3G33A

Crystal structure of cdk4/cyclin d3
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
291
structure length
291
Chain Sequence
RYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 4
publication title The structure of CDK4/cyclin D3 has implications for models of CDK activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 62
structure length 291
sequence length 291
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3g33A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3g33A01
3W1FA 1W84A 3EFWA 4O6EA 1OIUA 4M8TA 3DPKA 3ZYAA 4L01A 3JY0A 4RVTA 4MXYA 4J8NA 4GFMA 3ULIA 1GNGA 3UQGA 4E20A 4E5AX 3TL8A 5LVNA 4UALA 4O91A 5H3QA 1OVEA 4B9DA 1Q97A 3W2OA 4KBAA 2HZIA 3QD0A 1ZYCA 4HGTA 2RG5A 4D2TA 2R3GA 5EM7A 4GU6A 3OTUA 5K3YA 4A9UA 2QVSE 4KSPA 4EWQA 1OMWA 4ZMFA 4MNFA 3E93A 4E3CA 4BTFA 5EM6A 3F7WA 1PXLA 3U4UA 4DC2A 5FUTA 4ZY5A 3LFNA 1KE8A 4IAYA 5IQAA 3BYUA 4JR7A 3IECA 3QQHA 3ZSGA 2UVZA 4F0FA 5KKRB 4DF3A 4CFXA 5FEEA 1Q41A 3KQ7A 5DG5A 1OIQA 1QMZA 2C0IA 2C6EA 3NAYA 4FKQA 2I0HA 3UP2A 4EH9A 2BTSA 5JK3A 4QMQA 2R0UA 4O6LA 2VGPA 2QD9A 3LOKA 4WA9A 3A4OX 2ZV9A 2YCQA 3NW5A 4M15A 1GZKA 4E5WA 4BGQA 4W9XA 3SQQA 1Z5MA 2X8EA 5DBXA 5EHOA 1BI8A 4PX6A 4E73A 1ZY5A 3TNQB 4WG3A 5IF1A 3QD2B 4FKTA 1NVQA 4IDTA 4QMTA 3ET7A 4RLLA 4ZJIA 1Y6BA 3TT0A 2VWUA 4E6QA 4XMOA 3A4PA 1CDKA 3AQVA 3KCKA 3RM7A 4A4LA 2RFNA 3DU8A 3RVGA 2B0QA 4RIXB 3UDBA 3HRBA 4FK6A 5L8JA 2FGIA 3KKVA 3MVJA 2GQSA 2WMRA 4ITJA 4P7EA 3C0HA 4GIHA 2C6LA 2A4LA 5AR8A 4XH6A 4BI0A 4O0VA 4D0WA 2C69A 2EXCX 2IJMA 3FUPA 5GIPE 3R7IA 4MXCA 4P5QA 4QQJA 3LMIA 4CMTA 4Y5HA 5K0KA 2YHVA 5CQUA 1Q8ZA 5FTOA 4I94A 2BAQA 3VUDA 2NNWB 4EK8A 5DT3A 3UMWA 3K5UA 4AE9A 1MQ4A 4JX3A 5K4IA 5CAUA 1O6LA 3R9RA 4E26A 3D9VA 4WG4A 1DAWA 3O23A 3ZLSA 4IX6A 1OIYA 2QOCA 4RZWA 3GCSA 1UVRA 2AC5A 4WRGA 3VVHA 4GL9A 5AP4A 4W9WA 3FPQA 4YU2A 2PMNX 5H9BA 4J71A 4U44A 3QF9A 2JDOA 3QD3A 2PVKA 5CF5A 3CJFA 3WARA 2O8YA 3EKNA 1BX6A 5EKOA 3DAJA 4M67A 4FKGA 3P08A 3ZO3A 4FKSA 4ZY4A 4QT1A 3C4WA 5HICA 2QOOA 4QYYA 2Q0BA 3U6HA 2W17A 3GNIB 3V5JA 4QTEA 4IB1A 3WF9A 2VWWA 5H2UA 2H34A 4F7NA 3HYHA 3CD3A 5AAGA 4CYIA 3C4FA 2W1FA 4FIHA 3V51A 1NT2A 3AT2A 4YZCA 3PJCA 5IQDA 3HV4A 3BYMA 5J9YA 3ZM4A 5FM2A 4BCOA 5IUIA 1WBPA 3MVMA 5DHJA 1ZZ2A 4ASEA 4O22A 1H01A 3I1AA 5F4NA 5KHWA 3HV3A 2XKCA 2GHGA 2O63A 3R8ZA 5DR2A 3IW4A 4JR3A 1PXKA 2H8HA 1PRYA 4OT5A 4XG7A 4U41A 4H36A 4FT0A 1R78A 3HUBA 4MKCA 5E1EA 5EW3A 4I23A 3KRRA 4LMUA 4ANSA 1PMUA 1V0PA 1P4FA 3G6HA 4GEOA 3EZVA 5BYLA 2GS6A 2RG6A 2R3RA 1AGWA 1DAYA 2EB2A 3IW8A 5CX9A 4QTCA 2OZAB 3BKBA 2FYSA 2PVFA 5E1SA 5AP7A 3UO6A 3FI8A 5EYKA 4XLVA 3PG1A 5KMMA 2IVVA 4GVAA 2C6TA 1Q4LA 5K0XA 4UEUA 5IEYA 2QOFA 3GCVA 1JVPP 3RAKA 5KCVA 3SKCA 4B8LA 5CLPA 2JAMA 2PUPA 3TTJA 4MX9A 3WF6A 4CMOA 5K5XA 3HA6A 4AACA 4FSRA 3R9OA 4EQCA 3HRFA 1ERKA 4EH5A 4JIKA 5G6VA 4S30A 4ZZMA 3RZBA 4ID7A 3DA6A 1YWNA 4XBUA 4EZ5A 2ONLA 4C38A 1GZ8A 2BZIB 4ZJVA 2UVXA 1GJOA 5A4QA 2XMYA 3HDNA 4YHTA 2V22A 2ETMA 1SM2A 2GQGA 3QU0A 3RALA 3ZLWA 1OB3A 4YNEA 3H3CA 4M0YA 4AT5A 4F1MA 2OJFE 5HG5A 5E8VA 1JKKA 4FTQA 5JKGA 4ERKA 1M7QA 4HYUA 4F64A 3L1SA 3WF7A 3SOAA 3PJ2A 4D4RA 3ZBFA 3CJGA 3D0EA 2WQNA 3Q6WA 2B55A 3D2IA 5EM5A 3LQ3A 2CSNA 4EKLA 3I5NA 1CSNA 1U46A 2XNGA 1S9JA 3PXRA 1FQ1B 2B9FA 4BBMA 3RPVA 2I0VA 2W4JA 3FQHA 2X6DA 4CEGA 4TN6A 2B53A 2OICA 2F2UA 3RCDA 3ZH8A 2PZRA 4R7IA 4IJPA 3A8WA 4XYFA 4DT8A 4L6QA 2BVAA 2R3IA 3BI6A 3ZDIA 2JKMA 4QTAA 2P0CA 3F5UA 3FZ1A 5DA3A 4BC6A 2WB8A 3QA0A 3VRYA 4BKZA 1KOAA 1PKGA 4KSQA 5GZ8A 3PVUA 1STCE 2JKOA 2UZLA 1GAGA 3DQWA 4IX3A 4RVKA 4C2WA 3BEAA 3GU6A 1JBPE 4U42A 2OI4X 4JQ8A 5T68A 5H8EA 4EH7A 4X2KA 1PYXA 4K0YA 2R64A 2RFEA 4FSYA 4RBLA 4GW8A 4L00A 2Z60A 3O17A 2QI8A 3FMLA 3RJCA 2QU6A 4FTMA 4J52A 3ZZEA 5HBHA 4K8AA 5AA9A 4GKHA 3U55A 1JWHA 2YIYA 1Q61A 1YOLA 1Q5KA 2EVAA 3F9NA 3PZEA 4IJ9A 4RIXA 4AOJA 1B38A 4HYSA 3EQIA 3G9NA 1NY3A 5M4CA 3CP9A 3EN4A 5HI2A 1P4OA 2XNOA 3R8VA 4EH6A 4KKHA 3R6XA 3VW6A 2J5EA 4E6AA 2XK4A 3HV5A 3TM0A 2VO0A 4KNBA 5HO8A 2H9VA 4RIWB 5KMNA 2XM8A 3PVBA 2QU5A 4MCVA 4Y85A 3AD6A 3VQHA 4EL9A 5IZFA 2WIPA 4QMZA 3UZPA 3EMGA 5EG3A 3MFUA 3RPOA 2YM4A 2C5OA 3D5VA 3UOHA 4D9TA 3ODZX 4BWPA 1LUFA 3BHTA 3HMNA 2PWLA 4EH4A 3NEWA 3DKFA 4IWQA 1YWVA 2RFDA 5IH5A 3DAEA 5KMKA 4JVGA 4O86A 4JBOA 3AGMA 3KN5A 3F7ZA 2UVYA 4L53A 3A8XA 2VU3A 3HMIA 3ZDUA 3N9XA 3ZBXA 5AA8A 4LYNA 2HWOA 4IW0A 4EC8A 4F63A 2GU8A 3ORXA 4XV3A 4RJ5A 4XG6A 4ZMEA 2IW6A 3L9NA 3L8SA 3QUEA 4BCNA 4FSTA 5JN2A 5KNJA 4KBKA 1LR4A 3P7CA 3T9IA 2YCSA 4Q9SA 3RWQA 3SXFA 2VO3A 2FSTX 4F0IA 2QR8A 4Q9ZA 2H6DA 3E88A 4X0MA 4EOIA 1PMEA 3TV4A 3Q4TA 4ANOA 2JIUA 2BMCA 3F3WA 3S0OA 3ORMA 5A6NA 3IDCA 1H26A 1E9HA 1ZRZA 4HVHA 5CYIA 4YO4A 3DY7A 3W10A 2Z7LA 3VBTA 2WTKC 1Q99A 5GNKA 3IOKA 2UW0A 3PJ1A 4G5PA 4F6WA 3A2CA 4LGHA 2WTVA 1J3HA 5HU3A 4M3QA 4IHPA 1W98A 4D1SA 3BU3A 4AF3A 2QO7A 4TYEA 5A54A 5IH4A 3WF5A 3CEKA 3NVMB 4KWPA 5GHVA 4O83A 1H1PA 2CN8A 4HPUE 5AV0A 3DB8A 2PVHA 4TTHB 2R3HA 3CCNA 3UO5A 2XEZA 3HRCA 2C6KA 4UMTA 3KRWA 1J1CA 3PPZA 5C8NA 4AZFA 3FMDA 1QL6A 1XWSA 2BDWA 3BGPA 5LCKA 3VO3A 3I60A 4L3PA 4AQCA 4DTBA 2GNJA 4JQEA 4O7RA 5LCJA 2P55A 3D94A 4NCTA 2OXDA 3V5WA 5CANA 2F4JA 4J8MA 3E8NA 4V04A 2BDFA 4R5YA 5AP1A 1OL6A 3E8CA 4HNIA 4CG9A 3A7IA 1H00A 1YRPA 2HCKA 1OPJA 2HK5A 3O7LB 5CAPA 4F9YA 5CXHA 3HKOA 4C62A 5KMIA 4FSMA 4Z3VA 5HD4A 4PDYA 4QMWA 4AS0A 3N4VA 3EFJA 5TF9A 3CLYA 3NNUA 2ZV8A 4R3CA 4HVSA 2F9GA 4QYHA 5AV4A 4FEVA 4PUZA 4BGHA 2WMUA 4KS8A 3Q60A 1W82A 1MP8A 5HBEA 3HMMA 2VTPA 2PMOX 3IDPA 4AGCA 3GFEA 2QLUA 4A06A 5HORA 3OW3A 3O96A 4EBWA 5C1QB 4J98A 3V8WA 5J8IA 2OZOA 2BHEA 1PMNA 2UZNA 3DBFA 5FBNC 1JSUA 4DGLC 1I44A 2XP2A 3KN6A 4BVUA 2CNVA 3LQ8A 1UU9A 3PXZA 4JDHA 4O0UA 4PMTA 1V0OA 2BKZA 2O64A 4KKEA 4O96A 1OUKA 4OTDA 4ZTHA 5JSMA 4EC9A 3PP1A 1YXTA 4B8MA 4KAOA 3MA3A 3TUDA 1P2AA 2JFLA 1YDTE 2BR1A 2BZKB 4XHKB 4MXAA 5EI8A 3LAUA 3ZRMA 4PP7A 2C30A 3ACJA 1XBAA 4EYJA 5KZ0A 4TZRA 4BI2A 3IS5A 2X7OA 3PZHA 3OCSA 3V04A 5FXRA 4ZS0A 4MNEB 4KD1A 3ANQA 4CLJA 1YHWA 3P0MA 3M1SA 4ZLYA 4GU9A 4XX9A 2PTKA 3CR0A 4EHGA 4R7HA 4RG0A 4A7CA 2CKOA 4UZHA 2J2IB 4KRDA 3R7EA 4X7QA 4FT9A 3KXXA 3WI6A 3ZXTA 2J90A 2XIZA 3C5IA 2V7OA 3UZTA 5AFVA 3QQLA 4WUNA 2OBJA 4AZWA 3EN5A 3G2FA 4L45A 4X21A 4I3ZA 1F5QA 2I7QA 2OO8X 3R63A 3KL8A 1TKIA 1G8SA 5M09A 5JGBA 4O7WA 1JLUE 3QC9A 5AWMA 3QRIA 4V01A 3DK3A 4YJRA 3ZTXA 3DJ7A 5IUHA 4GYIA 4H1JA 3QUPA 4FNZA 2JAVA 2G1TA 2ZOQA 3TNHA 4CT1A 5C9CA 5JFSA 4R78A 3MB7A 3MSSA 3VAPA 3RHKA 3U54A 1CKIA 2ERZE 2PE1A 3NNXA 4C4HA 4CFUA 3TZMA 1ZLTA 4RWLA 4BDHA 2HY81 2YM7A 3QLGA 2Z8CA 2EWAA 3TNPC 3V6RA 4BY9E 4RJ8A 3K54A 3KXNA 3FZOA 1YKRA 3KA0A 3PUPA 3KY2A 2YLEA 4KIPA 5IDNA 4I6QA 2VTSA 2OF2A 3RKBA 1WBOA 4FYOA 1OPKA 2R0IA 3FMEA 4NUSA 3T3VA 1CKPA 4KIKB 3LLTA 4QP2A 5B2KA 3CBLA 5T3QA 2YDJA 4P5ZA 1ZYDA 3NUUA 2OWBA 4E7WA 4D5HA 3R8LA 4I22A 1G8AA 4U80A 3DT1A 3G6GA 3ZS5A 3H9RA 2ZAZA 4AA0A 3E3PA 2OIBA 4EORA 3BE9A 3MTFA 1ZMUA 2XK9A 5CU4A 4FNWA 1H1RA 1OITA 5J7BA 4YC3A 2SRCA 1ZWSA 2YDIA 3D83A 3EQGA 4ONAA 4BDGA 3TDVA 3DZOA 4PL3A 5BQ0A 5KMJA 1VYWA 4DGMA 3AG9A 3TV7A 2HZNA 5HLWA 5FRIA 4D1ZA 4F70A 5EW8A 4IWOA 4JNWA 4QMOA 4LUDA 2OFUA 3BLRA 4IBMA 4LV5A 4DA5A 3GCUA 4D55A 3C4ZA 3VUKA 4APPA 4L46A 2CNQA 1IEPA 2BRNA 4G3CA 2EB3A 2YN8A 3OTVA 4OBQA 1YI3A 3BQCA 4MK0A 4LGGA 4XJ0A 3W2SA 3VUMA 4OBPA 3C51A 4EZ7A 5BX0A 3QCXA 1VYZA 3HZTA 2Y4IB 3QCYA 4MBIA 4MF0A 3COHA 3ZFMA 3LFCA 5DFPA 3BHUA 2W96B 5DRDA 5AAFA 5EK7A 2W1GA 1P5EA 5BUEA 4OT6A 4BCHA 2R3NA 5F20A 4MAOA 3ZM9A 5K9IA 3A7JA 2F2CB 5I9VA 4XG8A 4UMQA 4GCJA 1VR2A 1E1XA 4EOSA 3PIXA 3U6JA 4J96A 5HNIX 5B0XA 4L3JA 4Y83A 2WELA 4HNFA 5DN3A 5L2TA 3EQFA 3QUDA 4X2GA 4ZSJA 5DNRA 2R3KA 2J0IA 1ZXEA 4AUAA 1ZOGA 5A4LA 1S9IA 3HMPA 2XK7A 2QO9A 3EB0A 3QTQA 4I6FA 4FZ7A 4M68A 3PXQA 4FT7A 5LJJA 5IU2A 2HAKA 2YERA 3E62A 2I1MA 3MFSA 2HZ0A 2QC6A 4YHFA 5HHWA 5JZNA 3EFLA 5AR4A 4IVAA 5L8KA 2GTNA 3NGAA 4OAUC 1OBDA 4HGSA 4DAWA 3L8XA 4EK4A 1KV2A 1LPUA 2FSMX 4O2PA 5E8WA 4BKJA 4BRXA 3H9OA 1UNGA 4QTDA 4USEA 4ORKA 2CGUA 3QC4A 4YSMA 3GGFA 4O84A 3TDWA 3PP0A 4FTIA 2QHNA 5E8TA 4PTCA 4WT6A 3U6IA 4NM5A 4YHJA 5DVRA 3IOPA 4YSJA 2WXVA 2ESMA 4JAJA 4YGAA 2XNBA 3Q3BA 3THBA 3OXTA 2VWVA 3N51A 5I9ZA 3KRJA 3QXPA 3QRKA 2C68A 1F0QA 3S2PA 3SD0A 4JDIA 4CRSA 4W4VA 5AR2A 3VS0A 3NYVA 3EYGA 2WU7A 3D7ZA 1YQJA 3SC1A 3UQCA 4QP8A 4G3EA 4GG5A 4TW9A 3SDJA 4RFMA 4EJNA 4YJPA 2XNMA 1SYKA 3NYXA 4TL0A 5FP5A 4U8ZA 2GHMA 4RGJA 2UUEA 3H4JA 3G90X 3OCTA 4E5BA 4USFA 3R8PA 2QONA 3F66A 4E4XA 4WD5A 3JVRA 3LXNA 4UXLA 1SVHA 4Z16A 5HTIA 4QMPA 1NW1A 3HAMA 4JBVA 3KRLA 5A4TA 2XKEA 4ANLA 1PXMA 4MD9E 3FE3A 5EYDA 3V3VA 2XS0A 2PZIA 4BHNA 4QD6A 4EONA 3EOCA 3OWJA 4IAIA 4CFNA 2DWBA 2IVTA 3T3UA 4F6UA 5AUUA 4EI4A 4O7NA 3HA8A 1JPAA 1ZYSA 3KFAA 5BPYA 2O2UA 4YLJA 3Q2JA 4ZTSA 3WZDA 3NCGA 5AMNA 3MFRA 5JEBA 2YA9A 4RQVA 4O0RA 3MYGA 2VWYA 2A2AA 3VUTA 4IIRA 4UMPA 5FDXA 2OJJA 4FTUA 1Y8GA 3PWYA 4FE2A 3BHYA 1DI9A 4CTBA 2NP8A 2HIWA 1BYGA 5AR3A 1M2RA 3CE3A 4PPCA 4YZDA 4ZSEA 4DN5A 3BEGA 5IQCA 4G9CA 2F7XE 3ZC6A 3NWWA 2IVSA 4AOIA 1Q8WA 1MUOA 3AC4A 5TO8A 1H27A 1XKKA 1UWHA 2VZ6A 4AZSA 1H1SA 5C8KA 4QMMA 3JYAA 3TV6A 1IASA 2QHMA 3FBVA 4QOXA 2GNIA 5LOHA 4E1ZA 4C37A 1SVEA 3QZFA 4H1MA 1Y57A 1XH9A 2UW5A 3C7QA 2G2FA 3L9LA 1OL2A 3CGFA 2R3OA 3JS2A 3LFQA 5JMSA 4FVRA 4NM3A 3RPRA 3CIKA 4FKLA 4MXZA 2JKKA 3R71A 3BGQA 5AX3A 4YURA 2C6IA 3KF7A 4U3ZA 2X2LA 3SW7A 3FI2A 4KIKA 2VTMA 4ZTRA 3COIA 5KZIA 1KE7A 3NLBA 3M2WA 3R7VA 4E8AA 3FL5A 1OL7A 2BPMA 5AV3A 2QOKA 2ZVAA 2QLQA 3LW0A 4NH1A 5AIKA 5HNBA 2WGJA 3POZA 4JDKA 4ZOGA 4YC8A 2QOLA 3DV3A 2VN9A 4LL5A 5EI2A 3KK8A 5FGKA 4WNPA 4DTKA 2JFMA 4DEGA 4IFGA 4BDBA 4XG3A 4YJNA 3EFKA 2AC3A 1UV5A 3UNJA 3KXMA 4N6ZA 4Z55A 2ITVA 2XYUA 5LMBA 5CU3A 5J9LA 4JBPA 4NW5A 3O8TA 4GKIA 1QPJA 2GPHA 2QOHA 3IK3A 4IQ6A 4YJSA 5HIBA 4FT3A 2V55A 2VTIA 4FIEA 5HO6A 3TTIA 2OJ9A 4XG4A 2YJSA 5CEPA 3MH0A 5HG8A 2CGVA 3LIJA 4IANA 5D41A 5BYZA 3SAYA 2PUUA 4WBBB 2VTQA 5HQ0A 2C1BA 2XBAA 3HP5A 4AN3A 1OI9A 1U5RA 2XNEA 3Q5IA 5I9WA 2PVMA 4LFIA 4MF1A 4YTIA 5CENA 4AW0A 3QQFA 4U81A 1ND4A 4BCQA 2VNYA 3PXFA 1VEBA 2A27A 4F7SA 2WKMA 5CSPA 4PTEA 4WNKA 2FA2A 3UIBA 3I81A 3OCBA 3E3BX 1H28A 2CHLA 3FLYA 2J5FA 2JBOA 3FZSA 3OEFX 2W06A 2X81A 2Z7RA 4YO6A 5CU2A 5AM6A 5AP2A 4ACCA 4C4FA 4CFWA 4FV8A 4ALVA 4ZSAA 3DK7A 3DLZA 1YHVA 4FIGA 5EYMA 5JQ8A 2C0TA 3G15A 5EM8A 5AUWA 3NYOA 3RK5A 3UIMA 5A14A 1YHSA 3ZUVA 1WBVA 2XEYA 4D2WA 1OUYA 3W2RA 4RX9A 5C26A 2GDOA 5CU0A 4NYEA 5FBOA 3FY2A 5ANJA 3ERKA 2JLDA 2VTTA 4F7LA 5I9UA 3KF4A 4FKUA 4YPSA 4FZDB 2PZ5A 5CAQA 2PL0A 2ZV7A 3O51A 3PVGA 2PMIA 2QOBA 3ZRLA 5GZAA 2OH4A 3FJQE 2GQRA 4GJ3A 3F5PA 3PE1A 4I5CA 2PK9A 2WTJA 4BDIA 2A19B 2C0OA 2GNFA 1H07A 2Y9QA 3DBEA 3UVPA 4EK6A 5K5NA 5ETCA 2BTRA 3QCSA 4PMMA 3F61A 4DG0E 3ORIA 4RWIA 3RK7A 4FBXA 5IMEA 4OTPA 4XV9A 3BQRA 3E7VA 3VS1A 3E63A 2X6EA 1FPUA 5I3RA 1YDSE 3QHRA 1MRYA 3UOKA 3W55A 4OTRA 5HIEA 1HCKA 2JEDA 4L7FA 4EZ3A 3A7FA 5FEDA 3D5XA 3VIDA 2YITA 3Q6UA 3EN6A 5D10A 5HEZA 4U79A 4O81A 4NK9A 3MN3A 3FKLA 4K11A 3R9NA 3VBYA 4LRMA 4NFNA 3NUXA 2XK3A 4DEBA 4GVJA 3B8QA 4ACDA 3A7GA 3Q04A 4IMYA 3EN9A 4ASZA 3PY3A 5IEVA 1IAJA 2DYLA 1CM8A 2VX3A 2WZJA 3R73A 4LOPA 3KB7A 3VS4A 3DAKA 4D1XA 5KBRA 4FKRA 5JQ5A 2X39A 2IZTA 3BU6A 3ANRA 4R77A 2JDSA 1VZOA 2YFXA 2OU7A 1H0VA 2AYPA 2NO3A 3OWKA 4RC4A 2C4GA 2FUMA 1UU7A 3EQCA 3LFBA 3ZO1A 4BCKA 4BR3A 4CG8A 3R1NA 1QPDA 4J97A 2VTLA 5I9YA 5LMAA 2CGWA 3DDPA 4BDKA 5M08A 2GNHA 4CV9A 4I93A 3PFQA 3WE4A 3UJGA 3HDMA 4NFMA 3UPXA 5DE2A 1T45A 1CMKE 2WEVA 3LCKA 4MQ1A 2RSVA 4OW8A 1URCA 3LXPA 3P86A 4UY9A 4PTGA 2OG8A 3PSCA 4PV0A 4XS2A 4GK2A 3FLQA 4XRLA 1IA9A 4FL3A 2XK8A 4BDFA 1OKWA 5FXQA 2J51A 4JRVA 4FA2A 4AG8A 2WMXA 3ZRKA 3PVWA 3AT4A 3O71A 4I5PA 1WAKA 3F5XA 2WMAA 2VWZA 4CZTA 3I6WA 2QR7A 4KBCA 3FEGA 1M2PA 1QPCA 3OW4A 3OROA 4ZLOA 1YXVA 2PVJA 3GT8A 4TT7A 3VN9A 4TRLA 4QO9A 4EJ7A 3UTOA 3D2KA 3QTRA 4CVAA 2GS2A 5EOLA 5L4QA 5GINE 3ROYA 2CMWA 3DDQA 4IVBA 3ZHPC 2HZ4A 3UG1A 4H58A 5B7VA 2XJ2A 2UW3A 3GI3A 4KKGA 2XIKA 4RRVA 4RJ6A 4S32A 3WZJA 5E8ZA 4LOQA 4P90A 5C4LA 4FVPA 4F7JA 2VAGA 3QGWA 3MPMA 2P2HA 1NVSA 4EH8A 4AU8A 2RGPA 3FKNA 1E1VA 3IW6A 4A4XA 2BRGA 3RTPA 2HY0A 2F7ZE 3LFSA 2V5QA 2ZM1A 4G3DA 4WRSA 3P7AA 3P23A 5HVYA 3E92A 2XA4A 5AR5A 2QOQA 1XJDA 2HXQA 4GRBA 2BIYA 4DLIA 3QHWA 4AWIA 5CI6A 5E9EA 3PRFA 3K3IA 4ZTMA 2UZWE 2P3GX 3FI3A 4G1WA 3RK9A 4O7LA 3NW6A 5AUXA 3FLNC 4ZZOA 1ZARA 3BYSA 1KE5A 2B1PA 1ZMVA 2J0MB 3BGZA 4GIIA 4MEDA 4WKQA 4FKWA 4I0TA 1GZOA 4J7BA 4G9RA 1ZY4A 4QYGA 1R1WA 4B7TA 3EHAA 1UNHA 4AW2A 4C3FA 4DH8A 4D0XA 2XM9A 3TWJA 2X9EA 4OTIA 5F95A 1PXJA 1OECA 3F6XA 1O6YA 5TT7A 4JBQA 1RW8A 5K4JA 2DUVA 4MQ2A 2JITA 5IISA 3CKWA 4GK4A 3BPRA 4LV8A 2YEXA 2XYNA 3KULA 5GJGA 4GMYA 2Z02A 4FL1A 2YIWA 4UXQA 4AZEA 5EW9A 4D4SA 2WOTA 3W33A 3PY1A 5A4EA 5DMZA 3SX9A 3DXQA 2W05A 4CFFA 5HCXA 3DQXA 2BRMA 3Q4UA 2X7GA 4FTKA 1XH7A 4FV5A 5IA1A 1Q3DA 3IW7A 3MPTA 4YNOA 4RT7A 3T8OA 4IADA 5CEKA 1K3AA 1UA2A 4EQMA 2CLXA 2BFYA 2W5AA 4WO5A 3GQIA 2W4KA 3R22A 1U54B 1H1WA 4AZVA 3KVWA 5FWKK 4DFNA 2VD5A 2IW9A 2GNLA 4C4IA 2ITOA 5HIDA 4EUTA 3AC5A 1AQ1A 4YTHA 3FQSA 4F99A 3TUCA 3O2MA 4JS8A 2UV2A 3PG3A 3NRMA 4MD7E 4IWDA 4LQMA 4IC7A 3U8WA 1Q8UA 4HGLA 1KWPA 5J95A 2QKWB 3AMBA 2PPQA 4W4XA 3V5TA 4GUEA 5M53A 1YDRE 2P2IA 4BCPA 3CXWA 4GFGA 4W8DA 1M2QA 3WYXA 3ORPA 5L6PA 1SMHA 3G0EA 2WQBA 3EL7A 1RE8A 3HLLA 3FLSA 4IB0A 4YZ9A 2YABA 3NMUF 3TN8A 5A3XA 1R0EA 3LJ1A 4UWBA 3NUSA 4WBOA 1KOBA 4IAZA 2Y6MA 3B2WA 4DEEA 1B6CB 5KX8A 2E9PA 4BF2A 4C8BA 3GU4A 3IPHA 1PKDA 2ERKA 4FTOA 3R83A 5D12A 2ETKA 3W8QA 4R8QA 1OL1A 3GBZA 2B9JA 3UP7A 5HO7A 4MXOA 5JH6A 4X3FC 3AC3A 2CKEA 4FEXA 2OJGA 3JY9A 2IZUA 4N57A 4BCGA 2VTNA 3ZUUA 1PW2A 3E64A 3L9PA 3R00A 5AR7A 5JFXA 1QPEA 1WBTA 3MY5A 4HYHA 4L7SA 2G9XA 4I92A 4L67A 5FP6A 2ITZA 5IPJA 2YWPA 3IDBA 3QTXA 4TWPA 4FV4A 5DI1A 1XH5A 5LVPA 2GHLA 4QP6A 3D15A 1J1BA 3MH2A 3QTWA 2R3MA 4G2FA 4RIYB 3TNIA 4EQUA 4LOOA 1IAHA 4UV0A 1K9AA 5C4KA 2R2PA 2REIA 5AUTA 4D2PA 2C6MA 3QXOA 2XNNA 1FVRA 4FNYA 4BIDA 4C57A 3LXKA 3E7OA 4EOJA 2B4SB 3G9LX 4BWXA 3OWLA 3ID6C 4LL0A 3UZRA 5EDQA 3C4XA 5JRQA 2BAJA 5C01A 4L3LA 4RSSA 3CC6A 4RJ7A 4YJQA 5M44A 3RPYA 3QKLA 4L8MA 4O7ZA 5DR9A 4MYGA 2IVUA 3TKUA 4CRLA 3SA0A 4C58A 3DBCA 1U4DA 2I6LA 4YLLA 3D5UA 5HZNA 3FXZA 4S34A 3FSFA 1FGKA 2IG7A 2I40A 3OXIA 5B2LA 3LFDA 3NAXA 3PPJA 1WZYA 2C5NA 3OUKA 4PPBA 5BUIA 2J4ZA 4G16A 4NIFA 4PMPA 5I4NA 5J1WA 1JSTA 2NRUA 4YZMA 2HENA 5KMLA 4QNYA 1SNUA 4C36A 4R1VA 3QX2A 4TYGA 3TUBA 3DBDA 4DT9A 3QLFA 4PQNA 4QPAA 4ERWA 3FMNA 5JGAA 2YIXA 2HW7A 3QX4A 5AUZA 5LVOA 3UYSA 4HCVA 2PVYA 4BZDA 5EKNA 3AC2A 4GUBA 4NU1A 1TVOA 2GCDA 4AT4A 2YM3A 5CSWA 5BUJA 3AC8A 1URWA 4CFVA 5BVOA 5L2WA 5IQBA 2UZEA 4O38A 4RWJA 5J7HA 3VUHA 3VRZA 3VF8A 3R8MA 4DCAA 5IUGA 3QBNA 3LPBA 1JQHA 4FTLA 3IGGA 2YM8A 4GT5A 5ANEA 3TI1A 4R5SA 3BYVA 4FIJA 1H1QA 2W1EA 4PL4A 5E7RA 3I4BA 5HD7A 5I3OA 4RVMA 4RZVA 4DINA 5CSXA 2W1CA 1YVJA 2XCHA 4L42A 4AOTA 4FGRA 2CJMA 3BYOA 4JG8A 4MWHA 3V6SA 3OFMA 4YBKA 3BV3A 3MWUA 3ZSHA 4B4LA 4BI1A 2JDTA 3UOJA 2PVNA 3V5PA 4F65A 2WD1A 4DGGA 4FTCA 3ZO2A 5L2SA 3I79A 5HE0A 4H39A 2ONLC 2IN6A 2BILB 3PRIA 3R28A 3OC1A 1WVYA 3MJ1A 2R9SA 4U6RA 2VWIA 4C4GA 4FV3A 4NT4A 5ETAA 3G5DA 4NJ3A 2V7AA 3NUPA 3EQRA 4IFCA 4E4MA 4BDCA 4YJVA 4HZSA 3TEIA 2JIVA 3ITZA 4I4FA 3MESA 4YJTA 3R9HA 2C3KA 2IW8A 3QRTA 3LCOA 3TACA 4JIAA 3VULA 4RMZA 4DCEA 4XG9A 2I0EA 1YI6A 4ZY6A 5ITAA 3R30A 4IVCA 3RAIA 3NS9A 3HEGA 1XHAA 5HLPA 1U54A 2H96A 5FM3A 4D5KA 3RCJA 2VTHA 2PZYA 1WCCA 3KMUA 3MFTA 4U97A 5L6WL 2C5YA 2FSLX 4G34A 3KMMA 4IM3A 2C1AA 4YBJA 2XJ1A 2X7FA 3UOLA 3VS7A 2XZSA 1OL5A 2RL5A 3DOGA 4KB8A 2C6OA 2XH5A 5KKRC 2IO6A 2ITNA 1LEZA 3TJCA 4BICA 3DK6A 1WVWA 3N4TA 4IAFA 3OBGA 2Y6OA 3OVVA 2NRYA 2WMVA 1PF8A 3L8PA 5JFWA 2WAJA 2ZJWA 1DI8A 5AAEA 1PXPA 2QG5A 4ANBA 2VNWA 4FG7A 5FG8A 4DTAA 2PSQA 3H0YA 3FXXA 2E9VA 4TYHB 4WSQA 5DR6A 5BNJA 4FKOA 3AMAA 3ATSA 4YJOA 4FSZA 1G5SA 2EU9A 2PVRA 5F9EA 4AA5A 4F1OA 4OBOA 3CKXA 4YP8A 4K77A 2UW6A 2YCFA 3GC8A 3WILA 3VUIA 3NUAA 3FZTA 2W5BA 5C03A 3GENA 5CF4A 4QPSA 5H8GA 3OS3A 5DT4A 2WTWA 4XEYA 3HX4A 3VHKA 4HVGA 3OF0A 3MIAA 2LGCA 4NM0A 4CCUA 3MBLA 3DS6A 3OHTA 4PNKA 3KRXA 4O0WA 1XH4A 5M4UA 4D4YA 5HE1A 3ATTA 1YOMA 3EQBA 1A48A 3ULZA 2C3JA 5E4HA 5I5ZA 3PIYA 4DEDA 1JKTA 3MGYA 2CKQA 1JSVA 1MRVA 1PY5A 2VTJA 2VGOA 2JDVA 3P79A 4S33A 3WF8A 2CCHA 1FVTA 3W2CA 4FV9A 4IZAA 3V5LA 4RIYA 4O7VA 3QL8A 3BV2A 5E92A 3LJ2A 5ANKA 3DLSA 2BKKA 4G6OA 5E8UA 3PIZA 1FGIA 4U3YA 5M06A 4Y8DA 2OIDA 3TZ8A 4DGNA 1Z9XA 1ZOEA 4ACGA 4YUQA 5AADA 5IQFA 4V0GB 4G6LA 3ZSIA 4A9YA 4PNIA 4EYMA 4FNXA 3QD4A 5M51A 3QWKA 5KE0A 1RQQA 4G6NA 4UX9A 4UMRA 5A6OA 2CGXA 2R3LA 4FICA 4N4SA 1NXKA 2KTYA 4TKSA 2J7TA 4Y46A 4OTGA 3COMA 3R01A 5B2MA 1J7UA 2W1DA 2WFYA 1CKJA 3VS6A 4RFZA 3ZU7A 2CCIA 3R2BA 2PVLA 5AP6A 2F7EE 2JBPA 4LRKA 2CLQA 5HNGA 1LEWA 4I21A 4D58A 4F0GA 2E2BA 3BZ3A 3FMHA 3MIYA 2WTKB 3GU8A 2DQ7X 3OT3A 4KIOA 4LMNA 3ZLXA 5HVKA 2YIQA 1H8FA 2XVDA 3R0TA 4L44A 2HXLA 4TY1A 5AV1A 1BLXA 4B0GA 1M7NA 4QMNA 2ZDTA 3ORKA 3W32A 4DG2E 2KULA 2BALA 2W99B 4WSYA 1GIJA 5E8YA 5BMMA 3OCGA 3UC4A 3RPSA 3OEZA 3SLSA 4XV2A 4XRJA 5HTCA 4F4PA 5CAOA 3GVUA 4N0SA 3FYKX 3SW4A 4GH2A 2HYYA 3H30A 2IZSA 2LAVA 5EDRA 4F6SA 3KXGA 3QRUA 5C27A 1H0WA 4W4YA 4CGAA 3Q9XA 5D1JA 2J9MA 2VRXA 3DFAA 4JJRA 2WMTA 4W4WA 1BI7A 1JKLA 2ITXA 4BCJA 5BMSA 5LVMA 3FYJX 3FXWA 4HJOA 4C2VA 4UBAA 3PA5A 3PSDA 4EHVA 4U0IA 3FWQA 5CASA 4XUFA 4BZNA 3ORTA 1WBNA 4RLKA 3EQHA 1W8CA 4IXPA 4IX5A 4CZYB 3BHVA 4NWMA 1XO2B 2JGZA 1YWRA 4HYIA 4TXCA 4BIEA 3ELJA 4Y73A 3AC1A 3NIEA 2W9ZB 3LVPA 1CTPE 3KCFA 5FQDC 3M42A 3QTIA 4O0YA 4QQCA 5EDPA 5IA4A 3NCZA 1FMKA 3P1AA 4PDPA 4AW1A 5E8XA 4RFYA 4HVIA 4PL5A 3NX8A 3MB6A 5CZIA 5AP3A 4F1TA 5CU6A 5CY3A 5IMXA 4AXAA 5IH6A 5J5SA 1UKHA 3HUCA 4XP3A 4Z7GA 5CQWA 3D5WA 3CY2A 3NUYA 3OZ6A 3VBQA 5L6OA 2WTDA 4IZYA 4A4OA 3SVVA 1ZZLA 3CGOA 2CKPA 2WHBA 4JOAA 2YLFA 4FZ6A 4DFBA 3LHJA 4FKJA 3LCTA 4IACA 2WQEA 1J7LA 4QMXA 1Q24A 4N70A 1YW2A 4JDJA 4RX5A 3LKMA 3IO7A 2JC6A 1WMKA 2ZMDA 4FX3A 1QCFA 4TNDA 3TCPA 3VC4A 4HGEA 3V5QA 4AZTA 4CQEA 4YZBA 5CAVA 3VJOA 3AXWA 3OY1A 5CS6A 3PWDA 3NSZA 1GIHA 4NM7A 4P4CA 2R5TA 3K5VA 5JRSA 4UN0C 5D7AA 4YTFA 2YDKA 1OPLA 2XUUA 3EYHA 4M97A 5HGIA 5GJFA 4O7SA 5LWNA 4GG7A 2DS1A 3GOKA 4OAVB 4K9YA 2YACA 4HOKA 4IWPA 5M55A 4GT3A 3MY0A 4RC3A 3Q53A 4EWHA 4MXXA 4DBNA 1YXUA 5C8MA 3IW5A 5IA0A 4IZ7A 4HCUA 3BX5A 5IQIA 3CPCA 3KC3A 2A0CX 2QQ7A 4MTAA 4R3PA 1Q62A 3HGKA 4TYHA 2WQMA 4UWYA 5AV2A 4EEVA 5F1ZA 1YOJA 5ETFA 2V62A 5DH3A 2OGVA 5M57A 1U5QA 5L2QA 1OKZA 5HTBA 2RIOA 1BKXA 3VJNA 2ZYBA 3MPAA 3ZFXA 1FOTA 4UMUA 5AEPA 3FHRA 4DFXE 4PDSA 3VUGA 2F57A 3UVRA 2YAKA 4FYNA 4RA5A 4II5A 5AP5A 3F3ZA 4UZDA 3G33A 4WOVA 3VBVA 5TOZA 3JVSA 5CVFA 3OD6X 3CQWA 4CTCA 2WMQA 4FEWA 3WYYA 3LCDA 4MHAA 3BE2A 4JQ7A 1OGUA 5LMKC 4C7TA 3R1QA 3WBLA 3D4QA 4I6HA 3S3IA 2VTRA 2ZM3A 3D7TB 5HG7A 4G17A 4GK3A 2BFXA 3RM6A 3U4WA 2PULA 3BU5A 3KXHA 4PDOA 2UZVA 3LMGA 2WPAA 5KUPA 2ETRA 3P7BA 2UZUE 4YPDA 1IA8A 3R21A 3AD5A 3GC9A 4UYAA 3QQKA 4EH2A 4V0GA 3KULB 4PP9A 2OKRA 5ANIA 4BKYA 2E9UA 3QALE 4NJDA 4BTJA 2OF4A 4CKRA 3RNYA 4JG6A 2FVDA 4AGUA 5CEOA 3DXPA 3D14A 4I41A 4TYJA 4CT2A 2E9NA 1OIRA 3E8DA 4FTAA 3MH1A 4E6CA 4BFMA 3Q9YA 3QTSA 3OXZA 4QP7A 4FSWA 3R9DA 2WU6A 4E93A 5JT2A 4C0TA 1UU8A 1M17A 5CXZA 3BIZA 3LM5A 3OG7A 2XJ0A 4X3FA 3HV7A 2QODA 3UVQA 4GSBA 5CZHA 4YTCA 3LCSA 4IEBA 4QYEA 4NEUA 2ITPA 3KVXA 4PF4A 3MW1A 4G5JA 4A9TA 4AFEA 3PY0A 3OWPA 3ALOA 3SOCA 3FMKA 4AFJA 4OTWA 3TIYA 4EOMA 2X4FA 2J0LA 1SVGA 4FIIA 1ATPE 3GC0A 4EK3A 4J53A 3OP5A 2BDJA 5F94A 4DG3E 4C4JA 4BTMA 4IAKA 4KINA 4ZTQA 2YM5A 3E87A 2J6MA 4I5MA 3QQGA 4ZK5A 5H8BA 2RF9A 3U9CA 4GJ2A 5EQEA 2W1ZA 3GQLA 4M69B 4C35A 4CD0A 2BZJA 2R3QA 4H3PA 1BMKA 5D9HA 3BWJA 4QMSA 4OUCA 1Z57A 4D4VA 3S4QA 3EKKA 3JUHA 5DRBA 3SXSA 3ZO4A 4U43A 3IGOA 4DGOA 5DYJA 2Z2WA 3CS9A 3CQEA 3PJ3A 2P4IA 3VS3A 1HCLA 1BL6A 3C0IA 3E5AA 3ZMMA 2W0JA 4TWOA 1M52A 1MQBA 4EUUA 3UODA 1G3NA 2OLCA 1B39A 1KSWA 4CSVA 5E8SA 3FZPA 2VV9A 4XLIA 3GU7A 2PY3A 4FOBA 5DPVA 5EH0A 3HP2A 3V01A 5CEQA 3H9FA 4ZXTA 2OIQA 4WUAA 4S2ZA 3Q9WA 2VO6A 2XNPA 5CNNA 3R2YA 2WMBA 3DB6A 2X0GA 2ZB1A 3GFWA 4AN2A 2YIRA 4O0SA 4YJUA 4FEQA 3VWAA 4AA4A 4O27B 3DKCA 3ETAA 4MWIA 4Y72A 2IPXA 4IE9A 5EQYA 3ORZA 3RBWA 3SRVA 1NA7A 3POOA 3BLHA 5AM7A 3F82A 4P2KA 4J99A 3L9MA 2GFSA 2ITWA 2Q83A 4DEAA 5M4IA 2PZPA 3DJ5A 3B2TA 5DLSA 2R7IA 2XK6A 4IDVA 3TKHA 2GTMA 3UIXA 4LM5A 5LARA 3R8UA 1W83A 4X3JA 4AW5A 4X2JA 2UW4A 1ZYJA 3FKOA 5CNOA 4C02A 2W1HA 3OMVA 3KMWA 2YAAA 3DFCB 2X8DA 4O21A 4RC2A 2G2HA 5AX9A 3ROCA 2W1IA 4WHZA 2J0KA 4GYGA 4ZP5A 5BVFA 3HVCA 2BAKA 4A9RA 2FB8A 3S95A 3ZC5A 2QCSA 2BIKB 4ZEGA 1SNXA 3LFAA 5DT0A 3ZOSA 4F9CA 4PMSA 5FD2A 2QOIA 3REPA 3NUNA 3OUNB 3W8LA 2VX0A 5L8LA 4YMJA 2V0DA 5BVEA 5CI7A 4QMLA 1FMOE 2HOGA 4KS7A 2VWXA 3ORLA 3CY3A 4ARKA 2OXXA 4DH5A 3PA4A 1JKSA 3Q9ZA 2UW7A 4NSTA 1L8TA 4JI9A 2O5KA 4NIFB 3TZ9A 5TKDA 3LJ0A 4K1BA 4BIBA 2VTAA 5KHXA 2BUJA 2ZDUA 5AIRA 5HVJA 4TNBA 5M56A 2PUIA 3QZHA 2XB7A 3RINA 2GFCA 2PMLX 2VO7A 1XR1A 2CDZA 4FR4A 4XCUA 4KUJA 1U59A 2R4BA 2WTIA 3FDNA 1R3CA 3EQDA 5CSHA 2PHKA 4APCA 5TR6A 3VF9A 3GU5A 2Y7JA 4NKSA 3LQ5A 1J7IA 3GB2A 5JGDA 2JKQA 4FL2A 3VBXA 1EH4A 4IB3A 3DKGA 3NIZA 3MI9A 1PYEA 2B9HA 4FZAB 3NYNA 3ENHA 4FUXA 4O1PA 4ZSGA 1IRKA 4WNOA 1V1KA 4O7YA 3ZEPA 2WIHA 2OSCA 1PXNA 3VHEA 3A7HA 5CVGA 3WZKA 5J5TA 1ZOHA 5IDPA 3VBWA 3TXOA 3II5A 3ZXZA 3TZ7A 1RDQE 3HL7A 3IQ7A 4FUYA 4LG4A 3HECA 4TWCA 3A60A 5G1XA 5IKWA 3ZZWA 4BBEA 4CZUA 3OBJA 5I9XA 1OKVA 3D7TA 4FG9A 4I0RA 2PUNA 3BWFA 4G3FA 3PPKA 4OR5A 4EOKA 4JT3A 2R3FA 5DEYA 3PJ8A 5IQGA 2UZDA 2BCJA 2GSFA 3BCEA 1ZMWA 3KK9A 4XG2A 4G31A 4GV1A 3MVHA 5HKMA 4FEUA 4FODA 3U51A 5FTQA 4OTHA 4OGRA 3W16A 3AD4A 5J1VA 1OKYA 2CPKE 5M4FA 2YM6A 4H3BA 4TWNA 2AUHA 3QCQA 2GNGA 4LUEA 2ITUA 2VX1A 4ZJJA 3WE8A 5J79A 3FMJA 4XBRA 5HOAA 1O9UA 1TQMA 3EN7A 5CWZA 4ASXA 5J9ZA 5BYYA 3DCVA 4NL0A 4ZZNA 3DBQA 3MS9A 2X9FA 4HZRA 3SG8A 2B7AA 3BLQA 2R3PA 3GXLA 3LE6A 3QTUA 4GS6A 4RA4A 2O65A 3VS5A 4DH3A 3P78A 4ENXA 3COKA 3C5UA 1JAMA 3FMMA 3G0FA 5IG1A 4Q5HA 4GFOA 4I0SA 3F88A 5EQPA 5JFVA 4CYJA 3UYTA 3BRBA 4IH8A 2WO6A 1UU3A 4UB7A 4X2FA 4ZIMA 4PWNA 1O6KA 2B54A 3FL4A 3SV0A 3MTLA 3W2PA 5ETIA 2G15A 2XRUA 3ZLYA 1IG1A 1A9UA 4FMQA 4RWKA 5FDPA 3CQUA 3UQFA 3EJ1A 4KIQA 4BCFA 2I0YA 5CEIA 5HBJA 1K2PA 4O0TA 3RHXA 4BWKA 4K6ZA 3U87A 4K2RA 2B9IA 5HESA 4OTQA 2Y4IC 3ZCLA 4ALUA 3KREA 3FZRA 5ACBC 2RKUA 1WVXA 2J50A 4M69A 4U40A 3FAAA 2E9OA 3W2QA 1H24A 1IR3A 3HV6A 5ANGA 4BYJA 4IC8A 4S31A 4ZLZA 4DLJA 1APME 3EIDA 1DS5A 4WIHA 3KU2A 5CF8A 1Y8YA 3LXLA 5EHYA 1Q8TA 3P9JA 2VWBA 1OBGA 1YI4A 1M14A 2QURA 2VTOA 3F3UA 3RGFA 1WBWA 2C5VA 2X8IA 4FG8A 4X2NA 2A1AB 4OLIA 3BBTB 4EBVA 2YISA 4QQTA 5EFQA 4BGGA 3QQUA 5CALA 3DZQA 4XNEA 4EKKA 3QA8A 4KABA 3UNKA 5E90A 3UBDA 1PXOA 1PMVA 3FHIA 3OOGA 5HCZA 5HE3A 4B6LA 3DTWA 3Q32A 4ZTNA 3RI1A 4MVFA 3R1YA 1KE6A 5AJQA 3AGLA 3O8PA 4PPAA 4F08A 4BYIA 4LRJA 2YZAA 5IQHA 4ZAUA 4FGBA 4C3RA 4O2ZA 1Y91A 2OFVA 5J87A 4R6VA 2ACXA 3P5KA 4BDDA 4JG7A 2IZRA 4U9AA 2FH9A 4L9IA 4QMYA 5CT7A 3B8RA 3C13A 2UZOA 3O7LD 3DGKA 4EH3A 1REKA 2G01A 2WTCA 1HOWA 3QZGA 4MH7A 4LI5A 4QP1A 4XOZA 2EUFB 4HW7A 5KO1A 5HLNA 4JLCA 4CNHA 4FTNA 4DEIA 3AOXA 3PLAE 4AP7A 3L8VA 5HE2A 4M12A 3PLSA 3BHHA 4NKAA 4Y95A 4QMUA 3MV5A 3WIGA 5DGZA 5T6KA 4FSQA 4R3RA 5HX6A 3I0OA 3CD8A 1UWJA 4FV7A 3EL8A 5BVNA 2XCKA 4U5JA 2RFSA 1BL7A 2C5XA 2GS7A 3FQEA 2OZAA 4QMVA 4ANNA 3IKAA 3Q4ZA 3V8TA 4X6RA 3S1HA 3I0QA 4I20A 3PSBA 3LMHA 3DKOA 3VQUA 3VS2A 1H4LA 3F2AA 2Q0NA 5A46A 2PE2A 3QKMA 3QWJA 2WEIA 1XBBA 5E91A 3LM0A 5AP0A 5IQEA 5KBQA 1UKIA 3UG2A 2XKDA 4ANQA 1TQPA 2QG7A 3V8SA 2GMXA 2XRWA 4FV6A 4FTTA 4QP3A 1R0PA 4FZFB 3P4KA 5HU9A 5GIOE 1XBCA 3R7UA 4O82A 3C50A 5A9UA 2XF0A 1BUHA 4EOLA 4CMUA 5HX8A 4FK3A 3C4EA 3F5GA 1PHKA 3NW7A 3AT3A 4M13A 3RAWA 5FEQA 3OY3A 1SZMA 2O0UA 3KEXA 2OW3A 4MBJA 5EOBA 3FI4A 3EH9A 3QZIA 4C61A 3SGCA 4FSUA 4QYFA 3GUBA 4AE6A 3F69A 2P33A 5CF6A 1YXXA 3R7GA 5DOSA 3GCPA 1H08A 3A99A 3DJ6A 5HG9A 4DEHA 4ZS4A 4O0XA 1L3RE 2OXYA 1MRUA 3PDTA 2WNTA 3SG9A 5HCYA 4Q5EA 3QRJA 4RQKA 3JXWA 2X2KA 3SXRA 3U9NA 3TJDA 3A62A 2F49A 3VW8A 4NW6A 3RWPA 4U7ZA 2OJIA 3F3VA 5BVKA 1FVVA 3ENMA 1Q3WA 4NZWB 1XQZA 2Y0AA 4WG5A 5GZ9A 4YZNA 3MH3A 3WZEA 2JIIA 3R1SA 3F3TA 4ITIA 3CSVA 4AX8A 4L68A 4BDJA 3EQPA 4XV1A 3KGAA 4AGWA 1P14A 3EZRA 3LFEA 4D9UA 3NPCA 2PE0A 4O1OA 2ZB0A 4TYIA 1ZAOA 2OH0E 4K18A 3LLAA 3IONA 3UC3A 3HNGA 2UW8A 4UWCA 5ANOA 2HW6A 4DITA 4FTRA 1GY3A 2WOUA 3ZEWA 2BRHA 3VNTA 4IM0A 3I6UA 4J1RA 1AD5A 3GP0A 4IAAA 5IA5A 2XIRA 5I0BA 3T9TA 2J0JA 3SHEA 3MVLA 2CNUA 3UO4A 5DEWA 4ENYA 3FY0A 2JD5A 2QKRA 1W0XC 3KXZA 4FF8A 4FKPA 4LGDA 1OZ1A 4KRCA 4XP0A 5DWRA 4D2RA 1J91A 4GT4A 1I09A 4EOQA 5GJDA 1WFCA 4FV1A 5LVLA 2NPQA 5LMKA 4RIWA 4JX7A 3RNIA 3PTGA 1GOLA 1A06A 1XH8A 2BROA 3QYZA 3R7OA 4QQ5A 3GC7A 5EI6A 4FV2A 2ITQA 3PA3A 3Q4CA 3R7YA 3UNZA 3NVKI 3Q5ZA 4FSNA 4X6QC 5L3AA 4C34A 1GZNA 4I6BA 4QNAA 2BZHB 4RX7A 3PE2A 4R7BA 2CN5A 2O3PA 3O0GA 4M14A 5LXMA 3NNWA 5IA2A 5ANDA 4XOYA 4QP4A 3TG1A 4C33A 3UIUA 3I7CA 1NVRA 4I4EA 4AGDA 3JPVA 3OOMA 4YR8A 4ALWA 3F2RA 2HELA 2WQOA 5D7VA 2XKFA 3I5ZA 4F9BA 2Y8OA 2ZMCA 3RMFA 4IVDA 4CKIA 4OTFA 2R7BA 1FINA 5JZJA 5KMOA 4Z9LA 5ICPA 4CFMA 2UZBA 2YJRA 5IA3A 3ACKA 3TKIA 1ZYLA 3BBWA 3QKKA 5CEMA 2QO2A 1F3MC 4I1ZA 4EHZA 1REJA 2ZM4A 3NNVA 3QFVA 4BDEA 2YCRA 2FSOX 3UE4A 4ACMA 4IZ5A 3Q2MA 3NZ0A 3FSKA 2W9FB 2Z7SA 4AT3A 4IB5A 3FLZA 2B52A 4RPVA 2BHHA 3ZONA 4FC0A 3MDYA 4L43A 4M84A 2UW9A 3PXYA 4EHEA 5CVHA 3M11A 3MJ2A 2QNJA 5LWMA 4B99A 3CPBA 4JAIA 4PRJA 4Y5QA 4DHFA 4DFYA 4ZSLA 2FO0A 4AAAA 4BHZA 4E4LA 3Q52A 4RX8A 3C1XA 4E4NA 3LZBA 5CTPA 3WZUA 4N6YA 1PJKA 3Q96A 3R02A 4ITHA 4E6DA 4HCTA 5FLFA 1PXIA 3N4UA 4CXAA 4D2VA 3GCQA 2W5HA 2ITYA 3CTHA 4YLKA 2ITTA 4H05A 3QQJA 4ASDA 4FIFA 5M07A 4CQGA 2X4ZA 4X3FB 3MY1A 3ALNA 3WOWA 5FTGA 2WMSA 4BZOA 4I5HA 4BL1A 2HWPA 3OT8A 4MBLA 5L2IA 3ZUTA 1T46A 1JOWB 4CKJA 4EOOA 3C0GA 3FLWA 2ZV2A 4USDA 3JR1A 2X1NA 3HMOA 5EYCA 3LFFA 3QAME 3FV8A 3K2LA 3G51A 4M7IA 3UPZA 4DH7A 5AUYA 4HVDA 4JXFA 4DFZE 4JRNA 1OM1A 4C3PA 1GIIA 4DE4A 4MD8E 4XP2A 4C4EA 4D28A 4NTSA 2C3LA 4RJ4A 4V05A 4CCBA 1TQIA 3H10A 4O7TA 4J95A 4QP9A 3NDMA 3RAHA 4I24A 4FVQA 1Y6AA 1V0BA 4EK5A 4A9SA 4A07A 3O8UA 2W7XA 4NCTC 3DTCA 4YC6A 2XBJA 2UZTA 3IG7A 4NTTA 1UNLA 2EXEA 5EHLA 4BBFA 4FT5A 4BN1A 4F9AA 5CT0A 2YWVA 4IM2A 3ORNA 1KE9A 1Q8YA 3UGCA 4Z7HA 1R39A 4QTBA 2OK1A 4D2SA 4FV0A 2R3JA 4W8EA 4QRCA 4F9WA 4DYMA 4WNMA 1YXSA 4Q2AA 5LQFA 2JDRA 2Y4PA 2C47A 2XIYA 3S00A 4DH1A 5ACKA 2PU8A 3HAVA 4BDAA 4BB4A 2PYWA 4MNEA 3BELA 4IX4A 1KV1A 4DBXA 2IWIA 3E8EA 3GOPA 4FKVA 4HPTE 4RVLA 2YZLA 3SRVB 2XIXA 4CV8A 4L52A 3ODYX 3WIKA 3DXNA 3ZFYA 3RZFA 2W4OA 2C6DA 4RJ3A 1X8BA 1WBSA 3FC2A 3MA6A 4FI1A 4U45A 3PXKA 3DNEA 3EWHA 3PYYA 3C4CA 2WMWA 3FPMA 1VJYA 1W7HA 2EXMA 2Z7QA 4BCMA 4CLIA 3H0ZA 4K33A 4DFLA 4FTJA 5CSVA 4BTKA 3UMXA 1DM2A 1KUTA 3K3JA 4UYNA 4F09A 2G2IA 1JNKA 4ZTLA 3QGYA 2X2MA 3AMYA 4AN9A 1XH6A 3NR9A 3TIZA 5AUVA 4G3GA 3A61A 5DIAA 4R1YA 3QTZA 5BVDA 4M66A 1LP4A 3C9WA 3CTQA 4FOCA 5D11A 4TPTA 4ACHA 3I7BA 3F2NA 4EOPA 5A4CA 1RJBA 2VUWA 3CTJA 5IEXA 1FBNA 4DFUA 4KA3A 4H3QA 3RP9A 3GEQA 4M0ZA 4ANMA 1H25A 4QPMA 3QYWA 3DNDA 5FXSA 5BVWA 3TNWA 5TE0A 3O50A 2BRBA 4FKIA 4C59A 3R04A 4RIOA 4BCIA 4JL9A 3W18A 2C3IB 4PY1A 3FC1X
chains in the Genus database with same CATH superfamily
3W1FA 1W84A 3EFWA 4O6EA 1OIUA 4M8TA 3DPKA 3ZYAA 4L01A 3JY0A 4RVTA 4MXYA 3BL9A 4J8NA 4GFMA 3ULIA 1GNGA 3UQGA 4E20A 4E5AX 3TL8A 5LVNA 4UALA 4O91A 5H3QA 1OVEA 4B9DA 1Q97A 3W2OA 4KBAA 2HZIA 3QD0A 1ZYCA 4HGTA 2RG5A 4D2TA 2R3GA 5EM7A 4GU6A 3OTUA 5K3YA 4A9UA 2QVSE 4KSPA 4EWQA 1OMWA 4ZMFA 4MNFA 3E93A 4E3CA 4BTFA 5EM6A 3F7WA 1PXLA 3U4UA 4DC2A 5FUTA 4ZY5A 3LFNA 1KE8A 4IAYA 5IQAA 3BYUA 4JR7A 3IECA 3QQHA 3ZSGA 2UVZA 4F0FA 5KKRB 4DF3A 4CFXA 5FEEA 1Q41A 3KQ7A 5DG5A 1OIQA 1QMZA 2C0IA 2C6EA 3NAYA 4FKQA 2I0HA 3UP2A 4EH9A 2BTSA 5JK3A 4QMQA 2R0UA 4O6LA 2VGPA 2QD9A 3LOKA 4WA9A 3A4OX 2ZV9A 2YCQA 3NW5A 4M15A 1GZKA 4E5WA 4BGQA 4W9XA 3SQQA 1Z5MA 2X8EA 5DBXA 5EHOA 1BI8A 4PX6A 4E73A 1ZY5A 3TNQB 4WG3A 5IF1A 3QD2B 4FKTA 1NVQA 4IDTA 4QMTA 3ET7A 4RLLA 4ZJIA 1Y6BA 3TT0A 2VWUA 4E6QA 4XMOA 3A4PA 1CDKA 3AQVA 3KCKA 3RM7A 4A4LA 2RFNA 3DU8A 3RVGA 2B0QA 4RIXB 3UDBA 3HRBA 4FK6A 5L8JA 2FGIA 3KKVA 3MVJA 2GQSA 2WMRA 4ITJA 4P7EA 3C0HA 4GIHA 2C6LA 2A4LA 5AR8A 4XH6A 4BI0A 4O0VA 4D0WA 2C69A 2EXCX 2IJMA 3FUPA 5GIPE 3R7IA 4MXCA 4P5QA 4QQJA 3LMIA 5BV3A 4CMTA 4Y5HA 5K0KA 2YHVA 5CQUA 1Q8ZA 5FTOA 4I94A 2BAQA 3VUDA 2NNWB 4EK8A 5DT3A 3UMWA 3K5UA 4AE9A 1MQ4A 4JX3A 5K4IA 5CAUA 1O6LA 3R9RA 4E26A 3D9VA 4WG4A 3UDZA 1DAWA 3O23A 3ZLSA 4IX6A 1OIYA 2QOCA 4RZWA 3GCSA 1UVRA 2AC5A 4WRGA 3VVHA 4GL9A 5AP4A 4W9WA 3FPQA 4YU2A 2PMNX 5H9BA 4J71A 4U44A 3QF9A 2JDOA 3QD3A 2PVKA 5CF5A 3CJFA 3WARA 2O8YA 3EKNA 1BX6A 5EKOA 3DAJA 4M67A 4FKGA 3P08A 3ZO3A 4FKSA 4ZY4A 4QT1A 3C4WA 5HICA 2QOOA 4QYYA 2Q0BA 3U6HA 2W17A 3GNIB 3V5JA 4QTEA 4IB1A 3WF9A 2VWWA 5H2UA 2H34A 4F7NA 3HYHA 3CD3A 5AAGA 4CYIA 3C4FA 2W1FA 4FIHA 3V51A 1NT2A 3AT2A 4YZCA 3PJCA 5IQDA 3HV4A 3BYMA 5J9YA 3ZM4A 5FM2A 4BCOA 5IUIA 1WBPA 3MVMA 5DHJA 1ZZ2A 4ASEA 4O22A 1H01A 3I1AA 5F4NA 5KHWA 3HV3A 2XKCA 2GHGA 2O63A 3R8ZA 5DR2A 3IW4A 4JR3A 1PXKA 2H8HA 1PRYA 4OT5A 4XG7A 4U41A 4H36A 4FT0A 1R78A 3HUBA 4MKCA 5E1EA 5EW3A 4I23A 3KRRA 4LMUA 4ANSA 1PMUA 1V0PA 1P4FA 3G6HA 4GEOA 3EZVA 5BYLA 2GS6A 2RG6A 2R3RA 1AGWA 1DAYA 2EB2A 3IW8A 5CX9A 4QTCA 2OZAB 3BKBA 2FYSA 2PVFA 5E1SA 5AP7A 3UO6A 3FI8A 5EYKA 4XLVA 3PG1A 5KMMA 2IVVA 4DHJA 4GVAA 2C6TA 1Q4LA 5K0XA 4UEUA 5IEYA 2QOFA 3GCVA 1JVPP 3RAKA 5KCVA 3SKCA 4AXCA 4B8LA 5CLPA 2JAMA 2PUPA 3TTJA 4MX9A 3WF6A 4CMOA 5K5XA 3HA6A 4AACA 4FSRA 3R9OA 4EQCA 3HRFA 1ERKA 4EH5A 4JIKA 5G6VA 4S30A 4ZZMA 3RZBA 4ID7A 3DA6A 1YWNA 4XBUA 4EZ5A 2ONLA 4C38A 1GZ8A 2BZIB 4ZJVA 2UVXA 1GJOA 5A4QA 2XMYA 3HDNA 4YHTA 2V22A 2ETMA 1SM2A 2GQGA 3QU0A 3RALA 3ZLWA 1OB3A 4YNEA 3H3CA 4M0YA 4AT5A 4F1MA 2OJFE 5HG5A 5E8VA 1JKKA 4FTQA 5JKGA 4ERKA 1M7QA 4HYUA 4F64A 3L1SA 3WF7A 3SOAA 3PJ2A 4D4RA 3ZBFA 3CJGA 3D0EA 2WQNA 3Q6WA 2B55A 3D2IA 5EM5A 3LQ3A 2CSNA 4EKLA 3I5NA 1CSNA 1U46A 2XNGA 1S9JA 3PXRA 1FQ1B 2B9FA 4BBMA 3RPVA 2I0VA 2W4JA 3FQHA 2X6DA 4CEGA 4TN6A 2B53A 2OICA 2F2UA 3RCDA 3ZH8A 2PZRA 4R7IA 4IJPA 4O4CA 3A8WA 4XYFA 4DT8A 4L6QA 2BVAA 2R3IA 3BI6A 3ZDIA 2JKMA 4QTAA 2P0CA 3F5UA 3FZ1A 5DA3A 4BC6A 2WB8A 3QA0A 3VRYA 4BKZA 1KOAA 1PKGA 4KSQA 5GZ8A 3PVUA 1STCE 4DHIB 2JKOA 2UZLA 1GAGA 3DQWA 4IX3A 4RVKA 4C2WA 3BEAA 3GU6A 1JBPE 4U42A 2OI4X 4JQ8A 5T68A 5H8EA 4EH7A 4X2KA 1PYXA 4K0YA 2R64A 2RFEA 4FSYA 4RBLA 4GW8A 4L00A 2Z60A 3O17A 2QI8A 3FMLA 3RJCA 2QU6A 4FTMA 4J52A 3ZZEA 5HBHA 4K8AA 5AA9A 4GKHA 3U55A 1JWHA 2YIYA 1Q61A 1YOLA 1Q5KA 2EVAA 3F9NA 3PZEA 4IJ9A 4RIXA 4AOJA 1B38A 4HYSA 3EQIA 3G9NA 1NY3A 5M4CA 3CP9A 3EN4A 5HI2A 1P4OA 2XNOA 3R8VA 4EH6A 4KKHA 3R6XA 3VW6A 2J5EA 4E6AA 2XK4A 3HV5A 3TM0A 2VO0A 4KNBA 5HO8A 2H9VA 4RIWB 5KMNA 2XM8A 3PVBA 2QU5A 4MCVA 4Y85A 3AD6A 3VQHA 4EL9A 5IZFA 2WIPA 4QMZA 3UZPA 3EMGA 5EG3A 3MFUA 3RPOA 2YM4A 2C5OA 3D5VA 3UOHA 4D9TA 3ODZX 4BWPA 1LUFA 3PUFC 3BHTA 3HMNA 2PWLA 4EH4A 3NEWA 3DKFA 4IWQA 1YWVA 2RFDA 5IH5A 3DAEA 5KMKA 4JVGA 4O86A 4JBOA 3AGMA 3KN5A 3F7ZA 2UVYA 4L53A 3A8XA 2VU3A 3HMIA 3ZDUA 3N9XA 3ZBXA 5AA8A 4JMQA 4LYNA 2HWOA 4IW0A 4EC8A 4F63A 2GU8A 3ORXA 4XV3A 4RJ5A 4XG6A 4ZMEA 2IW6A 3L9NA 3L8SA 3QUEA 4BCNA 4FSTA 5JN2A 5KNJA 4KBKA 1LR4A 3P7CA 3T9IA 2YCSA 4Q9SA 3RWQA 3SXFA 2VO3A 2FSTX 4F0IA 2QR8A 4Q9ZA 2H6DA 3E88A 4X0MA 4EOIA 1PMEA 3TV4A 3Q4TA 4ANOA 2JIUA 2BMCA 3F3WA 3S0OA 3ORMA 5A6NA 3IDCA 1H26A 1E9HA 1ZRZA 4HVHA 5CYIA 4YO4A 3DY7A 3W10A 2Z7LA 3VBTA 2WTKC 1Q99A 5GNKA 3IOKA 2UW0A 3PJ1A 4G5PA 4F6WA 3A2CA 4LGHA 2WTVA 1J3HA 5HU3A 4M3QA 4IHPA 1W98A 4D1SA 3BU3A 4AF3A 2QO7A 4TYEA 5A54A 5IH4A 3WF5A 3CEKA 3NVMB 4KWPA 5GHVA 4O83A 1H1PA 2CN8A 4HPUE 5AV0A 3DB8A 2PVHA 4TTHB 2R3HA 3CCNA 3UO5A 2XEZA 3HRCA 2C6KA 4UMTA 3KRWA 1J1CA 3PPZA 5C8NA 4AZFA 3FMDA 1QL6A 1XWSA 2BDWA 3BGPA 5LCKA 3VO3A 3I60A 4L3PA 4AQCA 4DTBA 2GNJA 4JQEA 4O7RA 5LCJA 2P55A 3D94A 4NCTA 2OXDA 3V5WA 5CANA 2F4JA 4J8MA 3E8NA 4V04A 1OGYA 2BDFA 4R5YA 5AP1A 1OL6A 3E8CA 4HNIA 4CG9A 3A7IA 1H00A 1YRPA 2HCKA 1OPJA 2HK5A 3O7LB 5CAPA 4F9YA 5CXHA 3HKOA 4C62A 5KMIA 4FSMA 4Z3VA 5HD4A 4PDYA 4QMWA 4AS0A 3N4VA 3EFJA 5TF9A 3CLYA 3NNUA 2ZV8A 4R3CA 4HVSA 2F9GA 4QYHA 5AV4A 4FEVA 4PUZA 4BGHA 2WMUA 4KS8A 3Q60A 1W82A 1MP8A 5HBEA 3HMMA 2VTPA 2PMOX 3IDPA 4AGCA 3GFEA 2QLUA 4A06A 5HORA 3OW3A 3O96A 4EBWA 5C1QB 4J98A 3V8WA 5J8IA 3TYKA 2OZOA 2BHEA 1PMNA 2UZNA 3DBFA 5FBNC 1JSUA 4DGLC 1I44A 2XP2A 3KN6A 4BVUA 2CNVA 3LQ8A 1UU9A 3PXZA 4JDHA 4O0UA 4PMTA 2XALA 1V0OA 2BKZA 2O64A 4KKEA 4O96A 1OUKA 4OTDA 4ZTHA 5JSMA 4EC9A 3PP1A 1YXTA 4B8MA 4KAOA 3MA3A 3TUDA 1P2AA 2JFLA 4AXFA 1YDTE 2BR1A 2BZKB 4XHKB 4MXAA 5EI8A 3LAUA 3ZRMA 4PP7A 2C30A 3ACJA 1XBAA 4EYJA 5KZ0A 3KIOC 4TZRA 4BI2A 3IS5A 2X7OA 3PZHA 3OCSA 3V04A 5FXRA 4ZS0A 4MNEB 4KD1A 3ANQA 4CLJA 1YHWA 3P0MA 3M1SA 4ZLYA 4GU9A 4XX9A 2PTKA 3CR0A 4EHGA 4R7HA 4RG0A 4A7CA 2CKOA 4UZHA 2J2IB 4KRDA 3R7EA 4X7QA 4FT9A 3KXXA 3WI6A 3ZXTA 2J90A 2XIZA 3C5IA 2V7OA 3UZTA 5AFVA 3QQLA 4WUNA 2OBJA 4AZWA 3EN5A 3G2FA 4L45A 4X21A 4I3ZA 1F5QA 2I7QA 2OO8X 3R63A 3KL8A 1TKIA 1G8SA 5M09A 5JGBA 4O7WA 1JLUE 3QC9A 5AWMA 3QRIA 4V01A 3DK3A 4YJRA 3ZTXA 3DJ7A 5IUHA 4GYIA 4H1JA 2AEGA 3QUPA 4FNZA 2JAVA 2G1TA 2ZOQA 3TNHA 4CT1A 5C9CA 5JFSA 4R78A 3W0PA 3MB7A 3MSSA 3VAPA 3RHKA 3U54A 1CKIA 2ERZE 2PE1A 3NNXA 4C4HA 4CFUA 3TZMA 1ZLTA 3W0MA 3BL7A 4RWLA 4BDHA 2HY81 2YM7A 3QLGA 2Z8CA 2EWAA 3TNPC 3V6RA 3AKLA 4BY9E 4RJ8A 3K54A 3KXNA 2IF8A 3FZOA 1YKRA 3KA0A 3PUPA 3KY2A 2YLEA 4KIPA 5IDNA 4I6QA 2VTSA 2OF2A 3RKBA 1WBOA 4FYOA 1OPKA 2R0IA 3FMEA 4NUSA 3T3VA 1CKPA 4KIKB 3LLTA 4QP2A 5B2KA 3CBLA 5T3QA 2YDJA 4P5ZA 1ZYDA 3NUUA 2OWBA 4E7WA 4D5HA 3R8LA 4I22A 1G8AA 4U80A 3DT1A 3G6GA 3ZS5A 3H9RA 2ZAZA 4AA0A 3E3PA 2OIBA 4EORA 3BE9A 3MTFA 1ZMUA 2XK9A 5CU4A 4FNWA 1H1RA 1OITA 5J7BA 4YC3A 2SRCA 1ZWSA 2YDIA 3D83A 3EQGA 4ONAA 4BDGA 3TDVA 3DZOA 4PL3A 5BQ0A 5KMJA 1VYWA 4DGMA 3AG9A 3TV7A 2HZNA 5HLWA 5FRIA 4D1ZA 4F70A 5EW8A 4IWOA 4JNWA 4QMOA 4LUDA 2OFUA 3BLRA 4IBMA 4LV5A 4DA5A 3GCUA 4D55A 3C4ZA 3VUKA 4APPA 4L46A 2CNQA 1IEPA 2BRNA 4G3CA 2EB3A 2YN8A 3OTVA 4OBQA 1YI3A 3BQCA 4MK0A 4LGGA 4XJ0A 3W2SA 3VUMA 4OBPA 3C51A 4EZ7A 5BX0A 3QCXA 1VYZA 3HZTA 2Y4IB 3QCYA 4MBIA 4MF0A 3COHA 3ZFMA 3LFCA 5DFPA 3BHUA 2W96B 5DRDA 5AAFA 5EK7A 2W1GA 1P5EA 5BUEA 3BLAA 4OT6A 4BCHA 2R3NA 5F20A 4MAOA 3ZM9A 5K9IA 3A7JA 2F2CB 5I9VA 4XG8A 4UMQA 4GCJA 1VR2A 1E1XA 4EOSA 3PIXA 3U6JA 4J96A 5HNIX 5B0XA 4L3JA 4Y83A 2WELA 4HNFA 5DN3A 5L2TA 3EQFA 3QUDA 4X2GA 4ZSJA 5DNRA 2R3KA 2J0IA 1ZXEA 4AUAA 1ZOGA 5A4LA 1S9IA 3HMPA 2XK7A 2QO9A 3EB0A 3QTQA 4I6FA 4FZ7A 3UDTA 4M68A 3PXQA 4FT7A 5LJJA 5IU2A 2HAKA 2YERA 3E62A 2I1MA 3MFSA 2HZ0A 2QC6A 4YHFA 5HHWA 5JZNA 3EFLA 5AR4A 4IVAA 5L8KA 2GTNA 3NGAA 4OAUC 1OBDA 4HGSA 4DAWA 3L8XA 4EK4A 1KV2A 1LPUA 2FSMX 4O2PA 5E8WA 4BKJA 4BRXA 3H9OA 1UNGA 4QTDA 4USEA 4ORKA 2CGUA 3QC4A 4YSMA 3GGFA 4O84A 3TDWA 3PP0A 4FTIA 2QHNA 5E8TA 4PTCA 4WT6A 3U6IA 4NM5A 4YHJA 5DVRA 3IOPA 4YSJA 2WXVA 2ESMA 4JAJA 4YGAA 2XNBA 3Q3BA 3THBA 3OXTA 2VWVA 3N51A 5I9ZA 3KRJA 3QXPA 3QRKA 2C68A 1F0QA 3S2PA 3SD0A 4JDIA 4CRSA 4W4VA 5AR2A 3VS0A 3NYVA 3EYGA 2WU7A 3D7ZA 1YQJA 3SC1A 3UQCA 4QP8A 4G3EA 4GG5A 4TW9A 3SDJA 4RFMA 4EJNA 4YJPA 2XNMA 1SYKA 3NYXA 4TL0A 5FP5A 4U8ZA 2GHMA 4RGJA 2UUEA 3H4JA 3G90X 3OCTA 4E5BA 4USFA 3R8PA 2QONA 3F66A 4E4XA 4WD5A 3JVRA 3LXNA 4UXLA 1SVHA 4Z16A 5HTIA 4QMPA 1NW1A 3HAMA 4JBVA 3KRLA 5A4TA 2XKEA 4ANLA 1PXMA 4MD9E 3FE3A 5EYDA 3V3VA 2XS0A 2PZIA 4BHNA 4QD6A 4EONA 2XANA 3EOCA 3OWJA 4IAIA 3UDSA 4CFNA 2DWBA 2IVTA 3T3UA 4F6UA 5AUUA 4EI4A 4O7NA 3HA8A 1JPAA 1ZYSA 3KFAA 5BPYA 2O2UA 4YLJA 3Q2JA 4ZTSA 3WZDA 3NCGA 5AMNA 3MFRA 5JEBA 2YA9A 4RQVA 4O0RA 3MYGA 2VWYA 2A2AA 3VUTA 4IIRA 4UMPA 5FDXA 2OJJA 3AKKA 4FTUA 1Y8GA 3PWYA 4FE2A 3BHYA 1DI9A 4CTBA 2NP8A 2HIWA 1BYGA 5AR3A 1M2RA 3CE3A 4PPCA 4YZDA 4ZSEA 4DN5A 3BEGA 5IQCA 4G9CA 2F7XE 3ZC6A 3NWWA 2IVSA 4AOIA 1Q8WA 1MUOA 3AC4A 5TO8A 1H27A 1XKKA 1UWHA 2VZ6A 4AZSA 1H1SA 5C8KA 3W0RA 4QMMA 3JYAA 3TV6A 1IASA 2QHMA 3FBVA 4QOXA 2GNIA 5LOHA 4E1ZA 4C37A 1SVEA 3QZFA 4H1MA 1Y57A 1XH9A 2UW5A 3C7QA 2G2FA 3L9LA 1OL2A 3CGFA 2R3OA 3JS2A 3LFQA 5JMSA 4FVRA 4NM3A 3RPRA 3CIKA 4FKLA 4MXZA 2JKKA 3R71A 3BGQA 5AX3A 3W0QA 4YURA 2C6IA 3KF7A 4U3ZA 2X2LA 3SW7A 3FI2A 4KIKA 2VTMA 4ZTRA 3COIA 5KZIA 1KE7A 3NLBA 3M2WA 3R7VA 4E8AA 3FL5A 1OL7A 2BPMA 5AV3A 2QOKA 2ZVAA 2QLQA 3LW0A 4NH1A 5AIKA 5HNBA 2WGJA 3POZA 4FRFA 4JDKA 4ZOGA 4YC8A 2QOLA 3DV3A 2VN9A 4LL5A 5EI2A 3KK8A 5FGKA 4WNPA 4DTKA 2JFMA 4DEGA 4IFGA 4BDBA 4XG3A 4YJNA 3EFKA 2AC3A 1UV5A 3UNJA 3KXMA 4N6ZA 4Z55A 2ITVA 2XYUA 5LMBA 5CU3A 5J9LA 4JBPA 4NW5A 3O8TA 4GKIA 1QPJA 2GPHA 2QOHA 3IK3A 4IQ6A 4YJSA 5HIBA 4FT3A 2V55A 2VTIA 4FIEA 5HO6A 3TTIA 2OJ9A 4XG4A 2YJSA 3NFFB 5CEPA 3MH0A 5HG8A 2CGVA 3LIJA 4IANA 5D41A 5BYZA 3SAYA 2PUUA 4WBBB 2VTQA 5HQ0A 2C1BA 2XBAA 3HP5A 4AN3A 1OI9A 1U5RA 2XNEA 3Q5IA 5I9WA 2PVMA 4LFIA 4MF1A 4YTIA 5CENA 4AW0A 3QQFA 4U81A 1ND4A 4BCQA 2VNYA 3PXFA 1VEBA 2A27A 4F7SA 2WKMA 5CSPA 4PTEA 4WNKA 2FA2A 3UIBA 3I81A 3OCBA 3E3BX 1H28A 2CHLA 3FLYA 2J5FA 2JBOA 3FZSA 3OEFX 2W06A 2X81A 2Z7RA 4YO6A 5CU2A 5AM6A 5AP2A 4ACCA 4C4FA 4CFWA 4FV8A 4ALVA 4ZSAA 3DK7A 3DLZA 1YHVA 4FIGA 5EYMA 5JQ8A 2C0TA 2A98A 3G15A 5EM8A 5AUWA 3NYOA 3RK5A 3UIMA 5A14A 1YHSA 3ZUVA 1WBVA 2XEYA 4D2WA 1OUYA 3W2RA 4RX9A 5C26A 2GDOA 5CU0A 4NYEA 5FBOA 3FY2A 5ANJA 3ERKA 2JLDA 2VTTA 4F7LA 5I9UA 3KF4A 4FKUA 4YPSA 4FZDB 2PZ5A 5CAQA 2PL0A 2ZV7A 3O51A 3PVGA 2PMIA 2QOBA 3ZRLA 5GZAA 2OH4A 3FJQE 2GQRA 4GJ3A 3F5PA 3PE1A 4I5CA 2PK9A 2WTJA 4BDIA 2A19B 2C0OA 2GNFA 1H07A 2Y9QA 3DBEA 3UVPA 1XMMA 4EK6A 5K5NA 5ETCA 2BTRA 3QCSA 4PMMA 3F61A 4DG0E 3ORIA 4RWIA 3RK7A 4FBXA 5IMEA 4OTPA 4XV9A 3BQRA 3E7VA 4O4BB 3VS1A 3E63A 2X6EA 1FPUA 5I3RA 1YDSE 3QHRA 1MRYA 3UOKA 3W55A 4OTRA 5HIEA 1HCKA 2JEDA 4L7FA 4AAYA 4EZ3A 3A7FA 5FEDA 3D5XA 3VIDA 2YITA 1G8KA 3Q6UA 3EN6A 5D10A 5HEZA 4U79A 4O81A 4NK9A 3MN3A 3FKLA 4K11A 3R9NA 3VBYA 4LRMA 4NFNA 3NUXA 2XK3A 4DEBA 4GVJA 3B8QA 4ACDA 3A7GA 3Q04A 4IMYA 3EN9A 4ASZA 3PY3A 5IEVA 1IAJA 2DYLA 1CM8A 2VX3A 2WZJA 3R73A 4LOPA 3KB7A 3VS4A 3DAKA 4D1XA 5KBRA 4FKRA 5JQ5A 2X39A 2IZTA 3BU6A 3ANRA 4R77A 2JDSA 1VZOA 2YFXA 2OU7A 1H0VA 2AYPA 2NO3A 3OWKA 4RC4A 2C4GA 2FUMA 1UU7A 3EQCA 3LFBA 3ZO1A 4BCKA 4BR3A 4CG8A 3R1NA 1QPDA 4J97A 2VTLA 5I9YA 5LMAA 2CGWA 3DDPA 4BDKA 5M08A 2GNHA 4CV9A 4I93A 3PFQA 3WE4A 3UJGA 3HDMA 4NFMA 3UPXA 5DE2A 1T45A 1CMKE 2WEVA 3LCKA 4MQ1A 2RSVA 4OW8A 4QDEA 1URCA 3LXPA 3P86A 4UY9A 4PTGA 2OG8A 3PSCA 4PV0A 4XS2A 4GK2A 3FLQA 4XRLA 1IA9A 4FL3A 2XK8A 4BDFA 1OKWA 5FXQA 2J51A 4JRVA 4FA2A 4AG8A 2WMXA 3ZRKA 3PVWA 3AT4A 3O71A 4I5PA 1WAKA 3F5XA 2WMAA 2VWZA 4CZTA 3I6WA 2QR7A 4KBCA 3FEGA 1M2PA 1QPCA 3OW4A 3OROA 4ZLOA 1YXVA 2PVJA 3GT8A 4TT7A 3VN9A 4TRLA 4QO9A 4EJ7A 3UTOA 3D2KA 3QTRA 4CVAA 2GS2A 5EOLA 5L4QA 5GINE 3ROYA 2CMWA 3DDQA 4IVBA 3ZHPC 2HZ4A 3UG1A 4H58A 5B7VA 2XJ2A 2UW3A 3GI3A 4KKGA 2XIKA 4RRVA 4RJ6A 4S32A 3WZJA 5E8ZA 4LOQA 4P90A 5C4LA 4FVPA 4F7JA 2VAGA 3QGWA 3MPMA 2P2HA 1NVSA 4EH8A 4AU8A 2RGPA 3FKNA 1E1VA 3IW6A 4A4XA 2BRGA 3RTPA 2HY0A 2F7ZE 3LFSA 2V5QA 2ZM1A 4G3DA 4WRSA 3P7AA 3P23A 5HVYA 3E92A 2XA4A 5AR5A 2QOQA 1XJDA 2HXQA 4GRBA 2BIYA 4DLIA 3QHWA 4AWIA 5CI6A 5E9EA 3PRFA 3K3IA 4ZTMA 2UZWE 2P3GX 3FI3A 4G1WA 3RK9A 4O7LA 3NW6A 5AUXA 3FLNC 4ZZOA 1ZARA 3BYSA 1KE5A 2B1PA 1ZMVA 2J0MB 3BGZA 4GIIA 4MEDA 4WKQA 4FKWA 4I0TA 1GZOA 4J7BA 4G9RA 3VONA 1ZY4A 4QYGA 1R1WA 4B7TA 3EHAA 1UNHA 4AW2A 4C3FA 4DH8A 4D0XA 2XM9A 3TWJA 2X9EA 4OTIA 5F95A 1PXJA 1OECA 3F6XA 1O6YA 5TT7A 4JBQA 1RW8A 5K4JA 2DUVA 4MQ2A 2JITA 5IISA 3CKWA 4GK4A 3BPRA 4LV8A 2YEXA 2XYNA 3KULA 5GJGA 4GMYA 2Z02A 4FL1A 2YIWA 4UXQA 4AZEA 5EW9A 4D4SA 2WOTA 3W33A 3PY1A 5A4EA 5DMZA 3SX9A 2XAOA 2W05A 3AKJA 4CFFA 3DXQA 5HCXA 3DQXA 2BRMA 3Q4UA 2X7GA 4FTKA 1XH7A 4FV5A 5IA1A 1Q3DA 3IW7A 3MPTA 4YNOA 4RT7A 3T8OA 4IADA 5CEKA 1K3AA 1UA2A 4MUQA 4EQMA 2CLXA 2BFYA 2W5AA 4WO5A 3GQIA 2W4KA 3R22A 1U54B 1H1WA 4AZVA 3KVWA 5FWKK 4DFNA 2VD5A 2IW9A 2GNLA 4C4IA 2ITOA 5HIDA 4EUTA 3AC5A 1AQ1A 4YTHA 3FQSA 4F99A 3TUCA 3O2MA 4JS8A 2UV2A 3PG3A 3NRMA 4MD7E 4IWDA 4LQMA 4IC7A 3U8WA 1Q8UA 4HGLA 1KWPA 5J95A 2QKWB 3AMBA 2PPQA 4W4XA 3V5TA 4GUEA 5M53A 1YDRE 2P2IA 4BCPA 3CXWA 4GFGA 4W8DA 1M2QA 3WYXA 3ORPA 5L6PA 1SMHA 3G0EA 2WQBA 3EL7A 1RE8A 3HLLA 3FLSA 4IB0A 4YZ9A 2YABA 3NMUF 3TN8A 5A3XA 1R0EA 3LJ1A 4UWBA 3NUSA 4WBOA 1KOBA 4IAZA 2Y6MA 3B2WA 4DEEA 1B6CB 5KX8A 2E9PA 4BF2A 4C8BA 3GU4A 3IPHA 1PKDA 2ERKA 4FTOA 3R83A 5D12A 2ETKA 3W8QA 4R8QA 1OL1A 3GBZA 2B9JA 3UP7A 5HO7A 4MXOA 5JH6A 4X3FC 3AC3A 2CKEA 4FEXA 2OJGA 3JY9A 2IZUA 4N57A 4BCGA 2VTNA 3ZUUA 1PW2A 3E64A 3L9PA 3R00A 5AR7A 5JFXA 1QPEA 1WBTA 3MY5A 4HYHA 3TMOA 4L7SA 2G9XA 4I92A 4L67A 5FP6A 2ITZA 5IPJA 2YWPA 3IDBA 3QTXA 4TWPA 4FV4A 5DI1A 1XH5A 5LVPA 2GHLA 4QP6A 3D15A 1J1BA 3MH2A 3QTWA 2R3MA 4G2FA 4RIYB 3TNIA 4EQUA 4LOOA 1IAHA 4UV0A 1K9AA 5C4KA 2R2PA 2REIA 5AUTA 4D2PA 2C6MA 3QXOA 2XNNA 1FVRA 4FNYA 4BIDA 4C57A 3LXKA 3E7OA 4EOJA 2B4SB 3G9LX 4BWXA 3OWLA 3ID6C 4LL0A 3UZRA 5EDQA 3C4XA 5JRQA 2BAJA 5C01A 4L3LA 4RSSA 3CC6A 4RJ7A 4YJQA