2PE1A

Crystal structure of human phosphoinositide-dependent protein kinase 1 (pdk1) {2-oxo-3-[1-(1h-pyrrol-2-yl)-eth-(z)-ylidene]-2,3-dihydro-1h-indol-5-yl}-urea {bx-517} complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
275
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Indolinone based phosphoinositide-dependent kinase-1 (PDK1) inhibitors. Part 1: Design, synthesis and biological activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pe1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pe1A01
3JS2A 1QPDA 5IEYA 4GIIA 5HNGA 4BVUA 1WBTA 5HG8A 2BZKB 4EOJA 5L2WA 5E92A 1VR2A 3L9PA 3GXLA 3IDPA 2C6KA 4IHPA 4RC4A 3P7CA 5AX3A 3QHRA 1Q8ZA 4U41A 3UZPA 2X4FA 2Z7RA 1WBOA 1WZYA 3NLBA 3VUTA 4EZ5A 3WF8A 3COMA 1J1CA 4DG0E 2C6OA 2EXEA 4M15A 3Q4CA 2OW3A 2ZOQA 4IBMA 2KULA 2W17A 3DNDA 4QQ5A 3WF5A 2BKKA 3NVKI 4UMTA 4CTCA 2CN8A 2WIPA 1ZRZA 4O81A 5J5TA 3LE6A 5E4HA 4W9WA 1J7UA 1XR1A 2YA9A 4X2NA 4S31A 4XOZA 4G9CA 2BAQA 5CSVA 4DFUA 3QRUA 3CQWA 3IW7A 3CS9A 4RFYA 4D1XA 3FUPA 4E4LA 2GHLA 2QR8A 3PZHA 4XJ0A 4C4HA 1Q8TA 4R7HA 1KOAA 2YM7A 4AGUA 4BBEA 4IFGA 5CU6A 3K5UA 2YCFA 2UVYA 3EYHA 3Q96A 4UV0A 1QPJA 3E5AA 4IDTA 4XG8A 4C2WA 4YR8A 4WO5A 3RAWA 5LXMA 5TE0A 3WBLA 3WZDA 1H08A 1Q4LA 3BYUA 3ZXTA 4TYEA 4XNEA 2BUJA 2XBAA 3TXOA 4KS8A 3W2SA 3LVPA 5EYKA 5EQPA 3EKKA 4L8MA 2ZYBA 5L2QA 4XP3A 4IAZA 2PE1A 3BU6A 3FY2A 3WYYA 3LPBA 4CQEA 3NYOA 5BUIA 1UNGA 2F57A 4IC8A 4GSBA 3AT2A 2GNJA 3LFQA 4EUUA 5IH5A 2FH9A 4QP8A 4FKVA 5EW8A 5HKMA 3R8UA 3UOHA 4NM3A 4QP7A 2EUFB 3UG1A 4F7JA 2CN5A 4JBVA 2A0CX 4G5JA 5EYDA 5DRDA 4CFXA 4K18A 2OBJA 4RG0A 3QRIA 4H3BA 3HRCA 2PZPA 4I1ZA 3AMBA 3RHKA 3LXPA 3RKBA 3V8WA 5IUIA 3TCPA 3HUBA 4TKSA 3KU2A 2ITOA 1IG1A 2CGVA 4D4RA 3FKNA 5EYMA 4PMSA 5BYZA 3PVBA 4FTNA 3EL7A 4AZEA 1BX6A 4YUQA 2C3IB 4GYIA 1PXNA 2OJGA 5CVHA 3PP1A 1OB3A 2ZB1A 2PVYA 3NWWA 2Y0AA 3QCQA 1ZMUA 3CGOA 4J53A 3EQHA 2WEVA 3ITZA 3EKNA 5ETCA 3RZFA 2J5FA 1IAJA 2GQSA 5JKGA 4EKKA 1VYZA 3FLSA 4JDIA 1PKGA 5F1ZA 3VUKA 2XRWA 3QQGA 1GJOA 4A9SA 5L8KA 3HV6A 2RG6A 4WBBB 4WG3A 3HRFA 5F95A 5H8BA 4FYOA 4B8LA 1XH4A 4PL3A 3FQSA 4QD6A 2GFCA 3GOKA 4JVGA 1J1BA 2B9JA 4GT5A 4BDGA 5IMEA 2A1AB 4ZY5A 4XG9A 4A9RA 5J8IA 4PDSA 3D14A 2XNEA 3A8WA 1FGIA 3LOKA 4YJVA 2IN6A 4O7RA 2WTKC 2UW8A 3MPAA 4RJ3A 1ZOHA 4EYJA 2WEIA 4AA0A 2RFDA 2RKUA 4AGCA 4BTJA 2PL0A 2BAJA 3W2OA 2RIOA 2VTTA 4F9AA 4XYFA 2PVLA 4Q9ZA 2XIYA 4AE6A 3UJGA 2V55A 4WRGA 3P7AA 4FKQA 2WXVA 1L8TA 4DT8A 2PUNA 2VWVA 5EDQA 4CKJA 1Q3DA 2I6LA 3HECA 3EFJA 2YCQA 4J97A 3Q53A 3PLSA 4NT4A 4CNHA 2DWBA 4ZS4A 4FVPA 5TOZA 4B7TA 2IPXA 4IANA 3MN3A 4I23A 3DY7A 5H3QA 5IF1A 4JDHA 2YIWA 5A3XA 2B0QA 3G0EA 4FODA 2YIXA 2QOLA 2AC3A 2P4IA 4OTPA 4CTBA 4Z7GA 5K3YA 2VZ6A 4CKIA 1UA2A 3FL5A 2J50A 2ETRA 3TZ8A 4AW1A 4LMUA 4DN5A 5FP5A 2ZDTA 4OT6A 5DEWA 3BBTB 4MBJA 2VV9A 3H0ZA 3K54A 3KVWA 1Y6AA 4DLIA 5LVOA 4TWPA 3LLTA 3UZRA 1RE8A 2YFXA 5AUYA 3RMFA 5B2LA 5J87A 4IAKA 2WQBA 5D9HA 4M97A 4L43A 4MVFA 2H9VA 3RNIA 4AE9A 2CKEA 3G0FA 4KWPA 4LGGA 5CEIA 4GT4A 3TTJA 5M56A 1FMOE 2VTJA 2XF0A 3ZBXA 4HYSA 4RFMA 3EQRA 3IKAA 3OF0A 4WUAA 5J95A 5BVEA 4BIBA 5LMAA 3FPMA 2ETMA 2KTYA 3IGGA 4X2GA 3RAHA 4ANLA 4PDYA 4E3CA 3LM5A 3QD0A 3P79A 3R7YA 1M17A 5ANGA 4DH3A 2YWVA 3UNJA 3PWYA 4PX6A 1YQJA 4ZXTA 1RJBA 4OTWA 4M14A 3U4UA 4D2SA 1LPUA 4M69B 4RX8A 5JFXA 3DFAA 1JKKA 3KA0A 3UIBA 2UZTA 5FEQA 3OROA 3T3UA 4JNWA 4D4YA 3PJ8A 4FICA 4GFOA 4J95A 3W33A 4J52A 5GJGA 4QP3A 4FKRA 4KAOA 4IAAA 3WIGA 2PZYA 2OIDA 3FQHA 2X6EA 3ORPA 4FZFB 1DS5A 5ACKA 2ZM1A 1CDKA 3DA6A 5L8JA 5M07A 4I5HA 1W98A 3R7GA 3R1SA 5BUJA 3A4PA 3PXQA 3MFTA 4QPMA 2B55A 4CFFA 3TEIA 4H3PA 4ZLZA 5KKRC 4G2FA 3G51A 3KFAA 3W2RA 4BYIA 4NYEA 3O8PA 5FTGA 1H8FA 1ZYCA 3UBDA 1U4DA 3HV7A 3LFFA 3GCVA 5I9YA 2UV2A 4O0XA 4OTRA 4RC2A 2UW5A 2WOTA 4IJ9A 4F0FA 4B4LA 2PVJA 4FSQA 4JT3A 3MVJA 4LGHA 5EW3A 3A7GA 1CTPE 5AUVA 3NSZA 4CRLA 4R1VA 5E8UA 2C30A 1U54A 4FKOA 2DS1A 2QD9A 2QU6A 4XX9A 4XOYA 4IM0A 2VRXA 4Q2AA 4H1JA 2VTLA 4IADA 4BI0A 4II5A 3VS1A 3F2RA 4L3JA 5DFPA 2BVAA 4FEUA 4FE2A 1NY3A 2XEZA 1ATPE 4JLCA 4N4SA 3ZBFA 4CFMA 2EVAA 4YNEA 2R3JA 3WF9A 2V7AA 1B38A 5E8VA 1Q97A 5IQBA 4NSTA 3I7CA 1U59A 1NA7A 3ANQA 3MFSA 3F7WA 2J0KA 4TN6A 5FTQA 1TQMA 4MXYA 4HYIA 3ZRMA 4M8TA 3RAKA 4F0GA 3F3VA 3W8LA 3UC4A 4C62A 3KRRA 2C5NA 2BDJA 4FC0A 4RX7A 4D28A 4Y8DA 3CQEA 4AU8A 4I93A 4MXOA 1UWHA 2PK9A 3B8RA 3RPVA 1BKXA 2WU6A 2VO6A 3A4OX 4YZ9A 5E8XA 3WOWA 1NW1A 2PUPA 5DYJA 2C3JA 3BIZA 3MJ1A 4JIAA 5IU2A 4WNPA 1G8AA 4WNKA 3QYZA 4JBOA 5A14A 5LCJA 2ZV8A 5LCKA 2WTCA 5AM7A 2BDFA 4HCUA 2B9FA 2QHNA 3T9TA 2YLFA 2J0JA 2C0TA 2UZEA 4WKQA 5HCXA 3OFMA 4ACCA 4J8NA 1TQPA 3TIZA 3D2KA 2X7GA 3VF8A 5LVNA 5KMKA 4U0IA 5KMNA 4NH1A 3PUPA 3QWKA 4D9TA 3ZO4A 3ATTA 1P4OA 2VU3A 3A60A 5M51A 3DCVA 3KRXA 2G1TA 4BCHA 2Z60A 5IQIA 4O0VA 4DAWA 4UBAA 4IAYA 3FMKA 3UNKA 1XJDA 4QMMA 5IDPA 1KE7A 4AZTA 5C8MA 3JR1A 2P0CA 3MFRA 4IDVA 4MQ2A 4TT7A 4RJ5A 4ZSGA 5HGIA 1F5QA 2WTIA 4L6QA 3N4UA 4ZTRA 2I0HA 1XH5A 2WELA 4FX3A 4JR3A 3BLHA 4O96A 3CXWA 1U5RA 1R0EA 4A9YA 4AS0A 2OXDA 4G6NA 3RAIA 3DDPA 1IRKA 3QCSA 4TNDA 4AACA 4D0WA 1UKIA 4AW0A 3I0QA 2REIA 3ORTA 4RIXA 3POOA 3U51A 1DI8A 3ZSGA 4HVDA 2CHLA 2H8HA 1PMEA 1Z9XA 3E93A 3DJ6A 3KULA 4UXQA 5FDXA 4JXFA 3Q9YA 3BQCA 4I6HA 4NZWB 4BDBA 4FIEA 4X6RA 3GC8A 1WMKA 1OPKA 3E8CA 3FZRA 1H4LA 5IA3A 4RT7A 2OJ9A 4FSUA 2FA2A 3RVGA 2F7EE 2PUUA 2YJRA 3NIZA 3DKOA 4X3JA 1PXMA 4EK8A 3OWLA 3P4KA 3FQEA 5EI8A 4NM5A 5AAEA 4QMWA 5CU3A 2W0JA 2JGZA 2Z2WA 4W8DA 5CENA 4EOKA 5LVLA 1KUTA 1AQ1A 3ORNA 3MSSA 2YJSA 4H05A 5BVNA 2F49A 4ALVA 3AXWA 4I5MA 2P55A 4LRKA 3ZSIA 3KXZA 2W1IA 5ANKA 3FI3A 3F5UA 4IM3A 4AGDA 4IM2A 4D4VA 3QHWA 4BF2A 3OCGA 3SG9A 1OUYA 1OKYA 3LM0A 3Q5ZA 3LJ0A 4TZRA 4UYNA 4A9UA 4E20A 5I4NA 5ETAA 4NM7A 3V5WA 5EK7A 3EZRA 5JRQA 3SRVA 5AR3A 4QMZA 2VGPA 3LFNA 2R3QA 4TYJA 2WTWA 4A4OA 4FKGA 3SDJA 2QO7A 4H3QA 4D9UA 4I0TA 4K0YA 1G8SA 2W1DA 2HWOA 4ITHA 4HVHA 4ZTSA 3UODA 3UOKA 2YERA 4CT1A 2PHKA 4I0RA 1G3NA 1GAGA 5HHWA 3U4WA 1SVEA 4OTQA 4ANMA 2JC6A 4S32A 3NNVA 3W2QA 2XVDA 3Q6WA 5AV3A 5C8KA 1JSUA 2OXXA 3NYNA 3WF6A 4A4XA 5CANA 3R73A 2VWZA 3OXIA 2JBOA 3DB8A 4QMTA 5FG8A 3SOCA 1IAHA 2WTVA 4FKLA 3V5QA 4L3LA 3VRZA 5EM7A 4KS7A 5KUPA 2WMXA 2Z7SA 3GC7A 4WIHA 3FXXA 5CYIA 4QP6A 2UZWE 3DB6A 1ZARA 3IECA 5B2MA 5JK3A 4YBJA 3QD2B 4L45A 4DEGA 4QRCA 1J3HA 2HCKA 1U46A 4EHEA 3FL4A 3LFSA 4BIDA 5CEQA 2OZOA 1RQQA 4GEOA 2QOQA 4M13A 5D11A 5L4QA 2VO3A 3UIMA 4C02A 2OFVA 4ZAUA 3V5JA 4E5AX 2YACA 2CPKE 3MWUA 3EFLA 4OTDA 4B9DA 4F7LA 4BKZA 5HTIA 4HGSA 3FI8A 3ORXA 1YHVA 5EW9A 4RFZA 1W0XC 4BZDA 1DM2A 4WA9A 5DVRA 2GS6A 4LV5A 2GPHA 1DAYA 4O0UA 4KIPA 3C5UA 2HENA 2BFYA 5A4QA 2JKQA 3H4JA 5DEYA 2GS7A 2J90A 3ZM9A 3R9NA 1OMWA 5HOAA 4FG8A 5CS6A 1Q8YA 4C4JA 2JDVA 2NRUA 3B2WA 4FIGA 4OBQA 5B2KA 3ZC6A 3QUPA 2XK9A 4FV1A 5AP5A 3WZUA 4BDAA 5CEKA 3IW8A 3MA6A 3MVHA 5EQEA 3L8PA 5JH6A 3TNHA 1YXVA 4P4CA 4FKJA 4RVKA 4NL0A 3F69A 3KKVA 3DBCA 3I1AA 5FBNC 4BKYA 5AR7A 5AP2A 2HIWA 1KSWA 4QQJA 5DBXA 4J71A 2VTHA 2R0IA 5HVYA 4ZTMA 1QMZA 2NNWB 1JKLA 3IW4A 4BTFA 4DG2E 1QPEA 4BCFA 4YU2A 2X7OA 1B39A 5HE1A 4FZ6A 1UV5A 4DA5A 4I4EA 3A99A 5D12A 1U54B 2RF9A 3ZHPC 5IA2A 2UZDA 3AQVA 5CAUA 4LV8A 1BLXA 4J1RA 4DGNA 3UQCA 1V0PA 3HUCA 4YNOA 2OI4X 3R22A 5HLNA 3ORZA 3O23A 5DIAA 4I21A 5JGDA 3I60A 2WTKB 4F6SA 4O83A 4QQCA 4B0GA 2O3PA 1GZOA 4AT3A 2VAGA 1W8CA 4L7SA 4LQMA 2XK6A 4PDOA 2PZ5A 5ANDA 3SW4A 1ZZ2A 3U55A 1Z5MA 3KGAA 3MYGA 3O51A 3R02A 5CWZA 4B6LA 1FINA 4QMXA 3HLLA 4BTKA 4G6LA 4O2ZA 1H1PA 2OICA 3AT3A 5KHWA 3GB2A 3QD3A 4RRVA 4BCNA 3O17A 5DHJA 5I0BA 2GNIA 3TKUA 5AR2A 5A4EA 2SRCA 1GZKA 4OTFA 5HICA 3MB6A 5HESA 4R8QA 5HG5A 1XQZA 4OTHA 2QODA 5JT2A 3WZKA 1YXSA 2ZB0A 3GEQA 4G5PA 5AP1A 5L8LA 3PY1A 4Y72A 3G90X 3LJ1A 3U9CA 2J7TA 3RPSA 2J2IB 4YTFA 3R8ZA 4FYNA 2XS0A 3C0GA 4USEA 4ZMEA 4XUFA 3L9LA 4FIFA 3UVQA 1O6LA 3BQRA 2Q0NA 5AP0A 4O7TA 4MQ1A 4O7NA 5HX6A 4A9TA 3QUDA 5K5NA 2WZJA 1YHSA 5D41A 3OOGA 2UZLA 4KRDA 5HIDA 5IA1A 4DTAA 3R21A 2ITTA 3Q6UA 2UW7A 2YIRA 4C61A 2X6DA 1MRVA 1ZY5A 1V1KA 3BGQA 3FYJX 3VS4A 2Y8OA 5J9LA 1OIUA 4NIFB 5HU9A 1YW2A 1MQ4A 1XWSA 3NEWA 4EZ7A 4FR4A 5AJQA 3EFKA 4R7IA 3H10A 3BE9A 3EMGA 3QRKA 3BE2A 3BGZA 4UALA 4ARKA 2XIKA 4ID7A 3OY1A 4U44A 4AZSA 2C5VA 3IDBA 4ZSJA 5HU3A 1JPAA 3RWPA 4ZY4A 2X7FA 3E3BX 4DH7A 4KUJA 5EOLA 5M4CA 1YWVA 4RIXB 4C37A 2JKOA 2C47A 3OZ6A 1CMKE 5B0XA 4FGBA 3DAEA 3PE2A 2R0UA 3FXWA 4NU1A 2OK1A 3VJNA 2HXQA 3KULB 3MS9A 2GNFA 4ZEGA 5IH6A 3N4TA 3C51A 5JRSA 3TWJA 4E6CA 3LMGA 3S2PA 4FBXA 1CKJA 2IO6A 4P7EA 4WNOA 5CAQA 2CMWA 3PLAE 2ONLC 3R04A 2X81A 2BIKB 4N6YA 5CY3A 5K0KA 4BCQA 4DH8A 4DEHA 4BB4A 3TV4A 2R3KA 1OL2A 5A6OA 2JIVA 1FBNA 2W5BA 4F4PA 3EB0A 2BTSA 3S4QA 3CKXA 4PPAA 3PRFA 1OKVA 3GU6A 3P9JA 3FSFA 2P2IA 2JAMA 3TT0A 2EU9A 3F5PA 3O96A 4MH7A 2R7IA 3BKBA 3IK3A 4KSPA 1M7QA 4GFGA 3TJDA 3VUMA 4BDHA 5BUEA 4IWPA 4A07A 5KKRB 3OD6X 4M7IA 4RVLA 2ITZA 2PUIA 1HCKA 5J1WA 3FHIA 2W1CA 1M14A 1Q62A 2WTDA 4XRLA 3T3VA 1ERKA 3P7BA 4JBQA 5CU2A 4CYJA 2VTSA 4KBAA 5H8GA 4AA4A 5DNRA 4APPA 1J7IA 4AN3A 3QTIA 3QU0A 4D55A 3IO7A 4EZ3A 1Q61A 4ITIA 2XB7A 4JG6A 4AFJA 3EJ1A 3DJ7A 3C9WA 3FLWA 3BEAA 4CFNA 1OL5A 4WHZA 2JDRA 5JQ8A 4EK3A 4IJPA 5AM6A 3HA6A 2QOKA 1PYEA 4G6OA 2BZIB 3R83A 1E9HA 4UMRA 4KKGA 2ZJWA 4CVAA 1YXTA 3G6HA 3O8TA 4OBOA 5EHYA 3K3JA 1VJYA 4JAIA 2PVFA 2YABA 1A06A 2IVVA 5AIKA 3EQCA 4GKHA 4ASZA 3LAUA 5D10A 5DR9A 3TZ9A 1T45A 4YTHA 1QPCA 2XUUA 3ANRA 3P23A 2GMXA 4HPUE 4IEBA 3QXOA 4QP4A 3KXMA 4WD5A 2YITA 3E7OA 4TW9A 4TYHA 4IWOA 4GKIA 2WQNA 2XNBA 4F0IA 3IOPA 5HD4A 2CCIA 4N57A 2Z02A 2BTRA 5K0XA 4M66A 3UP7A 5IQDA 2W05A 3Q4UA 2IWIA 2C1AA 2QC6A 3QALE 3O7LD 5M09A 2HZ4A 4Y46A 5ETIA 3WE4A 1IA8A 2WFYA 4TL0A 2YM8A 1UNHA 3IDCA 4FV2A 4RQKA 4UZDA 5GZAA 4AOIA 4EHZA 5AEPA 4E4XA 3QC4A 4EOQA 5J7BA 4OT5A 2W1FA 2GQGA 4QTDA 5AV4A 2GSFA 4G3EA 3D5VA 4LL0A 4OGRA 4UMQA 1R39A 1TKIA 3FSKA 4QMNA 4YC6A 2EB2A 4I92A 2BZJA 2XKFA 2C0OA 3ULZA 4RIWB 4YHFA 3FYKX 2HYYA 3KXXA 3LCOA 3M1SA 3D2IA 3PPZA 2XBJA 5AUZA 5AR4A 3QTZA 2BRHA 3VJOA 3WIKA 5E9EA 5IQFA 2RFSA 3QZFA 4BTMA 2H96A 4FSTA 1H00A 4JL9A 5EG3A 4U6RA 3VBXA 1LP4A 3AGMA 4IH8A 4BFMA 1OKWA 1MRYA 3MV5A 4QNAA 3OXZA 3R28A 4O0TA 3OW3A 4ENYA 1GIHA 2GS2A 3NUNA 5AMNA 3NVMB 4DTBA 4M84A 5AIRA 3R8PA 4USDA 5A4TA 2X1NA 4AGWA 2W9FB 4JIKA 4AX8A 2E9PA 4XG3A 3FXZA 3F88A 3O50A 5L2TA 4YSMA 2YM5A 3H9OA 3BELA 4C58A 1WVWA 1F0QA 4FUYA 4RVMA 4GU9A 4DCAA 2O0UA 4NW6A 2PVNA 5F94A 2R3PA 2UW6A 4P5ZA 3VS3A 4QMLA 2FSTX 4RIYA 1NT2A 2HZ0A 3FKOA 1URWA 3DV3A 4LOOA 3E87A 4W9XA 4G9RA 1PW2A 2JKKA 2I0VA 2RL5A 3ERKA 4GJ2A 3CKWA 2ONLA 4YZNA 3PDTA 2QOHA 2UZVA 2I7QA 5TO8A 4DYMA 2VNYA 4JQEA 5HCYA 2PE0A 5BQ0A 3UO5A 3SOAA 1ZMVA 4RX5A 3QD4A 2VTOA 2B54A 2BAKA 5EOBA 2IW9A 3BU5A 3VUHA 4BGHA 4ZJVA 4EOLA 3R7UA 3MJ2A 5HNBA 5IPJA 3DK7A 3HMNA 4MD9E 1KV2A 2IZTA 1NVSA 3VS6A 4LUEA 3R6XA 4ANOA 3C13A 3CJGA 3U9NA 4CSVA 2BRNA 2WO6A 3OTUA 3PA4A 4DLJA 3WE8A 4NKSA 4YHTA 5IA4A 4L9IA 4FNYA 5DT4A 2F7ZE 1LEZA 3DAJA 1HOWA 2GNLA 1RW8A 3G5DA 3OXTA 4J7BA 5CZHA 3VC4A 5LWMA 4FZAB 2OZAA 2WU7A 5DWRA 3MESA 2GFSA 2JEDA 4RJ8A 3D5XA 2X2MA 4A7CA 3CGFA 3UQFA 4RMZA 3LMHA 4E1ZA 3ZZWA 3NR9A 4CT2A 5F9EA 1IR3A 2W1ZA 4FNWA 3FMDA 2J0MB 4JS8A 4U5JA 1YI3A 5EI6A 3DU8A 4YZDA 5IA5A 3DPKA 4ANSA 4O0SA 4ZZMA 2UW9A 5BMMA 5I9VA 2CSNA 3MH2A 3MBLA 2VO7A 3D0EA 2VO0A 4YP8A 4WOVA 5CQWA 3DBQA 3JUHA 3JY9A 2IZUA 3OEFX 4IX4A 2XKDA 3V04A 1UWJA 4CLIA 2G2FA 4U42A 2Y7JA 2PMLX 3COKA 3UNZA 2C6EA 3D15A 4HYUA 3NW7A 3DTCA 2YN8A 4WG5A 3F6XA 2O2UA 2B1PA 3P1AA 2CLQA 4GT3A 4XG2A 5FXSA 5HIEA 5EM8A 3FC2A 5KO1A 3FI4A 4FT5A 3CPBA 5KNJA 5E90A 1NVRA 2VTQA 1PMVA 3I6UA 4PMMA 2R3LA 5FDPA 3M42A 3P0MA 1SVGA 5HLWA 3MDYA 4U81A 4YURA 4F6UA 4QP2A 3BYVA 4BRXA 3UMXA 3E8DA 2Q0BA 4F9WA 1W82A 3VS7A 3KC3A 4CMTA 2QOCA 4FIHA 5E8ZA 1PY5A 3CJFA 4DE4A 2I1MA 4EJ7A 4FT3A 3A7IA 3ZRKA 4QMVA 5H9BA 4FKTA 5EH0A 2JIUA 1Q8UA 3QA8A 3TL8A 3WF7A 1P14A 4ANQA 4L46A 3QC9A 4BI1A 2XK7A 1OPJA 4AAAA 5JGAA 3EQFA 4IW0A 3P78A 4EJNA 3HMMA 2HY81 4EH5A 4KBKA 3S95A 5HX8A 5M06A 3NZ0A 3W55A 5EDPA 1A48A 1UNLA 1IA9A 3SGCA 4YLKA 4TWNA 4YPDA 3FZSA 4I41A 2XKEA 4TTHB 2ZVAA 4ZP5A 3P08A 4MXZA 3VS2A 3F9NA 3KEXA 2XH5A 4RVTA 1U5QA 2B7AA 2XYUA 2G01A 4BCOA 4BC6A 4LOQA 4HCTA 4QYEA 2VWYA 4FKIA 4NWMA 3R7VA 4E5WA 1Y8YA 3CLYA 3JPVA 4D2RA 3GT8A 3DXQA 4I5PA 2IVSA 4NFNA 5L6PA 4XLVA 3KL8A 3V8TA 3UTOA 5A46A 2CLXA 3NCGA 3R7OA 3VHEA 4C59A 2Y4IC 4X21A 3HMPA 2ZAZA 1JQHA 2VWUA 4NM0A 3VVHA 3CY2A 1PXOA 5IQEA 3GENA 3QLFA 4KIQA 3F3WA 5M4IA 3KXHA 3OBJA 3I4BA 3FDNA 4YC3A 4QTEA 4TYHB 2C6MA 5C01A 4JRNA 2JLDA 5CAVA 5HORA 3UP2A 4RPVA 4IB5A 2O65A 3DKCA 5KCVA 3UGCA 3UIUA 4FKUA 3NPCA 2G15A 4R5SA 3HNGA 4U8ZA 1R1WA 4EC8A 3UZTA 5CI6A 3C5IA 3FMEA 3KXNA 3HAMA 5D7AA 3P86A 3NRMA 4LRMA 1YOJA 2Y6OA 1YOLA 2WMRA 1H25A 4PP9A 4E6DA 5JN2A 1PXKA 2UZNA 3KCFA 4CFWA 2X9FA 4XP0A 4MKCA 4BICA 3BPRA 4G1WA 5A9UA 2XNPA 4XBRA 4ALUA 4AXAA 2UW3A 2UW0A 3R2YA 4YZCA 4ZZOA 2LAVA 1E1VA 4BDJA 2WOUA 3BRBA 4YSJA 2VTNA 1Y6BA 1XO2B 1WBWA 2V22A 4NK9A 4FTOA 3I6WA 3KRJA 3DBEA 3OOMA 4MCVA 1SM2A 4O1OA 3RGFA 4C36A 2E2BA 3TUDA 1H1SA 4FA2A 1JOWB 3R8MA 5DA3A 4BWKA 5AAGA 3H9RA 3DQWA 3DTWA 1PKDA 4HJOA 3F61A 5AAFA 5DPVA 2PE2A 2YWPA 4EHVA 5DRBA 5IUGA 3RK5A 5DE2A 1OBDA 3G9NA 4EL9A 5J9ZA 3DBDA 4LOPA 1M2QA 2F7XE 2JFMA 3PSCA 4MNEA 3LFDA 3LQ8A 3FLQA 1YI6A 2VN9A 1BI7A 2X2KA 2HWPA 5ANJA 4C4GA 3TUCA 4USFA 4XG6A 2CNUA 4W4WA 5FWKK 5JFWA 3PJCA 5AV1A 4OAVB 1O9UA 5FGKA 5FEDA 3TNWA 4F1MA 4RIYB 3W10A 4I6FA 4F1OA 1H1QA 5C4LA 3FHRA 2QG7A 3WI6A 4IMYA 1JVPP 5CALA 3C4FA 3NS9A 2E9VA 2QR7A 4GG7A 4QTBA 4H58A 4RBLA 3L9MA 1ZOGA 1K3AA 3TDVA 4YJQA 4KA3A 2CGXA 3FMJA 3RCDA 3Q9XA 3SX9A 3QTQA 3CTJA 5L6WL 5KBQA 3IQ7A 4BI2A 3RALA 3LW0A 3C1XA 4E8AA 4GRBA 4FTUA 3QQLA 3OCSA 5CU4A 3TM0A 2WPAA 3REPA 4KIOA 5AUTA 5E8YA 1XH6A 3PTGA 5HG7A 3GFEA 3ROCA 3VHKA 3QWJA 5BVDA 3QCYA 1ZAOA 2R3IA 5JMSA 2P2HA 4U3YA 4U79A 3ZYAA 2FGIA 5E91A 2R9SA 4GIHA 4HNIA 4BZOA 2GHGA 4MBIA 5DT3A 3W8QA 3IG7A 4C38A 4DGOA 2P3GX 4E5BA 2BFXA 2WMAA 1B6CB 2F9GA 4AF3A 4EQCA 3IONA 4W8EA 3RZBA 4DBXA 3GGFA 3MVLA 2A2AA 3QRJA 4X2JA 5HBHA 2Y4PA 1M2PA 4O7LA 4I3ZA 5GIOE 3L8SA 4I6QA 3O71A 2OZAB 4NIFA 4LG4A 5ITAA 4O22A 3PRIA 5HNIX 3HKOA 2JDOA 4FV9A 3LCKA 3QQKA 4RZWA 4RJ4A 1OL7A 5IQHA 5M53A 2XCHA 3BCEA 4AG8A 5CF5A 5DMZA 5FM3A 2GTNA 4KSQA 3H30A 4FOBA 1V0BA 4EOIA 3ZEWA 5IA0A 1KE6A 4DFLA 5A4CA 3RINA 2BMCA 4CD0A 4DFXE 4FV6A 3AD4A 4PV0A 4EH9A 1MP8A 3VW8A 3OWPA 3OMVA 3QTUA 4N6ZA 4XV2A 3KXGA 3R2BA 4C2VA 3CD8A 2XJ0A 3R9HA 3IW6A 3ZUUA 3Q2JA 4ENXA 4ZLOA 4FT9A 1J91A 3A7HA 4JOAA 2WMUA 3ZFXA 4EBVA 5CAPA 5I9WA 4QMUA 1UU9A 2ITVA 4XG4A 4EK6A 3TUBA 5AFVA 1BL6A 1O6KA 4E4NA 4F6WA 2YLEA 3EQDA 4NTSA 2W96B 4IAIA 1UU7A 4O86A 5C26A 3ENHA 3PG3A 5D1JA 2HXLA 4JDJA 3BZ3A 1P4FA 5AA9A 3FBVA 3JXWA 3NUSA 1O6YA 4XRJA 2OSCA 4R3RA 4QYHA 5CNNA 3CBLA 3AC1A 5E8TA 4A4LA 3GCUA 3RI1A 3R01A 3HZTA 4O7VA 4EK5A 3R7EA 4H36A 3GC0A 3ZONA 4FSZA 1PXLA 4BZNA 5H2UA 4QP9A 5DI1A 3RTPA 1OBGA 3NW6A 1NVQA 5CVGA 3HX4A 3TJCA 4DEAA 3HAVA 4HVGA 4BCJA 1OL1A 1PRYA 3NNUA 4QYFA 4Z3VA 3Q9WA 1ZYLA 5M4FA 5BVOA 3S1HA 3SHEA 4ZIMA 1T46A 3SC1A 4C34A 4XP2A 3V5TA 4AFEA 4UB7A 3ORMA 2VTAA 3LXKA 4K2RA 4G3CA 1FGKA 3TTIA 4PY1A 4GH2A 3A8XA 4AA5A 2BCJA 3O2MA 1XKKA 3QX2A 3BHUA 4DHFA 3QZHA 1KE8A 4PPBA 4BCIA 3ZO3A 4EK4A 4O91A 3LKMA 2C1BA 2EXMA 5AR5A 5IH4A 2OG8A 4D2VA 3PG1A 4YJTA 4MWIA 2YEXA 3S00A 4RSSA 2XK3A 5T6KA 4J96A 3HDMA 2QOBA 4U80A 3JY0A 4ACMA 3Q52A 5C4KA 1OVEA 3R30A 3RM6A 1H1WA 4R3PA 5TF9A 3NNXA 1W84A 5DOSA 5KMOA 3ULIA 3F3TA 3DZOA 5HZNA 3OTVA 4GCJA 4RIWA 4BBMA 4D1ZA 3BWJA 4E6QA 2GU8A 1FVRA 1NXKA 3CCNA 2W99B 2PZRA 2XK8A 1L3RE 4BYJA 2W4OA 4BIEA 5IQGA 5LJJA 2PVMA 4FUXA 4L53A 2OF2A 2PPQA 4N0SA 4ACDA 2YM4A 4EONA 3BU3A 3PXRA 5KMLA 3N4VA 3NW5A 5CEPA 4K11A 2RGPA 2C3LA 4UYAA 5DR2A 3R9DA 2JD5A 2HW6A 3AC2A 4FTLA 1OKZA 4ZZNA 2VX0A 4A06A 5DH3A 3PY0A 4X2KA 5LMKC 3OHTA 3W2PA 5FEEA 5IQCA 3VNTA 2JITA 2QOIA 3FAAA 3QQJA 4KINA 4MNEB 3UIXA 4D2WA 4W4YA 4HYHA 3AMYA 4ZLYA 1YI4A 3GQIA 5CLPA 2CKQA 3DT1A 2H6DA 2PMIA 3AC5A 1XBBA 3Q04A 2VTIA 2VGOA 5FXQA 4OUCA 1TVOA 4MWHA 3TV6A 1SYKA 2ITNA 4QTAA 4UXLA 2XNNA 4YJSA 2W06A 4YPSA 3JVRA 3UG2A 4B99A 4DEBA 1P2AA 5GHVA 4CKRA 4AN9A 3BHHA 3ACKA 3ZU7A 3GFWA 3D7ZA 3GU8A 4FTKA 4ZTQA 3VBVA 1R0PA 2IVUA 3MPTA 4YLLA 2V62A 5J79A 4FEVA 5IQAA 3PJ2A 3RK7A 4MX9A 5F20A 4DEEA 3VBYA 4YZMA 3W16A 2PSQA 3GC9A 1Q99A 2R64A 3BWFA 5ETFA 2RSVA 2YCSA 2OKRA 3G6GA 3POZA 4ANBA 4O82A 4MXCA 5AP6A 4CMOA 3VRYA 3BYMA 5BVWA 4FF8A 3KMMA 3OG7A 5DLSA 4Q5EA 1WBNA 1ZXEA 5JEBA 5H8EA 3ALOA 2GTMA 2BRGA 5LMBA 5AP4A 3EQGA 2QOOA 1H27A 2XCKA 3Q9ZA 4IFCA 3ZTXA 4Z55A 5A4LA 5L6OA 4BDDA 4O6LA 3DXNA 3FZTA 5CXZA 4F9CA 3KB7A 3KVXA 4V0GB 2PMOX 5FM2A 1OL6A 4BDKA 3OWJA 2H34A 3ZLXA 4D2PA 4UWYA 5E7RA 2FB8A 3D5WA 4J99A 3PVWA 2QO2A 5I3OA 1H24A 3A7FA 3ET7A 5HBJA 4MEDA 3NUPA 4IIRA 2BRBA 4FKPA 4PMTA 4KKEA 4CZUA 5HTCA 4F08A 1WVXA 2VWIA 2WMQA 5FBOA 4QNYA 4U40A 2X8DA 4XH6A 5CF4A 3PZEA 1OM1A 2R3NA 4AUAA 3ID6C 2ETKA 2XIXA 3TG1A 3UQGA 3HRBA 3EWHA 4PTEA 4AOJA 2Y4IB 3DK6A 5EI2A 3Q32A 5K9IA 4JI9A 2OU7A 2ITYA 2WKMA 4FL2A 1OIRA 1VEBA 2XEYA 4L01A 5K4JA 4FG9A 4J8MA 4ACHA 4QQTA 3G2FA 3MB7A 3Q4TA 3CIKA 3D7TB 3BEGA 2W7XA 1Q8WA 1OZ1A 4JX3A 1PXPA 4OTGA 4JG8A 4TWCA 1XHAA 4X0MA 3TI1A 4F99A 4BCKA 3HEGA 5I5ZA 3FKLA 4EH6A 4XMOA 5EHLA 4QP1A 3OP5A 3R9OA 3KMUA 4QMYA 4CCBA 2QKRA 3M11A 3EQIA 4L00A 2DUVA 4S30A 4RA5A 5HG9A 1M2RA 4FZ7A 2BR1A 3UVRA 3PFQA 1GNGA 1KOBA 3OW4A 4AP7A 4K9YA 2IZSA 4EH7A 2QNJA 3QGYA 2OJJA 4WSQA 4ZMFA 2R5TA 3KF4A 4DT9A 3SLSA 4DGGA 4FTAA 2AUHA 3R00A 1AGWA 3LCTA 4MXXA 3VULA 5JFSA 3SG8A 4ITJA 5L3AA 4WSYA 4ZK5A 4F7NA 5M4UA 2UVZA 4FGRA 3V6RA 4HGEA 4RC3A 2X2LA 4FL1A 4IZAA 2YIQA 3H0YA 3UMWA 2OJFE 3ZMMA 4RX9A 1WFCA 2W4KA 3BGPA 3PWDA 4FV3A 4HNFA 4FTRA 4Z16A 2IW8A 2YCRA 3BYOA 4JAJA 3RBWA 5BPYA 2IG7A 1H0WA 3KRLA 2DQ7X 2C68A 3EN5A 1STCE 2X8IA 4IC7A 4IWDA 4CG9A 4RGJA 4ONAA 3M2WA 3ZUVA 3FEGA 1URCA 1Q3WA 4ASDA 1G5SA 2BPMA 4F70A 4X3FC 1Y57A 4BCMA 3PXYA 4BWXA 4ZTNA 4KIKA 3EN9A 1RDQE 4HZRA 4IZ5A 4IZYA 2FSMX 2QVSE 1BYGA 4I22A 4YBKA 4EUTA 5CASA 5HE3A 3IW5A 4KRCA 1AD5A 1PHKA 1FVVA 4FVQA 2OJIA 3HMOA 3E7VA 4MBLA 4K6ZA 2XJ1A 4TPTA 4FK6A 4FTQA 2C5OA 5KX8A 5IKWA 3BX5A 2WQMA 4KD1A 4BGGA 4C4FA 4CEGA 4AT5A 2XRUA 5HEZA 4GK3A 3PPJA 3RPRA 5HVJA 3PY3A 3QF9A 3VBQA 2YM3A 4BCGA 4C3RA 3R8LA 1LEWA 5JZNA 4JDKA 3PIYA 4NFMA 4PDPA 5AV0A 3KN6A 1K9AA 5E8SA 2C6IA 3QZIA 4FT0A 4NW5A 2FUMA 2QO9A 2R2PA 4O2PA 5CNOA 3QA0A 5FD2A 3OCTA 4PNKA 4OR5A 1REKA 4XG7A 5CT0A 5BYLA 2NRYA 3HDNA 5KMMA 1S9JA 4HGTA 1JKTA 1JSVA 2ITXA 4UY9A 3QYWA 4XLIA 3QFVA 1CKIA 2WMVA 2YZLA 1GIJA 2B4SB 3AC3A 2GHMA 2YISA 1YHWA 3LXNA 1IASA 4X6QC 3ZEPA 4BDIA 3PIXA 4JG7A 1UU3A 1VYWA 3U6HA 3JYAA 4RJ7A 4Y73A 5HE0A 3T8OA 5K5XA 2ERZE 2VTMA 2ZV7A 2ZV9A 4LMNA 5CAOA 2WNTA 2PY3A 4PNIA 3BHTA 3HV3A 4L7FA 4W4VA 1UVRA 4U45A 4EQUA 3R63A 2GNHA 2PVRA 3ZM4A 2PZIA 4DG3E 5LQFA 3PSBA 3R1QA 3A2CA 3FY0A 4IE9A 4WT6A 3ACJA 1BUHA 5EYCA 4MXAA 4IVCA 1ZZLA 4G3GA 2IZRA 5AA8A 3MY5A 4FIJA 4ZJIA 3DZQA 3KQ7A 4D5HA 1V0OA 3DNEA 1WCCA 4YGAA 4RIOA 1OPLA 3F2NA 4UN0C 1MUOA 3DGKA 3ELJA 4IWQA 2GDOA 2YDIA 3MH0A 4DFZE 4U97A 3W32A 2PU8A 4I4FA 3ZFMA 3UPZA 1SMHA 4RZVA 1VZOA 2WHBA 3ETAA 2B53A 2XYNA 5EHOA 5FRIA 2O5KA 5HTBA 3MIYA 2YAKA 1OITA 4FTTA 1WBSA 4OW8A 3VWAA 2G2IA 3W1FA 1SNXA 3Q2MA 2CKOA 2HELA 2VWBA 3EZVA 4R1YA 3ROYA 3GVUA 4FTJA 1ZYSA 3VIDA 1OUKA 3QL8A 4XV9A 2X0GA 3LFCA 1GIIA 3GCQA 3AGLA 3MFUA 1JWHA 4NTTA 5ACBC 1GZNA 3ZSHA 3E88A 3SD0A 2HW7A 5L2IA 3S0OA 3FE3A 1WBVA 4YJUA 1PYXA 4U43A 4NJDA 1ZOEA 3NGAA 1ZYJA 3D94A 5KMJA 4Z9LA 5HI2A 3LXLA 4PF4A 3IGOA 4FSRA 4BDEA 4E7WA 4ANNA 3PE1A 5T3QA 4D4SA 4ACGA 4GV1A 2GNGA 3PXZA 4FV0A 4TXCA 4HGLA 5K4IA 4IZ7A 4TWOA 4YMJA 4MK0A 3FLZA 4M68A 1LUFA 4X3FA 2BILB 4GVJA 3SXFA 1H26A 3OS3A 4QTCA 3D83A 4BL1A 2B9HA 3ALNA 3GQLA 4FKWA 4HCVA 3TNQB 5J5SA 2W1EA 2CJMA 3FV8A 4YTCA 3U6JA 2FSLX 4XV1A 3O0GA 2CGUA 2V5QA 3PJ1A 2OIBA 3F2AA 3GU4A 3ZOSA 4DITA 4ZS0A 5CZIA 3DAKA 4C8BA 2WMSA 5C27A 3RHXA 4UMPA 2UVXA 5M44A 2V0DA 4W4XA 3LZBA 4DGLC 1OI9A 1Y91A 1DAWA 3QAME 4JQ7A 4GK4A 3ZO1A 5E1SA 3MY0A 3SXRA 4YO4A 4YLJA 3TNPC 3FMNA 3EYGA 3NCZA 3C4XA 3CQUA 2YHVA 4R6VA 3DXPA 2B9IA 3L9NA 4IVBA 3E64A 4S34A 3TIYA 2VX1A 3HV5A 1FPUA 3SA0A 4MTAA 5AWMA 4EWQA 2WQEA 3ZLWA 5AX9A 1H0VA 3THBA 3ENMA 4ZY6A 3I0OA 4XHKB 3E8NA 3QQHA 4L44A 4ASEA 2QURA 2E9UA 4QPAA 4RA4A 2B52A 5HBEA 5JQ5A 1JAMA 3PSDA 4BHNA 1DI9A 2F2CB 2VWWA 3NUAA 3EN7A 4M3QA 3CSVA 4U9AA 3QGWA 3GCPA 4BR3A 4G17A 3V3VA 3ZH8A 4KNBA 4EH2A 3CTQA 1YWRA 1PMUA 4GYGA 4BBFA 3BHVA 2YDJA 3II5A 4HZSA 4R3CA 5JZJA 4C7TA 2BZHB 2I40A 4AOTA 3DOGA 4E73A 3MI9A 3OT8A 2XKCA 5JGBA 4F9YA 2VUWA 3QBNA 1REJA 4O38A 2J4ZA 3Q5IA 3VS5A 4CLJA 3FMHA 4LFIA 3E8EA 3DKFA 3R1NA 2R3GA 3F66A 3C4CA 2ERKA 2X9EA 2PMNX 2RG5A 4G16A 4YTIA 4HW7A 4UMUA 4Y5HA 1KWPA 2W5HA 3BBWA 1K2PA 2J9MA 4KIKB 2C6DA 3QCXA 5CXHA 5KZ0A 3OUNB 4LM5A 3AOXA 1XBAA 3LJ2A 4PWNA 3RPYA 2UZBA 3LFAA 3S3IA 4GG5A 5GNKA 2WIHA 4KBCA 2HY0A 3L8XA 3TZ7A 3VS0A 5IG1A 4PL4A 1FVTA 3HA8A 4FV8A 4ZJJA 2Y9QA 3E3PA 5GIPE 2PYWA 1ZYDA 1UU8A 2WB8A 3PVUA 4R77A 4YJPA 3CR0A 2BHHA 4XS2A 2Q83A 2XM9A 3LCDA 4R78A 4IB1A 3C4ZA 4ZTHA 4ERWA 4D2TA 3AC8A 5EKOA 3RM7A 2XMYA 3R0TA 4AQCA 4BDCA 3MIAA 3U54A 3LMIA 3F82A 2PVHA 3ATSA 4FK3A 3A61A 4EYMA 2JDSA 5IISA 4EI4A 2PWLA 3EL8A 2ITWA 2WTJA 4TYIA 4C0TA 1Q41A 2XNMA 4I0SA 2Z8CA 5JSMA 5C03A 4GL9A 4WNMA 5ANEA 4CZTA 4UWBA 3PXKA 3HV4A 2R4BA 3SW7A 1SVHA 5AP3A 4JJRA 5IMXA 2OGVA 5HO7A 2HZIA 4FV4A 5HE2A 3HYHA 4QMQA 2YAAA 3VUGA 5A54A 4CCUA 3TDWA 2OF4A 5CVFA 5HCZA 2YIYA 1UKHA 5CSHA 4EORA 5J7HA 4I94A 4TYGA 4CFVA 4IX5A 1YRPA 2W5AA 4U7ZA 3ZC5A 1PXJA 3VO3A 3ZLYA 3PA3A 2NO3A 4WG4A 4IACA 3ZXZA 4PPCA 3C4EA 2NPQA 2OIQA 3OWKA 4HOKA 4GMYA 4PUZA 3D5UA 4Y85A 3A62A 3GP0A 4KABA 3CE3A 3ZZEA 3V5LA 3VUDA 3EH9A 2W1HA 3L8VA 2DYLA 5HVKA 4BCPA 2YM6A 3V51A 4BHZA 5BYYA 3KK9A 4RWLA 4D0XA 5ANOA 4EQMA 3MTFA 1KV1A 2BHEA 3HGKA 4BY9E 3I7BA 3F5GA 1YXUA 3EQBA 1PMNA 4JBPA 3LFBA 5A6NA 3DQXA 5BNJA 3U6IA 3FMLA 2GCDA 3O7LB 4UX9A 1JBPE 4LUDA 4YJOA 3FWQA 4F09A 4O0YA 5GJDA 4EH3A 2CKPA 2QLUA 1ZLTA 3CD3A 4U3ZA 4G31A 5CTPA 4AZVA 3MH3A 2BALA 5F4NA 1WBPA 4AW5A 3PVGA 1H1RA 3NMUF 1APME 2OO8X 3Q3BA 3DK3A 2EXCX 4NJ3A 2PULA 4EH8A 3ORLA 5CU0A 2QQ7A 5CSWA 5EFQA 2ITPA 4FV7A 1FQ1B 2HZNA 3BYSA 4DINA 2UZOA 4BKJA 3B2TA 4LGDA 4Y5QA 5LWNA 4TY1A 4FI1A 4D1SA 4EBWA 4F9BA 3W2CA 2J5EA 4FSYA 1FOTA 4V01A 4CV9A 4FTMA 3QZGA 3PYYA 1ZY4A 2ZM3A 4JQ8A 4CMUA 5GZ9A 4V0GA 2F4JA 1WAKA 2ITUA 4FL3A 4GFMA 4JRVA 1R78A 3OY3A 5IUHA 2O64A 4QYGA 4FSNA 4EEVA 4V04A 2WAJA 3FZPA 2R3FA 3K2LA 3R1YA 4K33A 4Q5HA 2XZSA 2JAVA 2UZUE 2XIRA 4FNZA 3PJ3A 1GY3A 3UC3A 3MW1A 4BN1A 3PXFA 1CM8A 3ZRLA 5KE0A 2Y6MA 3ORIA 4K8AA 5KMIA 2XP2A 4XBUA 5E1EA 4CRSA 4X3FB 5CX9A 2ZM4A 4GS6A 3SAYA 4FIIA 2IW6A 4FTIA 3CC6A 4C57A 4K1BA 1OGUA 4CGAA 3HL7A 4IX3A 3B8QA 3C7QA 2W4JA 1SNUA 2BROA 3ZCLA 1Q24A 3N9XA 3K3IA 2AC5A 4I20A 3EN6A 3KREA 1EH4A 2X4ZA 4PL5A 3D7TA 4XCUA 2J0IA 2O63A 4YC8A 5AUXA 1M7NA 1W83A 2VD5A 4C3PA 3FPQA 3R7IA 2CNVA 1YKRA 2J0LA 4OAUC 2R3MA 2XNGA 4LYNA 3FC1X 3COIA 2QHMA 4AZWA 4P2KA 2J51A 3QRTA 5FXRA 2R3RA 5I9UA 4BWPA 5C1QB 5CEMA 4NEUA 3UE4A 4MF0A 3ZLSA 4DFNA 3VBTA 3MY1A 5BVFA 4L67A 3RP9A 5EQYA 4RLLA 4AWIA 4MNFA 3VN9A 1Z57A 4NCTC 3UO4A 3AMAA 4FSMA 4RWJA 3NIEA 1PXIA 4FKSA 3N51A 3I5NA 4HVSA 4HVIA 2FVDA 3D9VA 2IJMA 2A19B 3RPOA 3ZFYA 5HLPA 4DGMA 1YWNA 5BMSA 2J6MA 3CPCA 4IXPA 3I5ZA 4F65A 2QCSA 3F5XA 4G3FA 3VQUA 4UEUA 4MD8E 4FMQA 4E26A 3H9FA 4MAOA 5JFVA 1CKPA 2VX3A 4ORKA 1JKSA 2OWBA 4FV5A 3EOCA 3TKIA 5EM5A 3WILA 3DKGA 3LQ3A 3NAYA 4XEYA 2OXYA 2C0IA 4O7ZA 5BX0A 4D5KA 4O1PA 3C50A 3JVSA 4EC9A 3BV2A 4EOMA 5HQ0A 2CCHA 4M12A 2Z7LA 4FVRA 2C4GA 4O84A 3QTXA 2WQOA 2CGWA 1TQIA 4IAFA 4O27B 5KHXA 3LFEA 3AD6A 1WVYA 3VBWA 4DTKA 1ND4A 4UZHA 3SQQA 4L68A 1XBCA 4RWKA 1YVJA 4CFUA 2WD1A 2X39A 2BDWA 2C69A 3VQHA 2HOGA 5DT0A 3QTSA 1M52A 3QUEA 4YO6A 2VTRA 3QTWA 3UPXA 4TRLA 4FZDB 4O6EA 3MVMA 3LHJA 2ZV2A 4O7YA 3R71A 2C5YA 3W18A 4M0ZA 2NP8A 4FEXA 5LOHA 3E62A 4GUEA 4GW8A 4QMSA 2FO0A 3IPHA 3LLAA 5DR6A 3ORKA 3U8WA 4BGQA 1IEPA 1R3CA 5LARA 1YDTE 2O8YA 4ZTLA 3RCJA 4RQVA 4YHJA 3SV0A 4DBNA 5I3RA 4R7BA 3OT3A 4IVAA 2YDKA 3GCSA 4S2ZA 4LL5A 4ZSAA 4B8MA 4DCEA 5J1VA 5CQUA 3KY2A 1YDRE 3LCSA 4OTIA 5EKNA 3WZJA 2JIIA 4DFBA 4WRSA 5KBRA 2R3HA 5HO8A 4AZFA 4AW2A 3UOLA 4FOCA 1XH9A 3D4QA 3KCKA 3ZDIA 3TZMA 1A9UA 2W1GA 3NNWA 2WGJA 3KF7A 2RFEA 2FSOX 3OC1A 4F1TA 1FMKA 4I6BA 4IVDA 3MPMA 3I81A 4YJRA 3KN5A 4ERKA 3NUUA 3RJCA 4EH4A 5LVMA 3FI2A 3IOKA 1PF8A 1X8BA 1S9IA 3COHA 3C0IA 4R5YA 1P5EA 2FYSA 5EDRA 2OFUA 2ITQA 3CTHA 4LI5A 3SKCA 2QG5A 4YZBA 1LR4A 2E9NA 2CNQA 3QKMA 3QKKA 3NDMA 2W9ZB 2YZAA 4EOOA 4DH1A 4PQNA 5C8NA 3GI3A 3KMWA 4RJ6A 4QMOA 2R3OA 4LRJA 2QI8A 3GUBA 3QX4A 4GU6A 5DGZA 4CXAA 5C9CA 4M0YA 1I09A 2BRMA 2ZMCA 4M67A 3AC4A 4NUSA 1E1XA 2JFLA 4DC2A 4EWHA 2QU5A 3ZDUA 3AD5A 2WMWA 2EB3A 3OBGA 4GJ3A 3V5PA 4ZSLA 2BIYA 4C35A 3VF9A 4QOXA 2AYPA 2EWAA 1BI8A 5LVPA 4I24A 4AN2A 4Z7HA 3DFCB 3V8SA 2JBPA 1YDSE 4H39A 2PTKA 1Y8GA 2C6LA 4QMPA 3P5KA 3GOPA 5J9YA 1ZWSA 4DH5A 2HAKA 3VUIA 1I44A 1ZMWA 4NCTA 2R7BA 3I79A 3BHYA 2C6TA 2QOFA 4FEQA 3FZ1A 3G9LX 1GZ8A 5ICPA 2OH0E 5GINE 1BMKA 5FUTA 4O0RA 3KK8A 3GBZA 3UVPA 4FSWA 3MGYA 3K5VA 1OIQA 3V6SA 3GNIB 5KZIA 3HVCA 3A7JA 3EQPA 5HIBA 3V01A 3G15A 3HP2A 5B7VA 3TNIA 1KE5A 4NKAA 4F64A 4O7WA 1JNKA 1KE9A 4E93A 3NUYA 4IQ6A 2WMTA 2QLQA 3QQFA 4CG8A 3DLSA 2ZDUA 5D7VA 1Q5KA 4H1MA 1H28A 4PTCA 4IX6A 4FTCA 4HPTE 4K77A 3F3UA 3WARA 3FJQE 3CY3A 5FQDC 4RLKA 4ALWA 5TR6A 3WYXA 2Z7QA 3HP5A 2VWXA 3NYXA 3O8UA 4GK2A 1YXXA 3TV7A 4MHAA 3UDBA 4AT4A 2OH4A 3NUXA 4F7SA 3C0HA 2G9XA 5G6VA 5EM6A 3NX8A 3E63A 3KRWA 2VNWA 5CF8A 4PMPA 4Y83A 5AADA 5I9XA 4DF3A 3T9IA 4KB8A 4G34A 4X7QA 2I0YA 2JDTA 3PA5A 4WBOA 5DN3A 5AP7A 3TKHA 3LIJA 4CQGA 3QTRA 1JLUE 4EOSA 4TNBA 3FMMA 4APCA 2LGCA 2JKMA 3PIZA 4CZYB 2P33A 4FNXA 4YJNA 3UYSA 3F3ZA 3UOJA 4JR7A 4P5QA 2QONA 3EN4A 3OVVA 4JX7A 5M57A 3GU5A 5CEOA 3PPKA 4ZOGA 5M08A 4O0WA 1MRUA 4V05A 4WUNA 5HD7A 5GJFA 4E4MA 4E6AA 5IEVA 5AUUA 4QO9A 3QQUA 1OECA 4N70A 1BL7A 5CT7A 1H07A 3SXSA 5TKDA 4P90A 2E9OA 4BDFA 4MYGA 5T68A 4DEDA 4QT1A 2XK4A 2ACXA 4XV3A 3Q4ZA 5CI7A 2PVKA 3RNYA 3G33A 5CF6A 5E8WA 3TN8A 3UO6A 4C33A 4Y95A 4S33A 4OLIA 3DBFA 3BI6A 2A27A 3WZEA 5DG5A 5IZFA 4D58A 4C4IA 1PJKA 3ZO2A 3VAPA 5GZ8A 2OLCA 3OEZA 5LMKA 4PRJA 3QKLA 3SVVA 3EIDA 3BV3A 3OCBA 2VTPA 5CSPA 3L1SA 5HO6A 4MF1A 5CSXA 5AR8A 4C4EA 4F63A 3NAXA 1XH8A 5IDNA 3FLYA 5TT7A 4PP7A 2WMBA 3MA3A 2BKZA 3R9RA 4J98A 3UYTA 4CYIA 3IS5A 3ODYX 3SRVB 3RK9A 5AUWA 3AT4A 4QYYA 1QL6A 2HK5A 1MQBA 3F7ZA 3NYVA 3ODZX 3ZUTA 3DLZA 1H01A 2XM8A 3GU7A 4I5CA 4CV8A 2C3KA 4FG7A 2CDZA 4ASXA 2C5XA 4DFYA 2UUEA 3CEKA 2XIZA 1OIYA 3CP9A 3EHAA 4L3PA 4ZSEA 2A4LA 3QXPA 1F3MC 1XH7A 2G2HA 4RWIA 3OUKA 1J7LA 4UWCA 4Q9SA 5I9ZA 4MD7E 2XNOA 3Q60A 2GQRA 3R8VA 3BLQA 4OBPA 2F2UA 2QKWB 2IVTA 5FLFA 5L2SA 2X8EA 1SZMA 1CSNA 4L42A 1JSTA 3PP0A 4X2FA 2I0EA 3FLNC 2UW4A 3H3CA 3EFWA 4KKHA 5M55A 3AG9A 3TACA 2RFNA 5G1XA 2V7OA 4EKLA 3DJ5A 4M69A 5AV2A 3E92A 4C3FA 3C4WA 4IB3A 2ZMDA 3BLRA 5BVKA 5FTOA 4IB0A 2XA4A 3QLGA 3HMIA 2ESMA 3VW6A 1GOLA 3ZS5A 4EHGA 5FP6A 1YOMA 4L52A 4G3DA 3MTLA 5ANIA 3DS6A 1HCLA 1W7HA 4FT7A 4O21A 2XJ2A 3MH1A 3U87A 3RWQA 1QCFA 4GVAA 4GUBA 3LQ5A 4O7SA 4EOPA 4PTGA 5IEXA 4FEWA 3FZOA 3DDQA 4DEIA 4QPSA
chains in the Genus database with same CATH superfamily
3JS2A 1QPDA 5IEYA 4GIIA 5HNGA 4BVUA 1WBTA 5HG8A 2BZKB 4EOJA 5L2WA 5E92A 1VR2A 3L9PA 3GXLA 3IDPA 2C6KA 4IHPA 4RC4A 3P7CA 5AX3A 3QHRA 1Q8ZA 4U41A 3UZPA 2AQXA 2X4FA 1WBOA 1WZYA 2Z7RA 3NLBA 3VUTA 4EZ5A 4F78A 3WF8A 3COMA 1J1CA 4DG0E 2C6OA 2EXEA 1TFFA 4M15A 3Q4CA 2OW3A 2ZOQA 4IBMA 2KULA 2W17A 3DNDA 4QQ5A 3WF5A 2BKKA 3NVKI 4UMTA 4CTCA 2CN8A 2WIPA 1ZRZA 4O81A 5J5TA 3LE6A 5E4HA 4W9WA 1J7UA 1XR1A 2YA9A 4X2NA 4S31A 4XOZA 4G9CA 2BAQA 5CSVA 4DFUA 3QRUA 3CQWA 3IW7A 3CS9A 4RFYA 4D1XA 3FUPA 4E4LA 2GHLA 2QR8A 3PZHA 4XJ0A 4C4HA 1Q8TA 4R7HA 1KOAA 2YM7A 4AGUA 4BBEA 4IFGA 5CU6A 3K5UA 2YCFA 2UVYA 3EYHA 3Q96A 4UV0A 1QPJA 3E5AA 4IDTA 4XG8A 4C2WA 4YR8A 4WO5A 3RAWA 5LXMA 5TE0A 3WBLA 3WZDA 1H08A 1Q4LA 3BYUA 3ZXTA 4TYEA 4XNEA 4DHIB 2BUJA 2XBAA 3TXOA 4KS8A 3W2SA 3LVPA 5EYKA 5EQPA 3EKKA 4L8MA 2ZYBA 5L2QA 4XP3A 4IAZA 2PE1A 3BU6A 3FY2A 3WYYA 3LPBA 4CQEA 3NYOA 5BUIA 1UNGA 2F57A 4IC8A 4GSBA 3AT2A 2GNJA 3LFQA 4EUUA 5IH5A 2FH9A 4QP8A 4FKVA 5EW8A 5HKMA 3R8UA 3UOHA 4NM3A 4QP7A 2EUFB 3UG1A 4F7JA 2CN5A 4JBVA 2A0CX 4G5JA 5EYDA 5DRDA 4CFXA 4K18A 2OBJA 4RG0A 3QRIA 4H3BA 3HRCA 2PZPA 4I1ZA 3AMBA 3RHKA 4AQKA 3LXPA 3RKBA 3V8WA 5IUIA 3TCPA 3HUBA 4TKSA 3KU2A 2ITOA 1IG1A 2CGVA 4D4RA 3FKNA 5EYMA 4PMSA 5BYZA 3PVBA 4FTNA 3EL7A 4AZEA 1BX6A 4YUQA 2C3IB 4GYIA 1PXNA 2OJGA 5CVHA 3PP1A 1OB3A 2ZB1A 2PVYA 3NWWA 2Y0AA 3QCQA 1ZMUA 3CGOA 4J53A 3EQHA 2WEVA 3ITZA 3EKNA 5ETCA 3RZFA 2J5FA 1IAJA 2GQSA 5JKGA 4EKKA 1VYZA 3FLSA 4JDIA 1PKGA 5F1ZA 3VUKA 2XRWA 3QQGA 1GJOA 4A9SA 5L8KA 3HV6A 2RG6A 4WBBB 4WG3A 3HRFA 5F95A 5H8BA 4FYOA 4B8LA 1XH4A 4PL3A 3FQSA 4QD6A 2GFCA 3GOKA 4JVGA 1J1BA 2B9JA 4GT5A 4BDGA 5IMEA 2A1AB 4ZY5A 4XG9A 4A9RA 5J8IA 4PDSA 3D14A 2XNEA 3A8WA 1FGIA 3LOKA 4YJVA 2IN6A 4O7RA 2WTKC 2UW8A 3MPAA 4RJ3A 1ZOHA 4EYJA 2WEIA 4AA0A 2RFDA 2RKUA 4AGCA 4BTJA 2PL0A 2BAJA 3W2OA 2RIOA 2VTTA 4F9AA 4XYFA 2PVLA 4Q9ZA 2XIYA 4AE6A 3UJGA 2V55A 4WRGA 3P7AA 4AXEA 4FKQA 2WXVA 1L8TA 4DT8A 2PUNA 2VWVA 5EDQA 4CKJA 1Q3DA 2I6LA 3HECA 3EFJA 4BJJB 2YCQA 4J97A 3Q53A 3PLSA 4NT4A 4CNHA 2DWBA 4ZS4A 4FVPA 5TOZA 4B7TA 2IPXA 4IANA 3MN3A 4I23A 3DY7A 5H3QA 5IF1A 4JDHA 2YIWA 5A3XA 2B0QA 3G0EA 4FODA 2YIXA 2QOLA 2AC3A 2P4IA 4OTPA 4CTBA 4Z7GA 5K3YA 2VZ6A 4CKIA 1UA2A 3FL5A 2J50A 2ETRA 3TZ8A 4AW1A 4LMUA 4DN5A 5FP5A 2ZDTA 4OT6A 5DEWA 3BBTB 4MBJA 2VV9A 3H0ZA 3K54A 3KVWA 1Y6AA 4DLIA 5LVOA 4TWPA 3LLTA 3UZRA 1RE8A 2YFXA 5AUYA 3RMFA 5B2LA 5J87A 4IAKA 2WQBA 5D9HA 4M97A 4L43A 4MVFA 2H9VA 3RNIA 4AE9A 2CKEA 3G0FA 4KWPA 4LGGA 5CEIA 4GT4A 3TTJA 5M56A 1FMOE 2VTJA 2A98A 2XF0A 3ZBXA 4HYSA 4RFMA 3EQRA 3IKAA 3OF0A 4WUAA 5J95A 5BVEA 4BIBA 5LMAA 3FPMA 1XMLA 2ETMA 2KTYA 3IGGA 4X2GA 3RAHA 4ANLA 4PDYA 4E3CA 3LM5A 3QD0A 3P79A 3R7YA 1M17A 5ANGA 4DH3A 2YWVA 3UNJA 3PWYA 4PX6A 1YQJA 4ZXTA 1RJBA 4OTWA 4M14A 3U4UA 4D2SA 1LPUA 4M69B 4RX8A 5JFXA 3DFAA 1JKKA 3KA0A 3UIBA 2UZTA 5FEQA 3OROA 3T3UA 4JNWA 2XAOA 4D4YA 3PJ8A 4FICA 4GFOA 4J95A 3W33A 4J52A 5GJGA 4QP3A 4FKRA 4KAOA 4IAAA 3WIGA 2PZYA 2OIDA 3FQHA 2X6EA 3ORPA 4FZFB 1DS5A 5ACKA 2ZM1A 1CDKA 3DA6A 4QEBA 5L8JA 5M07A 4I5HA 1W98A 3R7GA 3W0NA 3R1SA 5BUJA 3A4PA 3PXQA 3MFTA 4QPMA 4FRFA 2B55A 4CFFA 3TEIA 4H3PA 4ZLZA 5KKRC 4G2FA 3G51A 3KFAA 3W2RA 4BYIA 4NYEA 3O8PA 5FTGA 1H8FA 1ZYCA 3UBDA 1U4DA 3HV7A 3LFFA 3GCVA 5I9YA 2UV2A 4O0XA 4OTRA 4RC2A 2UW5A 2WOTA 4IJ9A 4F0FA 4B4LA 2PVJA 4FSQA 4JT3A 3MVJA 4LGHA 5EW3A 3A7GA 1CTPE 5AUVA 3NSZA 4CRLA 4R1VA 5E8UA 2C30A 2XARA 1U54A 4FKOA 2DS1A 2QD9A 2QU6A 4XX9A 4XOYA 4IM0A 2VRXA 4Q2AA 4H1JA 2VTLA 4IADA 4BI0A 4II5A 3VS1A 3F2RA 4L3JA 5DFPA 2BVAA 4FEUA 4FE2A 1NY3A 2XEZA 1ATPE 4JLCA 4N4SA 3ZBFA 4CFMA 2EVAA 4YNEA 2R3JA 3WF9A 2V7AA 1B38A 5E8VA 1Q97A 5IQBA 4NSTA 3I7CA 1U59A 1NA7A 3ANQA 3MFSA 3F7WA 2J0KA 4TN6A 5FTQA 1TQMA 4MXYA 4HYIA 3ZRMA 4M8TA 3RAKA 4F0GA 3F3VA 3W8LA 3UC4A 4C62A 3KRRA 2C5NA 2BDJA 4FC0A 4RX7A 4D28A 4Y8DA 3CQEA 4AU8A 4I93A 4MXOA 1UWHA 2PK9A 3B8RA 3RPVA 1BKXA 2WU6A 2VO6A 3A4OX 4YZ9A 5E8XA 3WOWA 1NW1A 2PUPA 5DYJA 2C3JA 3BIZA 3MJ1A 4JIAA 5IU2A 4WNPA 1G8AA 4WNKA 3QYZA 4JBOA 5A14A 5LCJA 2ZV8A 5LCKA 2WTCA 5AM7A 2BDFA 4HCUA 2B9FA 2QHNA 3T9TA 2YLFA 2J0JA 2C0TA 2UZEA 4WKQA 5HCXA 3OFMA 4ACCA 4J8NA 1TQPA 3TIZA 3D2KA 2X7GA 3VF8A 5LVNA 5KMKA 4U0IA 5KMNA 4NH1A 3PUPA 3QWKA 4D9TA 3ZO4A 3ATTA 1P4OA 2VU3A 3A60A 5M51A 3DCVA 3KRXA 2G1TA 4BCHA 2Z60A 5IQIA 4O0VA 4DAWA 4UBAA 4IAYA 3FMKA 3UNKA 1XJDA 4QMMA 5IDPA 1KE7A 4AZTA 5C8MA 3JR1A 2P0CA 3MFRA 4IDVA 4MQ2A 4TT7A 4RJ5A 4ZSGA 5HGIA 1F5QA 2WTIA 4L6QA 3N4UA 4ZTRA 2I0HA 1XH5A 2WELA 4FX3A 4JR3A 3BLHA 4O96A 3CXWA 1U5RA 1R0EA 4A9YA 4AS0A 2OXDA 4G6NA 3RAIA 3DDPA 1IRKA 3QCSA 4TNDA 4AACA 4D0WA 1UKIA 4AW0A 3PUFC 3I0QA 2REIA 3ORTA 4RIXA 3POOA 3U51A 1DI8A 3ZSGA 4HVDA 2CHLA 2H8HA 1PMEA 1Z9XA 3E93A 3DJ6A 3KULA 4UXQA 5FDXA 4JXFA 3Q9YA 3BQCA 4I6HA 4NZWB 4BDBA 4FIEA 4X6RA 3GC8A 1WMKA 1OPKA 3E8CA 3FZRA 1H4LA 5IA3A 4RT7A 2OJ9A 4FSUA 2FA2A 3RVGA 2F7EE 2PUUA 2YJRA 3NIZA 3DKOA 4X3JA 1PXMA 4EK8A 3OWLA 3P4KA 3FQEA 5EI8A 4NM5A 5AAEA 4QMWA 5CU3A 2W0JA 2JGZA 2Z2WA 4W8DA 5CENA 4EOKA 5LVLA 1KUTA 1AQ1A 3ORNA 3MSSA 2YJSA 4H05A 5BVNA 2F49A 4ALVA 3AXWA 4I5MA 2P55A 4LRKA 3ZSIA 3KXZA 2W1IA 5ANKA 3FI3A 3F5UA 4IM3A 4AGDA 4IM2A 4D4VA 3QHWA 4BF2A 3OCGA 3SG9A 1OUYA 1OKYA 3LM0A 3Q5ZA 3LJ0A 4TZRA 4UYNA 4A9UA 4E20A 5I4NA 5ETAA 4NM7A 3V5WA 5EK7A 3EZRA 5JRQA 3SRVA 5AR3A 4QMZA 2VGPA 3LFNA 2R3QA 4TYJA 2WTWA 4A4OA 3BL9A 4FKGA 3SDJA 2QO7A 4H3QA 4D9UA 4I0TA 4K0YA 1G8SA 2W1DA 2HWOA 4ITHA 4HVHA 4ZTSA 3UODA 3UOKA 2YERA 4CT1A 2PHKA 4I0RA 1G3NA 1GAGA 5HHWA 3U4WA 1SVEA 4OTQA 4ANMA 2JC6A 4S32A 3NNVA 3W2QA 2XVDA 3Q6WA 5AV3A 5C8KA 1JSUA 2OXXA 3NYNA 3WF6A 4A4XA 5CANA 3R73A 2VWZA 3OXIA 3O5AA 2JBOA 3DB8A 4QMTA 5FG8A 3SOCA 1IAHA 2WTVA 4FKLA 3V5QA 4L3LA 3VRZA 5EM7A 4KS7A 5KUPA 2WMXA 2Z7SA 3GC7A 4WIHA 3FXXA 5CYIA 4QP6A 2UZWE 3DB6A 1ZARA 3IECA 5B2MA 5JK3A 4YBJA 3QD2B 4L45A 4DEGA 4QRCA 1J3HA 2HCKA 1U46A 4EHEA 3FL4A 3LFSA 4BIDA 5CEQA 2OZOA 1RQQA 4GEOA 2QOQA 4M13A 5D11A 5L4QA 2VO3A 3UIMA 4C02A 3W0RA 2OFVA 4ZAUA 3V5JA 4E5AX 2YACA 2CPKE 3MWUA 3EFLA 4OTDA 4B9DA 4F7LA 4BKZA 5HTIA 4HGSA 3FI8A 3ORXA 4MUQA 1YHVA 5EW9A 3W0MA 4RFZA 1W0XC 4BZDA 1DM2A 4WA9A 5DVRA 2GS6A 4LV5A 2GPHA 1DAYA 4O0UA 4KIPA 3C5UA 2HENA 2BFYA 5A4QA 2JKQA 3H4JA 5DEYA 2GS7A 2J90A 2X0PA 3KIOC 3ZM9A 3R9NA 1OMWA 5HOAA 4FG8A 5CS6A 1Q8YA 4C4JA 2JDVA 2NRUA 3B2WA 4FIGA 4OBQA 5B2KA 3ZC6A 3QUPA 2XK9A 4FV1A 5AP5A 3WZUA 4BDAA 5CEKA 3IW8A 3MA6A 3MVHA 5EQEA 3L8PA 5JH6A 3TNHA 1YXVA 4P4CA 4FKJA 4RVKA 4NL0A 3F69A 3KKVA 3DBCA 3I1AA 5FBNC 4BKYA 5AR7A 5AP2A 2HIWA 1KSWA 4QQJA 5DBXA 4J71A 2VTHA 2R0IA 5HVYA 4ZTMA 1QMZA 2NNWB 1JKLA 3IW4A 4BTFA 4DG2E 1QPEA 4BCFA 4YU2A 2X7OA 1B39A 1G8KA 5HE1A 4FZ6A 1UV5A 4DA5A 4I4EA 3A99A 5D12A 1U54B 2RF9A 3ZHPC 5IA2A 2UZDA 3AQVA 4O4CA 4LV8A 5CAUA 3TYKA 1BLXA 4J1RA 4DGNA 3UQCA 1V0PA 3HUCA 4YNOA 2OI4X 3R22A 5HLNA 3ORZA 3O23A 5DIAA 4I21A 5JGDA 3I60A 2WTKB 4F6SA 4O83A 4QQCA 4B0GA 2O3PA 1GZOA 4AT3A 2VAGA 1W8CA 4L7SA 4LQMA 2XK6A 4PDOA 2PZ5A 5ANDA 3SW4A 1ZZ2A 3U55A 1Z5MA 3KGAA 3MYGA 3O51A 3R02A 5CWZA 4B6LA 1FINA 4QMXA 3HLLA 4BTKA 4G6LA 4O2ZA 1H1PA 2OICA 3AT3A 5KHWA 3GB2A 3QD3A 4RRVA 4BCNA 3O17A 5DHJA 5I0BA 2GNIA 3TKUA 5AR2A 5A4EA 2SRCA 1GZKA 4OTFA 5HICA 3MB6A 5HESA 4R8QA 5HG5A 1XQZA 4OTHA 2QODA 5JT2A 3WZKA 1YXSA 2ZB0A 3GEQA 4G5PA 5AP1A 5L8LA 3PY1A 4Y72A 3G90X 3LJ1A 3U9CA 2J7TA 3RPSA 2J2IB 4YTFA 3R8ZA 4FYNA 2XS0A 3C0GA 4USEA 3NFFB 4ZMEA 4XUFA 3L9LA 4FIFA 3UVQA 1O6LA 3BQRA 2Q0NA 5AP0A 4O7TA 4MQ1A 4O7NA 5HX6A 4A9TA 3QUDA 5K5NA 2WZJA 1YHSA 5D41A 3OOGA 2UZLA 4KRDA 5HIDA 5IA1A 4DTAA 3R21A 2ITTA 3Q6UA 2UW7A 2YIRA 4C61A 2X6DA 1MRVA 1ZY5A 1V1KA 3BGQA 3FYJX 3VS4A 2Y8OA 5J9LA 1OIUA 4NIFB 5HU9A 1YW2A 1MQ4A 4QDEA 1XWSA 3NEWA 4EZ7A 4FR4A 5AJQA 3EFKA 4R7IA 3H10A 3BE9A 3EMGA 3QRKA 3BE2A 3BGZA 4UALA 4ARKA 2XIKA 4ID7A 3OY1A 4U44A 4AZSA 2C5VA 3IDBA 4ZSJA 5HU3A 1JPAA 3RWPA 4ZY4A 2X7FA 3E3BX 4DH7A 4KUJA 5EOLA 5M4CA 1YWVA 4RIXB 4C37A 2JKOA 2C47A 3OZ6A 1CMKE 5B0XA 4FGBA 3DAEA 3PE2A 2R0UA 3FXWA 4NU1A 2OK1A 3VJNA 2HXQA 3KULB 3MS9A 2GNFA 4ZEGA 5IH6A 3N4TA 3C51A 5JRSA 3TWJA 4E6CA 3LMGA 3S2PA 4FBXA 1CKJA 2IO6A 4P7EA 4WNOA 5CAQA 2CMWA 3PLAE 2ONLC 3R04A 2X81A 2BIKB 4N6YA 5CY3A 5K0KA 4BCQA 4DH8A 4DEHA 4BB4A 3TV4A 2R3KA 1OL2A 5A6OA 2JIVA 1FBNA 2W5BA 4F4PA 3EB0A 2BTSA 3S4QA 3CKXA 4PPAA 3PRFA 1OKVA 3GU6A 3P9JA 3FSFA 2P2IA 2JAMA 3TT0A 2EU9A 3F5PA 3O96A 4MH7A 2R7IA 3BKBA 3IK3A 3W0QA 4KSPA 1M7QA 4GFGA 3TJDA 3VUMA 4BDHA 5BUEA 4IWPA 4A07A 5KKRB 3OD6X 4M7IA 4RVLA 2ITZA 2PUIA 1HCKA 5J1WA 3FHIA 2W1CA 1M14A 1Q62A 2WTDA 4XRLA 3T3VA 1ERKA 3P7BA 4JBQA 5CU2A 4CYJA 2VTSA 4KBAA 5H8GA 4AA4A 5DNRA 4APPA 1J7IA 4AN3A 3QTIA 3QU0A 4D55A 3IO7A 4EZ3A 1Q61A 4ITIA 2XB7A 4JG6A 4AFJA 3EJ1A 3DJ7A 3C9WA 3FLWA 3BEAA 4CFNA 1OL5A 4WHZA 2JDRA 5JQ8A 4EK3A 4IJPA 5AM6A 3HA6A 2QOKA 1PYEA 4G6OA 2BZIB 3R83A 1E9HA 4UMRA 4KKGA 2ZJWA 4CVAA 1YXTA 3G6HA 3O8TA 4OBOA 5EHYA 3K3JA 1VJYA 4JAIA 2PVFA 2YABA 1A06A 2IVVA 5AIKA 3EQCA 4GKHA 4ASZA 3LAUA 5D10A 5DR9A 3TZ9A 1T45A 4YTHA 1QPCA 2XUUA 3ANRA 3P23A 2GMXA 4HPUE 4IEBA 3QXOA 4QP4A 3KXMA 4WD5A 2YITA 3E7OA 4TW9A 4TYHA 4IWOA 4GKIA 2WQNA 2XNBA 4F0IA 3IOPA 5HD4A 2CCIA 4N57A 2Z02A 2BTRA 5K0XA 4M66A 3UP7A 5IQDA 2W05A 3Q4UA 2IWIA 2C1AA 2QC6A 3QALE 3O7LD 5M09A 2HZ4A 4Y46A 5ETIA 3WE4A 1IA8A 2WFYA 4TL0A 2YM8A 1UNHA 3IDCA 4FV2A 4RQKA 4UZDA 5GZAA 4AOIA 4EHZA 5AEPA 4E4XA 3QC4A 4EOQA 5J7BA 4OT5A 2W1FA 2GQGA 4QTDA 5AV4A 2GSFA 4G3EA 3D5VA 4LL0A 4OGRA 4UMQA 1R39A 1TKIA 3FSKA 4QMNA 4YC6A 2EB2A 4I92A 2BZJA 2XKFA 2C0OA 3ULZA 4RIWB 4YHFA 3FYKX 2HYYA 3KXXA 3LCOA 3M1SA 3D2IA 3PPZA 2XBJA 5AUZA 5AR4A 3QTZA 2BRHA 3VJOA 3WIKA 5E9EA 5IQFA 2RFSA 3QZFA 4BTMA 2H96A 4FSTA 1H00A 4JL9A 5EG3A 4LDTA 4U6RA 3VBXA 1LP4A 3AGMA 4IH8A 4BFMA 1OKWA 1MRYA 3MV5A 4QNAA 3OXZA 3R28A 4O0TA 3OW3A 4ENYA 1GIHA 2GS2A 3NUNA 5AMNA 3NVMB 4DTBA 4M84A 5AIRA 3R8PA 4USDA 5A4TA 2X1NA 4AGWA 2W9FB 4JIKA 4AX8A 2E9PA 4XG3A 3FXZA 3F88A 3O50A 5L2TA 4YSMA 2YM5A 3H9OA 3BELA 4C58A 1WVWA 1F0QA 4FUYA 4RVMA 4GU9A 4DCAA 2O0UA 4NW6A 2PVNA 5F94A 2R3PA 2UW6A 4P5ZA 3VS3A 4QMLA 2FSTX 4RIYA 1NT2A 2HZ0A 3FKOA 1URWA 3DV3A 4LOOA 3E87A 4W9XA 4G9RA 1PW2A 2JKKA 2I0VA 2RL5A 3ERKA 4GJ2A 3CKWA 1OGYA 2ONLA 4YZNA 2XALA 3PDTA 2QOHA 2UZVA 2I7QA 5TO8A 4DYMA 2VNYA 4JQEA 5HCYA 2PE0A 5BQ0A 3UO5A 3SOAA 1ZMVA 4RX5A 3QD4A 2VTOA 2B54A 2BAKA 5EOBA 2IW9A 3BU5A 3VUHA 4BGHA 4ZJVA 4EOLA 3R7UA 3MJ2A 5HNBA 5IPJA 3DK7A 3HMNA 4MD9E 1KV2A 2IZTA 1NVSA 3VS6A 4LUEA 3R6XA 4ANOA 3C13A 3CJGA 3U9NA 4CSVA 2BRNA 2WO6A 3OTUA 3PA4A 4DLJA 3WE8A 4NKSA 4YHTA 5IA4A 4L9IA 4FNYA 5DT4A 2F7ZE 1LEZA 3DAJA 1HOWA 2GNLA 1RW8A 2IF8A 3G5DA 3OXTA 4J7BA 5CZHA 3VC4A 5LWMA 4FZAB 2OZAA 2WU7A 5DWRA 3MESA 2GFSA 2JEDA 4RJ8A 3D5XA 2X2MA 4A7CA 1TZDA 3CGFA 3UQFA 4RMZA 3LMHA 4E1ZA 3ZZWA 3NR9A 4CT2A 5F9EA 1IR3A 2W1ZA 4FNWA 3FMDA 2J0MB 4JS8A 4U5JA 1YI3A 5EI6A 3DU8A 4YZDA 5IA5A 3DPKA 4ANSA 4O0SA 4ZZMA 2UW9A 5BMMA 5I9VA 2CSNA 3MH2A 3MBLA 2VO7A 3D0EA 2VO0A 4YP8A 4WOVA 5CQWA 3DBQA 3JUHA 3JY9A 2IZUA 3OEFX 4IX4A 2XKDA 3V04A 1UWJA 4AXFA 4CLIA 2G2FA 4U42A 2Y7JA 2PMLX 3COKA 3UNZA 2C6EA 3D15A 4HYUA 3NW7A 3DTCA 2YN8A 4WG5A 3F6XA 2O2UA 2B1PA 3P1AA 2CLQA 4GT3A 4XG2A 5FXSA 5HIEA 5EM8A 3FC2A 5KO1A 3FI4A 4FT5A 3CPBA 5KNJA 5E90A 1NVRA 2VTQA 1PMVA 3I6UA 4PMMA 2R3LA 5FDPA 3M42A 3P0MA 1SVGA 5HLWA 3MDYA 4U81A 4YURA 4F6UA 4QP2A 3BYVA 4BRXA 3UMXA 3E8DA 2Q0BA 4F9WA 1W82A 3VS7A 3KC3A 4CMTA 2QOCA 4FIHA 5E8ZA 1PY5A 3CJFA 4DE4A 4O4EA 2I1MA 4EJ7A 4FT3A 3A7IA 3ZRKA 4QMVA 5H9BA 4FKTA 5EH0A 2JIUA 1Q8UA 3QA8A 3TL8A 3WF7A 1P14A 4ANQA 4L46A 3QC9A 4BI1A 2XK7A 1OPJA 4AAAA 5JGAA 3EQFA 4IW0A 3P78A 4EJNA 3HMMA 2HY81 4EH5A 4KBKA 3S95A 5HX8A 5M06A 3NZ0A 3W55A 5EDPA 1A48A 1UNLA 1IA9A 3SGCA 4YLKA 4TWNA 4YPDA 3FZSA 4I41A 2XKEA 4TTHB 2ZVAA 4ZP5A 3P08A 4MXZA 3VS2A 3F9NA 3KEXA 2XH5A 4RVTA 1U5QA 2B7AA 2XYUA 2G01A 4BCOA 4BC6A 4LOQA 4HCTA 4QYEA 3UDZA 2VWYA 4FKIA 4NWMA 3R7VA 4E5WA 1Y8YA 3CLYA 3JPVA 4D2RA 3GT8A 3DXQA 4I5PA 2IVSA 4NFNA 5L6PA 4XLVA 3KL8A 3V8TA 3UTOA 5A46A 2CLXA 3NCGA 3R7OA 3VHEA 4C59A 2Y4IC 4X21A 3HMPA 2ZAZA 1JQHA 2VWUA 4NM0A 3VVHA 3PFYA 3CY2A 1PXOA 5IQEA 3GENA 3QLFA 4KIQA 3F3WA 5M4IA 3KXHA 3OBJA 3I4BA 3FDNA 4YC3A 4QTEA 4TYHB 2C6MA 5C01A 4JRNA 2JLDA 5CAVA 5HORA 3UP2A 4RPVA 4IB5A 2O65A 3DKCA 5KCVA 3UGCA 3UIUA 4FKUA 3NPCA 2G15A 4R5SA 3HNGA 4U8ZA 1R1WA 4EC8A 3UZTA 5CI6A 3C5IA 3FMEA 3KXNA 3HAMA 5D7AA 3P86A 3NRMA 4LRMA 1YOJA 2Y6OA 1YOLA 2WMRA 1H25A 4PP9A 4E6DA 5JN2A 1PXKA 2UZNA 3KCFA 4CFWA 2X9FA 4XP0A 4MKCA 4BICA 3BPRA 4G1WA 5A9UA 2XNPA 3UDTA 4XBRA 4ALUA 4AXAA 2UW3A 2UW0A 3R2YA 4YZCA 4ZZOA 2LAVA 1E1VA 4BDJA 2WOUA 3BRBA 4YSJA 2VTNA 1Y6BA 1XO2B 1WBWA 2V22A 4NK9A 4FTOA 3I6WA 3KRJA 3DBEA 3OOMA 4MCVA 1SM2A 4O1OA 3RGFA 4C36A 2E2BA 3TUDA 1H1SA 4FA2A 1JOWB 3R8MA 5DA3A 4BWKA 5AAGA 3H9RA 3DQWA 3DTWA 1PKDA 4HJOA 3F61A 5AAFA 5DPVA 2PE2A 2YWPA 4EHVA 5DRBA 5IUGA 3RK5A 5DE2A 1OBDA 3G9NA 4EL9A 5J9ZA 3DBDA 4LOPA 1M2QA 2F7XE 2JFMA 3PSCA 4MNEA 3LFDA 3LQ8A 3FLQA 1YI6A 2VN9A 1BI7A 2X2KA 2HWPA 5ANJA 4C4GA 3TUCA 4USFA 4XG6A 2CNUA 4DDGA 1ST0A 4W4WA 5FWKK 5JFWA 3PJCA 5AV1A 4OAVB 1O9UA 5FGKA 5FEDA 3TNWA 4F1MA 4RIYB 3W10A 4I6FA 4F1OA 1H1QA 5C4LA 3FHRA 2QG7A 3WI6A 4IMYA 1JVPP 5CALA 3C4FA 3NS9A 2E9VA 2QR7A 4GG7A 4QTBA 1W2FA 4H58A 4RBLA 3L9MA 1ZOGA 1K3AA 3TDVA 4YJQA 4KA3A 2CGXA 3FMJA 3RCDA 3Q9XA 3SX9A 3QTQA 3CTJA 5L6WL 5KBQA 3IQ7A 4BI2A 3RALA 3LW0A 3C1XA 4E8AA 4GRBA 4FTUA 3QQLA 3OCSA 5CU4A 3TM0A 2WPAA 3REPA 4KIOA 5AUTA 5E8YA 1XH6A 3PTGA 5HG7A 3GFEA 3ROCA 3VHKA 3QWJA 5BVDA 3QCYA 1ZAOA 2R3IA 5JMSA 2P2HA 4U3YA 4U79A 3ZYAA 2FGIA 5E91A 2R9SA 4GIHA 4HNIA 4BZOA 2GHGA 4MBIA 5DT3A 3W8QA 3IG7A 4C38A 4DGOA 2P3GX 4E5BA 1VLRA 2BFXA 2WMAA 1B6CB 2F9GA 4AF3A 4EQCA 3IONA 4W8EA 3RZBA 4DBXA 3GGFA 3MVLA 2A2AA 3QRJA 4X2JA 5HBHA 2Y4PA 1M2PA 4O7LA 4I3ZA 5GIOE 3L8SA 4I6QA 3O71A 2OZAB 4NIFA 4LG4A 5ITAA 4O22A 3PRIA </