2PE1A

Crystal structure of human phosphoinositide-dependent protein kinase 1 (pdk1) {2-oxo-3-[1-(1h-pyrrol-2-yl)-eth-(z)-ylidene]-2,3-dihydro-1h-indol-5-yl}-urea {bx-517} complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
275
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Indolinone based phosphoinositide-dependent kinase-1 (PDK1) inhibitors. Part 1: Design, synthesis and biological activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pe1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pe1A01
3FY0A 2OJIA 4I5HA 5CANA 3EFKA 3BBWA 3W33A 4UMPA 3NW5A 4I6HA 3B2WA 3QFVA 3MPTA 3TUBA 2EB2A 4O0VA 2W7XA 4D55A 4I93A 4YZDA 1OL5A 5IQDA 3NUSA 2XIRA 2NPQA 4EJNA 3H3CA 4WSYA 3QTRA 5TT7A 3EMGA 2ZM3A 4A9YA 5HHWA 4CZTA 4ZK5A 1JSVA 4C33A 4O7TA 3LM0A 5FM3A 2XCKA 2VWUA 2UZOA 1URCA 2C3KA 1KOAA 4Z7HA 5CXHA 3KB7A 2ZMDA 3LJ1A 4P2KA 4CTCA 4IX5A 3ULZA 3A7JA 2ITUA 3ZM4A 2X8EA 4ZLZA 5BQ0A 1O6LA 3O71A 3EQRA 4RZVA 4DGMA 2B9FA 3FXXA 1QPCA 4KKGA 5HCYA 3RAWA 5F1ZA 3PXQA 4XG9A 3TWJA 2R3GA 5JN2A 2Y4IB 2XM9A 4G5JA 1YXVA 2GSFA 5E8SA 5BNJA 2VO3A 4AT4A 4BTFA 1NVRA 3KULA 4FTLA 4OGRA 4EQUA 2QHMA 3ZSHA 1DM2A 4FI1A 2RIOA 4LMNA 4PNIA 4R7BA 5K3YA 2HOGA 2RL5A 3EOCA 4KKHA 3O51A 1JBPE 1FMOE 2ITWA 2CKQA 3ZCLA 3PRIA 3VS7A 5FGKA 4CMUA 3HDMA 2W4KA 2PPQA 3RM7A 3G90X 4O0XA 4CV9A 3PJ8A 2OXXA 4EOSA 4P90A 1U5QA 3MDYA 3VUGA 3ZDUA 3QALE 2X7OA 3KMWA 3RK7A 2XJ2A 3ZZEA 5M08A 5HBEA 2UZEA 2P4IA 2DUVA 3ZSGA 3AT3A 3LFQA 1RQQA 5HE3A 4NM5A 4L52A 4DLIA 1PJKA 1SVGA 2CCIA 2P33A 5BVEA 4XG8A 5AP6A 1YHSA 4QTCA 2R3HA 3R9NA 2JIUA 4JDHA 1U4DA 3UZPA 3JXWA 1SMHA 2I7QA 5C1QB 1P2AA 5FEDA 2J0LA 2VWWA 4C4JA 5A4TA 3NUXA 4W8DA 3WILA 2FH9A 2OI4X 4QP3A 4JR7A 3BGQA 3COIA 4L53A 4LGDA 5GJGA 5I9VA 3GC7A 4YC8A 3C0IA 4LUDA 1PW2A 3L1SA 1Q3WA 4V04A 4J97A 3SOCA 1Q99A 5L8LA 1Q61A 3DPKA 5CVFA 3ZU7A 3DBCA 4WA9A 4I5MA 3QKKA 2FO0A 3IOKA 3CXWA 3CQUA 4E5AX 3V5LA 5JFWA 4BRXA 3Q53A 4BIBA 3BGZA 3PY0A 3QX2A 4MEDA 1YXUA 4AE9A 2V55A 4WIHA 2QI8A 4M3QA 2IO6A 4IC8A 4EC9A 5K5NA 3FI4A 1WFCA 2ITYA 1M2RA 4KBCA 2C3IB 4O38A 5M57A 3R00A 4LV8A 4USDA 4BBMA 4IEBA 1Y8GA 5LCJA 4J71A 2WU7A 4BWKA 1NXKA 5CEMA 3BEGA 4CKIA 1PY5A 2WGJA 4IWPA 4YLJA 3RPRA 3LKMA 1H0VA 3IW4A 2ZB1A 5JFXA 3I5NA 1IG1A 4X2GA 2VTPA 4Q5EA 4AS0A 2BRBA 5ETCA 3DY7A 4BCQA 1WCCA 5J7HA 3SG8A 3RCDA 2BVAA 3C5UA 3I5ZA 5AA9A 4RJ4A 3ERKA 3P08A 4L3PA 3NIZA 4EYJA 2BILB 3PIZA 4RWLA 3U54A 2EWAA 4MD7E 5F20A 1QL6A 2RKUA 2VWYA 4QP4A 4W4YA 3FV8A 4XS2A 5I0BA 4OBPA 4HZRA 1B39A 3ZRLA 3DKFA 3CY2A 2J9MA 3JUHA 3UDBA 3KY2A 4YR8A 3QTWA 2OZAA 5EYMA 3Q4ZA 5JFVA 4RC4A 2XBAA 4NSTA 2DWBA 1YW2A 3GVUA 3MTLA 4QMPA 5D12A 3R7OA 3VRYA 4ASEA 2H34A 4BCOA 1I44A 4BCIA 2NRUA 3DXPA 3SQQA 4RFYA 3PXRA 3F2AA 2EXEA 3UOJA 3AOXA 3KL8A 4MNFA 2BALA 3KF4A 3KULB 5AP4A 5CEQA 3SRVA 4QMZA 3MFTA 4PL3A 1URWA 4F1TA 4YHFA 3NIEA 4CNHA 1IRKA 1JKTA 3E92A 5BUJA 4I4FA 3U51A 4TYHA 4KKEA 5KUPA 2QLQA 2UW6A 1YOJA 3BU5A 3NUAA 1PXLA 3R9OA 3IW5A 3LMIA 5CAQA 3DBFA 5E1SA 2YIYA 2GQRA 1W98A 3TCPA 4D2TA 2ESMA 2J5EA 5IA4A 3UQGA 4IC7A 1LPUA 4XV3A 2EU9A 2QQ7A 2B4SB 4H39A 5ACKA 4YZ9A 2YABA 5ICPA 2G2FA 3VF8A 4S34A 1PYXA 4O0TA 2CCHA 4A9RA 2ZB0A 4OTFA 5JFSA 2IZRA 4EQCA 3DDQA 4M7IA 3WZEA 4PF4A 3LXNA 3IGOA 4AUAA 1S9IA 4CMOA 4EWQA 4LL5A 3CPCA 3NX8A 5EW3A 5KZ0A 5F9EA 1FBNA 4KIKA 1APME 4Z16A 1PXJA 5CEPA 5FG8A 3ZZWA 5HLWA 3LPBA 5HNBA 2IW9A 3U4UA 1NVSA 3KU2A 3UBDA 3DJ5A 1J7IA 4QOXA 4BI2A 5CF6A 2XIKA 4BKJA 2C1BA 4MCVA 4JQEA 3BHVA 4IB0A 3AGLA 3I1AA 3W8LA 1ZXEA 3OHTA 3VVHA 2WD1A 3A7GA 5IUIA 2G01A 3AC2A 4L68A 3PPKA 4M15A 2CN8A 4CYJA 3WF6A 3LFCA 3QZFA 5H9BA 5HIDA 3ULIA 2OICA 3TZMA 4HOKA 4PV0A 5A9UA 3O8UA 2O2UA 3FSFA 4TYEA 4ZP5A 4NM0A 5AUYA 3VBYA 4AAAA 5LVOA 1CMKE 1B6CB 1WAKA 2VX3A 3IK3A 4QMWA 4DE4A 2WXVA 5HCZA 4JI9A 4IVDA 2R7IA 1NW1A 4B6LA 2PE0A 4YURA 3DB6A 4BCKA 2XNGA 2PVYA 2CKOA 2BZHB 3CBLA 3EKNA 4FSYA 5CU4A 3UIBA 4MXXA 2JFLA 4U43A 2CLXA 3UVRA 4RRVA 3P86A 4EK5A 5KNJA 5IMEA 2CLQA 2Q0BA 3NCZA 4GIIA 4RBLA 4DEHA 1WZYA 5C01A 2F7ZE 2UW3A 1UU8A 4YJQA 4JBVA 5A4LA 3U55A 3MH2A 4FTOA 5CU6A 4RWJA 3VUTA 3ZO4A 4R77A 4D1XA 2PUIA 2HZ0A 3GXLA 4DEDA 3D14A 2XVDA 3QRKA 4K77A 5KMIA 2W99B 2VN9A 3CKWA 2XK6A 2VRXA 2FVDA 3TIYA 4O0SA 3UE4A 5LVLA 4BHNA 3GU6A 5BVKA 1LP4A 2B53A 3G33A 3F6XA 5DG5A 3QU0A 4QPSA 3Q9YA 3DNDA 4TN6A 5GJDA 5AR8A 5HVYA 2OZAB 2PVFA 3VRZA 4KABA 2VZ6A 3DBQA 5AR4A 5FM2A 3V6RA 5CF4A 3WE4A 1P5EA 1JLUE 4E5BA 4RVTA 5HCXA 3R8LA 4U80A 4YZCA 5E8XA 1RW8A 5B2KA 3DAEA 1PXNA 5K4IA 3FC1X 4U45A 3LXKA 3FAAA 2YIQA 4CLIA 2PMOX 1XH9A 4ZSGA 3AMAA 2Q0NA 4EH3A 4EH4A 3B2TA 5D7AA 2ONLA 4B8MA 5L6OA 3GQIA 4BKZA 5LQFA 5AUVA 4BCGA 2HZNA 2CNQA 2HK5A 4R1VA 3PPJA 3W16A 3SRVB 2IJMA 3LFEA 3OBJA 3OY3A 3OOGA 5E8WA 3UMWA 1KE8A 4PTGA 1V0OA 2WMWA 1VYWA 4TYHB 5LARA 4WRGA 3AC5A 3F9NA 4FTUA 3KQ7A 4QP8A 3T9IA 4ASZA 4OTIA 4IAKA 3V8WA 3DTWA 2VD5A 1A48A 4C59A 3GCVA 2P2IA 2BRMA 3D5VA 4WOVA 4ID7A 4UN0C 5A6OA 2VX1A 3HV6A 3IW8A 2ZV2A 4JX7A 2VWVA 1JSTA 4QMOA 4XG3A 3ZFXA 3GU8A 2R7BA 3QHWA 3FBVA 3RALA 3K3IA 5L6PA 2V22A 4GK2A 1H01A 3DNEA 1F3MC 2UV2A 3BRBA 1H26A 2XK3A 5K5XA 5DMZA 3BYUA 4DH3A 3C4XA 4XG6A 4U3ZA 4RC3A 4YC6A 4AGWA 4EOQA 2GFCA 3FHIA 2QKWB 2YZAA 3P7AA 4HNFA 4YJOA 2W1CA 4XMOA 3DKGA 4ZMEA 3PY1A 2GNFA 1H4LA 3BLHA 4F7SA 3ZSIA 4D2SA 4ZJJA 4WG5A 3U87A 5J1WA 5HORA 3LCKA 1Q97A 5LVMA 5FXQA 4DG2E 3BKBA 3TZ9A 4ITHA 3R83A 5L4QA 2WEIA 4R7HA 1SNXA 2OH0E 3E8DA 4R7IA 3AG9A 1JSUA 4UEUA 2YM7A 3R63A 2JKKA 2WKMA 2RF9A 4NU1A 4HZSA 3LFFA 4ZIMA 4BI0A 3QZIA 4MBIA 2B9JA 4UX9A 2IN6A 4J8MA 4QP9A 4WG4A 3ROCA 4E7WA 2WMUA 4E8AA 4EJ7A 4O2PA 3MJ1A 1T45A 4W8EA 3NYVA 4MXYA 5HO6A 1KE6A 2IVSA 3GT8A 3MH3A 4DFXE 5C9CA 4V01A 3UC3A 3ZONA 3NAYA 2HYYA 3QQJA 5AV3A 4TXCA 4HGLA 4GYIA 2JDRA 5EW8A 3UYTA 3HL7A 4FL1A 1R3CA 4C35A 4AXAA 2BDWA 1M2QA 2WMSA 4F7NA 3LM5A 3UO5A 1XJDA 3HP2A 4EOMA 1F5QA 3QRTA 4RG0A 3CGOA 3LFAA 4I92A 3JY9A 2QO2A 5C8NA 3UZTA 3TNHA 4MBJA 1OKWA 4W9XA 2B9HA 3R9RA 1Q3DA 4M97A 2GTNA 4RIXA 4TNBA 4CMTA 4CV8A 2GNJA 4IW0A 3DGKA 4FIIA 5G6VA 5EDPA 1ZOGA 3F3UA 4LQMA 4C57A 2YFXA 4FC0A 5IU2A 4I0TA 4CT2A 3TV4A 4DFNA 2AYPA 3N4UA 3QYWA 3PSCA 1GOLA 2UW5A 4HCVA 5KBRA 2UZLA 4EOOA 4ACMA 5CWZA 4FKWA 1H24A 4YJVA 3PXYA 2ITNA 4I4EA 5DR9A 4O21A 3PWYA 4YO6A 5T68A 3V51A 3GU4A 2ZYBA 2YERA 5M09A 4BTJA 5HO8A 5J9ZA 2YDJA 4EUTA 1PXOA 3BX5A 4KB8A 1YHWA 4M12A 4AG8A 4FIJA 4KAOA 4L9IA 3REPA 3NAXA 4CG8A 4UWBA 2PVMA 3F82A 2OJFE 2JDVA 3FDNA 2XZSA 3AGMA 4XG2A 4XUFA 4G5PA 3BV2A 4EQMA 1TVOA 1PXIA 2VTNA 3GC9A 4XOZA 3ZXTA 3B8QA 2PVJA 2JIIA 1REKA 3PSDA 2R3QA 4MNEA 5HU3A 3UOLA 5I4NA 5J79A 4QNYA 3HAMA 4M0ZA 5CU0A 2OJ9A 3KF7A 2I0HA 3QTQA 4YMJA 1LEZA 4XG4A 3FSKA 4D5HA 4ZZOA 4O81A 4DEAA 1H25A 3QA0A 2UZDA 4JG7A 5HO7A 1DS5A 3WIKA 4ZXTA 3OWLA 3WZKA 3ZTXA 3FI3A 1MQBA 1YWNA 3R7EA 4F6WA 5K4JA 2BTSA 1MRVA 2JDOA 4UZDA 2O5KA 4R5SA 3P4KA 5HG5A 5J95A 3BE2A 3QD0A 3EJ1A 3RKBA 4E6AA 5I5ZA 3FQEA 3MBLA 4GFGA 3R71A 2V62A 5CT7A 2XK4A 3BPRA 3W18A 3W2OA 4HCTA 2A0CX 4ZS0A 1Z9XA 4AP7A 5DGZA 5AR5A 3ZRKA 2EXCX 3NYNA 2CKEA 3V5TA 3HRBA 1BYGA 3LXLA 4K1BA 3RZBA 3MN3A 3Q9WA 4XYFA 2CMWA 3PA4A 4QYHA 3HMNA 3TACA 3SA0A 4QPMA 3Q4CA 4Y5QA 4D4RA 2RFDA 2W4OA 2NP8A 1O6YA 4WNOA 3W2PA 3QUDA 1P4FA 4XOYA 3C9WA 3HAVA 3MA3A 4IJPA 4NFMA 3GC0A 4MD9E 5EM5A 4CD0A 3R2BA 3BWJA 3S1HA 1PKDA 4OW8A 5G1XA 1Y91A 4QT1A 2VU3A 3TJCA 4JDJA 4PX6A 4BDBA 4L3LA 4F63A 5BVOA 3P9JA 4L43A 2YM5A 3EQPA 3W2CA 4DF3A 4NW5A 5CEIA 3U9CA 2CNVA 3FLSA 4GVJA 5DEYA 4A7CA 2QOFA 1XQZA 2VTTA 3OCTA 2PUNA 4K18A 4D2VA 5AMNA 4C61A 4E6QA 2ZDUA 3V5QA 2BTRA 2XS0A 4G2FA 1ND4A 4DTBA 4EZ7A 4FZ7A 3HDNA 3SOAA 3VQUA 1ZAOA 2YM6A 5JMSA 2PVLA 4IH8A 4ZTSA 3MB7A 3GP0A 3MH1A 4X6QC 1FQ1B 4BIDA 2C69A 4L00A 2B9IA 2QOCA 5BVFA 4ERKA 3PA3A 5A4EA 3CLYA 4TYJA 5CF5A 3SD0A 4E93A 3EWHA 2ITTA 1OVEA 5JRQA 4IXPA 2PMNX 4IZYA 5AADA 1G8AA 4FKIA 3A4PA 3BYOA 5GZAA 1ZMWA 5LOHA 2C5VA 4JJRA 3OP5A 2J7TA 2QO7A 2HAKA 4YPDA 5AIKA 1UVRA 3OZ6A 4DGOA 4GT5A 4KSQA 4FSNA 3ZLYA 2XBJA 5I9YA 2CDZA 3BCEA 4PQNA 3LLTA 2XIZA 5ITAA 1XBBA 2B1PA 1I09A 2XNEA 3LFNA 1KE7A 3ACJA 3SXRA 4PP7A 3P1AA 3N9XA 2NO3A 4IZ5A 4JAJA 5FXSA 3ANRA 2OLCA 5HGIA 5CY3A 2G1TA 1VR2A 2ONLC 5CSWA 4Q9ZA 4WBBB 3FKNA 4Y72A 4ANSA 4D0XA 4QMNA 2CGUA 4N6ZA 1LUFA 3F88A 3O96A 4KIQA 4PUZA 5CEOA 1ZARA 5L2QA 3VHEA 3W10A 3PVWA 2X8DA 4DITA 5E4HA 3PJ1A 3EN4A 4WUNA 3Q2JA 3NSZA 4IX3A 1Q41A 3FLQA 3MSSA 4C02A 5FQDC 3U9NA 4UYAA 4BCHA 2X7FA 3DS6A 4XBRA 4AW2A 5CENA 2Z7QA 3IDCA 4FKTA 5HE1A 5IKWA 4I21A 3Q96A 4NCTA 4BI1A 1IASA 3MH0A 2XK8A 4C3FA 4O7ZA 3THBA 4D2RA 1OIQA 2H9VA 3II5A 4JG8A 1ZYCA 3TNIA 1CM8A 5BYYA 2WTKB 3SW7A 4FNXA 4FK6A 4RJ7A 1H1RA 1BLXA 2B55A 3KK9A 3PJCA 1Q8TA 3VS6A 3FHRA 3Q9ZA 1H1QA 4F08A 4HVHA 3DLSA 4DFBA 2XNOA 4EYMA 4FYNA 4MF0A 3Q3BA 4X0MA 3H0ZA 2Z02A 4QYFA 4FL3A 3SG9A 3TV7A 1UNGA 2A1AB 2XH5A 4I6BA 5F4NA 3TG1A 4FIHA 5M53A 4RLLA 3QD4A 4M0YA 3H4JA 4GJ2A 5CYIA 4EH9A 4AT3A 5B7VA 3A7HA 4WG3A 3ORKA 5EKOA 4QP6A 4IQ6A 1K3AA 4YTCA 2VTQA 4JIAA 3CS9A 4QQ5A 4H36A 3QBNA 4CG9A 5FEQA 1W8CA 3FMMA 4CFFA 4AU8A 1QPEA 3KKVA 3MESA 1OPLA 4F70A 4FE2A 5D10A 4DBXA 4PMPA 3TUCA 4PTEA 5KBQA 3SHEA 3HV4A 5JZJA 1XH7A 2PK9A 4GUBA 4EH7A 3MIAA 1W83A 2FB8A 4DCEA 5JKGA 4H3PA 4TWOA 4AQCA 3A60A 2ITPA 4FSMA 3WF8A 4YLLA 3F3VA 4DEGA 3VBVA 4MH7A 1O6KA 5CSVA 3GCQA 4U41A 2QOIA 1OKZA 4CFUA 2WHBA 3Q5IA 5JK3A 3UPZA 3IPHA 3HEGA 1UU9A 3MV5A 4RJ3A 2JIVA 5CS6A 4C7TA 2IZSA 4FR4A 4CFWA 3FJQE 3T3UA 4ZLOA 2QKRA 4NIFA 4CCBA 5E7RA 2VO0A 4IAIA 4XG7A 3WI6A 1IR3A 1V0PA 2VTAA 5IUGA 4KBKA 4XP3A 3F2RA 4DTAA 3Q9XA 2PZ5A 4G31A 4M8TA 2BMCA 4FV6A 4I41A 3MA6A 4NM7A 5HE0A 2C0OA 4I0RA 4NT4A 5AUUA 3EYGA 3L8VA 4FT0A 5EDQA 3LXPA 1DAYA 1SVHA 2VTOA 5AP1A 3CD8A 2VTMA 3RZFA 4RQKA 3CY3A 3Q52A 4DHFA 3VF9A 4XEYA 1JWHA 3PPZA 1YI4A 3KEXA 2GDOA 2VTJA 1M52A 3DQXA 4MK0A 3EIDA 3KK8A 1ZOEA 4NK9A 2OU7A 3DJ7A 3CKXA 5EI6A 1YKRA 1ATPE 2C30A 2Z7LA 3QTIA 1GIJA 1JKLA 3S95A 3RAHA 2JDSA 4XLIA 3WOWA 3K5UA 2PMIA 2GHGA 3QF9A 2OXYA 5CVHA 4AN3A 3HRFA 4LG4A 2IPXA 2OIQA 4X3FA 5DNRA 4FKJA 3QX4A 3LJ2A 2BUJA 4L44A 1TQIA 3B8RA 1JQHA 1VYZA 3H9OA 4AN2A 3IQ7A 5HBJA 4W4VA 3R8PA 3VN9A 2XYNA 3C4CA 4B0GA 2VTLA 4CQEA 1H27A 3VAPA 5J9LA 1U59A 1YI3A 4FMQA 4QP7A 5GJFA 4FZAB 3QQFA 3ZUTA 3PY3A 4AGDA 5DI1A 3LW0A 4ZZMA 5FTOA 4LRJA 4WSQA 1XWSA 4O2ZA 3PA5A 5GINE 3PWDA 4FV8A 4U42A 3NGAA 3ROYA 3OW4A 2BDJA 2X2MA 3A8XA 4OTDA 5IA0A 3E8CA 2WTKC 4E4NA 4FV5A 4DEIA 3OWPA 4UY9A 1ZYLA 4QNAA 4UXLA 2QOOA 3UGCA 4LOOA 3NZ0A 4PMTA 4GRBA 4RA4A 5KHXA 4ZMFA 1UU3A 2R0UA 3FLNC 3LQ8A 3HNGA 3PJ2A 4OR5A 5AP0A 3KXMA 1FINA 2ZMCA 3BIZA 5FTQA 3R6XA 3QCXA 1E1XA 3S0OA 1ZZ2A 3L9NA 5AEPA 5IQEA 4QTBA 5AP2A 4JIKA 5AA8A 3G9NA 3E93A 4P4CA 5AAFA 2Z2WA 3RPSA 4YJRA 5DFPA 3UODA 3ZFYA 2XRWA 3TDVA 3EFJA 4ENYA 3DFAA 3BHTA 5A46A 4FKRA 1G8SA 4DGGA 1XO2B 4DC2A 2CKPA 4F4PA 3POOA 1NT2A 4G9CA 3D7TA 1WVXA 3DK3A 3QZHA 5FRIA 2W5HA 2XIYA 3VBQA 4A4XA 4BCFA 4H3QA 5EYDA 5B2LA 3W2SA 3K3JA 2GS6A 1J3HA 4G34A 3HV7A 3M2WA 3HZTA 3A61A 3DAJA 4A06A 1Q8ZA 4AZVA 3Q2MA 4R78A 2XEYA 3BBTB 4YZMA 1A9UA 3C5IA 4IHPA 4FSUA 3R01A 4JLCA 5I9UA 2FUMA 2X6DA 5IQHA 4TRLA 4EEVA 3ETAA 4MKCA 4GL9A 2IVTA 4QMMA 4ERWA 4NIFB 2XA4A 4I24A 1WBSA 2RGPA 3OC1A 5JSMA 2W5BA 5CSHA 1WBOA 2PYWA 1UWHA 2WMAA 2XK9A 5H2UA 4MTAA 2Z7RA 4EUUA 2C3LA 3MFRA 4HCUA 3SAYA 2OF4A 3LFBA 4XJ0A 3C4EA 4BBEA 3FI8A 4L67A 4F1OA 3ACKA 4AGUA 2ITXA 1W82A 3IW6A 3NRMA 3TUDA 2PU8A 5CI6A 4M84A 5KZIA 3VS4A 5DRDA 5E1EA 2OIDA 4R3CA 2YAKA 2CGXA 2J90A 5F94A 1GZKA 4FKOA 3GCSA 3MPMA 5A6NA 5HKMA 4WD5A 1UV5A 3LZBA 3W2RA 3ZUUA 4E6CA 5A4QA 2QURA 3TT0A 3NDMA 1GZNA 2PZPA 1U54A 4IADA 4FEUA 1Q5KA 4NEUA 5HQ0A 3PDTA 2W05A 2QOKA 3TM0A 4GFOA 2C68A 2X4ZA 2WB8A 4EZ5A 5LJJA 3CTJA 4P7EA 1KWPA 1ZRZA 3BELA 3FQSA 1XKKA 3R7UA 3FZOA 4AN9A 3L8PA 4FKVA 2LGCA 4R8QA 3D15A 3PVGA 4G3CA 5FBNC 5IA2A 1VEBA 2O64A 4X3FB 3C13A 1SYKA 2Y0AA 4C8BA 5J5TA 5KO1A 3BQCA 5ANJA 2Y4IC 4FOCA 4PDYA 1QPDA 1ZMUA 4GS6A 4I94A 2WQNA 2XKFA 5EK7A 4YJSA 4FSQA 3IDBA 2BFXA 1P14A 1MQ4A 2B54A 3HX4A 3KXXA 3VS0A 4FL2A 4WHZA 1E1VA 3WYYA 3F3ZA 3RPVA 3VIDA 3DTCA 2QU5A 2BPMA 3KRLA 4BDEA 1RE8A 4NCTC 4QMLA 3LE6A 3I0OA 1W7HA 2WTIA 2C6OA 4ZTRA 4A07A 3EQIA 3DZQA 3Q4UA 3D9VA 4O1PA 4ZY5A 1FGKA 5AV0A 1V0BA 3Q32A 4AE6A 4A9SA 3GCUA 2BRHA 3VJOA 3PG1A 4RWKA 2UW9A 1OI9A 2ITOA 3H30A 2IWIA 4UMRA 5DR2A 4YU2A 4TYIA 2F2UA 3F5PA 2JEDA 4QMUA 3TKUA 4IANA 3MI9A 3PXFA 5DIAA 5LVPA 3GOPA 5AR2A 3QWJA 4KS8A 2XNBA 2J0MB 4AZFA 3BLQA 4YSMA 1WBVA 4BHZA 2ZOQA 3O7LB 3D7TB 5EOLA 3QZGA 3ZLSA 2W9FB 3GOKA 3UMXA 4C4EA 4KS7A 3R7VA 3CQEA 4MVFA 2RFNA 4U97A 4AFJA 1NA7A 2VTIA 4DH8A 3HMOA 4Z7GA 5HNIX 2PUPA 5HG8A 4Y8DA 3ORNA 4RX8A 4FGBA 3E8EA 4D58A 1OM1A 4O83A 3AC8A 3QTZA 4W9WA 3DK7A 3UO4A 2YITA 3P79A 5K0XA 1HCLA 4XCUA 2VV9A 3AD5A 3QGYA 4WNPA 3MGYA 3PIXA 2HW6A 4S30A 4J95A 3CTHA 1G5SA 3FLYA 1XHAA 3M1SA 4FT7A 4G3DA 3RM6A 4DH5A 2WFYA 4HVSA 4RX5A 1R78A 1YHVA 4AOTA 3OS3A 4M14A 3D5XA 3QAME 4RIOA 4BDAA 2O8YA 1V1KA 4D4VA 4FUXA 1H8FA 3C0GA 4TWNA 2GNGA 3FZ1A 1ERKA 2NRYA 3F69A 4FSZA 1OIUA 3C4WA 3U4WA 4IB1A 4WT6A 1REJA 5ETAA 1VJYA 3O2MA 4ZJIA 4FTKA 3GFWA 5AP7A 4BFMA 1DAWA 2FA2A 3CP9A 1J91A 3IW7A 4CFMA 2W5AA 4RIWA 4BYJA 5KMKA 1U54B 3HYHA 5HG9A 3EL8A 3PVUA 2R9SA 4YJUA 4BKYA 3K2LA 3PTGA 4NZWB 5AV4A 2AC3A 4FSRA 4Y5HA 5AUWA 5DYJA 2J0JA 5DR6A 2VTRA 3L9LA 5EDRA 2R3RA 4BICA 2PWLA 5LXMA 5DT4A 3BGPA 4KA3A 4B9DA 3MFUA 4AX8A 1UU7A 2YAAA 4EH6A 5GZ8A 3UO6A 1SZMA 4R1YA 3WF9A 4U3YA 4FV7A 1W0XC 4IDTA 2XB7A 3LCDA 3QQUA 4M67A 2E2BA 5A14A 2R3IA 4XV1A 1GZOA 4FTAA 4IAAA 3N4TA 4D2PA 3PVBA 3FZTA 3JY0A 4I1ZA 2R64A 3CQWA 4BGHA 5M4IA 4IM3A 3RWQA 4TL0A 4IMYA 3LMHA 4R6VA 5D7VA 4K9YA 4X3FC 1MRYA 5DOSA 3KREA 4RX7A 2VNWA 3IOPA 1YXXA 3OW3A 4JS8A 4UMQA 4FVPA 1ZYJA 2HWOA 4U8ZA 5EQPA 4BN1A 3CCNA 2VWBA 3JVSA 3MIYA 4FEXA 4AT5A 3CIKA 3OEZA 2C5XA 4X7QA 4O6EA 1FVRA 3HA8A 1AGWA 5EG3A 3I7BA 4LYNA 3ZRMA 3GC8A 1P4OA 3EQHA 4XX9A 1XR1A 4E4MA 4R3RA 3FMJA 1IA8A 4IAFA 2XM8A 1J1CA 3QLFA 4PP9A 5IMXA 4RIYA 3GI3A 5BUIA 5KHWA 3S4QA 4DH7A 3TNWA 3EYHA 4G3GA 3O23A 3I0QA 2Y8OA 5TO8A 2QOBA 4HGTA 2C1AA 3UOHA 3K54A 4BGQA 4F9BA 3HGKA 3SDJA 3VHKA 4CFXA 2ZDTA 4QYGA 2WQMA 4DEBA 4IM2A 4ZS4A 2C6LA 3AD4A 4PPBA 4B99A 5M4CA 4MBLA 4EZ3A 4FIGA 1UNHA 3R8UA 4BBFA 2YIWA 4GU6A 1YXSA 4BDFA 3QGWA 3KRJA 1GIHA 3P23A 1UKIA 3FI2A 4ALVA 4F0FA 1YDSE 4FIFA 4E73A 3PJ3A 4LFIA 5IH5A 2XP2A 3TTJA 3N4VA 2QHNA 2C0TA 4FTTA 3TIZA 3DV3A 5K0KA 3MS9A 4EK4A 5H8BA 4ASDA 4USFA 1BX6A 1KUTA 3QTUA 2X7GA 2GNIA 3SC1A 5C26A 1FOTA 5LWMA 4BGGA 3UVPA 2YCQA 4AW0A 3NNXA 4O96A 5CAVA 3FMKA 2BZIB 5HVKA 4BWXA 5CNNA 4DFUA 2Z7SA 4FEVA 4QMQA 3N51A 3PE1A 1X8BA 1K2PA 3R7YA 5D11A 4FKLA 4KD1A 4Q9SA 2J51A 4JXFA 4WUAA 3U6IA 5EYKA 2QD9A 4K33A 1ZLTA 4CQGA 4FNYA 2VWIA 3NUYA 5J8IA 3DCVA 2YDKA 4FKUA 2BROA 3BLRA 3CPBA 2PSQA 3HVCA 4EKLA 2JBOA 2ZM1A 3I60A 5CXZA 5IDPA 5M4UA 2JKOA 3MYGA 1KV2A 2OW3A 4RT7A 4JT3A 3GU5A 5E8ZA 4MYGA 2UZTA 4OLIA 3NUNA 2X8IA 4GT4A 2UW8A 4NWMA 2G9XA 4PMMA 2R2PA 4IE9A 4RIWB 4EHEA 3TEIA 4ENXA 5CAOA 5D1JA 4USEA 2UW0A 2BDFA 5I9WA 2BKZA 3IS5A 2FSMX 2HELA 3BHHA 3OT3A 2YEXA 3ALNA 5CNOA 1H28A 5AR3A 1QCFA 4RJ5A 2R3KA 2UZBA 4DBNA 4DTKA 4E1ZA 3TDWA 3FZSA 2R4BA 2UZUE 3F5XA 3BE9A 3RNIA 3UVQA 1BL7A 3DKOA 3IG7A 3QL8A 2H8HA 4CYIA 4E20A 5M07A 3ORMA 3PLSA 1H0WA 1JVPP 4GK4A 3KFAA 4LI5A 4V05A 4GMYA 3OTUA 2AC5A 4YZBA 3HRCA 5EW9A 3SX9A 3MPAA 5M4FA 4GG5A 1Q8WA 2WELA 2W96B 2ZM4A 3QD3A 4JBOA 4YPSA 3VS1A 2G15A 4IFGA 4GJ3A 3ZO1A 4N4SA 4CRLA 4YP8A 2W4JA 2XCHA 1J7UA 3R2YA 4G3FA 2W1IA 5AM6A 3UG1A 4BTKA 1CDKA 2W1FA 4FKGA 4KWPA 2EUFB 4ZOGA 4JRNA 3EN9A 1IA9A 3JR1A 3UIMA 3QKMA 2OJJA 2VNYA 3EQDA 2QOQA 4AZEA 5IQFA 4QTDA 3A4OX 4IB3A 4TW9A 1OL2A 1T46A 2BAJA 4YNEA 4FUYA 5DHJA 2YLFA 2GU8A 4QTAA 5LMKA 3GB2A 4E26A 5IQGA 4F9AA 4BCPA 4K6ZA 1PHKA 4RIYB 3QUPA 4G17A 2WQEA 4CSVA 4I22A 2GHLA 1GNGA 3E5AA 4YTHA 4F65A 5FTGA 4G6OA 3GGFA 2X2KA 3QRIA 3PFQA 4ANLA 5JEBA 4S31A 5KMJA 3ORTA 4EH8A 3NUUA 3DT1A 4AF3A 5DLSA 4F64A 3UPXA 1S9JA 2W1HA 1GZ8A 4C38A 1WBPA 3ORPA 4AWIA 2OWBA 4CT1A 3VQHA 4BDDA 2ETRA 2YJRA 4WO5A 2R3OA 1H08A 4FEQA 2UVYA 3KXZA 5E92A 4OTHA 5C27A 1WVYA 2FSLX 3ZHPC 4FV2A 3R9DA 2H6DA 2HY81 3U8WA 4O6LA 1BL6A 4D1ZA 4RX9A 3EH9A 5EQYA 3ZBFA 4MAOA 4H58A 3DFCB 2F2CB 4FNZA 1YQJA 2YHVA 2C6MA 4O0YA 4BB4A 1Q24A 2UVXA 2X9FA 3AC1A 5HX6A 5HZNA 1YXTA 4BDHA 4I3ZA 2WTJA 2P0CA 1OIYA 1ZYSA 2CJMA 2UZNA 3Q4TA 4O91A 1Q8UA 5KE0A 5L2SA 3UNZA 2PL0A 3GENA 4ALWA 3NPCA 2WZJA 3F3WA 5JZNA 5IQIA 2PTKA 1OIRA 3KC3A 5FP5A 4C4FA 3EL7A 1ZMVA 4RPVA 5AV2A 3ORXA 2VWZA 5HD7A 3UZRA 3CGFA 1Y8YA 2J5FA 3QHRA 4C4IA 2QVSE 4NYEA 2A4LA 4R3PA 5I9ZA 3SVVA 3ITZA 3R02A 3VBWA 1BKXA 1UNLA 4NW6A 4ZTLA 3UG2A 5J7BA 2EB3A 5E9EA 3DKCA 2UW4A 4L6QA 2RG6A 3NR9A 4ZY4A 2XRUA 5M51A 4ACDA 2X9EA 3EKKA 3EN5A 2P55A 4U5JA 4FZ6A 3KXHA 3ZLWA 4CKJA 2I0VA 2WMVA 4Y73A 3C50A 2BFYA 5EM7A 3D83A 2O63A 3QLGA 4HYIA 3V01A 3DDPA 3A8WA 4EOIA 1GY3A 4FTQA 3FXZA 2VUWA 1YOLA 4CCUA 4F9YA 3EQCA 2HZIA 3KN6A 3OCBA 4DH1A 3EN7A 3LCTA 3K5VA 3VUDA 4O0WA 4HJOA 2X0GA 2WTCA 4O0RA 1Q62A 2PZIA 4EI4A 2IW6A 3I7CA 2C6TA 5HESA 4G6NA 1XH8A 4M13A 2YIRA 3OG7A 3LQ3A 4H05A 2WQOA 3NLBA 3MB6A 4P5ZA 4O27B 3RBWA 2WAJA 2C6KA 4YUQA 3DU8A 3QRUA 4ZY6A 3CTQA 4GT3A 4G9RA 4A4OA 3C4FA 2KTYA 2QCSA 3OXTA 2VTSA 1TQMA 2YIXA 3R73A 5CVGA 5BYZA 3D2KA 2DS1A 3NNWA 4C2WA 3L8XA 4TWCA 2BKKA 2PVRA 4J96A 1ZOHA 1A06A 5IDNA 4J8NA 3RP9A 5FDPA 4II5A 1U46A 1R1WA 4I23A 3WF7A 5FD2A 4RFZA 4YGAA 4EOKA 2YLEA 3KMMA 3OBGA 3W55A 3BHYA 5ANKA 2YWVA 2ITZA 4EL9A 4FX3A 3R1YA 3MTFA 5CT0A 1CTPE 3VBTA 4C4HA 4HNIA 4JL9A 5I3OA 2GCDA 2PUUA 3RJCA 4CXAA 4GW8A 3QQHA 5FUTA 1U5RA 3QKLA 3AQVA 4TNDA 4QP1A 2HY0A 1OKVA 3JPVA 2BCJA 3FPQA 3TJDA 3TKIA 3S00A 2C0IA 2R3MA 4IVCA 3NYXA 2V0DA 2J2IB 3V8TA 3LVPA 5DVRA 4IZ7A 3A99A 4K0YA 1KE5A 3ZMMA 1WBWA 2C5NA 1H07A 3A7IA 3E8NA 2QODA 4GSBA 5IEYA 4AACA 3OUNB 3OY1A 4JAIA 4LGHA 3H0YA 4LRMA 2RFEA 3MW1A 4O1OA 5T3QA 3P0MA 3LLAA 3MWUA 5JGBA 1JPAA 3I81A 2VGOA 5H8GA 4AA4A 4D5KA 1UKHA 3LCSA 2ZAZA 5F95A 2PY3A 3OD6X 5M44A 2E9VA 3Q6WA 5E91A 3UOKA 3EB0A 3HA6A 3RAIA 4JR3A 1WMKA 4ANQA 3WIGA 4BZOA 2IG7A 3UP7A 2RSVA 3ENMA 3OWKA 5GZ9A 5CAPA 4M66A 4OTWA 5J87A 1IEPA 3V8SA 4ZTNA 3O17A 4KRCA 3RMFA 4ONAA 4E6DA 4YO4A 1M14A 3TV6A 4AA0A 3FKLA 4B8LA 5CQWA 4YSJA 3GCPA 3LCOA 5FP6A 4IB5A 1BUHA 3RPYA 4RMZA 3PXZA 3O8PA 4PNKA 2O0UA 1BI7A 2B52A 2BHEA 3VW8A 3FMNA 1F0QA 3WYXA 3FUPA 4E5WA 2CHLA 2E9UA 3AT2A 3FLZA 2O65A 4FSWA 4OT5A 1IAJA 2BZJA 3DXQA 4O84A 1OL6A 1TKIA 2CGVA 2IVVA 1GIIA 1JKKA 2PZYA 3BQRA 4K2RA 2YCFA 4GH2A 5EHOA 4AGCA 2VO7A 2R3PA 3F66A 3HMIA 4XLVA 4D2WA 3FY2A 4X21A 4IIRA 5DH3A 2I40A 2W1EA 3D94A 3V3VA 2J0IA 2WU6A 2UZVA 3FMEA 4IAZA 2WIPA 3I6UA 4KBAA 5HTIA 3QCYA 2JAVA 4BDKA 5JGAA 3KVWA 3RK9A 4OAVB 4Z55A 3D5WA 1W84A 4DLJA 3PUPA 5J9YA 5LWNA 3CC6A 3HP5A 4CFNA 4XRLA 3UIXA 4DGNA 4MXCA 5IQAA 2OZOA 3E62A 3QWKA 4XP0A 1OMWA 5EHYA 4L3JA 4EH2A 3FL4A 2XNPA 4PDOA 3LFDA 4L7SA 1KSWA 4B4LA 1HOWA 3CJGA 5EI2A 1PF8A 3NYOA 5AP3A 1HCKA 5E90A 3W2QA 5CEKA 4IACA 4FVQA 5E8UA 4EONA 2JC6A 3F7ZA 4PWNA 2GPHA 4MXAA 1YDRE 3R0TA 4X3JA 4ALUA 2UW7A 3QCSA 5IISA 3KRRA 1KOBA 4NKAA 2QONA 2XKEA 4U9AA 4ZSLA 2HXQA 5EM6A 3HMPA 3VUHA 3PIYA 3H9RA 3FEGA 5KMMA 2WMQA 3C0HA 3CEKA 5IF1A 1OZ1A 4CGAA 3ZEPA 3POZA 4CZUA 5AAEA 5LMKC 4MQ1A 1M2PA 1Q4LA 4HPUE 5GHVA 3TTIA 1LEWA 2OG8A 4C2VA 2VX0A 3CE3A 3FKOA 4I6QA 3M42A 2I1MA 3LIJA 4OBQA 4FNWA 1FVTA 3WE8A 2Z60A 3H10A 1GAGA 2J0KA 4YJTA 3D7ZA 2PE1A 3ELJA 2YCSA 4JNWA 4O7YA 2ZVAA 3IGGA 3BEAA 3O0GA 2JBPA 2QC6A 5BVWA 3PSBA 3TN8A 5GIOE 2Q83A 2R3JA 3NUPA 3QTSA 4YJNA 3R1QA 4J99A 5AIRA 5D41A 4DFZE 5JQ8A 3ATSA 1PMEA 1SVEA 3KVXA 3COKA 3OROA 5CQUA 4U7ZA 4DG0E 1G3NA 2BRGA 5LVNA 1R39A 4DINA 3Q60A 1YVJA 2IZTA 2G2HA 4OBOA 2Y6MA 4KSPA 2R5TA 4BDCA 3BWFA 4H1JA 2A27A 4EOPA 2JAMA 1PXPA 2PE2A 2IZUA 4KINA 2F7XE 3HECA 1ZZLA 3BU3A 4ZEGA 3TL8A 3ZC6A 3G6HA 4BC6A 3GBZA 4Z3VA 4JG6A 5EHLA 4I6FA 5I3RA 2JGZA 2EVAA 5HG7A 1OECA 5AR7A 4O86A 1STCE 3QA8A 4N70A 4FG8A 3T8OA 2UVZA 4UALA 4ZSEA 1OUYA 4FKPA 1QPJA 5HNGA 3UQFA 3PLAE 5EI8A 3ZEWA 4D4YA 3FL5A 2J50A 2W06A 4JX3A 2HCKA 2J6MA 4ITJA 3DBEA 4ACCA 4BZDA 3DLZA 3NWWA 3ENHA 3OOMA 2R3FA 5EM8A 2WMRA 3OCSA 3GEQA 2CNUA 5CTPA 3V6SA 3W1FA 3PP0A 3FQHA 5FBOA 1SM2A 3F5GA 3SLSA 3UTOA 5CAUA 4I5PA 2QR7A 4PTCA 4GFMA 3NW7A 3QXOA 5DT3A 4E3CA 5HBHA 3HLLA 3Q04A 3FMHA 4MHAA 4AFEA 4U44A 2QO9A 4D4SA 2WO6A 2YISA 3DB8A 4J53A 3ZYAA 1TQPA 1UWJA 1OGUA 4OAUC 2XYUA 3DAKA 5LMBA 4A9UA 5TF9A 3CSVA 4ORKA 4C37A 4JDKA 5ETIA 4FV3A 1OPKA 5M56A 5TKDA 3WZJA 5HI2A 3R22A 3ZC5A 4BIEA 4CTBA 4DFYA 4ZZNA 5FXRA 3FYKX 2WQBA 4IM0A 3C51A 4S2ZA 1M7NA 4W4WA 4IZAA 4F7JA 2JKQA 4MWIA 4FV1A 5IQBA 3L9PA 1YRPA 3MJ2A 5AP5A 2F4JA 2OFUA 3UNJA 3G0FA 4J1RA 4C3RA 2ETKA 1OBDA 4UMTA 4YHJA 4QTEA 4EBVA 4B7TA 2QLUA 3FC2A 2GS7A 4C0TA 2YDIA 3V04A 4I20A 4E4LA 4BDIA 4UWCA 1PMNA 2R3NA 4E4XA 4C4GA 4AOJA 5BUEA 2YCRA 3BZ3A 3O8TA 4JBPA 5HE2A 3DQWA 3BV3A 2ITQA 3D0EA 3GFEA 4NTTA 5HTCA 5BVDA 3OMVA 3OUKA 4YJPA 2WMXA 2W9ZB 4Y95A 2VAGA 3MFSA 4MXZA 2Y6OA 2QU6A 3KA0A 2ACXA 4NH1A 4GUEA 1SNUA 1Z57A 3JS2A 4XH6A 1J7LA 3UQCA 5FLFA 3FE3A 4EBWA 1GJOA 3FMLA 5CSPA 4XBUA 5GNKA 5AWMA 4QP2A 5E8TA 3C7QA 3SKCA 4F09A 3DZOA 4KNBA 3AMYA 2WIHA 2XK7A 4YNOA 2NNWB 1OB3A 4PPCA 4TTHB 5ANIA 2IW8A 4YTFA 4O7SA 3IECA 4O0UA 2V7OA 3R7GA 4D0WA 4FF8A 3EQBA 4RVKA 4CZYB 2Z8CA 2OBJA 3ZLXA 2GHMA 4HGEA 1FGIA 2PHKA 3LAUA 4DGLC 4RWIA 5D9HA 2XMYA 4FVRA 4BDGA 4F0GA 4EOJA 5KMLA 4TWPA 3QQLA 3F61A 3ZM9A 4ZTQA 3S2PA 2GQSA 3D5UA 3F2NA 3A7FA 5CX9A 4BTMA 2ERZE 4D9TA 5I9XA 2P2HA 4IVBA 2XUUA 2ITVA 4UWYA 5HICA 4EC8A 4L01A 4I5CA 5IPJA 2V5QA 3D2IA 2XKCA 3OXZA 4XNEA 4AW1A 4OTPA 4FA2A 5KKRB 5L6WL 4ZSJA 4C58A 2HWPA 1DI8A 3VUKA 5HLNA 4QMXA 5IA1A 2G2IA 5CZHA 3E63A 4G6LA 3R1NA 2GS2A 5DRBA 4ANOA 5HTBA 5M55A 4F6SA 4HGSA 4EK8A 2HXLA 3QQKA 1FPUA 4FTMA 4FZFB 4QD6A 2X1NA 3A62A 3FLWA 3I6WA 5AJQA 3C4ZA 4ANMA 3M11A 3TNQB 5DA3A 1PMUA 3F3TA 4X2NA 1NVQA 5IUHA 2RG5A 4IWOA 4C3PA 2W0JA 4ARKA 4CLJA 2X4FA 3ALOA 3HUCA 3ZBXA 2HENA 3G5DA 3G0EA 1EH4A 4WKQA 4RVLA 4GKHA 4YZNA 4EK6A 4U81A 4HYHA 5B0XA 3QUEA 3KCKA 3ZDIA 5LMAA 5IEXA 4Y85A 3CR0A 2BR1A 3JVRA 4XHKB 3WBLA 4DCAA 4FG7A 1ZWSA 3LHJA 4CFVA 5CZIA 1MRUA 3GNIB 4NFNA 4MWHA 3OEFX 3QC4A 2UUEA 2O3PA 1YDTE 3I4BA 3VBXA 5L8KA 1AD5A 2W1ZA 5JQ5A 1IAHA 2GMXA 5ACBC 1OPJA 2OGVA 2WTDA 3EHAA 4IJ9A 3VULA 3EQGA 3L9MA 3PG3A 4YBKA 1PKGA 2C5OA 4QPAA 2F57A 4ZLYA 4BL1A 1XH4A 3OWJA 4LRKA 4U6RA 2I0EA 3KN5A 5DN3A 4MX9A 5AAGA 5CASA 2C6EA 3MVLA 2ZV9A 4UYNA 4ANBA 2BZKB 4BCMA 4BCNA 3PZEA 4GEOA 4RVMA 5HIBA 4YC3A 3VUIA 2E9PA 5TOZA 3G2FA 3TXOA 3KRWA 4HW7A 3UJGA 4FYOA 1OUKA 4NM3A 1M17A 4FT3A 4JRVA 4ZTHA 3Q5ZA 5IZFA 4S32A 4UXQA 4FV4A 5CI7A 5M06A 1OL1A 4X6RA 3PYYA 4KRDA 5CU3A 4QMSA 2WNTA 5DE2A 5H3QA 3P5KA 3VUMA 3HUBA 4QO9A 4A4LA 1MP8A 2C6IA 4RGJA 1L8TA 5AFVA 4ACHA 3RGFA 1OBGA 3RTPA 2VWXA 4BVUA 1O9UA 3QRJA 2DQ7X 2YJSA 3RI1A 3VC4A 4F9CA 5AUTA 2WEVA 5BMSA 2XF0A 3AXWA 2VO6A 3O50A 4Y83A 2OSCA 5FDXA 2BAQA 2CPKE 4TZRA 4XP2A 4M68A 5T6KA 1R0PA 1CKIA 2VGPA 4R5YA 3E3BX 3VJNA 3ZS5A 4QQTA 1J1BA 4LV5A 4WNMA 5ETFA 3DOGA 2RFSA 4FTIA 4WNKA 4U0IA 4FGRA 3UP2A 3FPMA 4F7LA 2W17A 2XNNA 2WOUA 4JVGA 3LOKA 2C5YA 2WTVA 2OIBA 4FTRA 1BMKA 2WMBA 4HYSA 2H96A 2JFMA 2DYLA 4ITIA 4O7LA 3IONA 3SXSA 4O82A 4G1WA 3RPOA 2X2LA 4FTJA 1DI9A 4KIKB 4QQCA 2I6LA 4PDSA 4L45A 4YHTA 3MVJA 2REIA 1PMVA 3JYAA 3EZVA 3Q6UA 4QMYA 2EXMA 4ANNA 4KIOA 4HYUA 2YWPA 4C36A 2B0QA 5L2TA 5TR6A 4IVAA 5HEZA 1CKPA 2YACA 4N0SA 5ANEA 4LL0A 4PY1A 4PDPA 4O22A 1Q8YA 4GU9A 3PRFA 4QMVA 5AX9A 5EOBA 3R30A 4TPTA 3LJ0A 3FZPA 4M69A 4XV2A 5AV1A 3QQGA 4FG9A 4PL5A 5C8KA 5KKRC 3ZXZA 4O7VA 3F7WA 5TE0A 2PULA 2JITA 3VNTA 1YI6A 4K8AA 3LMGA 4BDJA 2AUHA 3E7OA 4IWDA 3RHKA 1WVWA 4APPA 2E9NA 3KXNA 4Q5HA 4PRJA 2CN5A 3A2CA 3T9TA 3HV3A 4FV0A 5L3AA 4NTSA 1PRYA 4C34A 1RJBA 4ZSAA 3R28A 4D9UA 4F9WA 4NKSA 4U40A 4EHGA 1WBTA 4YBJA 4U79A 2HIWA 4O7RA 4J7BA 3R04A 2BRNA 2I0YA 3ORZA 5JRSA 2QNJA 4OUCA 4TYGA 2R3LA 3ATTA 4HPTE 4IWQA 4GVAA 4NUSA 4GIHA 5BX0A 3MY5A 4APCA 3E3PA 5IH6A 3HV5A 1H1SA 3DK6A 3MY1A 3ORIA 2GNHA 3OFMA 4FICA 5BMMA 3NVMB 1H1PA 4H3BA 4N6YA 5CALA 3RCJA 4AZTA 3BU6A 4DT9A 2XKDA 3WF5A 2PZRA 5DPVA 4BCJA 3ANQA 2J4ZA 3EFWA 1ZY5A 3OT8A 2VTHA 4FT5A 3E7VA 3DA6A 5AUZA 3PZHA 5IH4A 4J98A 4ASXA 5IQCA 2OK1A 1JKSA 3AT4A 3EZRA 3KRXA 2X39A 4RFMA 4FKSA 4PMSA 3RNYA 4FSTA 4DA5A 4F99A 2E9OA 3HMMA 1XH5A 3AMBA 5EYCA 2R0IA 3D4QA 3BYMA 3G6GA 5ANGA 1AQ1A 2YA9A 4EOLA 4LOPA 3ID6C 3FZRA 2SRCA 4AOIA 3W8QA 3NEWA 4L7FA 2X6EA 4MXOA 4H1MA 5L2WA 3ODYX 2XJ1A 2XNMA 4CKRA 2WPAA 4QQJA 3NMUF 3CJFA 2YM8A 3C1XA 3OF0A 4FIEA 5ANDA 4FT9A 4DYMA 4S33A 3PE2A 4GV1A 5CSXA 1FVVA 2YM4A 4MF1A 3UYSA 5BYLA 4YLKA 4FOBA 4KUJA 3V5WA 1PXKA 3ET7A 4FK3A 4LMUA 4EHZA 1H00A 3FWQA 4OTGA 4LGGA 4P5QA 2Y4PA 2A2AA 4Y46A 4OTRA 2JD5A 4XV9A 2OF2A 3QXPA 3UIUA 5EQEA 2GQGA 3LQ5A 5KMOA 3R8VA 2KULA 1YOMA 3VW6A 1MUOA 5EFQA 3NNVA 4UBAA 2YM3A 3KXGA 4Z9LA 4TY1A 4C62A 3NNUA 4JOAA 2FYSA 3VS5A 1Y6AA 2CSNA 5CU2A 2XJ0A 5AX3A 5C03A 4FEWA 3GQLA 4WRSA 2GTMA 5DBXA 2LAVA 3RHXA 3MVMA 4L8MA 3ZFMA 4JBQA 3ZO2A 3R9HA 2PMLX 2QG7A 4D1SA 4X2KA 2OH4A 2WOTA 3NS9A 4QYEA 3GU7A 1BI8A 2Y9QA 4X2JA 4DN5A 2PVNA 2QOHA 3G9LX 5JGDA 3KCFA 4ZAUA 2W1DA 3TKHA 1E9HA 4EWHA 3KMUA 4I0SA 4BF2A 2WMTA 4IX4A 4GYGA 3AD6A 3DXNA 3P7CA 1WBNA 3ODZX 5BPYA 5EKNA 4TKSA 2X81A 2BAKA 3AC3A 4RQVA 2HZ4A 3P7BA 1Y6BA 4XRJA 4G16A 5IG1A 5FWKK 2C6DA 4A9TA 4M69B 4EHVA 4RA5A 4IX6A 5HLPA 5IEVA 1RDQE 3L8SA 5CF8A 5J5SA 3H9FA 3FYJX 2YN8A 2FSOX 1OITA 4IDVA 3DBDA 3ZOSA 4RJ6A 4GKIA 3OVVA 2FGIA 4N57A 1CSNA 1YWVA 5C4LA 1NY3A 4NJDA 4RSSA 5E8YA 4ZJVA 3SV0A 1L3RE 2OO8X 1YWRA 4F0IA 4BWPA 5JH6A 3V5PA 1LR4A 1B38A 5IA3A 2F9GA 2OFVA 3QTXA 4ACGA 5B2MA 1KE9A 2FSTX 4RIXB 4V0GA 3U6JA 2ETMA 3I79A 3RK5A 2ERKA 4EH5A 3R8ZA 2OKRA 5KX8A 3SW4A 4OTQA 5A54A 1Z5MA 2PVKA 3ORLA 2ZV8A 1JAMA 2WTWA 2F7EE 3OCGA 1PXMA 2UZWE 4WBOA 3P78A 5FEEA 4AW5A 1UA2A 4Q2AA 4AA5A 4MQ2A 4RC2A 3NVKI 2HW7A 3QYZA 4RLKA 1PYEA 3E64A 4TT7A 3R21A 4GG7A 4AZWA 4HVDA 3QC9A 2XEZA 3CD3A 3VWAA 5DWRA 3SXFA 4NJ3A 2JDTA 4QYYA 4FTNA 4OT6A 3NW6A 3TNPC 3EN6A 3R8MA 3KGAA 3VS3A 3EQFA 2CGWA 4QMTA 3G15A 3TZ8A 4EKKA 5HVJA 3G51A 1OL7A 4W4XA 4EORA 5HIEA 3VS2A 2P3GX 3LFSA 3RVGA 4BYIA 4F1MA 4IFCA 4DFLA 2C3JA 2BIYA 3VO3A 3WZUA 5J1VA 5C8MA 1JOWB 4LM5A 2OXDA 4MNEB 3NCGA 4PL4A 2JLDA 1XBAA 3U6HA 3MVHA 4KIPA 5LCKA 3IDPA 4J52A 3TI1A 5A3XA 4FBXA 3RAKA 4JDIA 3GUBA 2F49A 2JKMA 4DEEA 3OTVA 4L46A 1CKJA 4MD8E 2B7AA 5BVNA 2YZLA 3PP1A 3MY0A 5HOAA 5L2IA 5E8VA 4QRCA 4YTIA 3FMDA 5A4CA 3BHUA 4PPAA 3W32A 3UNKA 4HVIA 2ZV7A 1KV1A 4FODA 4GCJA 4UV0A 3ZO3A 2BIKB 4UMUA 2GFSA 4D28A 4CVAA 5CLPA 5DT0A 4FKQA 2IVUA 2PVHA 2QR8A 2XIXA 2C4GA 3R1SA 3WARA 4BY9E 5KCVA 4GK3A 4LUEA 1XH6A 3BYSA 1QMZA 4ZTMA 3AC4A 4BR3A 1OKYA 4O7NA 3EFLA 3F5UA 2QG5A 3ZUVA 3QD2B 1FMKA 5HU9A 3TZ7A 3T3VA 4FTCA 1ZYDA 4JQ7A 5HX8A 2ZJWA 1JNKA 3R7IA 3BI6A 5K9IA 4EK3A 4HVGA 3COHA 3IKAA 4FZDB 4RJ8A 4AZSA 2A19B 1H1WA 4DG3E 1ZY4A 5EH0A 1VZOA 3FXWA 2C47A 5GIPE 5H8EA 3UC4A 4BZNA 5JT2A 3WZDA 5AUXA 5L8JA 3SGCA 3BYVA 3RWPA 4G3EA 5AM7A 4CRSA 3OXIA 4RZWA 4DT8A 4UB7A 5IA5A 1K9AA 5C4KA 3QCQA 2V7AA 1R0EA 3ZH8A 3RINA 4UZHA 4IAYA 3PXKA 4CEGA 3E87A 3S3IA 5ANOA 3V5JA 2GNLA 4X2FA 4FV9A 4F6UA 5HD4A 2BHHA 3COMA 4LOQA 4V0GB 5DEWA 3HKOA 4DAWA 3IO7A 2OJGA 4JQ8A 5KMNA 1XBCA 4NL0A 3E88A 3DJ6A 4IBMA 4L42A 2QOLA 2Y7JA 4O7WA 3O7LD 1Y57A 2W1GA 4K11A 1M7QA
chains in the Genus database with same CATH superfamily
3FY0A 2OJIA 4I5HA 5CANA 3EFKA 3BBWA 3W33A 4UMPA 3NW5A 4I6HA 3B2WA 3QFVA 3MPTA 3TUBA 2EB2A 4O0VA 2W7XA 4D55A 4I93A 4YZDA 1OL5A 5IQDA 3NUSA 2XIRA 2NPQA 4EJNA 3H3CA 4WSYA 3QTRA 5TT7A 3EMGA 2ZM3A 4A9YA 5HHWA 4CZTA 4ZK5A 1JSVA 4C33A 4O7TA 3LM0A 5FM3A 2XCKA 2VWUA 2UZOA 1URCA 2C3KA 1KOAA 4Z7HA 5CXHA 3KB7A 2ZMDA 3LJ1A 4P2KA 4CTCA 4IX5A 3ULZA 3A7JA 2ITUA 3ZM4A 2X8EA 4ZLZA 5BQ0A 1O6LA 3O71A 3EQRA 4RZVA 4DGMA 2B9FA 3FXXA 3W0PA 1QPCA 4KKGA 5HCYA 3RAWA 5F1ZA 3PXQA 4XG9A 3TWJA 2R3GA 5JN2A 2Y4IB 4DDIA 2XM9A 4G5JA 1YXVA 2GSFA 5E8SA 5BNJA 2VO3A 4AT4A 4BTFA 1NVRA 3KULA 4FTLA 4OGRA 4EQUA 2QHMA 3ZSHA 1DM2A 4FI1A 2RIOA 4LMNA 4PNIA 4R7BA 5K3YA 2HOGA 2RL5A 3EOCA 4KKHA 3O51A 1JBPE 1FMOE 2ITWA 2CKQA 3ZCLA 3PRIA 3VS7A 5FGKA 4CMUA 3HDMA 2W4KA 2PPQA 3RM7A 3G90X 4O0XA 4CV9A 3PJ8A 2OXXA 4EOSA 4P90A 1U5QA 3MDYA 3VUGA 3ZDUA 3QALE 2X7OA 3KMWA 3RK7A 2XJ2A 3ZZEA 5M08A 5HBEA 2UZEA 2P4IA 2DUVA 3ZSGA 3AT3A 3LFQA 1RQQA 5HE3A 4NM5A 4L52A 4DLIA 1PJKA 1SVGA 2CCIA 2P33A 5BVEA 4XG8A 5AP6A 1YHSA 4QTCA 2R3HA 3R9NA 2JIUA 4JDHA 1U4DA 3UZPA 3JXWA 1SMHA 2I7QA 5C1QB 1P2AA 5FEDA 2J0LA 2VWWA 4C4JA 5A4TA 3NUXA 4W8DA 3WILA 2FH9A 4O4FA 2OI4X 4QP3A 4JR7A 3BGQA 3COIA 4L53A 4LGDA 5GJGA 5I9VA 3GC7A 4YC8A 4I6LA 3C0IA 4LUDA 1PW2A 3L1SA 1Q3WA 4V04A 4J97A 3SOCA 1Q99A 5L8LA 1Q61A 3DPKA 5CVFA 3ZU7A 3DBCA 4WA9A 4I5MA 3QKKA 2FO0A 3IOKA 3CXWA 3CQUA 4E5AX 3V5LA 5JFWA 4BRXA 3Q53A 4BIBA 3BGZA 3PY0A 3QX2A 4MEDA 1YXUA 4AE9A 2V55A 4WIHA 2QI8A 4M3QA 2IO6A 4IC8A 4EC9A 5K5NA 3FI4A 1WFCA 2ITYA 1M2RA 4KBCA 2C3IB 4O38A 5M57A 3R00A 4LV8A 4USDA 4BBMA 4IEBA 1Y8GA 5LCJA 4J71A 2WU7A 4BWKA 1NXKA 5CEMA 3BEGA 4CKIA 1PY5A 2WGJA 4IWPA 4YLJA 3RPRA 3TMOA 3LKMA 1H0VA 1W2DA 3IW4A 2ZB1A 5JFXA 3I5NA 1IG1A 4X2GA 2VTPA 4Q5EA 4AS0A 2BRBA 5ETCA 3DY7A 4BCQA 1WCCA 5J7HA 3SG8A 3RCDA 2BVAA 3C5UA 3I5ZA 5AA9A 4RJ4A 3ERKA 3P08A 4L3PA 3NIZA 4EYJA 2BILB 3PIZA 4RWLA 3U54A 2EWAA 4MD7E 5F20A 1QL6A 2RKUA 2VWYA 4QP4A 4W4YA 3FV8A 4XS2A 5I0BA 4OBPA 4HZRA 1B39A 3ZRLA 3DKFA 3CY2A 2J9MA 3JUHA 3UDBA 3KY2A 4YR8A 3QTWA 2OZAA 5EYMA 3Q4ZA 5JFVA 4RC4A 2XBAA 4NSTA 2DWBA 1YW2A 3GVUA 3MTLA 4QMPA 5D12A 3R7OA 3VRYA 4ASEA 2H34A 4BCOA 1I44A 4BCIA 3P5JC 2NRUA 3DXPA 3SQQA 4RFYA 3PXRA 3F2AA 2EXEA 3UOJA 3AOXA 3KL8A 4AXEA 4MNFA 2BALA 3KF4A 3KULB 5AP4A 5CEQA 3SRVA 4QMZA 3MFTA 4PL3A 1URWA 4F1TA 4YHFA 3NIEA 4CNHA 1IRKA 1JKTA 3E92A 5BUJA 4I4FA 3U51A 4TYHA 4KKEA 5KUPA 4O4DA 2QLQA 2UW6A 1YOJA 3BU5A 4MUQA 3NUAA 1PXLA 3R9OA 3IW5A 3LMIA 5CAQA 3DBFA 5E1SA 2YIYA 2GQRA 1W98A 3TCPA 4D2TA 2ESMA 2J5EA 5IA4A 3UQGA 4IC7A 1LPUA 4XV3A 2EU9A 2QQ7A 2B4SB 4H39A 5ACKA 4YZ9A 2YABA 5ICPA 2G2FA 3VF8A 4S34A 1PYXA 4O0TA 2CCHA 4A9RA 2ZB0A 4OTFA 5JFSA 2IZRA 4EQCA 3DDQA 4M7IA 3WZEA 4PF4A 3LXNA 3IGOA 4AUAA 1S9IA 4CMOA 4EWQA 4LL5A 3CPCA 3NX8A 5EW3A 5KZ0A 5F9EA 1FBNA 4KIKA 1APME 4Z16A 1PXJA 5CEPA 5FG8A 3ZZWA 5HLWA 3LPBA 5HNBA 2IW9A 3U4UA 1NVSA 3KU2A 3UBDA 3DJ5A 1J7IA 4QOXA 4BI2A 5CF6A 2XIKA 4BKJA 2C1BA 4MCVA 4JQEA 3BHVA 4IB0A 3AGLA 3I1AA 3W8LA 1ZXEA 3OHTA 3VVHA 2WD1A 3A7GA 5IUIA 2G01A 3AC2A 4L68A 3PPKA 4M15A 2CN8A 4CYJA 3WF6A 3LFCA 3QZFA 5H9BA 5HIDA 3ULIA 2OICA 3TZMA 4HOKA 4PV0A 5A9UA 3O8UA 2O2UA 3FSFA 4TYEA 4ZP5A 4NM0A 5AUYA 3VBYA 4AAAA 5LVOA 1CMKE 1B6CB 1WAKA 2VX3A 3IK3A 4QMWA 4DE4A 2WXVA 5HCZA 4JI9A 4IVDA 2R7IA 1NW1A 4B6LA 2PE0A 4YURA 3DB6A 4BCKA 2XNGA 2PVYA 2CKOA 2BZHB 3CBLA 3EKNA 4FSYA 5CU4A 3UIBA 4MXXA 2JFLA 4U43A 2CLXA 3UVRA 4RRVA 3P86A 4EK5A 5KNJA 5IMEA 2CLQA 2Q0BA 3NCZA 4GIIA 4RBLA 4DEHA 1WZYA 5C01A 2F7ZE 2UW3A 1UU8A 4YJQA 4JBVA 5A4LA 3U55A 3MH2A 4FTOA 5CU6A 4RWJA 3VUTA 3ZO4A 4R77A 4D1XA 2PUIA 2HZ0A 3GXLA 4DEDA 3D14A 2XVDA 3QRKA 4K77A 4BJJA 5KMIA 2W99B 2VN9A 3CKWA 2XK6A 2VRXA 2FVDA 3TIYA 4O0SA 3UE4A 5LVLA 4BHNA 3GU6A 5BVKA 1LP4A 2B53A 3G33A 3F6XA 5DG5A 3QU0A 4QPSA 3Q9YA 3DNDA 4TN6A 5GJDA 5AR8A 5HVYA 2OZAB 2PVFA 3VRZA 4KABA 2VZ6A 3DBQA 5AR4A 5FM2A 3V6RA 5CF4A 3WE4A 1P5EA 1JLUE 4E5BA 4RVTA 5HCXA 3R8LA 4U80A 4YZCA 5E8XA 1RW8A 5B2KA 3DAEA 1PXNA 5K4IA 3FC1X 4U45A 3LXKA 3FAAA 2YIQA 4CLIA 2PMOX 1XH9A 4ZSGA 3AMAA 2Q0NA 4EH3A 4EH4A 3B2TA 5D7AA 2ONLA 4B8MA 5L6OA 3GQIA 4BKZA 5LQFA 5AUVA 4BCGA 2HZNA 2CNQA 2HK5A 4R1VA 3PPJA 3W16A 3SRVB 2IJMA 3LFEA 3OBJA 3OY3A 3OOGA 5E8WA 3UMWA 1KE8A 4PTGA 1V0OA 2WMWA 1VYWA 4TYHB 5LARA 4WRGA 3AC5A 3F9NA 4FTUA 3KQ7A 4QP8A 3T9IA 4ASZA 4OTIA 4IAKA 3V8WA 3DTWA 2VD5A 1A48A 4C59A 3GCVA 2P2IA 2BRMA 3D5VA 4WOVA 4ID7A 4UN0C 5A6OA 2VX1A 3HV6A 3IW8A 2ZV2A 4JX7A 2VWVA 1JSTA 4QMOA 4XG3A 3ZFXA 3GU8A 2R7BA 3QHWA 3FBVA 3RALA 3K3IA 5L6PA 2V22A 4GK2A 1H01A 3DNEA 1F3MC 2UV2A 3BRBA 1H26A 2XK3A 5K5XA 5DMZA 3BYUA 4DH3A 3C4XA 4XG6A 4U3ZA 4RC3A 4YC6A 4AGWA 4EOQA 2GFCA 3FHIA 2QKWB 2YZAA 3P7AA 4HNFA 4YJOA 2W1CA 4XMOA 3DKGA 4ZMEA 3PY1A 2GNFA 1H4LA 3BLHA 4F7SA 3ZSIA 4D2SA 4ZJJA 4WG5A 3U87A 5J1WA 5HORA 3LCKA 1Q97A 5LVMA 5FXQA 4DG2E 3BKBA 3TZ9A 4ITHA 3R83A 5L4QA 2WEIA 4R7HA 1SNXA 2OH0E 3E8DA 4R7IA 3AG9A 1JSUA 4UEUA 2YM7A 3R63A 2JKKA 2WKMA 2RF9A 4NU1A 4HZSA 3LFFA 4ZIMA 4BI0A 3QZIA 4MBIA 2B9JA 4UX9A 2IN6A 4J8MA 4QP9A 4WG4A 3ROCA 4E7WA 2WMUA 4E8AA 4EJ7A 4O2PA 3MJ1A 1T45A 4W8EA 3NYVA 4MXYA 5HO6A 1KE6A 2IVSA 3GT8A 3MH3A 4DFXE 5C9CA 4V01A 3UC3A 2IEWA 3ZONA 3NAYA 2HYYA 3QQJA 5AV3A 4TXCA 4HGLA 4GYIA 2JDRA 5EW8A 3UYTA 3HL7A 4FL1A 1R3CA 4C35A 4AXAA 2BDWA 1M2QA 2WMSA 4F7NA 3LM5A 3UO5A 1XJDA 3HP2A 4EOMA 1XMLA 1F5QA 3QRTA 4RG0A 3CGOA 3LFAA 4I92A 3JY9A 2QO2A 5C8NA 3UZTA 3TNHA 4MBJA 1OKWA 4W9XA 2B9HA 3R9RA 1Q3DA 4M97A 2GTNA 4RIXA 4TNBA 4CMTA 4CV8A 2GNJA 4IW0A 3DGKA 4FIIA 5G6VA 2XANA 5EDPA 1ZOGA 3F3UA 4LQMA 4C57A 2YFXA 4FC0A 5IU2A 4I0TA 4CT2A 3TV4A 4DFNA 2AYPA 3N4UA 3QYWA 3PSCA 1GOLA 2UW5A 4HCVA 5KBRA 2UZLA 4EOOA 4ACMA 5CWZA 4FKWA 1H24A 4YJVA 3PXYA 2ITNA 4I4EA 5DR9A 4O21A 3PWYA 4YO6A 5T68A 3V51A 3GU4A 2ZYBA 2YERA 5M09A 4BTJA 5HO8A 5J9ZA 2YDJA 4EUTA 1PXOA 3BX5A 4KB8A 1YHWA 4M12A 4AG8A 4FIJA 4KAOA 4L9IA 3REPA 3NAXA 4CG8A 4UWBA 2PVMA 3F82A 2OJFE 2JDVA 3FDNA 2XZSA 3AGMA 4XG2A 4XUFA 4G5PA 3BV2A 4EQMA 1TVOA 1PXIA 2VTNA 3GC9A 4XOZA 3ZXTA 3B8QA 2PVJA 2JIIA 1REKA 3PSDA 2R3QA 4MNEA 5HU3A 3UOLA 5I4NA 5J79A 4QNYA 3HAMA 4M0ZA 5CU0A 2OJ9A 3KF7A 2I0HA 3QTQA 4YMJA 1LEZA 2X0QA 4XG4A 3FSKA 4D5HA 4ZZOA 4O81A 4DEAA 1H25A 3QA0A 2UZDA 4JG7A 5HO7A 1DS5A 3WIKA 4ZXTA 3OWLA 3WZKA 3ZTXA 3FI3A 1MQBA 1YWNA 3R7EA 4F6WA 5K4JA 2BTSA 1MRVA 2JDOA 4UZDA 2O5KA 4R5SA 3P4KA 5HG5A 5J95A 3BE2A 3QD0A 3EJ1A 3RKBA 4E6AA 5I5ZA 3TYKA 3FQEA 3MBLA 4GFGA 3R71A 2V62A 5CT7A 2XK4A 3BPRA 3W18A 3W2OA 4HCTA 2A0CX 4ZS0A 1Z9XA 4AP7A 5DGZA 5AR5A 3ZRKA 2EXCX 3NYNA 2CKEA 3V5TA 3HRBA 1BYGA 3LXLA 4K1BA 3RZBA 3MN3A 3Q9WA 4XYFA 2CMWA 3PA4A 4QYHA 3HMNA 3TACA 3SA0A 4QPMA 3Q4CA 4Y5QA 4D4RA 2RFDA 2W4OA 2NP8A 1O6YA 4WNOA 3W2PA 3QUDA 1P4FA 4XOYA 3C9WA 3HAVA 3MA3A 4IJPA 4NFMA 3GC0A 4MD9E 5EM5A 4CD0A 3R2BA 3BWJA 4DHJA 3S1HA 1PKDA 4OW8A 5G1XA 1Y91A 4QT1A 2VU3A 3TJCA 4JDJA 4PX6A 4BDBA 4L3LA 4F63A 5BVOA 3P9JA 4L43A 2YM5A 3EQPA 3W2CA 4DF3A 4NW5A 5CEIA 3U9CA 2CNVA 3FLSA 4GVJA 5DEYA 4A7CA 2QOFA 1XQZA 2VTTA 3OCTA 2PUNA 4K18A 4D2VA 5AMNA 4C61A 4E6QA 2ZDUA 3V5QA 2BTRA 2XS0A 4G2FA 1ND4A 4DTBA 4EZ7A 4FZ7A 3HDNA 3SOAA 3VQUA 1ZAOA 2YM6A 5JMSA 2PVLA 4IH8A 4ZTSA 3MB7A 3GP0A 3MH1A 4X6QC 1FQ1B 4BIDA 2C69A 4L00A 2B9IA 2QOCA 5BVFA 4ERKA 3PA3A 5A4EA 3CLYA 4TYJA 5CF5A 3SD0A 4E93A 3EWHA 2ITTA 1OVEA 5JRQA 4IXPA 2PMNX 4IZYA 5AADA 1G8AA 4FKIA 3A4PA 3BYOA 5GZAA 1ZMWA 5LOHA 2C5VA 4JJRA 3OP5A 2J7TA 2QO7A 2HAKA 4YPDA 5AIKA 1UVRA 3OZ6A 4DGOA 4GT5A 4KSQA 4FSNA 3ZLYA 2XBJA 5I9YA 2CDZA 3BCEA 4PQNA 3LLTA 1XMMA 2XIZA 5ITAA 1XBBA 2B1PA 1I09A 2XNEA 3LFNA 1KE7A 3ACJA 3SXRA 4PP7A 3P1AA 3N9XA 2NO3A 4IZ5A 4JAJA 5FXSA 3ANRA 2OLCA 5HGIA 5CY3A 2G1TA 1VR2A 2ONLC 5CSWA 4Q9ZA 4WBBB 3FKNA 4Y72A 4ANSA 4D0XA 4QMNA 2CGUA 4N6ZA 1LUFA 3F88A 3O96A 4KIQA 4PUZA 5CEOA 1ZARA 5L2QA 3VHEA 3W10A 3PVWA 2X8DA 4DITA 5E4HA 3PJ1A 4O4BB 3EN4A 4WUNA 3Q2JA 3NSZA 4IX3A 1Q41A 3FLQA 3MSSA 4C02A 5FQDC 3U9NA 4UYAA 4BCHA 2X7FA 3DS6A 4XBRA 4AW2A 5CENA 2Z7QA 3IDCA 4FKTA 5HE1A 5IKWA 4I21A 3Q96A 4NCTA 4BI1A 1IASA 3MH0A 2XK8A 4C3FA 4O7ZA 3THBA 4D2RA 1OIQA 2H9VA 3II5A 4JG8A 1ZYCA 3TNIA 1CM8A 5BYYA 2WTKB 3SW7A 4FNXA 4FK6A 4RJ7A 1H1RA 1BLXA 2B55A 3KK9A 3PJCA 1Q8TA 3VS6A 3FHRA 3Q9ZA 1H1QA 4F08A 4HVHA 3DLSA 4DFBA 2XNOA 4EYMA 4FYNA 4MF0A 3Q3BA 4X0MA 3H0ZA 2Z02A 4QYFA 4FL3A 3SG9A 3TV7A 1UNGA 2A1AB 2XH5A 4I6BA 5F4NA 3TG1A 4FIHA 5M53A 4RLLA 3QD4A 4M0YA 3H4JA 4GJ2A 5CYIA 4EH9A 4AT3A 5B7VA 3A7HA 4WG3A 3ORKA 5EKOA 4QP6A 4IQ6A 1K3AA 4YTCA 2VTQA 4JIAA 3CS9A 4QQ5A 4H36A 3QBNA 4CG9A 5FEQA 1W8CA 3FMMA 4CFFA 4AU8A 1QPEA 3KKVA 3MESA 1OPLA 4F70A 4FE2A 5D10A 4DBXA 4PMPA 3TUCA 4PTEA 5KBQA 3SHEA 3HV4A 5JZJA 1XH7A 2PK9A 4GUBA 4EH7A 3MIAA 1W83A 3AKKA 2FB8A 4DCEA 5JKGA 4H3PA 4TWOA 4AQCA 3A60A 2ITPA 4FSMA 3WF8A 4YLLA 3F3VA 4DEGA 3VBVA 4MH7A 1O6KA 2X0OA 5CSVA 3GCQA 3W0RA 4U41A 2QOIA 1OKZA 4CFUA 2WHBA 3Q5IA 5JK3A 3UPZA 3IPHA 3HEGA 1UU9A 3MV5A 4RJ3A 2JIVA 5CS6A 4C7TA 2IZSA 4FR4A 4CFWA 3FJQE 3T3UA 4ZLOA 2QKRA 4NIFA 4CCBA 5E7RA 2VO0A 4IAIA 4XG7A 3WI6A 1IR3A 1V0PA 2VTAA 5IUGA 4KBKA 4XP3A 3F2RA 4DTAA 3Q9XA 2PZ5A 4G31A 4M8TA 2BMCA 4FV6A 4I41A 2AQXA 3MA6A 4NM7A 5HE0A 2C0OA 4I0RA 4NT4A 5AUUA 3EYGA 3L8VA 4FT0A 5EDQA 3LXPA 1DAYA 1SVHA 2VTOA 5AP1A 3CD8A 2VTMA 3RZFA 4RQKA 3CY3A 3Q52A 4DHFA 3VF9A 4XEYA 1JWHA 3PPZA 1YI4A 3KEXA 2GDOA 2VTJA 1M52A 3DQXA 4MK0A 3EIDA 3KK8A 1ZOEA 4NK9A 2OU7A 3DJ7A 3CKXA 5EI6A 1YKRA 1ATPE 2C30A 2Z7LA 3QTIA 1GIJA 1JKLA 3S95A 3RAHA 2JDSA 4XLIA 3WOWA 3K5UA 2PMIA 2GHGA 3QF9A 2OXYA 5CVHA 4AN3A 3HRFA 4LG4A 2IPXA 2OIQA 4X3FA 5DNRA 4FKJA 3QX4A 3LJ2A 2BUJA 4L44A 1TQIA 3B8RA 1JQHA 1VYZA 3H9OA 4AN2A 3IQ7A 5HBJA 4W4VA 3R8PA 3VN9A 2XYNA 3C4CA 4B0GA 2VTLA 4CQEA 1H27A 3VAPA 5J9LA 1U59A 1YI3A 4FMQA 4QP7A 5GJFA 4FZAB 3QQFA 3ZUTA 3PY3A 4AGDA 4DHIB 5DI1A 3LW0A 4ZZMA 5FTOA 4LRJA 4WSQA 1XWSA 4O2ZA 3PA5A 5GINE 3PWDA 4FV8A 4U42A 3NGAA 3ROYA 3OW4A 2BDJA 2X2MA 3A8XA 4OTDA 5IA0A 3E8CA 2WTKC 4E4NA 4FV5A 4DEIA 3OWPA 4UY9A 1ZYLA 3PFYA 4QNAA 4UXLA 2QOOA 3UGCA 4LOOA 3NZ0A 4PMTA 4GRBA 4RA4A 5KHXA 4ZMFA 1UU3A 2R0UA 3FLNC 3LQ8A 3HNGA 3PJ2A 4OR5A 5AP0A 3KXMA 1FINA 2ZMCA 3BIZA 5FTQA 3R6XA 3QCXA 1E1XA 3S0OA 1ZZ2A 3L9NA 5AEPA 5IQEA 4QTBA 5AP2A 4JIKA 5AA8A 3G9NA 3E93A 4P4CA 5AAFA 2Z2WA 3RPSA 4YJRA 5DFPA 3UODA 3ZFYA 2XRWA 3TDVA 3EFJA 1W2CA 4ENYA 3DFAA 3BHTA 5A46A 4FKRA 1G8SA 4DGGA 1XO2B 4DC2A 2CKPA 4F4PA 3POOA 1NT2A 4G9CA 3D7TA 1WVXA 3DK3A 3QZHA 5FRIA 2W5HA 2XIYA 3VBQA 4A4XA 4BCFA 4H3QA 5EYDA 5B2LA 3W2SA 3K3JA 2GS6A 1J3HA 4G34A 3HV7A 3M2WA 3HZTA 3A61A 3DAJA 4A06A 1Q8ZA 4AZVA 3Q2MA 4R78A 2XARA 2XEYA 3BBTB 4YZMA 1A9UA 3C5IA 4IHPA 4FSUA 3R01A 4JLCA 5I9UA 2FUMA 2X6DA 5IQHA 4TRLA 4EEVA 3ETAA 4MKCA 4GL9A 2IVTA 4QMMA 4ERWA 4NIFB 2XA4A 4QDVA 4I24A 1WBSA 2RGPA 3OC1A 5JSMA 2W5BA 5CSHA 3AKJA 1WBOA 2PYWA 1UWHA 2WMAA 2XK9A 5H2UA 4MTAA 2Z7RA 4EUUA 2C3LA 3MFRA 4HCUA 3SAYA 3NFFB 2OF4A 3LFBA 4XJ0A 3C4EA 4BBEA 3FI8A 4L67A 4F1OA 3W0MA 3ACKA 4AGUA 2ITXA 1W82A 3IW6A 3NRMA 3TUDA 2PU8A 5CI6A 4M84A 5KZIA 3VS4A 5DRDA 5E1EA 2OIDA 4R3CA 2YAKA 2CGXA 2J90A 5F94A 1GZKA 4FKOA 3GCSA 3MPMA 5A6NA 5HKMA 4WD5A 1UV5A 3LZBA 3W2RA 3ZUUA 4E6CA 5A4QA 2QURA 3TT0A 3NDMA 1GZNA 2PZPA 1U54A 4IADA 4FEUA 1Q5KA 4NEUA 5HQ0A 3PDTA 2W05A 2QOKA 3TM0A 4GFOA 2C68A 2X4ZA 2WB8A 4EZ5A 5LJJA 3CTJA 4P7EA 1KWPA 1ZRZA 3BELA 3FQSA 1XKKA 3R7UA 3FZOA 4AN9A 3L8PA 4FKVA 2LGCA 4R8QA 3D15A 3PVGA 4G3CA 5FBNC 5IA2A 1VEBA 2O64A 4X3FB 3C13A 1SYKA 2Y0AA 4C8BA 5J5TA 5KO1A 3BQCA 5ANJA 2Y4IC 4FOCA 3KIOC 4PDYA 1QPDA 1ZMUA 4GS6A 4I94A 2WQNA 2XKFA 5EK7A 4YJSA 4FSQA 3IDBA 2BFXA 1P14A 1MQ4A 2B54A 3HX4A 3KXXA 3VS0A 4FL2A 4WHZA 1E1VA 3WYYA 3F3ZA 3RPVA 3VIDA 3DTCA 2QU5A 2BPMA 3KRLA 4BDEA 1RE8A 4NCTC 4QMLA 3LE6A 3I0OA 1W7HA 2WTIA 2C6OA 4ZTRA 4A07A 3EQIA 3DZQA 3Q4UA 3D9VA 4O1PA 4ZY5A 1FGKA 5AV0A 1V0BA 3Q32A 4AE6A 4A9SA 3GCUA 2BRHA 3VJOA 3PG1A 4RWKA 2UW9A 1OI9A 2ITOA 3H30A 2IWIA 4UMRA 5DR2A 4YU2A 4TYIA 2F2UA 3F5PA 2JEDA 4QMUA 3TKUA 4IANA 3MI9A 3PXFA 5DIAA 5LVPA 3GOPA 5AR2A 3QWJA 4KS8A 2XNBA 2J0MB 4AZFA 3BLQA 4YSMA 1WBVA 4BHZA 2ZOQA 3O7LB 3D7TB 5EOLA 3QZGA 3ZLSA 2W9FB 3GOKA 3UMXA 4C4EA 4KS7A 3R7VA 3CQEA 4MVFA 2RFNA 4U97A 4AFJA 1NA7A 2VTIA 4DH8A 3HMOA 4Z7GA 5HNIX 2PUPA 5HG8A 4Y8DA 3ORNA 4RX8A 4FGBA 3E8EA 4D58A 1OM1A 4O83A 3AC8A 3QTZA 4W9WA 3DK7A 3W0OA 3UO4A 2YITA 3P79A 3BL7A 5K0XA 3BL9A 1ST0A 1HCLA 4XCUA 2VV9A 3AD5A 3QGYA 4WNPA 3MGYA 3PIXA 3UDTA 2HW6A 4S30A 4J95A 1W2FA 3CTHA 1G5SA 3FLYA 1XHAA 3M1SA 4FT7A 4G3DA 3RM6A 4DH5A 2WFYA 4HVSA 4RX5A 1R78A 1YHVA 4AOTA 3OS3A 4M14A 3D5XA 3QAME 4RIOA 4BDAA 2O8YA 1V1KA 4D4VA 4FUXA 1H8FA 3C0GA 4TWNA 2GNGA 3FZ1A 1ERKA 2NRYA 3F69A 4FSZA 1OIUA 3C4WA 3U4WA 4IB1A 4WT6A 1REJA 5ETAA 1VJYA 3O2MA 4ZJIA 4FTKA 3GFWA 5AP7A 4BFMA 1DAWA 2FA2A 3CP9A 1J91A 3IW7A 4CFMA 2W5AA 4RIWA 4BYJA 5KMKA 1U54B 3HYHA 5HG9A 3EL8A 3PVUA 2R9SA 4YJUA 4BKYA 3K2LA 3PTGA 4NZWB 5AV4A 2AC3A 4FSRA 4Y5HA 5AUWA 5DYJA 2J0JA 5DR6A 2VTRA 3L9LA 5EDRA 2R3RA 4BICA 2PWLA 5LXMA 5DT4A 3BGPA 4KA3A 4B9DA 3MFUA 4AX8A 1UU7A 2YAAA 4EH6A 5GZ8A 3UO6A 1SZMA 4R1YA 3WF9A 4U3YA 4FV7A 1W0XC 4IDTA 2XB7A 3LCDA 3QQUA 4M67A 2E2BA 5A14A 2R3IA 4XV1A 1GZOA 4FTAA 4IAAA 3N4TA 4D2PA 3PVBA 3FZTA 3JY0A 4I1ZA 2R64A 3CQWA 4BGHA 5M4IA 4IM3A 3RWQA 4TL0A 4IMYA 3LMHA 4R6VA 5D7VA 4K9YA 4X3FC 1MRYA 5DOSA 3KREA 4RX7A 3BLAA 2VNWA 3IOPA 1YXXA 3OW3A 4JS8A 4UMQA 4FVPA 1ZYJA 2HWOA 4U8ZA 5EQPA 4BN1A 3CCNA 2VWBA 3JVSA 3MIYA 4FEXA 4AT5A 3CIKA 3OEZA 2C5XA 4X7QA 4O6EA 1FVRA 3HA8A 1AGWA 5EG3A 3ML1A 1G8JA 3I7BA 4LYNA 3ZRMA 3GC8A 1P4OA 3EQHA 4XX9A 1XR1A 4E4MA 4R3RA 3FMJA 1IA8A 4IAFA 2XM8A 1J1CA 3QLFA 4PP9A 5IMXA 4RIYA 3GI3A 5BUIA 5KHWA 3S4QA 4DH7A 3TNWA 3EYHA 4G3GA 3O23A 3I0QA 2Y8OA 5TO8A 2QOBA 4HGTA 2C1AA 3UOHA 3K54A 4BGQA 4F9BA 3HGKA 3SDJA 3VHKA 4CFXA 2ZDTA 4QYGA 2WQMA 4DEBA 4IM2A 4ZS4A 2C6LA 3AD4A 4PPBA 4B99A 5M4CA 4MBLA 4EZ3A 4FIGA 1UNHA