2PE1A

Crystal structure of human phosphoinositide-dependent protein kinase 1 (pdk1) {2-oxo-3-[1-(1h-pyrrol-2-yl)-eth-(z)-ylidene]-2,3-dihydro-1h-indol-5-yl}-urea {bx-517} complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
275
Chain Sequence
b'PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Indolinone based phosphoinositide-dependent kinase-1 (PDK1) inhibitors. Part 1: Design, synthesis and biological activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pe1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pe1A01
4YGAA 4YJPA 2VRXA 3F3UA 4F7JA 1URWA 2BAQA 2F9GA 4UBAA 2IVSA 2WTIA 5EFQA 1UA2A 5HG7A 4AA4A 3CJGA 4FT3A 3FMKA 5E8UA 1S9IA 4D0WA 2OF2A 1JKTA 2B9FA 3OY1A 3LCSA 2WU7A 3PYYA 1UKHA 3QA8A 4M0ZA 5F20A 4I22A 2R3FA 2FSLX 3HLLA 2FA2A 3NZ0A 3I5NA 1NXKA 3IGOA 3BGZA 4GG7A 4O96A 2G2HA 2XNEA 2B9HA 5HTIA 5HCZA 3ZONA 3JR1A 4FIIA 4LFIA 2I0HA 2I7QA 3P9JA 4IH8A 3M42A 4RWLA 5A4LA 3R00A 2JDRA 2VTSA 2C30A 3IQ7A 3Q4ZA 4NM3A 4U44A 2W1FA 3TDWA 5CF6A 3HX4A 2X8EA 2W1GA 3ACKA 4LG4A 3HAVA 3W33A 4B8LA 4GT3A 5AP3A 3FQHA 2HXQA 2X7FA 1XH9A 4G3DA 4TYGA 4D28A 2IJMA 3G6GA 1UU3A 5CF4A 3LZBA 4JBPA 3ZFYA 3DJ7A 3NUSA 5HU9A 3DJ6A 3CY2A 3UOLA 3I79A 3T3UA 5JRQA 4EC9A 4XNEA 2YITA 4DEIA 2IZTA 5CSWA 3W2CA 3UPZA 5IEXA 2QHMA 4FKSA 4KNBA 4UXLA 5CVFA 2NRYA 3BX5A 3Q04A 5DT0A 4CCUA 5A9UA 3RAWA 4DT8A 3A60A 3O8PA 4ALUA 3FHRA 5CASA 2QKWB 4FSRA 5TT7A 3KXZA 3QQHA 4FTKA 3QLGA 1R0EA 4FKPA 4K11A 2X4FA 3MVMA 3RPYA 4AZEA 3ZSGA 3R6XA 4IIRA 2PVNA 4EHGA 5M4FA 2OSCA 3QGWA 4L7SA 4FSYA 4R5SA 4ZTSA 4FE2A 5L8LA 5TF9A 3VS0A 3LKMA 5BVDA 3DB8A 3R9NA 2R64A 4CEGA 4QQCA 2BHEA 4IAYA 5BVFA 2H34A 4DGNA 3LCTA 5I9YA 4W8DA 2ACXA 5DRDA 4C2VA 3CTHA 3DNEA 4EUTA 5IISA 2C5VA 4ZTNA 1YHSA 2H8HA 2YM5A 3Q4UA 4FV4A 2CPKE 2KULA 2R7BA 3EQRA 2QVSE 2UUEA 4YLKA 5HBHA 5L8JA 3AD4A 1U54B 4FIJA 5L4QA 3GQLA 4F6WA 3AC4A 3ZFXA 5K5NA 4DYMA 4FV0A 4TPTA 4PTEA 1OL1A 3DZQA 3D7TB 3RTPA 5ICPA 2BZHB 3SXFA 4DEGA 3Q2JA 2FUMA 4J71A 3V5QA 4FI1A 4AACA 4YTFA 4XBUA 4AX8A 2BFYA 3UBDA 4MXYA 1JSUA 4BI1A 1GNGA 2IZUA 4HGEA 2CGWA 1YDSE 4BIEA 2W05A 4L3PA 3I81A 3KEXA 2OXDA 3BI6A 1R3CA 3DB6A 3ORMA 4PPAA 4EEVA 2ZV2A 3BEAA 4L9IA 3V5TA 2PMOX 3O8TA 1BI8A 2XJ2A 1OPLA 3ZEWA 5BQ0A 3GNIB 5BUJA 4FVRA 1K2PA 1XH8A 3O17A 4XP0A 2AYPA 4AGUA 2WOUA 2H96A 3PXZA 3CGOA 5BYZA 5JZNA 4USFA 5H9BA 4X3FC 5J1WA 1JLUE 2ONLC 3MTFA 3WZKA 5AA8A 4JDHA 3DBFA 3R7GA 4WRGA 3KB7A 4IE9A 5BUIA 1W98A 3O50A 4MXOA 1UNHA 4J99A 3PJ1A 3GU6A 4UYNA 4UX9A 2OIBA 3DBQA 4GCJA 5CZIA 4F9CA 2HZ0A 2YIQA 3A7GA 3QCSA 4NZWB 4E6DA 3EZRA 1KOBA 5HICA 2ERZE 4IX4A 4NL0A 3KC3A 3OC1A 4ACDA 4MEDA 4PUZA 5ETIA 3SXRA 3FC2A 2XS0A 3H9OA 3QWKA 3TKIA 3E7OA 4APPA 3THBA 4HOKA 4XG4A 5IPJA 1OI9A 4ZJVA 4FZFB 4R3PA 4DLIA 1Z9XA 2HCKA 5JFSA 4IBMA 5EH0A 4KAOA 5IH4A 1RE8A 2JD5A 4FV3A 2JIUA 4FKJA 1LEWA 3E64A 3A62A 3VIDA 3TDVA 1H0WA 4CRSA 2JGZA 2WMQA 2PVMA 3D9VA 5FDPA 5HX6A 4WA9A 4G3FA 5CU2A 5HO8A 3DKFA 4Z7GA 5E91A 2QOKA 3PVWA 5KZ0A 4X6QC 4TL0A 2VTOA 3KF4A 2XZSA 5CU0A 5FUTA 3EB0A 2B4SB 3BV2A 3ZBXA 4ZTLA 3RINA 4LOOA 4RIOA 5IUIA 1OL6A 3FYKX 1ZOHA 4X2NA 3EN6A 5HG9A 2WOTA 4AWIA 2X6DA 5JEBA 3DOGA 4NFNA 4ZTRA 2ZB1A 2W99B 3AOXA 3HMNA 2XCHA 4QP1A 2VWXA 2JIIA 4OTQA 3PY3A 4ZS0A 5GJFA 3TG1A 4L8MA 3H0ZA 3M11A 1UU8A 4TN6A 3SKCA 2FB8A 1YXVA 3W2SA 3FQEA 4E7WA 4RWJA 4EOJA 3CXWA 2OFUA 2RL5A 3OUNB 4FG9A 4WUAA 4FTTA 3AGMA 2WIPA 4M66A 3GFWA 3JVSA 4M15A 4QMOA 4RX7A 4GFMA 4BF2A 4DH5A 3GC9A 5HG8A 1MRUA 3OP5A 4G17A 4R7HA 3ZSHA 5DT4A 5KMKA 4O86A 5L2IA 3R01A 1XR1A 2QOIA 2UW3A 4KA3A 4QYFA 3UC4A 1Z57A 5LMKC 3LMIA 1P2AA 4C37A 3BHTA 4O0RA 4CD0A 3HV5A 3PRIA 5I9WA 1OKVA 3EN9A 4L01A 1Y6BA 2JKMA 3BQCA 3F6XA 3LFBA 4CFNA 2UW8A 4QMUA 4QPMA 3PE1A 4ZZOA 2WKMA 5BVWA 5KZIA 3S0OA 2WMUA 2ZVAA 3D2KA 5CSHA 1FGIA 4L6QA 4XBRA 5I3OA 3PP0A 1PXKA 4FSNA 4O7NA 2HZ4A 4ZSGA 4C58A 3VJNA 2Q0NA 3VHEA 2WQEA 4UXQA 4HNIA 3G2FA 2B53A 5EK7A 1WCCA 4C2WA 3KULB 4EH4A 2XKFA 4CT1A 4EYJA 5L6OA 1UNLA 3U51A 3OVVA 1P4OA 4IX5A 4OT6A 3GU5A 3QX2A 2QOLA 4N4SA 4EOMA 1X8BA 2GTNA 3BU6A 2YABA 4QP7A 1KE5A 3QRTA 2R2PA 5HHWA 2OFVA 4M84A 3PVGA 4A9RA 3LXLA 1YVJA 1QPCA 2X2MA 3VS5A 4PDPA 5IZFA 4WUNA 3NAXA 2YLFA 5A46A 2ZDTA 1PF8A 5B7VA 2R4BA 4RJ3A 1JWHA 2R3KA 3W18A 4BCNA 2WGJA 4CFFA 2OZAB 1M52A 4Z7HA 2VWWA 3D15A 4CV9A 1PMVA 4U0IA 3HV4A 4D5HA 4WRSA 2HENA 5AV1A 4BCQA 2R3OA 3EN4A 5CTPA 3A7IA 3REPA 3C1XA 5LMBA 3G5DA 3ZO3A 2E9VA 1CTPE 5L2TA 5HEZA 3SW7A 1J7IA 3QA0A 4XRJA 4LGGA 3DK3A 3CTQA 3AMBA 3LFDA 2OJIA 2W5HA 3NEWA 1STCE 1ZOGA 5E1SA 4OTDA 2V62A 3QD0A 3QC9A 4I1ZA 4RJ6A 2RIOA 3NLBA 4ASXA 4ZY5A 4J7BA 2Z7SA 4EOLA 4GEOA 3ZLWA 1ZZ2A 3LQ3A 1XHAA 3OS3A 4PF4A 4M67A 4E26A 2XK8A 3UIBA 1SVGA 3HUBA 4JBQA 5ANDA 1J3HA 3U6JA 1PXOA 4K1BA 5GHVA 5JH6A 3V6SA 2F2UA 4WOVA 3W55A 2EUFB 4IWDA 4IWPA 4YHTA 4OTPA 4EYMA 2VU3A 3EQHA 3NUNA 4FTIA 2KTYA 4ZXTA 4DFLA 5CSXA 3COMA 5J5SA 4CTBA 4XV2A 4IFCA 2YCSA 4TYIA 4ZAUA 1XH5A 2P4IA 4A9YA 3S00A 3FC1X 2QLUA 3QQGA 2VGPA 4C62A 3MWUA 1RQQA 2WTCA 3TNQB 3FZ1A 4PL4A 4XRLA 3OW4A 2OIDA 3NNVA 1NY3A 2WMVA 4LQMA 1XH4A 2PYWA 1PMEA 4ZOGA 4BCIA 1IA8A 1ZYDA 3PXKA 2X2LA 4HZRA 3R1QA 4AN9A 4ANOA 4AN2A 1IR3A 3IDCA 2R3HA 4GK3A 4U6RA 1XWSA 2UW5A 2W1HA 4IW0A 3T8OA 4M14A 4BDBA 2QHNA 3BYVA 4D1ZA 5AR4A 5HQ0A 2GHMA 5IA0A 5CSPA 5DT3A 4GKHA 3PFQA 2CLQA 3V5PA 2YWPA 2VWVA 2CGUA 2OZOA 5CF5A 5KMJA 5H3QA 2WTKC 2PL0A 2Y0AA 1R0PA 4U3ZA 3Q6WA 1T45A 2YM6A 4KIOA 4S30A 4MXXA 4JI9A 4H05A 3W2OA 2R0UA 3ZEPA 3BYUA 4WT6A 4FIFA 4NKSA 3DDQA 1ZYLA 4FF8A 4MBLA 1PXJA 4TYEA 4E73A 3C51A 4LYNA 4C0TA 5CF8A 3OMVA 4HNFA 4GRBA 3RBWA 4E4LA 1H1RA 2R0IA 4X3JA 3RJCA 3PA4A 4FOCA 1YRPA 4O2ZA 3RK5A 4HW7A 5AP5A 3ITZA 2IPXA 1ATPE 3QZGA 2BRBA 2HXLA 3PG3A 4JDJA 3NCGA 4YZCA 3OT3A 5EDPA 4CKIA 3NUAA 5F94A 2PVHA 4IAAA 1ZAOA 5HIBA 5AAFA 3ZZWA 3FJQE 1G8SA 3IS5A 4YZ9A 2YWVA 2O5KA 4O7TA 2J9MA 4JQEA 2XP2A 4FMQA 4Y5HA 3S95A 4KBKA 2WU6A 3HVCA 5G6VA 1B6CB 4MK0A 4Y73A 4FL2A 3HEGA 4KIKA 3EL8A 3OD6X 5AJQA 3GCUA 3F5XA 3IDPA 4HYSA 3LM5A 2DS1A 4E5AX 4L45A 4GYGA 4O7YA 3OCBA 4A9TA 4YJQA 4XEYA 1KE7A 3A2CA 2GDOA 4I24A 3VS7A 4QMSA 3LQ5A 4FEWA 5ACBC 5GZAA 5TOZA 3NDMA 4DF3A 1YOMA 1JQHA 3PA3A 3VQUA 3IPHA 2JIVA 3KGAA 3WF7A 3EQGA 4CGAA 3OTUA 4FNYA 1NVSA 2GQSA 3UNKA 4Z55A 3RWQA 5LVPA 5I0BA 2Z7QA 3EKKA 3NUXA 2JITA 4O1OA 4X6RA 5AP7A 5IDNA 2VWUA 3ENMA 4G31A 4XG2A 4NCTA 2WTVA 3UJGA 1XQZA 4RIWB 3QXPA 1NVQA 3D5VA 4EH8A 5E92A 3FLNC 4PMTA 3P7BA 3CE3A 4PNIA 3V3VA 4JBOA 2X7GA 3M2WA 4YNOA 5LVOA 4GU9A 3MVJA 1ZMVA 2VNWA 5GZ9A 3IG7A 3ORTA 3ZCLA 5LVLA 3KXGA 4EHVA 4LMUA 4BN1A 1NT2A 2YCFA 4RIYA 4IB5A 3MFRA 5EW3A 3RAIA 4FKIA 2XB7A 4Y85A 2PUNA 4QTCA 2C1AA 2GS7A 3FI2A 4OTHA 5KO1A 5EQPA 4LUEA 5IMEA 4DFBA 3QTRA 3R21A 4RJ8A 2O64A 2XM9A 2W1ZA 3OOGA 2WMRA 3TZ9A 3UE4A 3D5XA 4LV8A 5ANIA 4W9XA 4G6NA 4PP7A 4AGCA 3LLTA 4XHKB 4BTMA 4G3GA 1UU7A 2C6TA 3II5A 3PP1A 4EOQA 3R8PA 3D5WA 3NYNA 3S3IA 5DG5A 2B0QA 2BUJA 1F0QA 5LWMA 1PYXA 4F08A 4L3LA 5F95A 1G5SA 3MA6A 1Q8ZA 4JDIA 2ZDUA 3H10A 4Z9LA 4NKAA 3KXNA 2IW8A 3OF0A 4Q9ZA 4G34A 4RJ5A 4BCFA 4UMRA 3HECA 2VWBA 1BL6A 4L3JA 3ULIA 3C4CA 4BZDA 4EH7A 1FPUA 4HCTA 1QL6A 3P4KA 1ZARA 4BDJA 4MD9E 4EK6A 1FINA 4BCGA 5KNJA 1OUYA 1YHVA 3L9NA 3PA5A 3ZXZA 5HCXA 3AC3A 4FV9A 1WBVA 2B9JA 3OCSA 4QT1A 5DR9A 3GU4A 2QQ7A 1Q3WA 3TKHA 5JK3A 3PDTA 3E63A 4J8MA 4ITHA 4XX9A 5AUWA 2PZ5A 2J5FA 2JDOA 3CTJA 4KRCA 2RFDA 1OIRA 1RDQE 5CT7A 1PMUA 2C1BA 4N57A 1UNGA 4QTAA 2Z60A 4FV5A 5FDXA 2NPQA 2OGVA 3R63A 5HIEA 3AG9A 5AIKA 5CVGA 3KVXA 2PE1A 3CJFA 5CXHA 5EDRA 3QRIA 1BKXA 1OKZA 3MB6A 2XNGA 1M7QA 4DH1A 4YR8A 5IQAA 3DBEA 4I23A 4A7CA 5E4HA 2QU5A 3KU2A 2OI4X 3R22A 3C4XA 4F99A 3I6UA 2BHHA 2JDVA 5HD4A 3KY2A 2BIYA 2C5XA 2P2HA 3QCXA 2XNMA 3FEGA 3VBYA 2J0MB 3R7IA 4AGDA 4FL3A 3QTQA 4GL9A 4R7BA 3QTUA 4HCVA 4GIIA 4YBJA 3UZPA 2W4KA 3LCKA 4QTDA 3W2QA 2HW7A 3ROCA 4CFMA 4JAIA 1Q61A 5EHYA 3A7FA 3Q4TA 2DUVA 3KA0A 4QP2A 1U5QA 3LMHA 2OW3A 4D58A 3KXXA 3Q53A 3IW7A 4O21A 2IZRA 4BDCA 3ODYX 4YJNA 4E6CA 4DBXA 2XK6A 3GCSA 3CS9A 5DA3A 5C8NA 4D4VA 1UKIA 2WQOA 3QTWA 1XBCA 4MH7A 4XG7A 5CNOA 1SNUA 4UWYA 2OJJA 3DFCB 2I0VA 5HIDA 4XG6A 3FKNA 4YO4A 2C6IA 5CQUA 1TQIA 4FT0A 5FLFA 4E4XA 4KWPA 1KE8A 4RIXB 4OBPA 4UV0A 4EZ5A 4ZTHA 4F4PA 2R3MA 3H3CA 3LPBA 4W4XA 5E8ZA 5TKDA 1WFCA 3HDNA 4DEEA 4YTCA 2GNIA 3UVRA 4IAIA 2Y4IC 3MN3A 1H8FA 4MVFA 1U54A 3B2TA 3KN5A 4D55A 4CRLA 3DAKA 5FP5A 3U9NA 4D9TA 2A19B 3NW7A 4EONA 4ZS4A 4AN3A 1ZMWA 2VO3A 3VQHA 3D7TA 4CZTA 4IC7A 4QMLA 4A4LA 1JNKA 2UZEA 3R7YA 4WNOA 3R8MA 3R7VA 3BELA 4A4OA 3KN6A 4DG0E 5J1VA 2BKZA 4AGWA 2OJFE 1H00A 4I5HA 4OW8A 3RK7A 3IW4A 3BYMA 5HNGA 4IVDA 1O6KA 4O0UA 3KK9A 3LXNA 4W4VA 1H1QA 3ACJA 1DAWA 3UIXA 2IVTA 4FZ6A 4I0TA 5FBOA 4F09A 2J0KA 4CYIA 3CPBA 1YWNA 4F6SA 4TXCA 3G0EA 2LAVA 4I6BA 4M12A 4E4NA 5IEVA 3ORZA 3TM0A 2W9ZB 2J0JA 4NK9A 3L8PA 2XMYA 1W82A 4WO5A 4UB7A 4ACHA 5CLPA 4FKLA 3NRMA 4XV9A 5K5XA 3AC1A 5HO6A 3F3VA 4YO6A 4LL0A 3RALA 2UVZA 5EHOA 4G6LA 3R1NA 2XK7A 3WZEA 5CVHA 4RQVA 3D94A 2XYNA 4JIKA 3AT3A 4RT7A 4U5JA 3FI8A 1RW8A 1ZZLA 1WBOA 3TIZA 3NW6A 5LJJA 2UZLA 4AFJA 2UZVA 3IOPA 5CYIA 5EW8A 5IA3A 4HYIA 4X0MA 1NVRA 1P14A 1OKWA 4L00A 4BCPA 3C13A 4CMOA 2Q83A 2ITXA 5EQYA 4QYEA 3DXQA 5HLPA 2FH9A 1OL7A 2YDKA 3N4TA 3RM6A 5CU6A 2QONA 3V5LA 4E4MA 4BI2A 3VJOA 2Y6MA 4BBFA 3ORIA 2XKCA 4M13A 1TQPA 4RMZA 3W8QA 4RC3A 1VYWA 4ARKA 3F5PA 3F3TA 4FV8A 1O6LA 3PWDA 5HVJA 4BHZA 3EQCA 3BBTB 3IOKA 3ZDUA 5A4CA 3OZ6A 4DG2E 4F1TA 4D2PA 3ALNA 4FVQA 2WQNA 3Q60A 4TNDA 4RFMA 1HOWA 2YDJA 5EYDA 4E1ZA 5AR2A 4EQMA 2QLQA 3R8UA 3GC7A 3D4QA 4UZHA 1F3MC 5FBNC 4YZBA 3ETAA 3UTOA 4F7SA 3FZRA 4IADA 3DU8A 5HVYA 4BKJA 4K2RA 3GU7A 2PPQA 2XIRA 4G9RA 4J98A 2UZTA 4K18A 4PL3A 4PDSA 4CSVA 5M44A 3K2LA 3CQUA 3TUDA 1M2RA 4BGQA 5KHXA 4JXFA 5IF1A 4BBEA 5CI6A 5M57A 3BWFA 1M17A 4MD7E 4G2FA 2J0LA 4QYYA 2ZM4A 3R04A 4AE6A 3ALOA 3LVPA 3VS6A 4JRNA 5AEPA 3VC4A 5C4KA 2ETMA 3EQFA 4U80A 4WG5A 3CD3A 3ANQA 2ZYBA 3TV4A 5JFXA 2BKKA 5BVEA 4QOXA 3JUHA 1LUFA 4E6QA 2OWBA 5D9HA 2X39A 4GYIA 4X2JA 5FGKA 4CG8A 4ZZMA 1WVYA 3RWPA 4FNWA 5BVNA 2PMLX 1YQJA 4K6ZA 1WMKA 5GIPE 4U7ZA 3V01A 2PMNX 4UYAA 3O8UA 4CYJA 2JAVA 1R39A 3L1SA 5AWMA 3QUPA 4RLKA 4C34A 4W8EA 4ACGA 4GH2A 3F66A 4J1RA 4QQJA 1FBNA 2Z2WA 1I09A 4DEHA 4I6FA 2OIQA 2CKPA 2PZYA 3SW4A 5BMSA 5ANGA 3BGPA 1GY3A 1ZXEA 3IW5A 3PXFA 3I0QA 4AT3A 4BHNA 5BUEA 4D2TA 5CEKA 4HVGA 4YJUA 2BAKA 5AV4A 4WNPA 2IW9A 4USDA 3DA6A 3E88A 5DOSA 4I94A 5HZNA 3TUBA 1QMZA 3KULA 3ZO2A 5B2KA 3G0FA 4FSWA 5JGAA 2GNLA 4FTUA 3MY5A 1YXXA 3PY1A 4EI4A 3FYJX 3I7CA 3AQVA 4O7ZA 3HA6A 1Q24A 3KRLA 4R3CA 4BDFA 2YCQA 3MIYA 3FWQA 4P90A 1OECA 3NVKI 3BIZA 4FG8A 4NIFB 4V0GB 4PTCA 4QRCA 1ZY4A 4QMTA 4C4HA 4GIHA 3PG1A 4YP8A 1H08A 3DFAA 5CEPA 1LP4A 4TKSA 1MRYA 3C9WA 5KKRC 5L8KA 2ZM3A 4O0SA 2G2FA 4Y83A 4QNYA 3RNIA 3E93A 3ZH8A 2C47A 4HCUA 2A0CX 3CSVA 5ANEA 3TKUA 3SAYA 5HTCA 4RBLA 3PXQA 1H1SA 3JXWA 4NYEA 2F4JA 3RNYA 4RPVA 5DYJA 2B1PA 3AMYA 3TIYA 4BDKA 4FA2A 2B54A 3SHEA 3NR9A 2CKEA 3ZLSA 2W5BA 4Q9SA 3PIXA 1LPUA 1OL5A 4YSMA 3QQKA 4IZ7A 4IAZA 4AW1A 2JBPA 3LQ8A 4RQKA 1JOWB 3OTVA 3K54A 5ETFA 3SLSA 4U3YA 3FV8A 1V0BA 3E8DA 4CFUA 3QXOA 1Y91A 4O81A 3F5GA 1SZMA 3FL5A 2A4LA 4NCTC 4CZUA 3PRFA 3WZJA 3PSDA 3VW8A 1ZWSA 5KMIA 5AV2A 4FX3A 3ZDIA 4FSUA 4CFWA 4EL9A 1REKA 2E2BA 5AUXA 2RSVA 4PMSA 5A6NA 4P7EA 4H3QA 4U8ZA 3NNWA 2GS2A 3NW5A 5CANA 3W16A 4C57A 3OUKA 2YM8A 2IZSA 5EYKA 4DGGA 4F9BA 1RJBA 2C6EA 4FK3A 3V5WA 4O82A 4N6YA 3F7WA 5DR2A 1E1VA 2B55A 2XNOA 4FKTA 4FSQA 4GG5A 1XBAA 5AP2A 4TZRA 1JKLA 2UZUE 3NNXA 5T3QA 2VTMA 2ZMDA 3EFLA 4LRKA 4R3RA 4BC6A 3ENHA 4BGHA 4O0XA 4O6EA 3SA0A 2UW4A 3WF9A 3WF6A 4MXCA 5EOBA 2XF0A 4WKQA 5HLWA 5IA2A 1GIHA 3H30A 2OLCA 1W83A 2BR1A 3DLZA 2ITZA 3EFKA 3QRUA 3RCJA 5IA5A 2VTAA 4ASEA 5E8XA 5K9IA 3PWYA 1E1XA 2XNNA 3WE8A 2FSOX 3FXXA 4EBWA 4MF1A 4UWBA 2H6DA 3HRFA 1YW2A 4ZY6A 4PMMA 3IO7A 2YJSA 4ACCA 3ORXA 4BKYA 4YSJA 1OIUA 4MF0A 3AXWA 1E9HA 3ZUTA 2PVYA 3UVQA 3KF7A 5AUZA 5EKNA 3VS4A 3PVBA 3S2PA 5I5ZA 1VEBA 3V51A 4BCOA 5AP4A 4YBKA 3Q4CA 2VTTA 3UP2A 4O7SA 4TNBA 5H8EA 5I3RA 2XIKA 4Q2AA 3TJDA 5D10A 4DTBA 3VUKA 3CPCA 3FLSA 2UW0A 4IANA 1O6YA 1PKGA 3R7UA 2C3JA 3TNPC 3VBWA 5JRSA 3NMUF 5JMSA 4B6LA 5A14A 1WBTA 2A2AA 4JDKA 5E7RA 3DKOA 2JLDA 5FEQA 1FVRA 4G3EA 3QYWA 4MQ1A 3LFEA 3ZZEA 2BMCA 5B2MA 2WIHA 4DCAA 2NRUA 1J7UA 5IEYA 4BY9E 1J1BA 4U79A 5C1QB 5FEDA 4UMPA 5AAEA 4TWOA 5LVNA 3PJ2A 3NIZA 3WF8A 4BCJA 4K77A 2Z8CA 2YCRA 2ZM1A 2ZV9A 3MVHA 3PE2A 2PUIA 2IWIA 4EK3A 5KUPA 2O65A 2CCHA 3L9MA 1FOTA 3SV0A 2WFYA 3CBLA 3OXZA 4L52A 4PDOA 1IAJA 2ITPA 2IW6A 2R3IA 3ODZX 1KV2A 4FODA 5CEMA 4QQ5A 2VX1A 4D4RA 4XG9A 4O1PA 3IKAA 5AUVA 5C01A 2WO6A 3R8LA 3W1FA 3ZHPC 2W1EA 5DLSA 5EYMA 4FZ7A 3KL8A 5CAQA 2WTDA 3NUYA 3TNWA 1OM1A 1J1CA 4XOZA 3DCVA 4I5MA 5EM6A 3UP7A 2VO7A 3FMMA 4FNXA 3A61A 2WMTA 4A4XA 3GXLA 4RC4A 4XG3A 1CDKA 2VTJA 3O51A 5F1ZA 4RIWA 3JPVA 4HVIA 4IX3A 5HE3A 1WZYA 4WIHA 1WVWA 2FSMX 3A99A 2W17A 5AR7A 4UMUA 4M0YA 3VUHA 4F6UA 2XCKA 3U54A 4TYHB 3L8XA 5A3XA 2CDZA 4FTJA 3UOJA 3JS2A 3KMUA 4O6LA 4QMVA 3PSCA 5DGZA 4ANMA 3V04A 3Q96A 2Z02A 3MH3A 3ATTA 4G5PA 4A06A 3RP9A 2W5AA 3KCFA 2X0GA 4GW8A 4JRVA 4XG8A 4C8BA 5IUGA 2W1DA 3R7EA 5AP0A 1YI4A 2J2IB 1BMKA 3O23A 3QZIA 2GMXA 5D41A 4W4YA 4HPUE 3E8CA 1H1WA 4RZVA 2VTPA 3HA8A 4LGHA 3EQDA 2BRMA 3UNZA 4EOIA 4ZSEA 1SYKA 4RJ4A 5DN3A 4ENYA 2YACA 3GB2A 3JY0A 5IG1A 4USEA 5FWKK 3JVRA 5CAUA 3F3WA 2VN9A 4IB3A 4R6VA 4NU1A 2HY0A 2I1MA 3D2IA 4M8TA 4ALVA 1KOAA 3DKCA 3G15A 4ZSJA 2ITVA 5DE2A 4P2KA 4YLLA 1PMNA 4FT7A 3OBGA 2QG5A 4KRDA 3OG7A 3ROYA 2BTSA 2OU7A 4EHZA 5AA9A 4IZ5A 3PPJA 1ZY5A 4R5YA 1JKKA 4FT5A 4S34A 2YM4A 4FZAB 4RRVA 3CY3A 3BHYA 3R83A 3HUCA 2ZMCA 4C33A 1IG1A 4YHFA 5E8WA 3G9NA 4BGGA 1U46A 3C5UA 3GP0A 3CQEA 3ZO4A 5DI1A 3QD3A 2CN8A 4M69B 4Y8DA 3SDJA 3CP9A 3HMMA 5CEQA 4O22A 3QRKA 5ANKA 5C8KA 2FGIA 4CMUA 1G8AA 4G16A 3U6HA 1GIJA 4U81A 4HGSA 3RMFA 1APME 3DDPA 3SG9A 3EHAA 4B0GA 3ZRLA 3MVLA 3GI3A 3QWJA 4AOJA 2WTWA 3S1HA 4V05A 2E9NA 2XIZA 4LV5A 3DQWA 3GBZA 4XLIA 4I6QA 5CEIA 4JG8A 3EN7A 2YAKA 4D2RA 5GINE 4CNHA 2Y6OA 3VW6A 2OO8X 5M06A 2Y7JA 3QBNA 4BCHA 4H3BA 3F9NA 3V8TA 2QOQA 4DFYA 3FUPA 1BX6A 2YM3A 3Q6UA 2JEDA 3VBQA 3CCNA 2OJGA 4TRLA 4DCEA 4E6AA 3F88A 1Q5KA 1Q4LA 1W84A 5JFWA 5B0XA 1GAGA 5EI2A 5GIOE 5KBRA 3PIYA 4HGLA 1H25A 3OCGA 4JX3A 3UIMA 1Q97A 4AT4A 5DIAA 5FM3A 4IAKA 3MFTA 2VZ6A 1QCFA 2UZWE 4GUBA 2PZIA 4IDTA 4TW9A 5DVRA 2H9VA 5EG3A 5IA4A 4FTLA 3NPCA 4BDIA 5HNIX 4MBJA 3LFFA 3C0IA 3FPQA 4ZTMA 1CMKE 4TWNA 3A7JA 3QRJA 3EIDA 2R5TA 1U5RA 2GNJA 4G5JA 2IVUA 3BQRA 3CEKA 4NEUA 5HOAA 3O0GA 3SRVB 3TEIA 4C3PA 3UQFA 4I4EA 4ZEGA 3L8VA 4RIXA 4JIAA 4QMQA 3BCEA 4ZLYA 4UMQA 2BPMA 2OK1A 4EOPA 5CAPA 2C6KA 2ESMA 4LOPA 4QP8A 1IASA 1Q3DA 1Q8WA 2I0EA 3LFCA 3F82A 1KWPA 4C4JA 4RVTA 1OITA 3OBJA 1OZ1A 5BPYA 2UZDA 2PTKA 3QD4A 4J96A 4CG9A 4F9AA 4C02A 1SVHA 4KSQA 4PTGA 3FLWA 4QMYA 2PVJA 4FTAA 4BZOA 1VZOA 1GZNA 3CC6A 4CLJA 1B38A 3C0HA 4ITIA 4J97A 3DV3A 1P5EA 2BDWA 2VTHA 4HPTE 5KCVA 4AW5A 3E5AA 4BKZA 1UU9A 3RAKA 4C3RA 3O2MA 5LMAA 3W8LA 4DEBA 5CWZA 2ZB0A 4EK5A 3PTGA 4AZSA 3GOPA 2YN8A 4H3PA 4O2PA 2WB8A 1KSWA 4RFYA 3COKA 4QP4A 3KMWA 5HD7A 2C4GA 2YM7A 3D14A 3DY7A 3GC8A 4II5A 3OHTA 4MXAA 3VRZA 2CNUA 4JX7A 3Q2MA 3LLAA 2BCJA 5M53A 3I4BA 3IW8A 4J53A 5E8SA 5FG8A 2GFCA 3P78A 2JFMA 1H1PA 2V0DA 1JKSA 2JBOA 2ZV8A 4KBAA 4DH8A 1BI7A 1O9UA 2A1AB 4F64A 3HMIA 3WYXA 1J91A 4KB8A 3UZTA 4FYNA 3UG2A 3MY1A 4EJNA 2J0IA 2C3KA 3N9XA 4IVBA 3QU0A 3VULA 2WMBA 4MX9A 4X2KA 4YTIA 2R3RA 3LM0A 2QOFA 2QR7A 2JC6A 5CS6A 3CD8A 4GJ3A 1XKKA 2PZRA 3A8WA 1H0VA 4EOSA 1CKIA 4ORKA 4DA5A 4KD1A 2CGXA 3TNIA 3NNUA 2Y9QA 3F3ZA 3LFQA 4I5CA 2VUWA 4KIPA 2NP8A 4FEQA 4B8MA 3EZVA 1YWVA 1Q8TA 3GCPA 4BB4A 1MP8A 3PY0A 2CCIA 5IQGA 3I0OA 4UY9A 3FSFA 4B9DA 4K0YA 3BLQA 3MFUA 4XP3A 4J8NA 4ERKA 2RKUA 4IWQA 1SM2A 4X2FA 3AGLA 3DQXA 2YJRA 3K5VA 1HCLA 2W96B 4I41A 4YC3A 5A4QA 3PZEA 4EWQA 3GC0A 5M51A 4K8AA 2RF9A 2WXVA 4DINA 3LCDA 4NH1A 1A48A 4PQNA 2C5OA 4O0YA 4FTQA 4I0RA 4I21A 1CKPA 4AF3A 1BL7A 4DBNA 3FQSA 1Y8GA 5CQWA 2J5EA 2EU9A 3AMAA 4Q5HA 1W0XC 4EC8A 2WQMA 3GT8A 3ORNA 4UZDA 3UYTA 3GOKA 3T9IA 5CALA 4O7RA 5M08A 5E90A 1TVOA 2XEYA 3HV7A 3BU3A 4J95A 3DKGA 2OJ9A 1Q41A 3R2BA 5DH3A 2IVVA 1OIQA 3C7QA 4R77A 5DMZA 2YHVA 5LQFA 1PXPA 2PHKA 4AXAA 4KKGA 4XMOA 4FBXA 3HP2A 4NT4A 4OAUC 3LXKA 2UW6A 4BWPA 3FXWA 3FL4A 4BTKA 1YDRE 5AUYA 5HESA 3VVHA 3R7OA 3ZS5A 3FMDA 5CXZA 4L42A 3DK7A 3I5ZA 2EXEA 5T6KA 3FZPA 4IACA 2C3LA 1DI9A 3E8EA 2ITWA 2WMWA 4BVUA 3GCVA 1Q99A 2SRCA 2AC5A 3SGCA 3OWJA 1LR4A 3Q3BA 4RVMA 3WZDA 5D7AA 3PVUA 4E93A 2GCDA 2C6OA 4RVLA 3FMEA 4FK6A 1CSNA 2BZKB 4LMNA 5AR8A 5B2LA 4FKWA 4W9WA 5ANOA 4FZDB 2XKEA 4YNEA 5GJDA 4S33A 2VTQA 2RG5A 4OTWA 5EHLA 4E20A 1JAMA 3AD5A 4IJ9A 2RFNA 3GFEA 4FKVA 4PRJA 4FEUA 1OPKA 5KHWA 2UZNA 3ZBFA 4QMMA 4EOOA 5JGBA 3QYZA 1GOLA 2OKRA 2AC3A 2X1NA 4NTTA 5C26A 3UGCA 4YZNA 2R3PA 3ZM9A 2WEIA 2B9IA 2GHLA 1OVEA 2HAKA 3EYHA 4HZSA 4YC6A 3ZM4A 1FVVA 4C4GA 1QPEA 3WILA 3G90X 4BTJA 5BX0A 5EQEA 5E8TA 3TWJA 5M4CA 3LW0A 5ETCA 5EKOA 1WAKA 2O63A 3QGYA 4ZMEA 2F57A 2QD9A 1W8CA 3GQIA 3QKKA 1R1WA 3MPMA 3V6RA 3SG8A 4AW0A 1M2QA 5K4JA 3ELJA 4D1XA 4YMJA 4NIFA 4F7NA 4V0GA 3HNGA 4DEDA 3FLYA 3HGKA 3PPZA 4JQ7A 4GKIA 4DTAA 3KFAA 4AFEA 5I9XA 3ORPA 4RA5A 4U40A 4ZLOA 2VTLA 5HU3A 4Z16A 5J9LA 4ASZA 4JR7A 4GK4A 3E3BX 1U59A 2BDJA 4LM5A 4R78A 3RM7A 5CY3A 2GQGA 4CMTA 4ZZNA 4F9YA 3R0TA 4MXZA 4WBOA 4KSPA 4NJ3A 4NTSA 3D5UA 4F0FA 1WVXA 3QCYA 2WD1A 3SVVA 4DG3E 3EFWA 3FBVA 2PU8A 4I20A 1XBBA 3DJ5A 5EDQA 5EM5A 2GU8A 3UQCA 3UOHA 3UO4A 5CENA 3UMXA 2J51A 2Z7RA 4JG6A 3TXOA 3OWPA 5HORA 4IZYA 5J8IA 4BCKA 4UALA 5HBEA 3FZTA 1XJDA 5HE0A 3BV3A 3GU8A 2CSNA 4Y5QA 4ITJA 2W9FB 5D12A 3B8RA 5HCYA 5IQCA 3U4WA 2Z7LA 2WNTA 5AR5A 1IRKA 3OW3A 3MH0A 2C5NA 4M97A 1H24A 1YI3A 3E92A 4C61A 4U9AA 3VNTA 4E8AA 3QQFA 4IQ6A 1DS5A 4EZ3A 4BL1A 4ZTQA 5KE0A 4LRJA 4NM5A 2ZV7A 4X3FB 4I0SA 3OXTA 5C8MA 1AGWA 1UV5A 3NUUA 3VUDA 1JBPE 3RGFA 3COIA 3RZBA 3LJ0A 3GEQA 3QTIA 3MA3A 4IJPA 4ZMFA 2EB3A 3L9LA 4IDVA 3HRCA 4BI0A 3O7LD 2HZNA 5M09A 2PE0A 4KS7A 4E5WA 1EH4A 4APCA 2P33A 4NW5A 4YPSA 3WF5A 3PSBA 3K5UA 3RPVA 4EZ7A 3N4VA 4WD5A 4U41A 3PXYA 4H39A 4C59A 4IFGA 4KIQA 4W4WA 4YJSA 5CAOA 2BTRA 4F7LA 4DITA 3CLYA 3FSKA 5IQIA 2EXCX 1VJYA 3EJ1A 4M3QA 1DM2A 3KCKA 3P5KA 4C4FA 2YIYA 3FZOA 3HV6A 4DH7A 3N4UA 2WELA 1FGKA 2E9OA 5LCKA 1FQ1B 3TL8A 1PW2A 4NWMA 3D0EA 1Y57A 4FV7A 5M55A 3DLSA 4DTKA 4FC0A 3DXPA 3LFNA 4BZNA 2FO0A 4EUUA 4XCUA 2VAGA 4FKOA 3W32A 4U43A 4O7LA 4A9SA 1Y6AA 5IQDA 3U4UA 3ZO1A 4A9UA 3QQJA 5IQFA 3UDBA 4OT5A 5ETAA 3MIAA 3R73A 4GS6A 1KV1A 2BFXA 2J7TA 5CU3A 4FV2A 4FUXA 3TUCA 4R1YA 2J90A 2RGPA 5LOHA 5AV0A 5IQHA 2GHGA 4FKUA 3DTCA 3IONA 3MH2A 4BTFA 3POOA 3PZHA 5E9EA 2X8IA 1A06A 2PY3A 2QOCA 3NCZA 3RKBA 4I5PA 2YLEA 4DFZE 4DFXE 2XYUA 4JOAA 4MHAA 3VUMA 3HDMA 4FTNA 5FTQA 3R9HA 3C4ZA 4JBVA 3DPKA 2DQ7X 4FSZA 3WIKA 2HY81 1H07A 2ZOQA 4EBVA 3ID6C 3HMOA 3PLAE 3DTWA 4BYJA 5JN2A 3R9RA 2C68A 2BDFA 4FEXA 4PL5A 5FEEA 2Y4PA 5C9CA 1YKRA 3F69A 2VO0A 3FI3A 3ZOSA 2ITTA 4AZTA 3DXNA 4RGJA 5EI8A 3BKBA 5DRBA 1PXNA 3VF8A 1FMOE 1PY5A 2XNBA 2F49A 4UMTA 2O0UA 3C5IA 4EORA 5KBQA 2X4ZA 3F2NA 3QAME 2NNWB 2VD5A 3LAUA 2BRHA 4ZSLA 4MBIA 2XRWA 4DE4A 3QTXA 3CQWA 5LARA 2I40A 3NYVA 2YISA 3TJCA 2XKDA 3LJ2A 5JQ5A 4HJOA 4C4EA 5EM7A 2CN5A 4PPCA 4O27B 5DFPA 4IB1A 1IA9A 1TQMA 4BDHA 4BIBA 4FGBA 4IAFA 2Q0BA 2WZJA 4F0IA 4I93A 3B8QA 3ANRA 2R3LA 4Q5EA 4QMPA 3KXMA 4RSSA 3MH1A 5GNKA 4HGTA 2ZJWA 4O38A 4AT5A 4GVAA 4ANBA 4MKCA 2XBAA 5AIRA 4CV8A 3BPRA 5IA1A 4O7VA 3FZSA 4JT3A 2E9UA 4TYHA 2C6LA 2HK5A 1Y8YA 3EH9A 3KK8A 3EYGA 3ZMMA 4DGMA 3RI1A 2O3PA 5IKWA 4YJOA 5KMNA 3F61A 2OZAA 4H1MA 4FTRA 4EKLA 5J7BA 4RLLA 3W2PA 3VBXA 2BRGA 4AZFA 4FKQA 1K3AA 1U4DA 3VWAA 3JYAA 4TTHB 4MCVA 1UVRA 2JKKA 3G6HA 3O96A 2C6MA 3MGYA 4GV1A 3VO3A 4MQ2A 1YXUA 2R3GA 4EH6A 4MNEB 5AUTA 2ITYA 4QYHA 4JJRA 3NIEA 4EOKA 5FXRA 3QD2B 2X7OA 5HNBA 4P5QA 2IG7A 4XV1A 3I1AA 4ANSA 1AD5A 5AFVA 3QZFA 5DEYA 3QTSA 4ZJJA 3HRBA 5EOLA 1M7NA 2HWPA 4GSBA 4YTHA 5C03A 2ZAZA 4HVDA 3S4QA 3T9TA 3BGQA 1I44A 2O8YA 5CI7A 4RVKA 3ORLA 1ERKA 3PJ8A 3RCDA 3B2WA 3AC5A 2CMWA 4RFZA 2ITUA 5DNRA 3QHRA 4GU6A 2ITQA 4G1WA 2X2KA 1PRYA 2W4OA 3ZTXA 4IVAA 4PV0A 1OBGA 5FXQA 5FRIA 2V7AA 4YPDA 4FIHA 4CZYB 5JGDA 2VV9A 2BZIB 3C0GA 4L43A 4M69A 3VRYA 3BYSA 4FR4A 3NVMB 4RG0A 1ND4A 4D5KA 2WQBA 4AUAA 1GZ8A 2C69A 2VTNA 2WMSA 2V22A 4IZAA 4OGRA 4FTOA 4XP2A 3VBVA 5IU2A 3PLSA 4XUFA 5J7HA 1ZYSA 4QTBA 1W7HA 2W06A 3DZOA 1KUTA 3QQUA 5CT0A 4PMPA 1IEPA 3EFJA 4RWIA 3FPMA 4F0GA 4PDYA 4YZMA 1CM8A 2ETRA 3E8NA 3K3JA 1SMHA 3PJ3A 3PXRA 3QL8A 2PVFA 2XVDA 4BCMA 4O84A 3Q9WA 2QO2A 5JKGA 1L3RE 4C36A 3MJ1A 3U8WA 4TT7A 3Q9YA 4R1VA 5TO8A 3C4EA 5J95A 3MJ2A 1QPDA 2BILB 2GTMA 1XH7A 3G33A 4ANQA 4FGRA 3UIUA 4N70A 5E8VA 2J4ZA 3DBDA 4KINA 5HG5A 2PE2A 2G01A 3AT2A 3QFVA 2W1IA 5AX9A 3TI1A 2CNVA 2WTKB 4NM0A 3GGFA 5I9ZA 1BLXA 1FMKA 1YHWA 2OBJA 2UZOA 1IAHA 3HMPA 4EJ7A 3AD6A 1PXIA 4KS8A 2XUUA 1QPJA 3QALE 4HYUA 4JL9A 3SRVA 5BNJA 2G2IA 4O0WA 3VF9A 5EM8A 4Z3VA 3DGKA 3R02A 1REJA 4LI5A 4QP3A 3F5UA 1OB3A 3OFMA 4LGDA 3VS1A 4H1JA 3TTJA 4BBMA 3UZRA 4DFUA 4WNMA 1UWHA 4LRMA 4MD8E 3SOCA 2JDSA 2XM8A 2J6MA 5BVOA 2F7XE 4YLJA 3TV6A 2JAMA 2XK4A 3IK3A 4AZVA 4TYJA 5D11A 5KMOA 3UPXA 1Z5MA 3UO5A 4ZY4A 4NJDA 4C3FA 2QCSA 2PWLA 4YU2A 3IW6A 1CKJA 2QG7A 4S31A 3OCTA 4FNZA 2VNYA 4OTIA 4X21A 3IECA 5EYCA 4FV1A 3MTLA 3QCQA 5AX3A 3RHKA 3EN5A 2YEXA 4FG7A 4IB0A 5TE0A 3UG1A 2PULA 3CGFA 4KABA 4QO9A 5HBJA 1B39A 4Y72A 4O7WA 3OOMA 1Q8UA 2QC6A 3POZA 4GT4A 1Q8YA 4ZJIA 2XJ1A 3GUBA 3MDYA 4NUSA 2OF4A 1DAYA 2Y8OA 4AZWA 5A6OA 2VWZA 3EQBA 2W4JA 1GZOA 4IHPA 4KKHA 4GK2A 3H4JA 4FTCA 3COHA 3BRBA 2PSQA 3RK9A 2LGCA 1MQBA 5FP6A 4ZK5A 3QQLA 2F2CB 4RX5A 3U87A 3WBLA 3TNHA 4F63A 3F2RA 3FMHA 4F1OA 5IH5A 2DWBA 3PJCA 4K33A 3RHXA 4N0SA 2B7AA 4FSMA 2C0OA 4F65A 2YAAA 4D4SA 4FIGA 4EQCA 5IH6A 3Q9ZA 3QKLA 4UEUA 4NSTA 1PXMA 3QX4A 4AOIA 3IDBA 4XV3A 1L8TA 2XIXA 1H27A 4QD6A 1YOLA 4AG8A 4M7IA 2PVLA 3VN9A 5BVKA 4IEBA 5BYLA 3LIJA 4WHZA 3FXZA 2W0JA 4WG3A 2J50A 4BYIA 5FM2A 5M56A 2OXYA 2P3GX 1PKDA 3KRXA 3QUEA 1GIIA 4OUCA 3EMGA 5AMNA 5HE2A 4V04A 4H36A 3ATSA 4MWIA 4M68A 3BLHA 1H28A 3ORKA 2FVDA 4I4FA 4QNAA 4E5BA 3LFSA 5M07A 4S2ZA 1WBSA 1JSTA 4XH6A 2XIYA 4EH2A 2EB2A 2GNGA 4ONAA 5J9ZA 2OH4A 3MSSA 4ZP5A 4AS0A 3PUPA 2P2IA 4Y95A 2RFEA 3A8XA 3VS3A 5L2WA 1GJOA 4A07A 3ZXTA 5H8GA 4AE9A 2C0IA 3R1YA 4QYGA 2VX3A 3OWLA 4IMYA 5DHJA 3RPRA 4ANNA 3ZU7A 5HVKA 2EVAA 3ET7A 4DAWA 5A4EA 3KVWA 3JY9A 4GJ2A 4TY1A 2PUPA 3KQ7A 4AW2A 4RX9A 5M4IA 2V7OA 4CXAA 4PNKA 3FE3A 1P4FA 4MWHA 4XS2A 3TV7A 5AR3A 3ZFMA 4FOBA 2CNQA 4JG7A 4DT9A 1KE9A 4FV6A 4C7TA 4WG4A 2HWOA 2X8DA 4U45A 4MYGA 2C0TA 2XA4A 4L7FA 2EXMA 3MPAA 4IC8A 2C5YA 4JS8A 1YOJA 1XO2B 5K0KA 4UN0C 4NM7A 5K3YA 1V0PA 2X9EA 4JNWA 1F5QA 3ERKA 3VUIA 5AAGA 3EQIA 4P4CA 4QMXA 4OBQA 4RZWA 3P0MA 3ZUUA 5TR6A 4ZIMA 1WBWA 3O7LB 4DEAA 5GZ8A 5HE1A 3P23A 3HV3A 5DBXA 1ZOEA 4FKGA 3SQQA 1V0OA 4DFNA 5BMMA 3DAEA 4HVSA 2XJ0A 5L6PA 3N51A 4XYFA 3U6IA 4IVCA 1OGUA 2XK9A 2G1TA 4RJ7A 4TWCA 3LJ1A 4X7QA 5FXSA 5J87A 1ZLTA 3VUTA 3WIGA 4CFXA 3QF9A 4LUDA 3QC4A 2G15A 2UZBA 1R78A 5F4NA 5T68A 5HI2A 5JSMA 1VR2A 2FYSA 3L8SA 4ID7A 5AM7A 1BYGA 3P79A 4LL5A 4PPBA 2XH5A 2YIWA 5ITAA 2YZAA 1OBDA 2GQRA 4QP9A 3UYSA 5K4IA 4E3CA 4KUJA 5L3AA 2OICA 5IQEA 2VWYA 2HELA 3NX8A 3MB7A 4WSYA 2HW6A 3TZMA 3LMGA 5ACKA 5HLNA 3WARA 1SNXA 3E62A 4BDDA 3SOAA 3UMWA 3V8WA 2UW9A 4DC2A 5LWNA 4EH3A 2QURA 1UWJA 2BIKB 5LXMA 3NUPA 2A27A 4MNFA 3OEZA 5HKMA 1DI8A 2Y4IB 2CLXA 4V01A 1MQ4A 2PK9A 3SX9A 3D83A 4R8QA 4B99A 3K3IA 3R28A 3CIKA 4DGLC 5EI6A 4HVHA 2ITNA 2YDIA 4D2VA 5IQBA 2E9PA 2CKOA 2NO3A 3DK6A 3OY3A 4CKJA 5I9UA 4DH3A 3IGGA 5GJGA 3R30A 3R71A 3QKMA 2PVKA 5IDPA 4CLIA 4FKRA 4BRXA 3MW1A 2CHLA 2QNJA 5J5TA 2G9XA 3BE2A 3CR0A 1NA7A 3DBCA 3ZYAA 2UVXA 4JQ8A 4AP7A 4JR3A 3MFSA 4BIDA 4F9WA 4YURA 5FTGA 4Y46A 2AUHA 4QMWA 4O0VA 3P08A 2PMIA 3WZUA 4QQTA 4AOTA 1OIYA 4GFGA 5AM6A 2HZIA 2GFSA 2VX0A 3VBTA 3WOWA 2YERA 1YI6A 2ERKA 4X3FA 3UC3A 3WE4A 5CAVA 2IO6A 3A7HA 5KMLA 3R9DA 2ONLA 2QOBA 3I7BA 5L2SA 2RG6A 4CFVA 4EWHA 5LCJA 1A9UA 1SVEA 2IN6A 3AT4A 5J9YA 2REIA 2QO9A 1VYZA 3D7ZA 4PY1A 2C6DA 4IXPA 4OR5A 4OBOA 3V8SA 1MUOA 1KE6A 2BVAA 2FSTX 3GENA 5D7VA 4C35A 2WAJA 3W2RA 3ZLYA 3I6WA 4QP6A 5I4NA 3LHJA 5D1JA 3KREA 3V5JA 4BICA 3H0YA 3LOKA 4LOQA 1PYEA 5FQDC 4IWOA 4KKEA 4WNKA 3WYYA 4YC8A 2BZJA 1JSVA 3BU5A 4YJRA 5DR6A 5LVMA 3ZRKA 5K0XA 4YHJA 4DHFA 2W1CA 3H9FA 2OH0E 4JVGA 3U9CA 2JKOA 3TZ8A 3EQPA 5AV3A 3NSZA 3QTZA 4OTGA 2GPHA 3R1SA 3DS6A 3QZHA 3FKOA 1TKIA 4CT2A 1YDTE 2BROA 3E7VA 2DYLA 4GT5A 4L68A 5AP1A 4BWKA 4ACMA 1FVTA 4JLCA 3RZFA 3KMMA 2CKQA 3KRRA 4OTRA 5AADA 4IM0A 4ANLA 4O0TA 1URCA 4L67A 3FY0A 4CCBA 4DGOA 3KXHA 4XOYA 5JT2A 5JZJA 4I6HA 1Q62A 1ZMUA 2JKQA 3C4WA 4CTCA 2PZPA 3BBWA 3BZ3A 3QLFA 1ZRZA 5DWRA 3FAAA 4KBCA 1ZYCA 2XNPA 4AU8A 4I3ZA 2R3QA 3MS9A 3VS2A 4OAVB 3LFAA 4NFMA 1AQ1A 4PX6A 5L6WL 1H26A 4IM2A 3T3VA 2UVYA 3MV5A 2YFXA 3Q52A 1JVPP 4WSQA 3FLZA 2VTIA 3RPOA 4GVJA 3FDNA 2CGVA 3ULZA 4X2GA 2WPAA 4PWNA 4EHEA 4AA0A 3BHHA 2WHBA 3SD0A 4D9UA 4ENXA 2CJMA 2OG8A 4D1SA 4CVAA 3KKVA 3MYGA 3CKXA 2X6EA 3OWKA 5H2UA 4GMYA 3EWHA 4ASDA 3BYOA 3R8ZA 4EK8A 3MY0A 3EL7A 3E3PA 3LE6A 3TCPA 2V55A 5HO7A 5C4LA 3AC8A 2BAJA 4IX6A 4BDEA 4CQEA 2QI8A 2HYYA 2QKRA 2YA9A 3DNDA 1J7LA 4D4YA 1V1KA 4S32A 3F7ZA 4U42A 4G3CA 5LMKA 3HKOA 2JDTA 3BE9A 3ZUVA 5E1EA 4GUEA 1XH6A 3EKNA 3BHVA 5EW9A 3UVPA 1OPJA 2WEVA 4YJTA 1G3NA 5HTBA 5J79A 3NAYA 3NYOA 2R3JA 3KRWA 4QPSA 2WMXA 2I0YA 5CU4A 4QTEA 2XK3A 2R7IA 2XBJA 4D0XA 1S9JA 5G1XA 3C4FA 3ZC5A 4G9CA 3OEFX 2EWAA 4XJ0A 3OROA 2O2UA 3W10A 4QMZA 2B52A 3ZRMA 1M14A 3BHUA 3C50A 4FTMA 2YZLA 4QPAA 3P7CA 3P1AA 4CKRA 2ITOA 1WBNA 2C3IB 2XEZA 2R9SA 3BEGA 3PPKA 4R7IA 4YZDA 3AC2A 3MPTA 3GVUA 3NWWA 4K9YA 4MTAA 3ZLXA 5IMXA 1K9AA 3WI6A 3Q5IA 2WMAA 4FEVA 3Q9XA 3PIZA 3UQGA 5A4TA 1BUHA 1YWRA 3FY2A 1H01A 2VWIA 3FHIA 3TT0A 5CEOA 3P7AA 5DPVA 3FKLA 3SXSA 3F2AA 2WTJA 3R8VA 1PXLA 5BYYA 5HX8A 5CX9A 4QMNA 5F9EA 3E87A 5H8BA 4ZSAA 1T46A 2V5QA 4MNEA 5CNNA 3G9LX 4UWCA 3DAJA 4KIKB 1OKYA 2F7EE 2UV2A 2YIRA 4JAJA 3TZ7A 3UODA 4AQCA 1GZKA 3TN8A 4FIEA 3G51A 5KKRB 3R9OA 3U55A 3QUDA 3BLRA 2OXXA 2BALA 2QOOA 4FYOA 4YUQA 5A54A 4G6OA 4RWKA 4AAAA 4B7TA 2VTRA 2VGOA 3RVGA 5FD2A 4ALWA 3NGAA 4O91A 3RAHA 2PUUA 3FMNA 3Q5ZA 4BFMA 4F1MA 5ANJA 2YIXA 3FI4A 3MI9A 5I9VA 3RPSA 3Q32A 5KX8A 2VO6A 3ZC6A 4AA5A 2X9FA 2BRNA 2P55A 5CSVA 4O83A 5KMMA 4H58A 5L2QA 1YXTA 4EKKA 4EH9A 4D2SA 3H9RA 4FICA 4FL1A 4BDGA 4DN5A 3BWJA 3OXIA 4RC2A 4B4LA 1HCKA 4L53A 2R3NA 4HYHA 3VUGA 3P86A 4U97A 1OUKA 4F70A 5HGIA 5C27A 4PP9A 4FT9A 4I92A 3HAMA 3HZTA 4GFOA 4OTFA 5JQ8A 3M1SA 1OMWA 4BR3A 4OLIA 3NYXA 4DLJA 2QODA 2QO7A 2UW7A 3NS9A 4L44A 5DEWA 1M2PA 4IM3A 4EQUA 4TWPA 3CKWA 3R2YA 1H4LA 3FLQA 4XLVA 4CQGA 1OL2A 1PJKA 3L9PA 5FTOA 5E8YA 2ETKA 2GNFA 3UO6A 3A4OX 2GS6A 2XRUA 2W7XA 2P0CA 3TACA 5AUUA 4RA4A 4RIYB 4BWXA 5M4UA 2PVRA 2HIWA 3HL7A 3LXPA 4EK4A 4ZLZA 4P5ZA 4WBBB 3HYHA 2X81A 3LCOA 4NW6A 5JFVA 3FMLA 4FUYA 5IUHA 3GCQA 2HOGA 1PHKA 2GNHA 1YXSA 2I6LA 3MBLA 3O71A 3VHKA 4D2WA 4C38A 3A4PA 4MAOA 2GSFA 3FMJA 5AP6A 3ZSIA 4J52A 4N6ZA 3MESA 3UNJA 2QU6A 3UOKA 4RX8A 3SC1A 4ERWA 3DT1A 3KRJA 3VAPA 1MRVA 1ZYJA 3HP5A 3EOCA 2JFLA 1LEZA 1WBPA 4EH5A 4FSTA 3OT8A 4L46A 4BDAA 2RFSA 5CZHA 4YJVA 2QR8A 1JPAA 3I60A 4C4IA 3TTIA 2QOHA 3QHWA 4FVPA 1NW1A 2F7ZE
chains in the Genus database with same CATH superfamily
4YGAA 4YJPA 2VRXA 3F3UA 4F7JA 1URWA 2BAQA 2F9GA 4UBAA 2IVSA 2WTIA 5EFQA 1UA2A 5HG7A 4AA4A 3CJGA 4FT3A 3FMKA 5E8UA 1S9IA 4D0WA 2OF2A 1JKTA 2B9FA 3OY1A 3LCSA 2WU7A 3PYYA 1UKHA 3QA8A 4M0ZA 5F20A 4I22A 2R3FA 2FSLX 3HLLA 2FA2A 3NZ0A 3I5NA 1NXKA 3IGOA 3BGZA 4GG7A 4O96A 2G2HA 2XNEA 2B9HA 5HTIA 3P5JC 5HCZA 3ZONA 3JR1A 4FIIA 4LFIA 2I0HA 2I7QA 3P9JA 4IH8A 3M42A 4RWLA 5A4LA 3R00A 2JDRA 2VTSA 2C30A 3IQ7A 3Q4ZA 4NM3A 4U44A 2W1FA 3TDWA 5CF6A 3HX4A 2X8EA 2W1GA 3ACKA 4LG4A 3HAVA 3W33A 4B8LA 4GT3A 5AP3A 3FQHA 2HXQA 2X7FA 1XH9A 4G3DA 4TYGA 4D28A 2IJMA 3G6GA 1UU3A 5CF4A 3LZBA 4JBPA 3ZFYA 3DJ7A 3NUSA 5HU9A 3DJ6A 3CY2A 3UOLA 3I79A 3T3UA 5JRQA 4EC9A 4XNEA 2YITA 4DEIA 2IZTA 5CSWA 3W2CA 3UPZA 5IEXA 2QHMA 4FKSA 4KNBA 4UXLA 5CVFA 2NRYA 3BX5A 3Q04A 5DT0A 4CCUA 5A9UA 3RAWA 4DT8A 3A60A 3O8PA 4ALUA 3FHRA 5CASA 2QKWB 4FSRA 5TT7A 3KXZA 3QQHA 4FTKA 3QLGA 1R0EA 4FKPA 4K11A 2X4FA 3MVMA 3RPYA 4AZEA 3ZSGA 3R6XA 4IIRA 2PVNA 4EHGA 5M4FA 2OSCA 3QGWA 4L7SA 4FSYA 4R5SA 4ZTSA 4FE2A 5L8LA 5TF9A 3VS0A 3LKMA 5BVDA 3DB8A 1TFFA 3R9NA 2R64A 4CEGA 4QQCA 2BHEA 4IAYA 5BVFA 2H34A 4DGNA 3LCTA 5I9YA 4W8DA 2ACXA 5DRDA 4C2VA 3CTHA 3DNEA 4EUTA 5IISA 2C5VA 4ZTNA 1YHSA 2H8HA 2YM5A 3Q4UA 4FV4A 2CPKE 2KULA 2R7BA 3EQRA 2QVSE 2UUEA 4YLKA 5HBHA 5L8JA 3AD4A 1U54B 4FIJA 5L4QA 3GQLA 4F6WA 3AC4A 3ZFXA 5K5NA 4DYMA 4FV0A 4TPTA 4PTEA 1OL1A 3DZQA 3D7TB 3RTPA 5ICPA 2BZHB 3SXFA 4DEGA 3Q2JA 2FUMA 4J71A 3V5QA 4FI1A 4AACA 4YTFA 4XBUA 4AX8A 2BFYA 3UBDA 4MXYA 1JSUA 4BI1A 1GNGA 2IZUA 4HGEA 2CGWA 1YDSE 4BIEA 2W05A 4L3PA 3I81A 3KEXA 2OXDA 3BI6A 1R3CA 3DB6A 3ORMA 4PPAA 4EEVA 2ZV2A 3BEAA 4L9IA 3V5TA 2PMOX 3O8TA 1BI8A 2XJ2A 1OPLA 3ZEWA 5BQ0A 3GNIB 5BUJA 4FVRA 1K2PA 1XH8A 3O17A 4XP0A 2AYPA 4AGUA 2WOUA 2H96A 3PXZA 3CGOA 5BYZA 5JZNA 4USFA 5H9BA 4X3FC 5J1WA 1JLUE 2ONLC 3MTFA 3WZKA 2X0OA 5AA8A 4JDHA 3DBFA 3R7GA 4WRGA 3KB7A 4IE9A 5BUIA 1W98A 3O50A 4MXOA 1UNHA 4J99A 3PJ1A 3GU6A 4UYNA 4UX9A 2OIBA 3DBQA 4GCJA 5CZIA 4F9CA 2HZ0A 2YIQA 3A7GA 3QCSA 4NZWB 4E6DA 3EZRA 1KOBA 5HICA 2ERZE 4IX4A 4NL0A 3KC3A 3OC1A 4ACDA 4MEDA 4PUZA 5ETIA 3SXRA 3FC2A 2XS0A 3H9OA 3QWKA 3TKIA 3E7OA 4APPA 3THBA 4HOKA 4XG4A 5IPJA 1OI9A 4ZJVA 4FZFB 4R3PA 4DLIA 1Z9XA 2HCKA 5JFSA 4IBMA 5EH0A 4KAOA 5IH4A 1RE8A 2JD5A 4FV3A 2JIUA 4FKJA 1LEWA 3E64A 3A62A 3VIDA 3TDVA 1H0WA 4CRSA 2JGZA 2WMQA 2PVMA 1VLRA 3D9VA 5FDPA 5HX6A 4WA9A 4G3FA 4AXCA 5CU2A 5HO8A 3DKFA 4Z7GA 5E91A 2QOKA 3PVWA 5KZ0A 4X6QC 4TL0A 2VTOA 3KF4A 2XZSA 5CU0A 5FUTA 3EB0A 2B4SB 3BV2A 3ZBXA 4ZTLA 3RINA 4LOOA 4RIOA 5IUIA 1OL6A 3FYKX 1ZOHA 4X2NA 3EN6A 5HG9A 2WOTA 4AWIA 2X6DA 5JEBA 3DOGA 4NFNA 4ZTRA 2ZB1A 2W99B 3AOXA 3HMNA 2XCHA 4QP1A 2VWXA 2JIIA 4OTQA 3PY3A 4ZS0A 5GJFA 3TG1A 4L8MA 3H0ZA 3M11A 1UU8A 4TN6A 3SKCA 2FB8A 1YXVA 3W2SA 3FQEA 4E7WA 4RWJA 4EOJA 3CXWA 2OFUA 2RL5A 3OUNB 4FG9A 4WUAA 4FTTA 3AGMA 2WIPA 4M66A 3GFWA 3JVSA 4M15A 4QMOA 4RX7A 4GFMA 4BF2A 4DH5A 3GC9A 4DHZA 5HG8A 1MRUA 3OP5A 4G17A 4R7HA 3ZSHA 5DT4A 5KMKA 4O86A 5L2IA 3R01A 1XR1A 2QOIA 2UW3A 4KA3A 4QYFA 3UC4A 1Z57A 5LMKC 3LMIA 1P2AA 4C37A 3BHTA 4O0RA 4CD0A 3HV5A 3PRIA 5I9WA 1OKVA 3EN9A 4L01A 1Y6BA 2JKMA 3BQCA 3F6XA 3LFBA 4CFNA 2UW8A 4QMUA 4QPMA 3PE1A 4ZZOA 2WKMA 5BVWA 5KZIA 3S0OA 2WMUA 2ZVAA 3D2KA 5CSHA 1FGIA 4L6QA 4XBRA 5I3OA 3PP0A 1PXKA 4FSNA 4O7NA 2HZ4A 4ZSGA 4C58A 3VJNA 2Q0NA 3VHEA 2WQEA 4UXQA 4HNIA 3G2FA 2B53A 5EK7A 1WCCA 4C2WA 3KULB 4EH4A 2XKFA 4CT1A 4EYJA 5L6OA 1UNLA 3U51A 3OVVA 1P4OA 4IX5A 4OT6A 3GU5A 3QX2A 2QOLA 4N4SA 4EOMA 1X8BA 2GTNA 3BU6A 2YABA 4QP7A 1KE5A 3QRTA 2R2PA 5HHWA 2OFVA 4M84A 3PVGA 4A9RA 3LXLA 1YVJA 1QPCA 2X2MA 3VS5A 4PDPA 5IZFA 4WUNA 3NAXA 2YLFA 5A46A 2ZDTA 1PF8A 5B7VA 2R4BA 4RJ3A 1JWHA 2R3KA 3W18A 4BCNA 2WGJA 4CFFA 2OZAB 4AAYA 1M52A 4Z7HA 2VWWA 3D15A 4CV9A 1PMVA 4U0IA 3HV4A 4D5HA 4WRSA 2HENA 5AV1A 4BCQA 2R3OA 3EN4A 5CTPA 3A7IA 3REPA 3C1XA 5LMBA 3G5DA 3ZO3A 2E9VA 1CTPE 5L2TA 5HEZA 3SW7A 1J7IA 3QA0A 4XRJA 4LGGA 3DK3A 3AMBA 3CTQA 3LFDA 2OJIA 2W5HA 3NEWA 1STCE 1ZOGA 5E1SA 4OTDA 2V62A 3QD0A 3QC9A 4I1ZA 4RJ6A 2RIOA 3NLBA 4ASXA 4ZY5A 4J7BA 2Z7SA 4EOLA 4GEOA 3ZLWA 1ZZ2A 3LQ3A 1XHAA 3OS3A 4PF4A 4M67A 4E26A 2XK8A 3UIBA 1SVGA 3HUBA 4JBQA 5ANDA 1J3HA 3U6JA 1PXOA 4K1BA 5GHVA 5JH6A 3V6SA 2F2UA 4WOVA 3W55A 2EUFB 4IWDA 4IWPA 4YHTA 4OTPA 4EYMA 2VU3A 3EQHA 3NUNA 4FTIA 2KTYA 4ZXTA 4DFLA 5CSXA 3COMA 5J5SA 4CTBA 4XV2A 4IFCA 2YCSA 4TYIA 4ZAUA 1XH5A 2P4IA 4A9YA 3S00A 3FC1X 2QLUA 3QQGA 2VGPA 4C62A 3MWUA 1RQQA 2WTCA 4FRFA 3TNQB 3FZ1A 4PL4A 4XRLA 3OW4A 2OIDA 3NNVA 1NY3A 2WMVA 4LQMA 1XH4A 2PYWA 1PMEA 4ZOGA 4BCIA 1IA8A 1ZYDA 3PXKA 2X2LA 4HZRA 3R1QA 4AN9A 4ANOA 4AN2A 1IR3A 3IDCA 2R3HA 4GK3A 4U6RA 1XWSA 2UW5A 2W1HA 4IW0A 3T8OA 4M14A 4BDBA 2QHNA 3BYVA 4D1ZA 5AR4A 5HQ0A 2GHMA 5IA0A 5CSPA 5DT3A 4GKHA 3PFQA 2CLQA 3V5PA 2YWPA 2VWVA 2CGUA 2OZOA 5CF5A 5KMJA 5H3QA 2WTKC 2PL0A 2Y0AA 1R0PA 4U3ZA 3Q6WA 1T45A 2YM6A 4KIOA 4S30A 4MXXA 4JI9A 4H05A 3W2OA 2R0UA 3ZEPA 3BYUA 4WT6A 4FIFA 4NKSA 3DDQA 1ZYLA 4FF8A 4MBLA 1PXJA 4TYEA 4E73A 3C51A 4LYNA 4C0TA 5CF8A 3OMVA 4HNFA 4GRBA 3RBWA 4E4LA 1H1RA 2R0IA 4X3JA 3RJCA 3PA4A 4FOCA 1YRPA 4O2ZA 3RK5A 4HW7A 5AP5A 3ITZA 2IPXA 1ATPE 3QZGA 2BRBA 2HXLA 3PG3A 4JDJA 3NCGA 4YZCA 3OT3A 5EDPA 4CKIA 3NUAA 5F94A 2PVHA 4IAAA 1ZAOA 5HIBA 5AAFA 3ZZWA 3FJQE 1G8SA 3IS5A 4YZ9A 2YWVA 2O5KA 4O7TA 2J9MA 4JQEA 2XP2A 1TZDA 4FMQA 4Y5HA 3S95A 4KBKA 2WU6A 3HVCA 5G6VA 1B6CB 4MK0A 4Y73A 4FL2A 3HEGA 4KIKA 3EL8A 3OD6X 5AJQA 3GCUA 3F5XA 3IDPA 4HYSA 3LM5A 2DS1A 4E5AX 4L45A 4GYGA 4O7YA 3OCBA 4A9TA 4YJQA 3UDTA 4XEYA 1KE7A 3A2CA 2GDOA 4I24A 3VS7A 4QMSA 3LQ5A 4FEWA 5ACBC 5GZAA 5TOZA 3NDMA 4DF3A 1YOMA 1JQHA 3PA3A 3VQUA 3IPHA 2JIVA 3KGAA 3WF7A 3EQGA 4CGAA 3OTUA 4FNYA 1NVSA 2GQSA 3UNKA 4Z55A 3W0QA 3RWQA 5LVPA 5I0BA 2Z7QA 3EKKA 3NUXA 2JITA 4O1OA 4X6RA 5AP7A 5IDNA 2VWUA 3ENMA 4G31A 4XG2A 4NCTA 2WTVA 3UJGA 1XQZA 4RIWB 3QXPA 1NVQA 3D5VA 4EH8A 5E92A 3FLNC 4PMTA 3P7BA 3CE3A 4PNIA 3V3VA 4JBOA 1ST4A 2X7GA 3M2WA 4YNOA 5LVOA 4GU9A 3MVJA 1ZMVA 2VNWA 5GZ9A 3IG7A 3ORTA 3ZCLA 5LVLA 3KXGA 4EHVA 3W0MA 4LMUA 4BN1A 1NT2A 2YCFA 4RIYA 4IB5A 3MFRA 5EW3A 3RAIA 4FKIA 3BL9A 2XB7A 4Y85A 2PUNA 4QTCA 2C1AA 2GS7A 3FI2A 4OTHA 5KO1A 5EQPA 4LUEA 5IMEA 4DFBA 3QTRA 3R21A 4RJ8A 2O64A 2XM9A 2W1ZA 3OOGA 2WMRA 3TZ9A 3UE4A 3TMOA 3D5XA 4LV8A 5ANIA 4W9XA 4G6NA 4PP7A 4AGCA 3LLTA 4XHKB 4BTMA 4G3GA 1UU7A 2C6TA 3II5A 3PP1A 4EOQA 3R8PA 3D5WA 3NYNA 3S3IA 5DG5A 2B0QA 2BUJA 1F0QA 3AKJA 5LWMA 1PYXA 4F08A 4L3LA 5F95A 1G5SA 3MA6A 1Q8ZA 4JDIA 2ZDUA 3H10A 4Z9LA 4NKAA 3KXNA 2IW8A 3OF0A 4Q9ZA 4G34A 4RJ5A 4BCFA 4UMRA 3HECA 2VWBA 1BL6A 4L3JA 3ULIA 3C4CA 4BZDA 4EH7A 1FPUA 4HCTA 1QL6A 3P4KA 1ZARA 4BDJA 4MD9E 4EK6A 1FINA 4BCGA 5KNJA 1OUYA 1YHVA 3L9NA 3PA5A 3ZXZA 5HCXA 3AC3A 4FV9A 1WBVA 2B9JA 3OCSA 4QT1A 5DR9A 3GU4A 2QQ7A 1Q3WA 3TKHA 5JK3A 3PDTA 3E63A 4J8MA 4ITHA 4XX9A 5AUWA 2PZ5A 2J5FA 2JDOA 3CTJA 2XANA 4KRCA 2RFDA 1OIRA 1RDQE 5CT7A 1PMUA 2C1BA 4N57A 1UNGA 4QTAA 2Z60A 4FV5A 5FDXA 2NPQA 2OGVA 3VONA 3R63A 5HIEA 3AG9A 5AIKA 5CVGA 3KVXA 2PE1A 3CJFA 5CXHA 5EDRA 3QRIA 1BKXA 1OKZA 3MB6A 2XNGA 1M7QA 4DH1A 4YR8A 5IQAA 3DBEA 4I23A 4A7CA 5E4HA 2QU5A 3KU2A 2OI4X 3R22A 3C4XA 4F99A 3I6UA 2BHHA 2JDVA 5HD4A 3KY2A 2BIYA 2C5XA 2P2HA 4DDIA 3QCXA 2XNMA 3FEGA 3VBYA 2J0MB 3R7IA 4AGDA 4FL3A 3QTQA 4GL9A 4R7BA 3QTUA 4HCVA 4GIIA 4YBJA 3UZPA 2W4KA 3LCKA 4QTDA 3W2QA 2HW7A 3ROCA 4CFMA 4JAIA 1Q61A 1XMMA 5EHYA 3A7FA 3Q4TA 2DUVA 3KA0A 4QP2A 1U5QA 3LMHA 2OW3A 4D58A 3KXXA 3Q53A 3IW7A 4O21A 2IZRA 4BDCA 3ODYX 4YJNA 4E6CA 4DBXA 2XK6A 3GCSA 3CS9A 5DA3A 5C8NA 4D4VA 1UKIA 2WQOA 3QTWA 1XBCA 4MH7A 4XG7A 5CNOA 1SNUA 4UWYA 2OJJA 3DFCB 2I0VA 5HIDA 4XG6A 3FKNA 4YO4A 2C6IA 5CQUA 1TQIA 4FT0A 5FLFA 4E4XA 4KWPA 1KE8A 4RIXB 4OBPA 4UV0A 4EZ5A 4ZTHA 4F4PA 2R3MA 3H3CA 3LPBA 4W4XA 5E8ZA 5TKDA 1WFCA 3HDNA 4DEEA 4YTCA 2GNIA 3UVRA 4IAIA 2Y4IC 3MN3A 1H8FA 4MVFA 1U54A 3B2TA 3KN5A 4D55A 4CRLA 3DAKA 5FP5A 3U9NA 4D9TA 2A19B 3NW7A 4EONA 4ZS4A 4AN3A 1ZMWA 2VO3A 3VQHA 3D7TA 4CZTA 4IC7A 4QMLA 4A4LA 1JNKA 2UZEA 3R7YA 4WNOA 3R8MA 3R7VA 3BELA 4A4OA 3KN6A 4DG0E 5J1VA 2BKZA 4AGWA 3W0PA 2OJFE 1H00A 4I5HA 4OW8A 3RK7A 3IW4A 3BYMA 5HNGA 4IVDA 1O6KA 4O0UA 3KK9A 3LXNA 4W4VA 1H1QA 3ACJA 1DAWA 3UIXA 2IVTA 4FZ6A 4I0TA 5FBOA 4F09A 2J0KA 4CYIA 3CPBA 1YWNA 4F6SA 4TXCA 3G0EA 2LAVA 4I6BA 4M12A 4E4NA 5IEVA 3ORZA 3TM0A 2W9ZB 2J0JA 4NK9A 3L8PA 2XMYA 1W82A 4WO5A 4UB7A 4ACHA 5CLPA 4FKLA 3NRMA 4XV9A 5K5XA 3AC1A 5HO6A 3F3VA 4YO6A 4LL0A 3RALA 2UVZA 5EHOA 4G6LA 3R1NA 2XK7A 3WZEA 5CVHA 4RQVA 3D94A 2XYNA 4JIKA 3AT3A 4RT7A 4U5JA 3FI8A 1RW8A 1ZZLA 1WBOA 3TIZA 3NW6A 5LJJA 2UZLA 4AFJA 2UZVA 3IOPA 5CYIA 5EW8A 5IA3A 4HYIA 4X0MA 1NVRA 1P14A 1OKWA 4L00A 4BCPA 3C13A 4CMOA 2Q83A 2ITXA 5EQYA 4QYEA 3DXQA 5HLPA 2FH9A 1OL7A 2YDKA 3N4TA 3RM6A 5CU6A 2QONA 3V5LA 4E4MA 4BI2A 3VJOA 2Y6MA 4BBFA 3ORIA 2XKCA 4M13A 1TQPA 4RMZA 3W8QA 4RC3A 1VYWA 4ARKA 3F5PA 3F3TA 4FV8A 1O6LA 3PWDA 5HVJA 4BHZA 3EQCA 3BBTB 3IOKA 3ZDUA 5A4CA 3OZ6A 4DG2E 4F1TA 4D2PA 3ALNA 4FVQA 2WQNA 3Q60A 4TNDA 4RFMA 1HOWA 2YDJA 5EYDA 4E1ZA 5AR2A 4EQMA 2QLQA 3R8UA 3GC7A 3D4QA 4UZHA 1F3MC 5FBNC 4YZBA 3ETAA 3UTOA 4F7SA 3FZRA 4IADA 3DU8A 5HVYA 4BKJA 4K2RA 3GU7A 2PPQA 2XIRA 4G9RA 4J98A 2UZTA 4K18A 4PL3A 4PDSA 4CSVA 5M44A 3K2LA 3CQUA 3TUDA 1M2RA 4BGQA 5KHXA 4JXFA 5IF1A 4BBEA 5CI6A 5M57A 3BWFA 4O4FA 1M17A 4MD7E 4G2FA 2J0LA 4QYYA 2ZM4A 3R04A 4AE6A 3ALOA 3LVPA 3VS6A 4JRNA 5AEPA 3VC4A 5C4KA 2ETMA 3EQFA 4U80A 4WG5A 3CD3A 3ANQA 2ZYBA 3TV4A 5JFXA 2BKKA 5BVEA 4QOXA 3JUHA 1LUFA 4E6QA 2OWBA 5D9HA 2X39A 4GYIA 4X2JA 5FGKA 4CG8A 4ZZMA 1WVYA 3RWPA 4FNWA 5BVNA 2PMLX 1YQJA 4K6ZA 3ML1A 1WMKA 5GIPE 4U7ZA 3V01A 2PMNX 4UYAA 3O8UA 4CYJA 2JAVA 1R39A 3L1SA 5AWMA 3QUPA 4RLKA 4C34A 4W8EA 4ACGA 4GH2A 3F66A 4J1RA 4QQJA 1FBNA 2Z2WA 1I09A 4DEHA 4I6FA 2OIQA 2CKPA 2PZYA 3SW4A 5BMSA 5ANGA 3BGPA 1GY3A 1ZXEA 3IW5A 3PXFA 3I0QA 4AT3A 4BHNA 5BUEA 4D2TA 5CEKA 4HVGA 4YJUA 2BAKA 5AV4A 4WNPA 2IW9A 4USDA 3DA6A 3E88A 5DOSA 4I94A 5HZNA 3TUBA 1QMZA 4FJVA 3KULA 3ZO2A 5B2KA 3G0FA 4FSWA 5JGAA 2GNLA 4FTUA 3MY5A 1YXXA 3PY1A 4EI4A 3FYJX 2A98A 3I7CA 3AQVA 4O7ZA 3HA6A 1Q24A 3KRLA 4R3CA 4BDFA 2YCQA 3MIYA 3FWQA 4P90A 1OECA 3NVKI 3BIZA 4FG8A 4NIFB 4V0GB 4PTCA 4QRCA 1ZY4A 4QMTA 4C4HA 4GIHA 3PG1A 4AXDA 4YP8A 1H08A 3DFAA 5CEPA 1LP4A 4TKSA 1MRYA 3C9WA 5KKRC 5L8KA 2ZM3A 4O0SA 2G2FA 4Y83A 4QNYA 3RNIA 3E93A 3ZH8A 2C47A 4HCUA 2A0CX 3CSVA 4O4BB 5ANEA 3TKUA 3SAYA 5HTCA 4RBLA 3PXQA 1H1SA 3JXWA 4NYEA 2F4JA 3RNYA 4RPVA 5DYJA 2B1PA 3AMYA 3TIYA 4BDKA 4FA2A 2B54A 3SHEA 3NR9A 2CKEA 3ZLSA 2W5BA 4Q9SA 3PIXA 1LPUA 1OL5A 4YSMA 3QQKA 4IZ7A 4IAZA 4AW1A 2JBPA 3LQ8A 4RQKA 1JOWB 3OTVA 3K54A 5ETFA 3SLSA 4U3YA 3FV8A 1V0BA 3E8DA 4CFUA 3QXOA 1Y91A 4O81A 3F5GA 1SZMA 3FL5A 2A4LA 4NCTC 4CZUA 3PRFA 3WZJA 3PSDA 3VW8A 1ZWSA 5KMIA 3NFFB 5AV2A 4FX3A 3ZDIA 4FSUA 4CFWA 4EL9A 1REKA 2E2BA 5AUXA 2RSVA 4PMSA 5A6NA 4P7EA 4H3QA 4U8ZA 3NNWA 2GS2A 3NW5A 5CANA 4LDTA 3W16A 4C57A 3OUKA 2YM8A 2IZSA 5EYKA 4DGGA 4F9BA 1RJBA 2C6EA 4FK3A 3V5WA 4O82A 4N6YA 3F7WA 2XALA 5DR2A 1E1VA 2B55A 2XNOA 4O4DA 4FKTA 4FSQA 4GG5A 1XBAA 5AP2A 4TZRA 1JKLA 2UZUE 3NNXA 5T3QA 2VTMA 2ZMDA 3EFLA 4LRKA 4R3RA 4BC6A 3ENHA 4BGHA 4O0XA 4O6EA 3SA0A 2UW4A 3WF9A 3WF6A 4MXCA 5EOBA 3O5AA 4QDEA 2XF0A 4WKQA 5HLWA 5IA2A 1GIHA 3H30A 2OLCA 1W83A 2BR1A 3DLZA 2ITZA 3EFKA 3QRUA 3RCJA 5IA5A 2VTAA 4ASEA 5E8XA 5K9IA 3PWYA 1E1XA 2XNNA 3WE8A 2FSOX 3FXXA 4EBWA 4MF1A 4UWBA 2H6DA 3HRFA 1YW2A 4ZY6A 4PMMA 3IO7A 2YJSA 4ACCA 3ORXA 4BKYA 4YSJA 1OIUA 4MF0A 3AXWA 1E9HA 3ZUTA 2PVYA 3UVQA 3KF7A 5AUZA 5EKNA 3VS4A 3PVBA 3S2PA 5I5ZA 1VEBA 3V51A 3AKKA 4BCOA 5AP4A 4YBKA 3Q4CA 2VTTA 3UP2A 4O7SA 4TNBA 5H8EA 5I3RA 2XIKA 4Q2AA 3NFGB 3TJDA 5D10A 4DTBA 3VUKA 3CPCA 3FLSA 2UW0A 4IANA 1O6YA 1PKGA 3R7UA 2C3JA 3TNPC 3VBWA 5JRSA 3NMUF 5JMSA 4B6LA 5A14A 1WBTA 3UDZA 2A2AA 4JDKA 5E7RA 3DKOA 2JLDA 5FEQA 1FVRA 4G3EA 3QYWA 4MQ1A 3LFEA 3ZZEA 2BMCA 5B2MA 2WIHA 4DCAA 2NRUA 1J7UA 5IEYA 4BY9E 1J1BA 4U79A 5C1QB 5FEDA 4UMPA 5AAEA 4TWOA 5LVNA 4LV7A 3PJ2A 3NIZA 3WF8A 4BCJA 4K77A 2Z8CA 2YCRA 2ZM1A 2ZV9A 3MVHA 3PE2A 2PUIA 3W0NA 2IWIA 4EK3A 5KUPA 2O65A 2CCHA 3L9MA 1FOTA 3SV0A 2WFYA 3CBLA 3OXZA 4L52A 4PDOA 1IAJA 2ITPA 2IW6A 2R3IA 3ODZX 1KV2A 4FODA 5CEMA 4QQ5A 2VX1A 4D4RA 4XG9A 4O1PA 3IKAA 5AUVA 5C01A 2WO6A 3R8LA 3W1FA 3ZHPC 2W1EA 5DLSA 5EYMA 4FZ7A 3KL8A 5CAQA 2WTDA 3NUYA 3TNWA 1OM1A 1J1CA 4XOZA 3DCVA 4I5MA 5EM6A 3UP7A 2VO7A 3FMMA 4FNXA 3A61A 2WMTA 4A4XA 3GXLA 4RC4A 4XG3A 1CDKA 2VTJA 3O51A 5F1ZA 4RIWA 3JPVA 4HVIA 4IX3A 5HE3A 1WZYA 4WIHA 1WVWA 2FSMX 3A99A 2W17A 5AR7A 4UMUA 4M0YA 3VUHA 4F6UA 2XCKA 3U54A 4TYHB 3L8XA 5A3XA 2CDZA 4FTJA 3UOJA 3JS2A 3KMUA 4O6LA 4QMVA 3PSCA 5DGZA 4ANMA 3V04A 3Q96A 2Z02A 3MH3A 3ATTA 4G5PA 4A06A 3RP9A 2W5AA 3KCFA 2X0GA 4GW8A 4JRVA 4XG8A 4C8BA 5IUGA 2W1DA 3R7EA 5AP0A 1YI4A 2J2IB 1BMKA 3O23A 3QZIA 2GMXA 5D41A 4W4YA 4HPUE 3E8CA 1H1WA 4RZVA 2VTPA 3HA8A 4LGHA 3EQDA 2BRMA 3UNZA 4EOIA 4ZSEA 1SYKA 4RJ4A 5DN3A 4ENYA 2YACA 3GB2A 3JY0A 5IG1A 4USEA 5FWKK 3JVRA 5CAUA 3F3WA 2VN9A 4IB3A 4R6VA 4NU1A 2HY0A 2I1MA 3D2IA 4M8TA 4ALVA 1KOAA 3DKCA 3G15A 4ZSJA 2ITVA 5DE2A 4P2KA 4YLLA 1PMNA 4FT7A 3OBGA 2QG5A 4KRDA 3OG7A 3ROYA 2BTSA 2OU7A 4EHZA 5AA9A 4IZ5A 3PPJA 1ZY5A 4R5YA 1JKKA 4FT5A 4S34A 2YM4A 4FZAB 4RRVA 3CY3A 3BHYA 3R83A 3HUCA 2ZMCA 4C33A 1IG1A 4YHFA 5E8WA 3G9NA 4BGGA 1U46A 3C5UA 3GP0A 3CQEA 3ZO4A 5DI1A 3QD3A 2CN8A 4M69B 4Y8DA 3SDJA 3CP9A 3HMMA 5CEQA 4O22A 3QRKA 5ANKA 5C8KA 2FGIA 4CMUA 1G8AA 4G16A 3U6HA 1GIJA 4U81A 4HGSA 3RMFA 1APME 3DDPA 3SG9A 3EHAA 4B0GA 3ZRLA 3MVLA 3GI3A 3QWJA 1W2CA 2X0QA 2WTWA 4AOJA 3S1HA 4V05A 2E9NA 2XIZA 4LV5A 3DQWA 3GBZA 4XLIA 4I6QA 5CEIA 4JG8A 3EN7A 2YAKA 4D2RA 5GINE 4CNHA 2Y6OA 3VW6A 2OO8X 5M06A 2Y7JA 3QBNA 4BCHA 4H3BA 3F9NA 3V8TA 2QOQA 3AKLA 4DFYA 3FUPA 1BX6A 2YM3A 3Q6UA 2JEDA 3VBQA 3CCNA 2OJGA 4TRLA 4DCEA 4E6AA 3F88A 1Q5KA 1Q4LA 1W84A