA 5DLSA 3LLTA 3EYHA 4JT3A 4E6AA 3R9RA 3DK7A 5HESA 4FTIA 4RJ8A 1YW2A 2CMWA 3V6RA 2QO9A 1SMHA 2ITWA 3LFSA 1GZ8A 4GKIA 4QNAA 4ACCA 1OPJA 1U54A 4U43A 2OH4A 4W9XA 5JFWA 2IW6A 2XNEA 3TJDA 3V8SA 4Y95A 3VW8A 5FM2A 2O3PA 4KSPA 3P4KA 3PIYA 5HE0A 2XM9A 1NXKA 4F09A 3VJOA 4IB1A 1VLRA 3TNWA 3DXPA 2YN8A 4JIAA 4XCUA 5J5SA 3SOAA 5FBNC 4I4EA 3DTWA 5A3XA 3PXZA 4JL9A 4QP2A 3R83A 3PPZA 4KNBA 4E6CA 5IQFA 3LQ5A 3N4UA 4NZWB 5FXQA 3IQ7A 4DEHA 1UU7A 3AC8A 4NM7A 4Z16A 1B39A 3Q6UA 3W2CA 4O86A 3MPMA 5HO7A 3UOKA 5K4IA 1JSVA 3OW3A 1VR2A 3LXNA 5AIRA 3PYYA 3SXFA 3QKLA 5ETIA 2BTSA 3AC5A 4ACMA 1NW1A 3IK3A 4D2RA 3QQGA 1FVTA 1U46A 4F7SA 3DDQA 3FLWA 2GHGA 3HZTA 4DFLA 4ZZNA 1ZY5A 3KXHA 4UY9A 5DWRA 5LJJA 1LEZA 4XG2A 2GNGA 3WF6A 3ITZA 3COMA 4R6VA 3EIDA 5CU2A 1GY3A 3BWJA 3QRKA 3A2CA 4GFMA 4RGJA 5DRDA 4AAAA 4AZWA 2P4IA 4KRCA 4YBJA 5CANA 5L6WL 4C38A 4YJTA 3I79A 4R77A 3OOGA 2BFYA 3IDBA 4HNFA 2BIYA 4OTGA 5E7RA 4BWXA 4A4LA 4USDA 1OPKA 2OK1A 1FPUA 1Q4LA 4QTAA 5BVKA 4I0TA 3K5UA 3NNXA 4FEVA 1PW2A 2HZ4A 3U87A 2PMOX 4MHAA 5LMBA 3C4WA 4AZFA 1URWA 2VZ6A 3C5IA 2R3KA 4FG8A 2WMBA 4EZ5A 4A4OA 2WD1A 4QP9A 2QOFA 4CKJA 2Z2WA 2IZSA 3NIZA 4FNZA 4O4DA 1ZYCA 3FZOA 2CGUA 4J95A 1LPUA 5D7VA 4F9YA 4JQ8A 4RVKA 4E7WA 2C0IA 2W1IA 4AA0A 3HEGA 5T6KA 3ZBFA 4F64A 3PSCA 5FGKA 2QG7A 2OIQA 4A07A 4F6UA 4ASDA 2UZBA 4KIOA 4TWPA 1U59A 3MI9A 4YP8A 3LQ3A 1Q8ZA 5F4NA 5CAPA 4UMRA 3TDWA 4G16A 4QOXA 2R7IA 4RLKA 4DGGA 3U6HA 4YPDA 5DHJA 4I5CA 3QUDA 5HG9A 4WNOA 2PULA 3EKKA 5ANDA 4FT0A 4DG3E 3R6XA 1YDTE 4BDAA 3ZSIA 2UW6A 1WBSA 2YM5A 5IUGA 5JFVA 2YCFA 5JRQA 3SG9A 2VX1A 2WEIA 5KZIA 2YITA 3R21A 4QYFA 4L3JA 2HWOA 4RWKA 5GZ9A 1AQ1A 3AC2A 3EFLA 3F3ZA 3QYZA 3ZO4A 5M09A 4R8QA 3RCDA 3Q04A 4NKSA 4DG0E 5AV4A 4X6QC 1BL7A 5A4TA