4PX6A

Syk catalytic domain in complex with a potent pyridopyrimidinone inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
262
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Syk inhibitors with high potency in presence of blood.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 262
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4px6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4px6A01
3VHKA 4X2FA 4IAYA 2O5KA 4NZWB 3QQKA 3ALOA 3AC2A 5FEDA 5L6OA 3PP0A 4FSYA 4CTBA 4H3QA 2C6MA 1PW2A 1I09A 3EB0A 3MESA 3HGKA 4LOOA 2CSNA 4A9RA 5AUUA 4JJRA 2HZ0A 2JDVA 2W1EA 4LG4A 5A9UA 4HZRA 1OIRA 3QHRA 4I3ZA 3TWJA 4L3LA 4U45A 2BHHA 4QMOA 3VUKA 3BIZA 4QMXA 3FLSA 4CFNA 3V8WA 2X2KA 2YJRA 4I0SA 5AUZA 4Z16A 3UOKA 1PYEA 3F6XA 4AP7A 4PF4A 4QP2A 5AR5A 3ZZWA 1P5EA 4RSSA 3MB7A 4PY1A 2ZV9A 5GINE 2HXQA 4AW1A 3F88A 1F3MC 1TQPA 5JFWA 3EKKA 4RWJA 3A8XA 2C1BA 2R5TA 4YJPA 5FUTA 3GEQA 2ITVA 4IANA 4PRJA 3ANRA 2HW7A 1F5QA 5C27A 2GHMA 3R8UA 1BKXA 1PXIA 4NFNA 3EQBA 5FTQA 2QO2A 4C3RA 4RVTA 3BHVA 3PPZA 2X8EA 2ZMDA 2QHMA 4FZ7A 1PMVA 4CEGA 4FX3A 3VS1A 4BYJA 4MBJA 4DH3A 3IDBA 1Y91A 1YDSE 4LOPA 3QBNA 4CMOA 3O8UA 3E7VA 3FKOA 5AAEA 3S00A 5HG9A 4YTIA 2VAGA 3WE8A 2EXEA 3QD2B 3K3JA 5D11A 3G0EA 1ND4A 3HP2A 4E6QA 3UGCA 3EH9A 4FV6A 1S9JA 1J91A 2G15A 2WZJA 3K5UA 3R1SA 4RT7A 2XK3A 2DWBA 3I5NA 4JBPA 4AZSA 4RJ3A 3Q60A 3QTWA 4QTDA 1QPDA 4F99A 4MXZA 5BVNA 3I81A 3R9OA 3DKGA 5KMOA 1R0PA 3IW4A 4I92A 2BIYA 2HZ4A 4J8NA 4F4PA 3AD4A 3MTLA 4G31A 5BNJA 4YJNA 2ITOA 2JGZA 4ZY5A 5HD7A 4F9AA 4QMNA 4G1WA 2AYPA 4NH1A 3R1YA 2QR7A 2YM3A 1IA9A 4FZ6A 3SOCA 2CGWA 3BGZA 4LL0A 5CZIA 4RIWA 2HWOA 4F9BA 4GRBA 3PSBA 4FV5A 5IEVA 1LPUA 1JKTA 3C0IA 1APME 2C6TA 3ULIA 4BTFA 2WTCA 3Q2MA 5FBNC 3QAME 4DT8A 2YEXA 4JIKA 4U44A 1WMKA 3DCVA 4EYMA 5E8UA 2JDSA 3LW0A 3MFTA 4DG0E 1YDRE 4RJ6A 4EOQA 1OB3A 2C1AA 1Q8UA 3B8RA 3W2OA 3FZTA 4X3FA 3M1SA 2VTTA 3KC3A 1FPUA 3SHEA 3UVRA 3OWPA 3VQUA 2X2LA 4CYIA 2X9EA 3BI6A 3HEGA 5EFQA 2FSMX 4EOJA 2C5NA 1XH7A 3RNYA 2ZJWA 2XNPA 2RG6A 4NW5A 4GK2A 4XV3A 3VQHA 4W8EA 4E3CA 5E8WA 1B39A 3IW5A 2Y6OA 3QKLA 1MRVA 4YJQA 3S0OA 3MS9A 1UWJA 4WBOA 4JXFA 2R3IA 3V8TA 4L52A 3KK9A 4XEYA 3LCKA 1W82A 5HE1A 1S9IA 4JQ8A 4NFMA 2XA4A 2GDOA 1A06A 1BX6A 3LXPA 4RX5A 5KMJA 5KBQA 3K54A 3KULB 4GT4A 4TNBA 3TNIA 3QXPA 4QQ5A 3ZM4A 5B7VA 4GK4A 4MH7A 3NMUF 2RL5A 3CC6A 2NO3A 5GIPE 4FI1A 4G2FA 3MIAA 4D28A 3WYXA 2XEYA 4FNWA 3D4QA 3KXNA 3P5KA 1ZXEA 3UNZA 3IECA 4EI4A 3KRXA 5LARA 2IVUA 4L67A 4F0FA 3PYYA 3G2FA 1PF8A 3OEFX 4NM5A 4FICA 4EH8A 2O0UA 3R8ZA 3QL8A 3RAWA 5BQ0A 3KKVA 2GMXA 3O8TA 5E8ZA 3UC3A 3VVHA 5CX9A 5LMKC 4QYYA 2YM4A 4DH7A 4BTJA 2W06A 4RX9A 5DWRA 5AAFA 4O7RA 2OWBA 5CEQA 1YKRA 4QP3A 3R8PA 3V5PA 3TDVA 4EOIA 5DE2A 2H9VA 4XMOA 3R1NA 4NWMA 2ACXA 3PG3A 3D7ZA 4S30A 4DFUA 5AP0A 3BU6A 3D83A 4LM5A 4ZTLA 4ERWA 3NYNA 4L68A 3KMMA 4QMQA 4UMPA 5HNBA 2UZDA 4ITIA 1YXXA 4EUTA 2VTMA 3QZHA 3FKLA 4IM2A 2WU7A 5AR8A 2CNVA 4CTCA 2IZRA 4JT3A 1OBGA 3QZIA 3OF0A 4DFLA 4DEHA 3ZC6A 1DS5A 5CT0A 3CIKA 4C37A 4UN0C 5ANOA 4LV5A 4BCQA 5CEIA 4L8MA 1RJBA 1W0XC 3HV4A 2WD1A 2UV2A 3NCZA 3R7GA 4WNMA 4ANNA 4NTSA 4HYIA 1OKWA 4E5AX 2UZTA 4EK3A 3WF7A 1QCFA 3FHIA 5KX8A 5HO7A 4KBCA 5AIRA 3RTPA 4KRDA 5C8KA 2OFVA 3AC1A 1FGKA 1PXJA 2W5HA 3SDJA 3TZ7A 4ZLYA 1H28A 1OL6A 5AA8A 1J1BA 5EM5A 4BI1A 4OT6A 5HVKA 1UNLA 3ALNA 3PJCA 4EHVA 4XV2A 4IE9A 4LUEA 4ZS4A 3PXRA 4GKHA 5IDNA 4I6BA 1LR4A 4GG7A 3TL8A 3LPBA 2QOHA 4R5YA 2W1DA 4F7NA 4EKLA 3ZSGA 1OVEA 3R8MA 3MH1A 5L2IA 4YBKA 5AP1A 1PXMA 3EQRA 2Z7QA 2PMIA 4JAJA 2JDOA 2C4GA 2C5XA 2J50A 4Y95A 3P1AA 5IA0A 4D4RA 2J0KA 5J1VA 1NVSA 4J98A 2R0IA 4XJ0A 3RI1A 3TUBA 3SG8A 2HZIA 1JNKA 4H3PA 5G1XA 2Y9QA 4O0UA 1OITA 4EL9A 3L1SA 2XIZA 2E2BA 2VTOA 4RZWA 5JT2A 3MDYA 4DYMA 5LVNA 4PDPA 3DFCB 3D5UA 3QXOA 3MIYA 4K6ZA 4LOQA 3FUPA 4UY9A 2F57A 5EOBA 3F7WA 4V05A 1JKSA 5AMNA 1GAGA 5EOLA 4M68A 4IXPA 4N0SA 4OTQA 1OL5A 4I0RA 4YJVA 2JKMA 4MBLA 5M06A 4H05A 4FGBA 2YLFA 4AZEA 4NT4A 3A7HA 4XYFA 1XH9A 2WMBA 3HRFA 5EQYA 5LXMA 4FSQA 3HYHA 4GH2A 3H4JA 2BZHB 3SQQA 2ITUA 5CSXA 4E4XA 3CLYA 2NNWB 2IO6A 3N51A 4O7NA 2ONLC 4FV1A 2C0IA 4YTFA 2RFSA 4WRSA 3QGWA 5ANKA 2JC6A 4AZTA 5GZ9A 3G51A 2QR8A 2PVHA 5HNGA 4USFA 4FKGA 2XH5A 3LFFA 3E8CA 3F9NA 4JDIA 3OW4A 3QTSA 4QMSA 4EWQA 2Q0BA 4G6OA 4PP7A 2BDWA 4AN3A 4ZTSA 1YXVA 2PE2A 4U42A 2ERKA 4MD8E 3OFMA 4ORKA 1OKYA 3UE4A 5CF4A 4JBVA 3SV0A 2O63A 1ZRZA 3KA0A 2B54A 2A0CX 2YCSA 2C47A 3SA0A 4R1VA 2QKRA 4KWPA 2OJ9A 3VS4A 4ALWA 4EH6A 5JZJA 5L8LA 5DPVA 4EH2A 2A2AA 2W9ZB 4PUZA 5FEQA 5CEKA 2C3LA 1WBNA 4LMNA 4MNFA 3QX2A 3VO3A 2XIKA 4BWPA 3PY3A 2PWLA 3EQFA 3HRBA 5ETIA 1R0EA 1K9AA 2WEVA 3GCSA 5KHWA 4IVBA 2GTMA 2V22A 3AMYA 4RIOA 1JBPE 3I60A 3B2TA 4BVUA 5JGBA 3LCDA 4EBWA 3VRYA 5J5SA 3HV3A 5EDRA 4FTLA 5AV1A 3LIJA 5M53A 4PP9A 3JY0A 5JFXA 3JPVA 2G9XA 5LVOA 4TYHB 2OXYA 5FG8A 1WBVA 4ACDA 3FE3A 5HIDA 2O8YA 2QVSE 3BLQA 1U54B 3P0MA 3E88A 4K9YA 5HG7A 2BMCA 2OF4A 4FSRA 3RWQA 4DH1A 5E90A 3IOKA 4X6QC 2O65A 4U97A 3KCFA 2C6DA 4APPA 3SVVA 1ZMWA 1RE8A 5EM6A 2YDKA 4CYJA 2X1NA 5LQFA 3TM0A 3AT4A 3PLSA 5HOAA 2PVMA 3SRVB 4ANSA 2J0JA 4C0TA 4JAIA 5I9XA 3C50A 3IK3A 4M12A 5DIAA 3RNIA 4XP0A 1UWHA 4ERKA 3P7CA 1BL7A 1R1WA 4OTIA 4BI2A 4ZP5A 3RAIA 2XK6A 3W55A 3DA6A 3H0YA 4JNWA 4B99A 5A4LA 4IAZA 1TKIA 1UNHA 3D5VA 2V7AA 4BC6A 5C26A 3O7LD 3UIUA 3PXZA 5F1ZA 4WNPA 3LFDA 4UBAA 4GYGA 3T3UA 4EH4A 2X2MA 2HW6A 3QC4A 5FGKA 3ZOSA 2BFXA 5LWNA 3U55A 3DZQA 3PE2A 3R0TA 3SX9A 5ITAA 3E92A 4RJ7A 2PZRA 5JMSA 4L9IA 2V55A 3JR1A 1SVGA 1BI8A 3EYHA 3LFSA 4YO6A 5AUTA 4JBOA 2VWYA 5AUWA 4ZSLA 3R02A 1Q8YA 5KUPA 4JVGA 2OKRA 1UA2A 2ITXA 2GHGA 3KXMA 4A9TA 5EQPA 1YXUA 5IMXA 4BZDA 3ZLSA 4J99A 3JYAA 4IC7A 4IAAA 2BKZA 4IVDA 4QD6A 1ZYSA 4H39A 4QPAA 3EQCA 4BWKA 3TUCA 4CCBA 3UG2A 1WBTA 3P4KA 5A46A 4MNEB 5K9IA 2QKWB 3FAAA 4K18A 3VS0A 4Y8DA 3Q2JA 1DAYA 3U9NA 3V6SA 3IS5A 5G6VA 4MD7E 3QTUA 3ZRLA 4NU1A 4R77A 3CTJA 1PXOA 4BDCA 5I9VA 1CKIA 4MTAA 4B8MA 4O0XA 3V6RA 5EKNA 4CT1A 4EOLA 3MVHA 4AXAA 4BFMA 4F9YA 4GIHA 2WNTA 5FQDC 4KIKB 3ZO3A 5L6PA 2XBAA 3NRMA 2R2PA 1NW1A 4V0GB 2QOFA 5E9EA 4FIJA 1UV5A 3EQDA 4XBRA 4J96A 4A9YA 3BE9A 3VBVA 4NM3A 3VBWA 4NJ3A 2W1IA 2WMWA 5LMBA 4TY1A 2RGPA 3UODA 4KUJA 3V5JA 4GKIA 4EZ7A 2C6OA 1H08A 4WG4A 5D7AA 3VS6A 4E1ZA 3F2NA 3CSVA 4YP8A 4DTBA 4KIQA 4P5ZA 1IR3A 1U46A 2QLQA 4I6HA 2EB2A 2BPMA 4D2SA 4O0SA 4W4YA 2YN8A 4H58A 2BAJA 1Q99A 4PL5A 3MH0A 3Q32A 5EDPA 5HX8A 5IU2A 4RVKA 3E87A 3LQ3A 1IA8A 3HV5A 3TJCA 3U9CA 4LGHA 4L43A 4AU8A 1JWHA 2Z7RA 2UZBA 3W8LA 5IA3A 2BZKB 5I9ZA 2OJGA 3KXHA 4C3PA 5EYCA 1T45A 4YPSA 3I0QA 4F9CA 3REPA 4PNKA 5IQAA 5AA9A 3R28A 3Q04A 5EDQA 1Q8WA 3AGMA 3PJ8A 4N57A 3WZEA 3DQXA 1VZOA 3KF4A 3RALA 2B1PA 4L7FA 3Q53A 4FKUA 3W8QA 2C6IA 2WMAA 5M51A 2HCKA 4GVJA 5AFVA 1JLUE 3KULA 3LFAA 4Q5HA 4AT5A 5EYMA 4QYGA 4U7ZA 3GOKA 2Z7LA 4RBLA 5J9YA 4F9WA 2G1TA 4HGLA 2W05A 2B55A 4MQ2A 5CXHA 3UOJA 3QFVA 1U5QA 3F3VA 4TYGA 3SXFA 4EONA 4GFOA 5C01A 3GUBA 2OZOA 4MWIA 4BDIA 1YRPA 4MF1A 3EFJA 4R5SA 3HDNA 3CBLA 4FV0A 4AZVA 4I94A 4X7QA 5A4CA 2YWPA 1ZYDA 5HU9A 3II5A 2ZDUA 5IQEA 2X7GA 2XMYA 3OP5A 4BCKA 5J7BA 5AAGA 1ZY4A 5KE0A 4A07A 4FV4A 3L9PA 4TYEA 3S95A 3QCQA 3WF8A 5JGDA 4TPTA 3S3IA 3S2PA 4YJUA 4YTHA 3WZUA 5BVKA 3C13A 4XG9A 5ANDA 1T46A 3LQ5A 4NW6A 2JFLA 2J5FA 2OJJA 4FODA 5HESA 1JSUA 5KMMA 4RJ8A 2QU5A 2I0VA 3CE3A 5HVYA 2C30A 3ZUVA 1H1WA 1Q61A 1PHKA 2W17A 4NM7A 2QHNA 1H1PA 4DTKA 4YC3A 3DK7A 2FYSA 2WMVA 2QG5A 3LFCA 2CGUA 4YC6A 3SXSA 1Y6AA 2YCRA 4AAAA 4BKZA 3GOPA 4NEUA 1QL6A 2R3OA 4I5MA 3PXYA 4D9TA 4TWNA 1WCCA 5BYYA 5IQDA 1IAJA 3JUHA 5BYLA 2JAVA 3R2YA 4ZJIA 4BY9E 1XWSA 3LXLA 2J51A 2UZWE 2BAKA 4H1MA 4MQ1A 5AM6A 5ANIA 5I9UA 3VUIA 1Q4LA 4FSZA 4QNAA 4W9WA 2YITA 3VRZA 1O6LA 3DQWA 3I4BA 4LRKA 4AW5A 3MY5A 3RVGA 1FVVA 4M8TA 3FMEA 1BUHA 5TKDA 4ITJA 4RWLA 3LM0A 3LE6A 3PSCA 3IGOA 2YLEA 3NVMB 3SKCA 3I6UA 2RFEA 2W7XA 3WBLA 5EK7A 1Q24A 2CCIA 4ZZMA 1U59A 2W4KA 5K0KA 4C02A 2JDTA 2OG8A 3MY0A 2YM5A 2UW4A 3O96A 5CU6A 2IVVA 4KAOA 3R9NA 3GU8A 4RC2A 2PVLA 3ZDUA 4HYUA 1JQHA 2OJIA 4IWDA 4YSJA 3U54A 4BI0A 4GIIA 5DN3A 2RKUA 5DT0A 1TQIA 4FMQA 3GC7A 2CPKE 5HX6A 4IM3A 4XP3A 3OWJA 3EQPA 3ZXTA 3KQ7A 4L3PA 4FC0A 3NNWA 4C8BA 3LAUA 4JBQA 1YI4A 4UWBA 3PFQA 4AE9A 3DBDA 4XLVA 3KXZA 2R7IA 2WTVA 4CSVA 3ZM9A 3C4WA 4ZY6A 3ZEWA 3T3VA 3F3TA 2E9OA 2OH4A 3BGPA 4ARKA 3EL7A 4U79A 1YOLA 4FIGA 3FEGA 5DYJA 3KN6A 4I20A 5AV0A 2VD5A 1QPEA 3G9NA 3FMKA 4BCJA 3A8WA 4RG0A 3L9LA 2YHVA 1GY3A 1Q3WA 3OY1A 3UIBA 4O2PA 2VWIA 3FL5A 1F0QA 1SYKA 5EW9A 4D55A 3ORLA 4HVDA 2BVAA 5CF5A 5CF8A 3NS9A 3FXXA 4O2ZA 1YI6A 4ZSJA 2FVDA 5KZIA 4BCGA 3BQRA 1H01A 1V0BA 3POOA 5JFVA 4FIEA 1SVEA 2H96A 1OECA 3BLRA 3V5QA 3TZ9A 3NLBA 2YM8A 4YJOA 5H8BA 2QO7A 2YIRA 3BU3A 4B7TA 4WOVA 3UMWA 4D1XA 3G9LX 5J7HA 3RAKA 4FVQA 3JS2A 4IDVA 5IEYA 4FT3A 3R7YA 2PL0A 4C2VA 1OKVA 4AGUA 1J3HA 3GB2A 3GU7A 4JR3A 4BGGA 1BI7A 3VUGA 3KVXA 4FIIA 2QONA 4TWPA 3C7QA 3G90X 4MXOA 1JKLA 3LQ8A 3U87A 4CV8A 4C4HA 2YZLA 2G01A 1ZYJA 2QCSA 2XIXA 3BYMA 4FVRA 4GMYA 4ZXTA 4O38A 3GI3A 4IJ9A 4GCJA 4AOIA 4C3FA 4FG7A 1B38A 2YCFA 4I4EA 4QO9A 4EJ7A 5HIEA 3QX4A 4AGWA 4FKLA 3ZLWA 3AT3A 2ZDTA 3HMIA 5IZFA 4NM0A 3FJQE 4WO5A 4EC9A 4PDSA 3ZTXA 2R3KA 2QOCA 3DU8A 4BWXA 3E3BX 3LMGA 1YWNA 4B6LA 2R3RA 3DTCA 2UZUE 4TYHA 5L8JA 4IX5A 3VJNA 2ITPA 1KV1A 4DAWA 2R3FA 2CNUA 4O7LA 3OWKA 1U54A 1UU8A 2DUVA 2QNJA 3KXXA 3O51A 5I5ZA 4L44A 1OI9A 4U0IA 2OXXA 3ZFMA 3PJ3A 4D1ZA 4FTIA 5CY3A 3E7OA 3FMDA 5CZHA 4FSTA 4G34A 4U80A 3Q9ZA 1XQZA 3MJ2A 5EW8A 5FTOA 2XIRA 4D58A 5BVFA 3VJOA 2W1GA 1EH4A 2WTWA 3AG9A 3NNVA 4OTGA 3SRVA 5HLWA 2HK5A 1AD5A 2QC6A 4AOTA 2IZSA 4FNZA 4IVAA 3RGFA 4F6WA 4QMUA 1GZNA 1STCE 1JSTA 4FA2A 3C5IA 4G3GA 4YHJA 4KS7A 3DTWA 4CKJA 3CR0A 5CSHA 2EB3A 2NRUA 4PPBA 2R3LA 2OK1A 2PVYA 2YDJA 4K33A 2AC5A 1GZ8A 4XLIA 3UYTA 1G3NA 2REIA 1Q97A 5I9YA 3DZOA 3SW4A 1M17A 4DINA 4F0IA 3CQUA 3BYOA 3QCYA 3OOGA 4FOCA 5DH3A 2VWWA 1ZYLA 4FTMA 4B0GA 5A14A 3RHKA 5DOSA 3VF9A 5J9ZA 2Q0NA 4O6LA 4Y85A 5J95A 4EOSA 4DA5A 3QHWA 4EC8A 4LRJA 4RC3A 3QRTA 4U6RA 4YJTA 4M0ZA 4ZIMA 4GU6A 4CNHA 4ZAUA 4K1BA 1SMHA 4TWCA 5CI7A 4OGRA 3FLWA 4WRGA 3GFWA 4A9SA 4EBVA 3FXWA 4I5CA 2G2HA 4QMVA 1MRUA 5HORA 4GJ3A 2VWZA 4NUSA 4Y46A 4A4XA 3H9RA 4ZTNA 3OVVA 4MWHA 3QTXA 4EHGA 4PMSA 3OCTA 1MQ4A 3JVSA 3KMWA 4MNEA 2E9PA 4IH8A 4O0TA 2JITA 3HL7A 1KUTA 4K0YA 3NIZA 2P4IA 3ZCLA 3LOKA 2PY3A 2CN5A 5B2LA 1XH8A 3BBWA 2BALA 3QUEA 4FZAB 4ANBA 4R8QA 4JRNA 4D0XA 5A4EA 3NCGA 4E6CA 5JGAA 4YLJA 2E9NA 5EM7A 1WFCA 1YHSA 4ZSGA 5M07A 1YXSA 4PTCA 2BCJA 4WNKA 4MXYA 3TKIA 1O6KA 3TZMA 5CSVA 3LFBA 4MAOA 2XP2A 4U81A 2R9SA 2Y4IC 4FOBA 4KIKA 3SW7A 4IMYA 4V0GA 3U8WA 3WZDA 3LJ2A 5IISA 3A62A 3R63A 5HG8A 4F7LA 4ZZOA 1YHVA 4AN2A 3L8XA 2B9JA 3UP2A 2XK7A 4I41A 2CNQA 4TXCA 2ZVAA 4U40A 4BZNA 4E4NA 4F64A 4HVHA 3WYYA 1PMEA 4PV0A 3AC3A 5DRBA 5AEPA 5TOZA 5D41A 3RAHA 2X6DA 4EJNA 2ONLA 3L8PA 4FKQA 4MX9A 3UMXA 4I6QA 3IKAA 4O96A 3ZC5A 4AS0A 2Y4PA 4ZOGA 3Q5IA 3E8NA 2J0LA 4I6FA 3OBGA 2WTKC 4UWCA 4D2PA 5H3QA 3HAMA 3IW8A 2VO7A 4OR5A 1OPLA 2ZOQA 2QOBA 2IVTA 4CT2A 2ZV8A 1GIIA 4DBXA 2VZ6A 3SOAA 4BL1A 3EMGA 2VWVA 1J7LA 4RFZA 2VX3A 1P4OA 3A99A 3OD6X 5M44A 2CN8A 3KXGA 4EH7A 1YW2A 2JIVA 5M57A 1BLXA 4YJSA 3U6HA 3WARA 5A6NA 4O7WA 3NR9A 2Y6MA 4C38A 2BUJA 3E62A 3FZSA 3BZ3A 3OZ6A 4NSTA 2C5VA 3UQFA 4OTFA 2F2CB 4ZMFA 3PZEA 3ZEPA 3AC5A 4WHZA 4KABA 4IACA 4N70A 3C4FA 1KE9A 5J1WA 2H34A 2B4SB 4R6VA 5FDXA 3RPSA 1FBNA 3DOGA 2OSCA 4BICA 3O0GA 1PXKA 3FMMA 3OW3A 1G5SA 2RF9A 4BCOA 3CD8A 5HZNA 3FDNA 5FDPA 2R64A 2FO0A 4O0RA 4P4CA 5DI1A 4EWHA 2VO3A 3MTFA 3R6XA 4KS8A 3QQFA 3OT8A 2O3PA 3FWQA 4U41A 2XM9A 4GU9A 2XNEA 3FI4A 3FMJA 1V0PA 4JIAA 2W5BA 3DXNA 3HAVA 2OBJA 2CKOA 4C35A 4FKJA 4WG3A 3QQHA 3VN9A 1E1VA 4AA0A 2X7OA 4BCNA 4ZMEA 3KCKA 4AE6A 3L8VA 3GC9A 4JQ7A 2VRXA 3MH2A 3QCSA 1VJYA 2BILB 4FNXA 3HX4A 3C4CA 2VTQA 2X6EA 3IW7A 4DEIA 1HOWA 3QWKA 5A3XA 4F63A 3QKMA 4EH9A 4TW9A 4ASZA 2PUPA 4TTHB 4C4IA 3U6JA 3DFAA 1H1SA 3EL8A 4YTCA 4W4WA 4DLJA 1ZZ2A 3IONA 3IQ7A 4WUAA 4FZFB 3PWDA 4O83A 2W96B 4O7SA 4JLCA 1P4FA 4BGQA 3D0EA 4A4OA 1GOLA 4UYNA 4AA4A 4W9XA 3D7TB 3MYGA 3COHA 3GC8A 3R7VA 3ZO1A 4U9AA 3I7BA 5LCJA 4DH5A 4LRMA 4BHNA 2HWPA 4MHAA 4I21A 5FP6A 1NVRA 1WVYA 2CLQA 1REJA 3MVMA 5AV3A 3RM6A 1RQQA 4WA9A 5KCVA 3OT3A 3SXRA 4EK4A 3D14A 4FV8A 3JY9A 1WBWA 4GW8A 4H36A 3MJ1A 4II5A 4A4LA 4RFYA 5KHXA 4F08A 3R21A 4H1JA 3F3ZA 3R73A 3ZO2A 1SNXA 4LQMA 5TO8A 4IAKA 4TKSA 3RPVA 1KWPA 1W84A 1XH6A 2VU3A 4N4SA 4XG8A 5A4QA 4DF3A 1ATPE 3DNEA 5EG3A 1Q41A 5J79A 3BHTA 4R3RA 5JK3A 4IB3A 5EI2A 3PY0A 4KRCA 4TRLA 2HIWA 1ZLTA 4U3ZA 3P08A 5DT4A 3TCPA 3UDBA 2VX1A 1ERKA 2IW6A 4OTWA 5CU4A 3R22A 3SGCA 2XB7A 5M56A 3IOPA 1UKIA 1YOJA 4R1YA 3V8SA 4FTCA 4LGGA 4KINA 2W1FA 4GS6A 4G3CA 2B7AA 2Y4IB 2YM7A 4IFCA 4BZOA 3QLGA 2YIXA 5D9HA 4S31A 1DAWA 5M4IA 4DTAA 4AWIA 5TT7A 3HP5A 3BHHA 2OW3A 1CKJA 2OIQA 2GNIA 3K5VA 3O23A 1FINA 4RGJA 3UPXA 3ZFXA 3ET7A 3V04A 4QTCA 4NKSA 3FKNA 4MEDA 4NL0A 2LGCA 2QD9A 3C51A 3KN5A 4QRCA 3UC4A 2FA2A 5IQCA 4J52A 2PMNX 4M69B 5E4HA 4IWPA 5E92A 1CSNA 4I4FA 4RWKA 3KRRA 2V5QA 3EYGA 3BPRA 3MVJA 3F66A 2C6LA 4MVFA 4W4VA 4L7SA 2RFNA 3TJDA 4AX8A 5CXZA 3NW5A 4FKPA 1URCA 1K2PA 2C6KA 3DJ7A 5FEEA 3AC8A 4NCTC 4RX7A 4IX6A 2R3GA 4XNEA 5DBXA 3R8VA 3V5WA 3ZSHA 1PY5A 1Y8GA 3KF7A 2W1ZA 2R3JA 5AUYA 1W98A 2XJ2A 4FR4A 2WTIA 4FVPA 5HIBA 5LVLA 2WELA 1YI3A 2WMQA 2WIHA 3TTIA 3QU0A 5HE0A 4I22A 4M0YA 1B6CB 3CP9A 3F69A 3A7GA 4FSWA 2JKKA 4LL5A 4QMYA 4C4EA 5LOHA 1LEZA 2EXMA 5AIKA 4C57A 4NKAA 3N4VA 3ID6C 3BYUA 3BKBA 4CQEA 5BUJA 3BWFA 4E5BA 1XR1A 4FTKA 4YZCA 3R7IA 4FEVA 3E63A 2J9MA 3NUYA 4YLKA 5AV2A 5HQ0A 5HHWA 3GBZA 5JSMA 5B2MA 2PUUA 4BN1A 5DHJA 2PPQA 3BV2A 3VHEA 3DY7A 4ONAA 3NYVA 1XH5A 2GFSA 3OUNB 1QPJA 1ZOHA 3H9FA 3FMLA 3QD4A 4QP8A 4TYJA 2A27A 3D15A 4MXCA 4YNOA 4I24A 4EOPA 5B2KA 2J0MB 3OTVA 4XOYA 3FLZA 3WIKA 4DEGA 5IA4A 5DGZA 3GT8A 3DBEA 5E1EA 2CHLA 3AMAA 3ATTA 4AOJA 3R1QA 4JX3A 2ZB1A 1ZY5A 4M3QA 4FYNA 4JOAA 5HCZA 3IPHA 2C0OA 1OL2A 3FC1X 3PIZA 3ANQA 4QYFA 1U5RA 2PVKA 3WZKA 2IVSA 4EUUA 1SM2A 5AWMA 4ACCA 3T8OA 2YJSA 3R01A 3ZHPC 5L6WL 4DG3E 5I9WA 2VO6A 3VS5A 2WPAA 3R00A 1OIUA 4YUQA 2WMSA 4F65A 4PDYA 3Q4ZA 1OBDA 1H4LA 4XG7A 4CZUA 2XNMA 3UOHA 3ODYX 2ITQA 2UW5A 3NUUA 2E9VA 1H24A 3FXZA 1UU3A 4UALA 4D2TA 2BHEA 3CY2A 2GFCA 2JKOA 1E1XA 2OIDA 2YAKA 2YIWA 3CQEA 4MKCA 4QP9A 5CI6A 4YZ9A 3TG1A 3W2RA 4KIPA 3TV6A 3UBDA 1GZOA 3FZOA 3DGKA 4Q9SA 2HY0A 4DHFA 5IH4A 3SC1A 2B9HA 2BKKA 3G15A 2J0IA 1RW8A 2OH0E 5HG5A 3DNDA 2PK9A 1Q8ZA 2YERA 4OUCA 3NEWA 5KBRA 1FMKA 2BFYA 2QOIA 5GZAA 3MFSA 4KBAA 5AJQA 4QQJA 3GNIB 2WXVA 2HAKA 2YISA 3O17A 1YVJA 3EQHA 3K2LA 2I0HA 1Z57A 4G3EA 3ZSIA 3RCDA 1JAMA 5I4NA 1V0OA 5KO1A 3CQWA 3C4EA 4UXQA 3S4QA 3BHUA 3ZYAA 2NP8A 4CKIA 5AV4A 5CASA 5CYIA 3PA3A 2X81A 5EHOA 4QPMA 5HBJA 3W2SA 4BDAA 5HLNA 4FEWA 3QRUA 3VW6A 4D2RA 3OCSA 3WOWA 3EN7A 3AD6A 1URWA 3FI2A 4UWYA 5IDPA 2P33A 3UO6A 2XK8A 4O7TA 2X4FA 2W1CA 4KSQA 3JVRA 5DA3A 4IWOA 3GQLA 2EWAA 2V62A 4FK6A 1FOTA 2PE0A 4FYOA 2XJ0A 3BWJA 2OGVA 1FMOE 1CM8A 4MBIA 4FTRA 3QRKA 4QMWA 2FGIA 1ZAOA 3ZS5A 1DI8A 1OKZA 4ZJJA 2YCQA 3W2PA 2IW8A 3FY2A 4EZ3A 2WMRA 4F1TA 2WQBA 5M4CA 4WD5A 4ANOA 2QOKA 4IB5A 4EEVA 3P23A 3MH3A 3CTHA 3HRCA 4A9UA 3FMNA 2UZNA 4CRLA 4OTHA 3E8EA 4PL3A 2F2UA 3KL8A 5DRDA 1FQ1B 4BTKA 1H27A 3NNXA 3JXWA 3OTUA 4JI9A 4PDOA 3UJGA 3ZLXA 5CU2A 3ORPA 2JBPA 3D5WA 3HMNA 5HBEA 5CAUA 4L45A 4M66A 4XOZA 3E8DA 2AC3A 4UZDA 5AR4A 2ZV7A 4K2RA 3VUTA 4AT3A 5LVMA 4XX9A 3BHYA 2Y7JA 3OS3A 1XBAA 3DB6A 5CU3A 4GYIA 4GV1A 5L2TA 2B0QA 3IGGA 2V7OA 5AR7A 3ZRKA 5HCXA 4DGNA 5BUEA 3OXIA 3P7AA 3R9HA 4PQNA 1FGIA 3FLNC 5FD2A 4E93A 2ZM1A 4HPUE 4MXAA 4Q5EA 3V01A 4R7BA 1J7UA 2ITNA 3ORKA 4QOXA 4RA4A 4RC4A 3BQCA 3WZJA 2GQRA 3VS7A 4D4YA 1H1RA 4S2ZA 4D4SA 2WQOA 4WKQA 3O8PA 3WE4A 2C3KA 5HNIX 3I7CA 4FUXA 3NUAA 3HECA 3FL4A 2I40A 1U4DA 5FXQA 4IZ7A 4EK8A 2OF2A 3HNGA 1PRYA 2UUEA 4MCVA 4FT5A 2UW8A 3FHRA 2ZMCA 3KB7A 3RK7A 4DFBA 1Y8YA 4GK3A 4G17A 2GS6A 4QMPA 5HE2A 2WO6A 4JG8A 2F49A 3DV3A 4K8AA 5JN2A 3OEZA 2XK4A 3DKOA 4R7IA 4BYIA 4Z55A 2P0CA 3LVPA 4DN5A 5L4QA 2JD5A 3VS2A 3NPCA 1XJDA 3MPMA 1OL7A 3MPAA 4O81A 2YACA 2Z02A 4KA3A 3VW8A 4DITA 3BEAA 3L8SA 1PXPA 2WGJA 1R3CA 4ACGA 3QYWA 4X2GA 5EHYA 1M52A 3FV8A 5ANGA 5EHLA 3TIYA 4TT7A 3BRBA 1JVPP 3W1FA 5ICPA 1L3RE 1OPJA 3UZTA 3TNHA 1ZYCA 3EOCA 3W18A 2VTRA 3KRWA 2GNGA 5EYKA 3NYOA 3AD5A 5IKWA 3ULZA 3QA0A 3LJ0A 4FV3A 4IADA 2ITTA 3BX5A 4PX6A 4AACA 5L2QA 4ZEGA 2ZB0A 4BDEA 1W8CA 3MY1A 3PIXA 2IG7A 5ETAA 3C9WA 4BBFA 3DXPA 3TKUA 2VV9A 2P55A 4RIYB 3LCSA 4AQCA 1R78A 1UVRA 2PZ5A 3OOMA 2HENA 1I44A 2WFYA 3ZXZA 4MD9E 3EJ1A 4ACMA 3D7TA 3NX8A 3UQCA 4H3BA 5K4IA 3DJ5A 2PTKA 4BIEA 2PMOX 3EKNA 4AFJA 3HKOA 1IAHA 3HA8A 3O7LB 1M7NA 3QD0A 1LUFA 3NNUA 3Q9XA 4XRJA 5M4FA 3NW7A 3GU5A 4CV9A 4O6EA 3MA6A 2OO8X 2X8DA 3A2CA 3A7IA 4HCTA 5M55A 4RIXB 1X8BA 3PVUA 4AZWA 4BDHA 2PVFA 4MK0A 2VTPA 4BDFA 4DGLC 3KFAA 5HTIA 5KMNA 3BLHA 3QQJA 3MA3A 5KZ0A 4M14A 1WVXA 5EM8A 4GG5A 3QUDA 5F9EA 5FRIA 2B9IA 1UKHA 3DB8A 3A7FA 2CKPA 1G8AA 2F7ZE 3O71A 4P7EA 4UMTA 2Z2WA 1DM2A 3EZRA 4FKSA 4BGHA 4O91A 4ZSAA 5TE0A 3MW1A 3COKA 3HUCA 1IG1A 4QMLA 5AP2A 3ORNA 4V01A 4EORA 2XYNA 3R2BA 3NVKI 2DS1A 3E64A 4Q2AA 2QO9A 3MV5A 4BHZA 5E8XA 4USEA 4PWNA 2W0JA 3LCOA 2ETKA 3GGFA 5EI6A 3GU4A 1H0WA 2OZAB 4XG6A 4F09A 5I0BA 3UO5A 3AMBA 4C4GA 3F5UA 3ENMA 3K3IA 4KB8A 1MP8A 4YNEA 5CVFA 5CALA 4UMRA 4K11A 1IASA 5FLFA 3QRJA 5GJGA 3IW6A 4I5HA 3LXNA 3HVCA 4O7VA 2JBOA 3R7OA 3R9DA 5FBOA 3VF8A 4YURA 3RZBA 2C5YA 2RSVA 4J71A 3RK9A 3U4WA 4EOMA 2IJMA 3KU2A 4FL1A 2GS2A 1FVTA 2XNOA 4JR7A 2JDRA 5JRQA 3MVLA 4WIHA 4HYSA 4M69A 5A4TA 1NXKA 3KRJA 2R4BA 1MQBA 2R3HA 2UW9A 4LGDA 3QTZA 5CANA 4E8AA 3LFEA 2W4OA 4RLLA 2UZEA 4DEAA 4X6RA 2ETMA 3HZTA 3PXQA 4JS8A 3VWAA 2IPXA 4CG8A 3ACJA 5EH0A 4W4XA 2QU6A 3Q4TA 1PJKA 3SLSA 4DFZE 3GFEA 4APCA 3CXWA 5JRSA 2WMTA 1PXLA 1XBCA 2ZM4A 3HLLA 4O0VA 5AP3A 4ZTHA 3B8QA 3D5XA 5DT3A 2P2IA 3CD3A 4C4FA 3DBQA 3DJ6A 2BR1A 4FEXA 2UZVA 3GXLA 1KOBA 4OTRA 4ALUA 5K3YA 2SRCA 5AP7A 4D2VA 4E5WA 1V1KA 2UZLA 4FSUA 3UVPA 1NT2A 3CJGA 4LMUA 5GHVA 2A19B 3GCQA 3UZPA 3UP7A 3CS9A 4M13A 4IB1A 5EI8A 5J87A 3QKKA 4IBMA 1XH4A 4MYGA 5LMKA 5HTBA 3HV7A 2B52A 4USDA 1OUKA 1VEBA 5CAVA 5DMZA 3HV6A 2YZAA 3NDMA 5IH5A 1E9HA 4OTDA 4BDKA 2BRNA 4CLJA 5EW3A 3EWHA 4ZTRA 3R9RA 2B9FA 4GFMA 4FTUA 4L46A 4F0GA 2CCHA 4IHPA 2ZV2A 5AM7A 4BCPA 4DBNA 4Y73A 2C0TA 2PYWA 3LLAA 2GS7A 4GSBA 4R3CA 3Q9YA 4X2NA 3ZBFA 3C4XA 3LFNA 4L6QA 3UYSA 3POZA 3EHAA 1IRKA 1GIJA 4YLLA 1KE7A 4X2KA 3GU6A 2IW9A 3VBQA 3DBFA 4CRSA 4QQCA 2HELA 2I6LA 4TZRA 4WBBB 5BYZA 2BZIB 4D5KA 2WQMA 2XRWA 4HCVA 4EYJA 3FZ1A 2IZTA 4DEDA 3BEGA 3RCJA 3F5XA 4QP7A 3AQVA 5AP5A 5H8GA 3EN6A 5HCYA 4FKWA 4IQ6A 3ZDIA 3PTGA 3F7ZA 4P5QA 4RVMA 3ROCA 2VTHA 2XNBA 2Z7SA 4QQTA 2F7XE 3KMUA 3PZHA 2GQGA 4TWOA 2BRGA 4EH3A 4M97A 4DE4A 3N4UA 1Y57A 2XIYA 4O27B 5I3RA 4KSPA 4EOOA 5BMMA 4DH8A 3M2WA 5EYDA 3RHXA 5E8SA 4PMTA 3RP9A 4GT3A 3F2AA 4DGOA 3MFRA 3QCXA 4ZLZA 3ZLYA 1M2PA 4RFMA 4EOKA 4FTOA 3UNJA 4U5JA 4I1ZA 2BRBA 4AT4A 1YOMA 1JOWB 4WSQA 2ETRA 2GNHA 4EHZA 4IAFA 3FYKX 2YWVA 4O84A 4Z7GA 5HLPA 4CXAA 1BL6A 2G2IA 5HI2A 1Q5KA 5IUGA 5L8KA 1H26A 2PVRA 4KKEA 2VN9A 2H6DA 1XBBA 3OHTA 4LI5A 3R30A 5DR6A 5IEXA 1H1QA 3RPRA 2XF0A 2VUWA 3CGOA 4P2KA 1WBOA 3OCGA 3C5UA 3F3WA 4U43A 4M7IA 5H9BA 4FKRA 5AX3A 3OG7A 1ZZLA 5CAPA 4IC8A 1O6YA 5BMSA 4UX9A 4HPTE 3NUXA 3KRLA 3THBA 4J8MA 4QMZA 4CFXA 4FTQA 3PXKA 3F5GA 4GUEA 2ITZA 3P9JA 2J4ZA 3OMVA 2Y0AA 4RPVA 5CVGA 4F70A 3R71A 5JQ8A 2GU8A 3LCTA 4PPAA 4UXLA 4WG5A 4JDJA 4ZS0A 4DFYA 4ZTQA 2QG7A 4YO4A 3WIGA 1CDKA 2OJFE 4HZSA 4TYIA 3UNKA 5BVOA 3TZ8A 2CGVA 3LKMA 1GJOA 4KNBA 5ACKA 3RK5A 3BU5A 5T3QA 3F61A 3M42A 3R7UA 4DCAA 4AA5A 3Q6WA 4GVAA 3W32A 5C4KA 1L8TA 5KMLA 5F4NA 5ETCA 3VNTA 3I5ZA 4JDHA 4KKGA 1ZMUA 2O2UA 5GIOE 3I6WA 5IA5A 3C0HA 5CENA 3VULA 3ZUTA 3F3UA 2FSTX 1JSVA 3A61A 4IW0A 4XG2A 4UMUA 4C59A 5CU0A 5FXRA 2FB8A 2PVJA 3PJ2A 5IG1A 4FTTA 2HY81 4GT5A 3GENA 3BGQA 5GJFA 3TEIA 4ASEA 2BIKB 4NCTA 2J90A 3R8LA 2J7TA 2X7FA 5FWKK 4GL9A 3ZZEA 4CFWA 3Q3BA 3ERKA 3NSZA 2WMUA 1FVRA 1OUYA 2A4LA 4IWQA 3T9IA 2YA9A 4Y5QA 4AF3A 3R7EA 3RMFA 2NRYA 2WEIA 2WQEA 3PVGA 1LP4A 2VWXA 2Z60A 3N9XA 3O50A 1XHAA 4KBKA 4BKJA 3PIYA 4D0WA 1YQJA 2VX0A 1GNGA 3IDCA 3Q96A 3L9MA 3OROA 1VR2A 1PMNA 5CNNA 4BF2A 3KK8A 5E1SA 5CF6A 5I3OA 2I7QA 4C58A 1M2RA 3KEXA 5HGIA 2R3MA 2R3PA 2YIQA 3RWPA 5CAOA 3BV3A 5BX0A 5HTCA 1OGUA 2FSOX 4ANLA 1TQMA 4IIRA 5ETFA 4L01A 3CTQA 2ZM3A 3PDTA 5DEYA 5E8VA 3FI8A 1A9UA 5AR2A 2O64A 3RPOA 4AN9A 4C7TA 2R3NA 3Q6UA 4IX3A 3NAYA 5HO8A 2OI4X 2GPHA 4XS2A 5T68A 4QYHA 3VC4A 4ZLOA 4A06A 2JIUA 3W33A 4AZFA 4F1MA 4ZTMA 5EKOA 1G8SA 3NW6A 4O1OA 5LWMA 3DKCA 5HICA 5A6OA 1QPCA 2BRHA 3HMPA 4ALVA 3ZONA 4V04A 3MSSA 2XCHA 5FTGA 1PMUA 2UW0A 3FLQA 3FPQA 5CEPA 3HMMA 2I0EA 3PLAE 3UIXA 4I23A 3QZGA 3TIZA 2W9FB 4IVCA 4XH6A 4YC8A 3FQSA 2OICA 1NVQA 3H10A 3KGAA 3BE2A 4QMMA 4EZ5A 3FZPA 5DR9A 5IQIA 2DYLA 4ENYA 4CFMA 4O7ZA 4ZZNA 3AT2A 2CDZA 2QOQA 3GVUA 3CPCA 2CLXA 4FIFA 3DLSA 1NY3A 1OPKA 3EFWA 3ZMMA 4RIYA 3BCEA 4RJ4A 3QTRA 3ROYA 4YHTA 2H8HA 3GC0A 5D7VA 4XG3A 5CQUA 5DLSA 3UPZA 2GTNA 3LZBA 1H8FA 4JRVA 4KIOA 4QP4A 2QQ7A 4F6UA 3EFLA 3PVWA 4XG4A 1KSWA 3PVBA 4Z7HA 4HNIA 1BMKA 1KOAA 1REKA 4B8LA 4Q9ZA 4E20A 4RMZA 3EFKA 4RIXA 3WF5A 4KD1A 4E73A 4EQUA 2VTSA 4J97A 4EQCA 4OLIA 2ERZE 2VNWA 4AFEA 2OLCA 4K77A 2GHLA 4PTGA 4NIFB 3Q5ZA 1Q62A 2PZPA 2XVDA 4G6LA 4PMPA 1MUOA 3EQIA 4S32A 3LFQA 4RX8A 3W2CA 2BRMA 3RM7A 5IA2A 5IA1A 2XBJA 3COIA 4JDKA 1OM1A 3BBTB 3Q4CA 4IZAA 4CLIA 3LHJA 3SG9A 4FT7A 4J7BA 4O1PA 5L2WA 1RDQE 5HEZA 3OY3A 1KE5A 4YZBA 4BB4A 4MXXA 4DEEA 4IFGA 4HGSA 2XNGA 2KULA 2QOLA 3MN3A 2OZAA 2YFXA 2EU9A 1W83A 3F82A 4QTBA 3OC1A 4DC2A 5K0XA 4L3JA 4LYNA 1ZWSA 3DBCA 5C8NA 4FE2A 5CLPA 2ZAZA 4D4VA 4DGGA 3EQGA 5DNRA 5JZNA 4NJDA 1OIQA 2BTRA 3PSDA 4M15A 3LMHA 3P78A 5JH6A 4X3FC 3TV4A 1SVHA 2WTJA 3W2QA 4C61A 2WTKB 4IX4A 3I1AA 2JLDA 4O7YA 4L53A 2ITYA 3NZ0A 4FSNA 5BPYA 3A7JA 3ODZX 2PVNA 3G0FA 3ZU7A 2P2HA 1SNUA 1YXTA 4DFNA 4OAUC 1VYZA 5DVRA 5FP5A 4CMTA 4OBOA 2VWBA 3NUSA 4CMUA 3VUMA 2WMXA 3FLYA 1LEWA 1AQ1A 3QQUA 2PU8A 3ITZA 5IUHA 5AX9A 2GNLA 3UO4A 3CPBA 3LLTA 4Y72A 4X2JA 2PE1A 4JG6A 2EVAA 4C34A 3ETAA 3QWJA 4IAIA 1Z9XA 3PA5A 2YIYA 3EIDA 5CQWA 5GJDA 4BCMA 1M7QA 2LAVA 2WQNA 4EH5A 3QUPA 5IUIA 3CKXA 4FV7A 4UEUA 4FNYA 1Q8TA 2JFMA 4LV8A 5AR3A 2QOOA 4FL2A 4WNOA 3P86A 4RJ5A 3QZFA 1UU9A 4HYHA 2BROA 3DS6A 3AXWA 3QC9A 5C9CA 5E8YA 4CGAA 3DAKA 3WI6A 4IJPA 5FM2A 5AADA 4G5JA 3G6GA 5E8TA 3CY3A 4BCFA 4DGMA 1MRYA 3OUKA 4QP1A 4RA5A 4HVIA 4ZK5A 4HGTA 4ANQA 2CKQA 1GIHA 2Y8OA 4I0TA 4E26A 1DI9A 3IO7A 3QQLA 4G9CA 1JKKA 4ZSEA 1YWVA 3QA8A 4QNYA 4C4JA 4BKYA 4DFXE 4F7JA 3CKWA 4QTEA 2AUHA 1A48A 2GQSA 5CEOA 4O82A 4JQEA 4RQKA 1H25A 4HOKA 5DEWA 3O2MA 3ZRMA 2C6EA 5IQBA 4NYEA 4FTJA 5JEBA 3NYXA 2FSLX 3COMA 3MFUA 4YPDA 2R7BA 4BIDA 2QODA 2XKDA 3FZRA 3RBWA 2W4JA 3QD3A 3MI9A 5TF9A 2ZYBA 4DCEA 3QALE 5CAQA 2Z8CA 3M11A 4YZDA 4G3DA 2UVYA 3ORXA 1QMZA 3KY2A 3QF9A 2YDIA 1PXNA 2F9GA 2XKEA 4TN6A 4R78A 3LJ1A 2V0DA 4LFIA 4L42A 3KREA 1ZOGA 5K5XA 4Z3VA 3VUDA 5AUVA 2Q83A 4HJOA 2GSFA 2G2FA 4PTEA 4YR8A 3QGYA 4E6DA 4O22A 4FUYA 4E6AA 3TN8A 3Q52A 4O86A 2X9FA 4D5HA 3U6IA 1PKDA 1ZARA 2W99B 2WTDA 2XNNA 1CTPE 4BDJA 2GCDA 5C1QB 2WU6A 4JL9A 5L2SA 4WT6A 2UW7A 3PUPA 4W8DA 4Z9LA 2HXLA 4FG9A 3GCUA 3NWWA 3CEKA 3PPKA 4GFGA 4LUDA 3ACKA 4YJRA 5CWZA 4F7SA 4FTNA 4QTAA 3MB6A 4O0WA 4C62A 4EQMA 4FKVA 4G9RA 4P90A 5F94A 5AP6A 2IZUA 3F5PA 2FUMA 3DDQA 2OU7A 2VWUA 4IZ5A 2PSQA 3A60A 4ENXA 4I5PA 5HVJA 4O21A 3RJCA 1KE8A 3OCBA 4PNIA 3G5DA 5KKRC 3NGAA 2XEZA 4CKRA 4XUFA 4L00A 4YMJA 3PY1A 2C3IB 3ZFYA 1XO2B 3FPMA 4IEBA 3FYJX 3TNPC 4BTMA 3D2IA 3SAYA 4FBXA 3NUPA 4D9UA 1K3AA 4UZHA 4EK5A 4FZDB 2OIBA 2YM6A 4YHFA 4OTPA 2IN6A 2QLUA 3D2KA 4ANMA 2BZJA 3RZFA 3EN9A 4AGDA 4QYEA 4YGAA 1XKKA 2WOUA 2RIOA 5CS6A 3V5LA 3LXKA 4IDTA 2VTLA 3T9TA 2VO0A 2PHKA 1WBPA 2WB8A 4RIWB 4BIBA 3FQHA 4B9DA 5BUIA 3FY0A 1KE6A 3FMHA 1W7HA 4Y83A 3OBJA 3TI1A 3C0GA 3EZVA 3QTQA 3R83A 4DT9A 5D10A 4IM0A 3VIDA 4CZYB 5B0XA 4FGRA 4RVLA 4TNDA 4O0YA 3DAEA 4G5PA 2PZYA 3PA4A 2CGXA 5AP4A 3U4UA 4AW0A 3W16A 3NIEA 5IMEA 3OXTA 2YABA 4DLIA 4OT5A 2J6MA 4HNFA 2W5AA 2WHBA 4GJ2A 1PKGA 1Y6BA 2XM8A 4X3FB 5HE3A 3A4OX 3S1HA 2WIPA 3Q9WA 4UMQA 3MWUA 4G6NA 1H0VA 5DG5A 2I1MA 2WAJA 5C8MA 3TT0A 1CMKE 3GCPA 4AUAA 4FF8A 3LM5A 3MGYA 3ELJA 4BBEA 3ENHA 5KMIA 4ITHA 5J8IA 1VYWA 3I0OA 5F20A 4PMMA 3TNQB 2XK9A 4X0MA 4CZTA 4U3YA 3BYVA 5J5TA 1GZKA 2C69A 4A7CA 3PJ1A 1YWRA 3FC2A 3E93A 4X21A 3L9NA 2FH9A 1WAKA 4Y5HA 2RG5A 2XZSA 4FV2A 4N6ZA 5F95A 4FTAA 5ACBC 5C03A 3EN4A 4YBJA 3OWLA 1YDTE 2EXCX 5M08A 4HGEA 4EKKA 2VTJA 5IF1A 4J95A 3F2RA 3P7BA 5IQHA 1UNGA 3WF9A 5IH6A 5IQGA 3UOLA 5LVPA 2PMLX 4GEOA 4RZVA 3DT1A 1Q3DA 2P3GX 4BCHA 4OAVB 3TUDA 3Q4UA 2B53A 1P2AA 5JKGA 4XV9A 1WZYA 2JEDA 3TTJA 5A54A 4GUBA 3UVQA 3UG1A 1OMWA 2NPQA 3ORTA 1SZMA 2XRUA 3AC4A 3QRIA 2ESMA 2VNYA 4EK6A 2X8IA 2XKFA 5KMKA 3VBYA 3H30A 5FM3A 2RFDA 5L3AA 4FSMA 3PPJA 4CQGA 5AUXA 1H00A 3FQEA 3P79A 3DPKA 1R39A 4BCIA 4OBQA 3D94A 1M14A 4BDBA 3FBVA 5DFPA 2XUUA 5JFSA 4DEBA 4DG2E 2X0GA 3E3PA 5CTPA 4BDGA 2C3JA 4FEUA 4C36A 2OXDA 3EN5A 1NA7A 4XP2A 3CJFA 3DKFA 2HYYA 2KTYA 4FT9A 5HO6A 3VAPA 3AGLA 4R3PA 4U8ZA 4FV9A 4QMTA 3ZUUA 2E9UA 5CNOA 2JIIA 5LMAA 4S33A 4UYAA 4HVGA 2BDJA 3UZRA 3H0ZA 4OBPA 3V51A 3DDPA 4E4LA 3HDMA 4D1SA 5D1JA 3HMOA 2XYUA 2W1HA 4J53A 2BTSA 5GZ8A 3RKBA 4FT0A 3PG1A 2VGOA 3DAJA 3G33A 2YAAA 3MPTA 4ID7A 4BR3A 3DK6A 4FK3A 4EHEA 4HCUA 2UW6A 4XBUA 5HBHA 4FKTA 2F7EE 3W10A 3BYSA 2XS0A 2BAQA 2J2IB 3IDPA 1ZOEA 4X3JA 4XV1A 4ASXA 4BBMA 3B2WA 4WSYA 5H8EA 1P14A 2JAMA 4PL4A 5J9LA 1Z5MA 5K4JA 5ANEA 4QP6A 1KV2A 3GQIA 2DQ7X 4S34A 4F1OA 4HW7A 3C4ZA 5DR2A 2WKMA 5EQEA 4FKIA 5BVEA 3WF6A 3LMIA 1OL1A 3HUBA 4ZJVA 4QT1A 4J1RA 3H3CA 4TL0A 4CFUA 4CD0A 3OXZA 3FI3A 4M84A 3GCVA 5IQFA 2J5EA 4E4MA 3VS3A 3CCNA 5E91A 5KKRB 4JG7A 4I93A 4G16A 2F4JA 2UVZA 2X4ZA 3NAXA 4NIFA 4NK9A 2XJ1A 1J1CA 3GP0A 3ORMA 5M4UA 3ATSA 3QLFA 2OFUA 2ITWA 4UV0A 3TXOA 4FKOA 4BRXA 4CCUA 2UW3A 4ASDA 2IWIA 3DK3A 3PRIA 5TR6A 2CMWA 2R0UA 5ANJA 3RPYA 3ZO4A 3DLZA 4FL3A 3QYZA 5JQ5A 4CG9A 2X39A 3UQGA 3ZBXA 2R3QA 3CGFA 4ACHA 5HD4A 4PPCA 3IG7A 3R04A 4RWIA 2VTAA 3TV7A 3PWYA 3MBLA 3DXQA 2VGPA 3A4PA 5K5NA 4F6SA 5IPJA 1ZMVA 4B4LA 5D12A 5FXSA 4NTTA 4R7HA 2CJMA 4BDDA 3PP1A 3N4TA 3C1XA 4M67A 4AW2A 4OW8A 4YSMA 2QI8A 4ZY4A 2PUNA 3RINA 4YZMA 4E7WA 4MF0A 5HKMA 1HCKA 2CKEA 3I79A 1M2QA 4C2WA 2VTIA 3D9VA 3FSKA 2XKCA 4KKHA 3UIMA 4AGCA 5HU3A 5GNKA 4RLKA 3ORZA 3ZH8A 4YZNA 5BVWA 5LCKA 2XCKA 3NUNA 4XCUA 1PYXA 3VUHA 5M09A 1HCLA 1WVWA 5CVHA 1O9UA 2PULA 2WOTA 2EUFB 5E7RA 4AG8A 4IZYA 3V5TA 3HA6A 3WILA 4FEQA 4G3FA 3UTOA 1WBSA 4CVAA 1IEPA 3U51A 5CSWA 4IB0A 3ORIA 3KVWA 4RRVA 4YU2A 3QQGA 1BYGA 5CEMA 3E5AA 2HOGA 3H9OA 2GNFA 4FG8A 5CT7A 5BVDA 3TNWA 3V3VA 1H07A 4CFFA 1J7IA 3PE1A 4HVSA 2C68A 3PRFA 2I0YA 4N6YA 4XHKB 5CSPA 5LJJA 4WUNA 5C4LA 3SD0A 1OZ1A 1TVOA 2PUIA 4UB7A 4JX7A 3VBTA 3PXFA 1AGWA 1JPAA 2GNJA 3TDWA 5KNJA 3QTIA 2PZIA 2A1AB 2BDFA 1OIYA 2UZOA 3FSFA 3AOXA 4QPSA 4D2WA 5T6KA 4RQVA 3VBXA 4C33A 4FIHA 2HZNA 3TKHA 2QURA 2C5OA 3TACA 4CFVA 3G6HA 1CKPA 4XRLA 5H2UA 2UVXA 2VTNA 2JKQA 1UU7A 1YHWA 3BELA
chains in the Genus database with same CATH superfamily
3VHKA 4X2FA 4IAYA 2O5KA 4NZWB 3QQKA 3ALOA 3AC2A 5FEDA 5L6OA 3PP0A 4FSYA 4CTBA 4H3QA 2C6MA 1PW2A 1I09A 3EB0A 3MESA 3HGKA 4LOOA 2CSNA 4A9RA 5AUUA 4JJRA 2HZ0A 2JDVA 2W1EA 4LG4A 5A9UA 4HZRA 1OIRA 3QHRA 4I3ZA 3TWJA 4L3LA 4U45A 2BHHA 4QMOA 3VUKA 3BIZA 4QMXA 3FLSA 4CFNA 3V8WA 2X2KA 2YJRA 4I0SA 5AUZA 4Z16A 3UOKA 1PYEA 3F6XA 4AP7A 4PF4A 4QP2A 5AR5A 3ZZWA 1P5EA 4RSSA 3MB7A 4PY1A 2ZV9A 5GINE 2HXQA 4AW1A 3F88A 3W0RA 1F3MC 1TQPA 5JFWA 3EKKA 4RWJA 3A8XA 2C1BA 2R5TA 4YJPA 5FUTA 3GEQA 2ITVA 4IANA 4PRJA 3ANRA 2HW7A 1F5QA 5C27A 2GHMA 3R8UA 1BKXA 1PXIA 4NFNA 3EQBA 5FTQA 2QO2A 4C3RA 4RVTA 3BHVA 3PPZA 2X8EA 2ZMDA 2QHMA 4FZ7A 1PMVA 4CEGA 4FX3A 3VS1A 4BYJA 4MBJA 4DH3A 3IDBA 1Y91A 1YDSE 4LOPA 3QBNA 4CMOA 3O8UA 3E7VA 3W0NA 3FKOA 5AAEA 3S00A 5HG9A 4YTIA 2VAGA 3WE8A 2EXEA 3QD2B 3K3JA 5D11A 3G0EA 1ND4A 2X0PA 3HP2A 4E6QA 3UGCA 3EH9A 4FV6A 1S9JA 1J91A 2G15A 2WZJA 3K5UA 3R1SA 4RT7A 2XK3A 2DWBA 3I5NA 4JBPA 4AZSA 4RJ3A 3Q60A 3QTWA 4QTDA 1QPDA 4F99A 4MXZA 5BVNA 3I81A 3R9OA 3DKGA 5KMOA 1R0PA 3IW4A 4I92A 2BIYA 2HZ4A 4J8NA 4F4PA 3AD4A 3MTLA 4G31A 5BNJA 4YJNA 2ITOA 2JGZA 4ZY5A 5HD7A 4F9AA 4QMNA 4G1WA 2AYPA 4NH1A 3R1YA 2QR7A 2YM3A 1IA9A 4FZ6A 3SOCA 2CGWA 3BGZA 4LL0A 5CZIA 4RIWA 2HWOA 4F9BA 4GRBA 3PSBA 4FV5A 5IEVA 1LPUA 1JKTA 3C0IA 1APME 2C6TA 3ULIA 4BTFA 2WTCA 3Q2MA 5FBNC 3QAME 4DT8A 2YEXA 4JIKA 4U44A 1WMKA 3DCVA 4EYMA 5E8UA 2JDSA 3LW0A 3MFTA 4DG0E 1YDRE 4RJ6A 4EOQA 1OB3A 2C1AA 1Q8UA 3B8RA 3W2OA 3FZTA 4X3FA 2X0QA 3M1SA 2VTTA 3KC3A 1FPUA 3SHEA 3UVRA 3OWPA 3VQUA 2X2LA 4CYIA 2X9EA 3BI6A 3HEGA 5EFQA 2FSMX 4EOJA 2C5NA 1XH7A 3RNYA 2ZJWA 2XNPA 2RG6A 4NW5A 4GK2A 4XV3A 3VQHA 4W8EA 4E3CA 2IF8A 1B39A 5E8WA 3IW5A 2Y6OA 3QKLA 1MRVA 4YJQA 3S0OA 3MS9A 1UWJA 4WBOA 4JXFA 2R3IA 3V8TA 4L52A 3KK9A 4XEYA 3LCKA 1W82A 5HE1A 1S9IA 4JQ8A 4NFMA 2XA4A 2AQXA 2GDOA 1A06A 1BX6A 3LXPA 4RX5A 5KMJA 5KBQA 3K54A 3KULB 4GT4A 4TNBA 3TNIA 3QXPA 4QQ5A 3ZM4A 5B7VA 4GK4A 4MH7A 3NMUF 2RL5A 3CC6A 2NO3A 5GIPE 4FI1A 4G2FA 3MIAA 4D28A 3WYXA 2XEYA 4FNWA 3D4QA 3KXNA 3P5KA 1ZXEA 3UNZA 3IECA 4EI4A 3KRXA 5LARA 2IVUA 4L67A 4F0FA 3PYYA 3G2FA 1PF8A 3OEFX 4NM5A 4FICA 4EH8A 2O0UA 3UDTA 3R8ZA 3QL8A 3RAWA 5BQ0A 3KKVA 2GMXA 3O8TA 5E8ZA 3UC3A 3VVHA 5CX9A 5LMKC 4QYYA 2YM4A 4DH7A 4BTJA 2W06A 4RX9A 5DWRA 5AAFA 4O7RA 2OWBA 5CEQA 1YKRA 4QP3A 3R8PA 3V5PA 3TDVA 4EOIA 5DE2A 2H9VA 4XMOA 3R1NA 4NWMA 2ACXA 3PG3A 3D7ZA 4S30A 4DFUA 5AP0A 3BU6A 3D83A 4LM5A 4ZTLA 4ERWA 3NYNA 4L68A 3KMMA 4QMQA 4UMPA 5HNBA 2UZDA 4ITIA 1YXXA 4EUTA 2VTMA 3QZHA 3FKLA 4IM2A 2WU7A 3TMOA 5AR8A 2CNVA 4CTCA 2IZRA 4JT3A 1OBGA 3QZIA 3OF0A 4DFLA 4DEHA 3ZC6A 1DS5A 3W0SA 5CT0A 3CIKA 4C37A 4UN0C 5ANOA 4LV5A 4BCQA 5CEIA 4L8MA 1RJBA 1W0XC 3HV4A 2WD1A 2UV2A 3NCZA 3R7GA 4WNMA 4ANNA 4NTSA 4HYIA 1OKWA 4E5AX 2UZTA 4EK3A 3WF7A 1QCFA 3FHIA 5KX8A 5HO7A 4KBCA 5AIRA 3RTPA 4KRDA 5C8KA 2OFVA 3AC1A 1FGKA 1PXJA 2W5HA 3SDJA 3TZ7A 4ZLYA 1H28A 1OL6A 5AA8A 1J1BA 5EM5A 4BI1A 4OT6A 5HVKA 1UNLA 3ALNA 3PJCA 4EHVA 4XV2A 4IE9A 4LUEA 4ZS4A 3PXRA 4GKHA 5IDNA 4I6BA 1LR4A 4GG7A 3TL8A 3LPBA 2QOHA 4R5YA 2W1DA 4F7NA 4EKLA 3ZSGA 1OVEA 3R8MA 3MH1A 5L2IA 4YBKA 5AP1A 1PXMA 3EQRA 2Z7QA 2PMIA 4JAJA 2JDOA 2C4GA 2C5XA 2J50A 4Y95A 3P1AA 5IA0A 4D4RA 2J0KA 5J1VA 1NVSA 4J98A 2R0IA 4XJ0A 3RI1A 4AXFA 3TUBA 3SG8A 2HZIA 1JNKA 4H3PA 5G1XA 2Y9QA 4O0UA 1OITA 4EL9A 3L1SA 2XIZA 2E2BA 2VTOA 4RZWA 5JT2A 3MDYA 4DYMA 4O4DA 5LVNA 4PDPA 3DFCB 2NYAA 3D5UA 3QXOA 3MIYA 4K6ZA 4LOQA 3FUPA 4UY9A 2F57A 5EOBA 3F7WA 4V05A 1JKSA 5AMNA 1GAGA 5EOLA 4M68A 4IXPA 4N0SA 4OTQA 1OL5A 4I0RA 4YJVA 2JKMA 4MBLA 5M06A 3PUFC 4H05A 4FGBA 2YLFA 4AZEA 4AXDA 4NT4A 3A7HA 4XYFA 1XH9A 2WMBA 3HRFA 5EQYA 5LXMA 4FSQA 3HYHA 4GH2A 3H4JA 2BZHB 3SQQA 2ITUA 5CSXA 4E4XA 3CLYA 2NNWB 2IO6A 3N51A 4O7NA 2ONLC 4FV1A 2C0IA 4YTFA 2RFSA 4WRSA 3QGWA 5ANKA 2JC6A 4AZTA 5GZ9A 3G51A 2QR8A 2PVHA 5HNGA 4USFA 4FKGA 2XH5A 3LFFA 3E8CA 3F9NA 4JDIA 3OW4A 3QTSA 4QMSA 4EWQA 2Q0BA 4G6OA 4PP7A 2BDWA 4AN3A 4ZTSA 1YXVA 2PE2A 4U42A 2ERKA 4MD8E 3OFMA 4ORKA 1OKYA 3UE4A 5CF4A 4JBVA 3SV0A 2O63A 1ZRZA 3KA0A 2B54A 2A0CX 2YCSA 2C47A 3SA0A 4R1VA 2QKRA 4KWPA 2OJ9A 3VS4A 4ALWA 4EH6A 5JZJA 5L8LA 5DPVA 4EH2A 2A2AA 2W9ZB 4PUZA 5FEQA 5CEKA 2C3LA 1WBNA 4LMNA 4MNFA 3QX2A 3VO3A 2XIKA 4BWPA 3PY3A 2PWLA 3EQFA 3HRBA 5ETIA 1R0EA 1K9AA 2WEVA 3GCSA 5KHWA 4IVBA 2GTMA 2V22A 3AMYA 4RIOA 1JBPE 3I60A 3B2TA 4BVUA 5JGBA 3LCDA 4EBWA 3VRYA 5J5SA 3HV3A 5EDRA 4FTLA 5AV1A 3LIJA 5M53A 4PP9A 3JY0A 5JFXA 3JPVA 2G9XA 5LVOA 4TYHB 2OXYA 5FG8A 1WBVA 4ACDA 3FE3A 5HIDA 2O8YA 2QVSE 3BLQA 1U54B 3P0MA 3E88A 4K9YA 5HG7A 2BMCA 2OF4A 4FSRA 3RWQA 4DH1A 5E90A 3IOKA 4X6QC 2O65A 4U97A 3KCFA 2C6DA 4APPA 3SVVA 1ZMWA 1RE8A 5EM6A 2YDKA 4CYJA 2X1NA 5LQFA 3TM0A 3AT4A 3PLSA 5HOAA 2PVMA 3SRVB 4ANSA 2J0JA 4C0TA 4JAIA 5I9XA 3C50A 3IK3A 4M12A 5DIAA 3RNIA 4XP0A 1UWHA 4ERKA 3P7CA 1BL7A 1R1WA 4OTIA 4BI2A 1ST0A 4ZP5A 3RAIA 2XK6A 3W55A 3DA6A 3H0YA 4JNWA 4B99A 5A4LA 4IAZA 4LV7A 1TKIA 1UNHA 3D5VA 2V7AA 4BC6A 5C26A 3O7LD 3UIUA 3PXZA 5F1ZA 4WNPA 3LFDA 4UBAA 4GYGA 3T3UA 4EH4A 2X2MA 2HW6A 3QC4A 5FGKA 3ZOSA 2BFXA 5LWNA 3U55A 3DZQA 3PE2A 3R0TA 3SX9A 5ITAA 3E92A 4RJ7A 2PZRA 5JMSA 4L9IA 2V55A 3JR1A 1SVGA 1BI8A 3EYHA 3LFSA 4YO6A 5AUTA 4JBOA 2VWYA 5AUWA 4ZSLA 3R02A 1Q8YA 5KUPA 4JVGA 2OKRA 1UA2A 2ITXA 2GHGA 3KXMA 4A9TA 5EQPA 1YXUA 5IMXA 4BZDA 1W2CA 4J99A 3JYAA 4IC7A 4IAAA 2BKZA 4IVDA 4QD6A 3ZLSA 1ZYSA 4H39A 4QPAA 3EQCA 4BWKA 3TUCA 4CCBA 3UG2A 1WBTA 3P4KA 5A46A 4MNEB 5K9IA 2QKWB 3FAAA 4K18A 3VS0A 4Y8DA 3Q2JA 1DAYA 3U9NA 3V6SA 3IS5A 5G6VA 4MD7E 3QTUA 3ZRLA 4NU1A 4R77A 3CTJA 1PXOA 4BDCA 5I9VA 1CKIA 4MTAA 4B8MA 4O0XA 3V6RA 5EKNA 4CT1A 4EOLA 3MVHA 4AXAA 4BFMA 4F9YA 4GIHA 2WNTA 5FQDC 4KIKB 3ZO3A 5L6PA 2XBAA 3NRMA 2R2PA 1NW1A 4V0GB 2QOFA 5E9EA 4FIJA 1UV5A 3EQDA 4XBRA 4J96A 4A9YA 3BE9A 3VBVA 4NM3A 3VBWA 4NJ3A 2W1IA 2WMWA 5LMBA 4TY1A 2RGPA 3UODA 4KUJA 3V5JA 4GKIA 4EZ7A 2C6OA 1H08A 4WG4A 5D7AA 3VS6A 4E1ZA 3F2NA 3CSVA 4YP8A 4JMQA 4KIQA 4P5ZA 4DTBA 1IR3A 1U46A 2QLQA 4I6HA 2EB2A 2BPMA 4D2SA 4O0SA 4W4YA 2YN8A 4H58A 2BAJA 1Q99A 4PL5A 3MH0A 3Q32A 5EDPA 5HX8A 5IU2A 4RVKA 3E87A 3LQ3A 1IA8A 3HV5A 3TJCA 3U9CA 4LGHA 4L43A 4AU8A 1JWHA 2Z7RA 2UZBA 3W8LA 5IA3A 2BZKB 5I9ZA 2OJGA 3KXHA 4C3PA 5EYCA 1T45A 4YPSA 2XAOA 3I0QA 4F9CA 3REPA 4PNKA 5IQAA 5AA9A 3R28A 3Q04A 5EDQA 1Q8WA 3AGMA 3PJ8A 4N57A 3WZEA 3DQXA 1VZOA 3KF4A 3RALA 2B1PA 4L7FA 3Q53A 4FKUA 3W8QA 2C6IA 2WMAA 5M51A 2HCKA 4GVJA 5AFVA 1JLUE 3KULA 3LFAA 4Q5HA 4AT5A 5EYMA 4QYGA 4U7ZA 3GOKA 2Z7LA 4RBLA 5J9YA 4F9WA 2G1TA 4HGLA 2W05A 2B55A 4MQ2A 5CXHA 3UOJA 4DDGA 3QFVA 1U5QA 3F3VA 4TYGA 3SXFA 4EONA 4GFOA 5C01A 3GUBA 2OZOA 4MWIA 3W0PA 4BDIA 1YRPA 4MF1A 3EFJA 4R5SA 3HDNA 3CBLA 4FV0A 4AZVA 4I94A 4X7QA 5A4CA 4DHIB 2YWPA 1ZYDA 5HU9A 3II5A 2ZDUA 5IQEA 2X7GA 2XMYA 3OP5A 4BCKA 5J7BA 5AAGA 4FJVA 1ZY4A 5KE0A 4A07A 4FV4A 3L9PA 4TYEA 3S95A 3QCQA 3WF8A 5JGDA 4TPTA 3S3IA 3S2PA 4YJUA 4YTHA 3WZUA 5BVKA 3C13A 4XG9A 5ANDA 1T46A 3LQ5A 4NW6A 2JFLA 2J5FA 2OJJA 4FODA 5HESA 1JSUA 5KMMA 4RJ8A 2QU5A 2I0VA 3CE3A 5HVYA 2C30A 3ZUVA 1H1WA 1Q61A 1PHKA 2W17A 4NM7A 2QHNA 1H1PA 4DTKA 4YC3A 3DK7A 2FYSA 2WMVA 2QG5A 3LFCA 2CGUA 4YC6A 3SXSA 1Y6AA 2YCRA 4AAAA 4BKZA 3GOPA 4NEUA 1QL6A 2R3OA 4I5MA 3PXYA 4D9TA 4TWNA 1WCCA 5BYYA 5IQDA 1IAJA 3JUHA 5BYLA 2JAVA 3R2YA 4ZJIA 4BY9E 1XWSA 3LXLA 2J51A 2UZWE 2BAKA 4H1MA 4MQ1A 5AM6A 5ANIA 5I9UA 3VUIA 1Q4LA 4FSZA 4QNAA 4W9WA 2YITA 3VRZA 1O6LA 3DQWA 3I4BA 4LRKA 4AW5A 3MY5A 3RVGA 1FVVA 4M8TA 3FMEA 1BUHA 5TKDA 4ITJA 4RWLA 3LM0A 3LE6A 3PSCA 3IGOA 2YLEA 3NVMB 3SKCA 3I6UA 2RFEA 2W7XA 3WBLA 5EK7A 1Q24A 2CCIA 4ZZMA 1U59A 2W4KA 5K0KA 4C02A 2JDTA 2OG8A 3MY0A 2YM5A 2UW4A 3O96A 5CU6A 2IVVA 1W2FA 4KAOA 3R9NA 3GU8A 4RC2A 2PVLA 3ZDUA 4HYUA 1JQHA 2OJIA 4IWDA 4YSJA 3U54A 4BI0A 4GIIA 5DN3A 2RKUA 5DT0A 1TQIA 4FMQA 3GC7A 2CPKE 5HX6A 4IM3A 4XP3A 3OWJA 3EQPA 3ZXTA 3KQ7A 4L3PA 4FC0A 3NNWA 4C8BA 3LAUA 4JBQA 1YI4A 4UWBA 3PFQA 3P5JC 4AE9A 3DBDA 4XLVA 3KXZA 2R7IA 2WTVA 4CSVA 3ZM9A 3C4WA 4ZY6A 3ZEWA 3T3VA 3F3TA 2E9OA 2OH4A 3BGPA 4ARKA 3EL7A 4U79A 1YOLA 4FIGA 3FEGA 5DYJA 3KN6A 4I20A 5AV0A 2VD5A 1QPEA 3G9NA 3FMKA 4BCJA 3A8WA 4RG0A 3L9LA 4BJJB 2YHVA 1GY3A 1Q3WA 3OY1A 3UIBA 4O2PA 2VWIA 3FL5A 1F0QA 1SYKA 5EW9A 4D55A 3ORLA 4HVDA 1G8KA 2BVAA 5CF5A 5CF8A 2IEWA 3FXXA 3NS9A 4O2ZA 1YI6A 4ZSJA 2FVDA 5KZIA 4BCGA 3BQRA 1H01A 1V0BA 3POOA 5JFVA 4FIEA 1SVEA 2H96A 1OECA 3BLRA 3V5QA 3TZ9A 3NLBA 2YM8A 4YJOA 5H8BA 2QO7A 2YIRA 3BU3A 4B7TA 4WOVA 3UMWA 4D1XA 3G9LX 5J7HA 1TFFA 3RAKA 4FVQA 3JS2A 4IDVA 5IEYA 4FT3A 3R7YA 2PL0A 4C2VA 1OKVA 4AGUA 1J3HA 3GB2A 3GU7A 4JR3A 4BGGA 1BI7A 3VUGA 3KVXA 4FIIA 2QONA 4TWPA 3C7QA 3G90X 4MXOA 1JKLA 3LQ8A 3U87A 4CV8A 4C4HA 2YZLA 2G01A 1ZYJA 2QCSA 2XIXA 3BYMA 4FVRA 4GMYA 4ZXTA 4O38A 3GI3A 4IJ9A 4GCJA 4AOIA 4C3FA 4FG7A 1B38A 2YCFA 4I4EA 4QO9A 4EJ7A 5HIEA 3QX4A 4AGWA 4FKLA 3ZLWA 3AT3A 2ZDTA 3HMIA 5IZFA 4NM0A 3FJQE 4WO5A 4EC9A 4PDSA 3ZTXA 2R3KA 2QOCA 3DU8A 4BWXA 3E3BX 3LMGA 1YWNA 4B6LA 2R3RA 3DTCA 2UZUE 4TYHA 5L8JA 4IX5A 3VJNA 2ITPA 1KV1A 4DAWA 2R3FA 2CNUA 4O7LA 3OWKA 1U54A 1UU8A 2DUVA 2QNJA 3KXXA 3O51A 5I5ZA 4L44A 1OI9A 4U0IA 2OXXA 3ZFMA 3PJ3A 4D1ZA 4FTIA 5CY3A 3E7OA 3FMDA 5CZHA 4FSTA 4G34A 4U80A 3Q9ZA 1XQZA 3MJ2A 5EW8A 5FTOA 2XIRA 4D58A 5BVFA 3VJOA 2W1GA 4QEBA 1EH4A 2WTWA 3AG9A 3NNVA 4OTGA 3SRVA 5HLWA 2HK5A 1AD5A 2QC6A 4AOTA 2IZSA 4FNZA 4IVAA 3RGFA 4F6WA 4QMUA 1GZNA 1STCE 1JSTA 4FA2A 3C5IA 4G3GA 4YHJA 4KS7A 3DTWA 4CKJA 3CR0A 5CSHA 2EB3A 2NRUA 4PPBA 2R3LA 2OK1A 2PVYA 2YDJA 4K33A 2AC5A 3W0OA 1GZ8A 4XLIA 3UYTA 1G3NA 2REIA 1Q97A 5I9YA 3DZOA 3SW4A 1M17A 4DINA 4F0IA 3CQUA 3BYOA 3QCYA 3OOGA 4FOCA 4O4BB 5DH3A 2VWWA 1ZYLA 4FTMA 4B0GA 5A14A 3RHKA 5DOSA 3VF9A 5J9ZA 2Q0NA 4O6LA 4Y85A 5J95A 4EOSA 4DA5A 3QHWA 4EC8A 4LRJA 4RC3A 3QRTA 4U6RA 4YJTA 4M0ZA 4ZIMA 4GU6A 4CNHA 4ZAUA 4K1BA 1SMHA 4TWCA 5CI7A 4OGRA 3FLWA 4WRGA 3GFWA 4A9SA 4EBVA 3FXWA 4I5CA 2G2HA 4QMVA 1MRUA 5HORA 4GJ3A 2VWZA 4NUSA 4Y46A 4A4XA 3H9RA 3TYKA 4ZTNA 3OVVA 4MWHA 3QTXA 4EHGA 4PMSA 3OCTA 1MQ4A 3JVSA 3KMWA 4MNEA 2E9PA 4IH8A 4O0TA 2JITA 3HL7A 1KUTA 4MUQA 4K0YA 3NIZA 2P4IA 3ZCLA 3LOKA 2PY3A 2CN5A 5B2LA 1XH8A 3BBWA 2BALA 3QUEA 4FZAB 4ANBA 4R8QA 4JRNA 4D0XA 5A4EA 3NCGA 4E6CA 5JGAA 4YLJA 2E9NA 5EM7A 1WFCA 1YHSA 4ZSGA 5M07A 4I6LA 1YXSA 4PTCA 2BCJA 4WNKA 4MXYA 3TKIA 1O6KA 3TZMA 5CSVA 3LFBA 4MAOA 2XP2A 4U81A 2R9SA 2Y4IC 4FOBA 4KIKA 3SW7A 4IMYA 2AEGA 4V0GA 3U8WA 3WZDA 3LJ2A 5IISA 3A62A 3R63A 5HG8A 4F7LA 4ZZOA 1YHVA 4AN2A 3L8XA 2B9JA 3UP2A 2XK7A 4I41A 2CNQA 4TXCA 2ZVAA 4U40A 4BZNA 4E4NA 4F64A 4HVHA 3WYYA 1PMEA 4PV0A 3AC3A 5DRBA 5AEPA 5TOZA 5D41A 3RAHA 2X6DA 4EJNA 2ONLA 3L8PA 4FKQA 4MX9A 3UMXA 4I6QA 3IKAA 4O96A 3ZC5A 4AS0A 2Y4PA 4ZOGA 3Q5IA 3E8NA 2J0LA 4I6FA 3OBGA 2WTKC 4UWCA 4D2PA 5H3QA 3HAMA 3IW8A 2VO7A 4OR5A 1OPLA 2ZOQA 2QOBA 2IVTA 4CT2A 2ZV8A 1GIIA 4DBXA 2VZ6A 3SOAA 4BL1A 3EMGA 2VWVA 1J7LA 4RFZA 2VX3A 1P4OA 3A99A 3OD6X 5M44A 2CN8A 3KXGA 4EH7A 1YW2A 2JIVA 5M57A 1BLXA 4YJSA 3U6HA 3WARA 5A6NA 4O7WA 3NR9A 2Y6MA 4C38A 3AKJA 2BUJA 3E62A 3FZSA 3BZ3A 4QDVA 3OZ6A 4NSTA 2C5VA 3UQFA 4OTFA 2F2CB 4ZMFA 3PZEA 3ZEPA 3AC5A 4WHZA 4KABA 4IACA 4N70A 3C4FA 1KE9A 5J1WA 2H34A 2B4SB 4R6VA 5FDXA 3RPSA 1FBNA 3DOGA 2OSCA 4BICA 3O0GA 1PXKA 3FMMA 3OW3A 1G5SA 2RF9A 4BCOA 3CD8A 5HZNA 3FDNA 5FDPA 2R64A 2FO0A 4O0RA 4P4CA 5DI1A 4EWHA 2VO3A 3MTFA 3R6XA 4KS8A 3QQFA 3OT8A 2O3PA 3FWQA 4U41A 2XM9A 4GU9A 2XNEA 3FI4A 3FMJA 1V0PA 4JIAA 2W5BA 3DXNA 3HAVA 2OBJA 2CKOA 4C35A 4FKJA 4WG3A 3QQHA 3VN9A 1E1VA 4AA0A 2X7OA 4BCNA 4ZMEA 3KCKA 4AE6A 3L8VA 3GC9A 4JQ7A 2VRXA 3MH2A 3QCSA 1VJYA 2BILB 4FNXA 3HX4A 3C4CA 2VTQA 2X6EA 3IW7A 4DEIA 1HOWA 3QWKA 5A3XA 4F63A 3QKMA 4EH9A 2XAMA 4TW9A 4ASZA 2PUPA 4TTHB 4C4IA 3U6JA 3DFAA 1H1SA 3EL8A 4YTCA 4W4WA 4DLJA 1ZZ2A 3IONA 3IQ7A 4WUAA 4FZFB 3PWDA 4O83A 2W96B 4O7SA 4JLCA 1P4FA 4BGQA 3D0EA 4A4OA 1GOLA 4UYNA 4AA4A 4W9XA 3D7TB 3MYGA 3COHA 3GC8A 3R7VA 3ZO1A 4U9AA 3I7BA 5LCJA 4DH5A 4LRMA 4BHNA 2HWPA 4MHAA 4I21A 5FP6A 1NVRA 1WVYA 2CLQA 1REJA 3MVMA 5AV3A 3RM6A 1RQQA 4WA9A 5KCVA 3OT3A 3SXRA 4EK4A 3D14A 4FV8A 3JY9A 1WBWA 4GW8A 4H36A 3MJ1A 4II5A 4A4LA 4RFYA 5KHXA 4F08A 3R21A 4H1JA 3F3ZA 3R73A 3ZO2A 1SNXA 4LQMA 5TO8A 4IAKA 4TKSA 3RPVA 1KWPA 1W84A 1XH6A 2VU3A 4N4SA 4XG8A 5A4QA 4DF3A 1ATPE 3DNEA 5EG3A 1Q41A 5J79A 3BHTA 4R3RA 5JK3A 3PFYA 5BV3A 4IB3A 5EI2A 3PY0A 4KRCA 4TRLA 2HIWA 1ZLTA 4U3ZA 3P08A 5DT4A 3TCPA 3UDBA 2VX1A 1ERKA 2IW6A 4OTWA 5CU4A 3R22A 3SGCA 2XB7A 5M56A 3IOPA 1UKIA 1YOJA 4R1YA 3V8SA 4FTCA 4LGGA 4KINA 2W1FA 4GS6A 4G3CA 2B7AA 2Y4IB 2YM7A 4IFCA 4BZOA 4QDEA 3QLGA 2YIXA 4BJJA 5D9HA 4S31A 1DAWA 5M4IA 4DTAA 4AWIA 5TT7A 3HP5A 3BHHA 2OW3A 1CKJA 2OIQA 2GNIA 3K5VA 3O23A 1FINA 4RGJA 3UPXA 3ZFXA 3ET7A 3V04A 4QTCA 4NKSA 3FKNA 1XMLA 4MEDA 4NL0A 2LGCA 2QD9A 3C51A 3KN5A 4QRCA 3UC4A 2FA2A 5IQCA 4J52A 2PMNX 4M69B 5E4HA 4IWPA 5E92A 1CSNA 4I4FA 4RWKA 3KRRA 2V5QA 3EYGA 3BPRA 3MVJA 3F66A 2C6LA 4MVFA 4W4VA 4L7SA 2RFNA 3TJDA 4AX8A 5CXZA 3NW5A 4FKPA 1URCA 1K2PA 2C6KA 3DJ7A 5FEEA 3AC8A 4NCTC 4RX7A 4IX6A 2R3GA 4XNEA 5DBXA 3R8VA 3V5WA 3ZSHA 1PY5A 1Y8GA 3KF7A 2W1ZA 4AXEA 2R3JA 5AUYA 1W98A 2XJ2A 4FR4A 2WTIA 4FVPA 5HIBA 5LVLA 2WELA 1YI3A 2WMQA 2WIHA 3TTIA 3QU0A 5HE0A 4I22A 4M0YA 1B6CB 3CP9A 3F69A 3A7GA 4FSWA 2JKKA 4LL5A 4QMYA 4C4EA 5LOHA 1LEZA 2EXMA 5AIKA 4C57A 4NKAA 3N4VA 3ID6C 3BYUA 3BKBA 4CQEA 5BUJA 3BWFA 4E5BA 1XR1A 4FTKA 4YZCA 3R7IA 4FEVA 3E63A 2J9MA 3NUYA 4YLKA 5AV2A 5HQ0A 5HHWA 3GBZA 5JSMA 5B2MA 2PUUA 4BN1A 5DHJA 2PPQA 3BV2A 3VHEA 3DY7A 4ONAA 3NYVA 1XH5A 2GFSA 3OUNB 1QPJA 1ZOHA 3H9FA 3FMLA 3QD4A 4QP8A 4TYJA 2A27A 3D15A 4MXCA 4YNOA 4I24A 4EOPA 5B2KA 2J0MB 3OTVA 4XOYA 3FLZA 3WIKA 4DEGA 5IA4A 5DGZA 3GT8A 3DBEA 5E1EA 2CHLA 3AMAA 3ATTA 4AOJA 3R1QA 4JX3A 2ZB1A 1ZY5A 4M3QA 4FYNA 4JOAA 5HCZA 3IPHA 2C0OA 1OL2A 3FC1X 3PIZA 3ANQA 4QYFA 1U5RA 2PVKA 3WZKA 2IVSA 4EUUA 1SM2A 5AWMA 4ACCA 3T8OA 2YJSA 3R01A 3ZHPC 5L6WL 4DG3E 5I9WA 2VO6A 3VS5A 2WPAA 3R00A 1OIUA