4PX6A

Syk catalytic domain in complex with a potent pyridopyrimidinone inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
262
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Syk inhibitors with high potency in presence of blood.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 262
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4px6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4px6A01
4R3CA 3RTPA 4C58A 2FYSA 1W82A 2RIOA 3EJ1A 4O0WA 3RK9A 3H9OA 3O0GA 5EI6A 2HAKA 4D1ZA 5AP6A 2BIKB 4GUEA 4DCEA 3ZFMA 3V5WA 5CT7A 3GOPA 4H3PA 4QT1A 2C5OA 4AW5A 5HG9A 1OKZA 3P7BA 4U5JA 3ID6C 2R3JA 4AFJA 2VTNA 3F66A 4RX5A 4EH2A 2JITA 3NIZA 2XZSA 4DEBA 2C5XA 2QO2A 4CMOA 3P7AA 3K5VA 4NJ3A 3WF9A 4XRJA 4EH5A 3S3IA 5LMKA 4YLKA 3F6XA 5LCJA 4L43A 1DI8A 3LMIA 2BFXA 4GMYA 3Q2JA 4FNZA 4GK4A 3VW8A 4EHGA 4QNYA 3MFTA 2FGIA 5AR5A 3NEWA 3KXHA 4BVUA 4XV2A 4ZTSA 2YM4A 3VAPA 1ZZLA 3W2OA 4DEEA 5AR8A 4YR8A 3FC2A 4JBOA 5EDRA 4QTEA 2XA4A 2ZJWA 1XH7A 3MY5A 4I6FA 5DN3A 3NUAA 2BUJA 5L2IA 3JPVA 5FEEA 1R1WA 2Y4PA 3QAME 2R3KA 3NW7A 3FI3A 3AXWA 1IA8A 4FEWA 5LVLA 1XH6A 4JDIA 3K54A 2IVVA 1R3CA 1TQMA 4CCBA 5KMLA 4EOSA 2W0JA 3AOXA 3HA6A 3UG2A 4CQGA 3G15A 2V55A 3ZEWA 5JSMA 4G31A 4C33A 2A0CX 5HG5A 4NJDA 5E90A 3W2QA 4PP7A 3OBGA 3D2IA 4HGEA 2YCFA 2C6OA 4FT3A 1WAKA 3HMPA 4U45A 4XG6A 4BCGA 3LHJA 4NL0A 2BTSA 3NUXA 3PXFA 5AA9A 4ACHA 4NCTC 4M97A 4D2TA 4NK9A 4ZLOA 4EJ7A 3HUCA 1STCE 3GCUA 4YURA 4ZZOA 4BZNA 5EK7A 4MBJA 4M69B 3DJ6A 3QX4A 3TUBA 4QMXA 1XR1A 3A8XA 3EQHA 4ANBA 3HLLA 1G8SA 3POZA 2OXXA 4FV5A 3UQGA 3LM0A 1RW8A 4OAUC 5ANEA 5C03A 3RK5A 2WTVA 4EOQA 3EB0A 3VS1A 5CF8A 1JKSA 4MF1A 1FVTA 2UVZA 4E4MA 4RJ8A 3NR9A 2CSNA 2OKRA 2OZAA 2YHVA 4IVBA 2IO6A 5HICA 3G90X 3R02A 4FTCA 1BYGA 3FL5A 3CD3A 2PE0A 3CY2A 2QOBA 3HV7A 5CSVA 5HO7A 2W5BA 4N6ZA 4F6WA 3GC9A 5H8GA 4X6QC 5KMNA 3A4OX 5HCZA 3C0IA 4I3ZA 4ITHA 3L8PA 3TCPA 3KRRA 3LFAA 3F5GA 4MXOA 4FF8A 2HW7A 4AOTA 5CX9A 5KBRA 3DLSA 4O6EA 2VTAA 4YC3A 5ETAA 5IMEA 4R6VA 4W4XA 5KMOA 3QHRA 1ZMUA 3RMFA 4CKRA 4FKSA 2ITYA 2HZNA 2PHKA 2WMWA 2OFUA 3K3IA 2JAMA 1S9JA 3PWYA 3R04A 4I94A 3R7YA 3DTWA 5E8TA 3OF0A 3WZJA 3QQJA 3U87A 4GK3A 4HCUA 4KKEA 1WVXA 4JQ7A 1FVVA 3OEFX 2OXYA 4AGWA 4J52A 2DWBA 1XKKA 3TJDA 3F3VA 3CY3A 2QVSE 1PYXA 5JQ8A 2C6MA 4H1MA 3GU7A 1GZ8A 3CP9A 3JUHA 4IX5A 3AG9A 3E7VA 4J95A 3V3VA 4ZZMA 3RZFA 3WIKA 4O96A 5JQ5A 5EOLA 4IJPA 5IH4A 1W7HA 2W1FA 4BCNA 4FZ6A 4OBOA 4U7ZA 4QTCA 4APPA 3LMHA 4IZAA 2WTCA 5E91A 4KIKB 2QC6A 4NSTA 2YDKA 4KNBA 2V7OA 3PE1A 5ANDA 2ONLC 3GU8A 2R3IA 4PDPA 4YJSA 3E92A 4FV3A 3I1AA 4WNMA 2YIWA 2VTPA 2C0TA 2XK3A 2XF0A 3TT0A 5EQPA 1GNGA 1DAYA 3AGMA 4C02A 3PLSA 4FKJA 4I6HA 2ACXA 2Q83A 2F49A 5ANKA 1K3AA 2CKPA 2YM8A 2CHLA 2YIQA 4ZTLA 3KGAA 4CNHA 2JKOA 2REIA 4YJNA 3SAYA 4EHEA 4ANMA 3DU8A 2GDOA 2QCSA 3UPXA 4GIHA 3QUPA 5IA0A 1PMVA 2OH4A 2WTJA 1PRYA 3WF8A 3PXKA 2BTRA 3ZDUA 1QPJA 3UNKA 2VNYA 2W7XA 3RKBA 3AC4A 4PPBA 4EC9A 4FE2A 2X1NA 3E88A 3NPCA 4CZTA 1Q24A 2GNJA 3FQEA 5CAVA 3ROYA 1PMNA 3PTGA 4CG8A 3FMDA 4LQMA 2C1AA 5BX0A 5J9LA 5D12A 4G16A 3WZDA 3FZPA 2WOTA 3D5UA 2OW3A 3DKOA 3DKGA 1Q97A 4O1OA 4O0TA 5EKOA 3LQ3A 4F0GA 3G6GA 3OEZA 3PWDA 4FZ7A 4F63A 1A48A 4KBKA 4W8EA 5GNKA 4QMUA 1VR2A 3UJGA 2YACA 4CVAA 1GZKA 2VWXA 2UZWE 4J96A 5GJGA 5DIAA 1MQ4A 1M2PA 1ZYSA 4R1YA 4YP8A 5C4LA 3VF8A 4UMPA 3HUBA 2W5AA 3KU2A 3UZTA 1Q8WA 2HZ4A 4UWCA 4UY9A 5CEPA 2WTKC 5J7BA 2WTIA 4YLLA 2R3HA 4QP3A 4JVGA 1G5SA 5KHXA 2G9XA 3AMYA 3KXXA 3JS2A 2XKFA 3DLZA 3PG3A 4TWNA 5TO8A 3WYYA 2C5VA 2VO3A 1XWSA 2ZV9A 1NVSA 4GRBA 4FYNA 4JI9A 3UC3A 5FG8A 3VS4A 3W33A 5FXRA 2YABA 1CM8A 2Y4IC 3UYSA 3KC3A 4FG7A 5DFPA 4IB1A 5FM3A 3UZPA 1OL5A 2J90A 3QZGA 4O21A 3VJOA 3NVKI 4RT7A 1PXKA 3CXWA 1UU8A 3EQDA 3CSVA 3NSZA 4I22A 3MH2A 4FT9A 3QBNA 1R39A 2FA2A 4Q5EA 4TYJA 5HG8A 5CI6A 1TKIA 5HLWA 4PV0A 5DT0A 1YVJA 4XEYA 2VRXA 4ZY6A 4YTHA 4K6ZA 4OTFA 4W9WA 4O7NA 3JYAA 3KULA 5EQYA 2W4OA 5EW9A 2IW8A 4RLLA 3HECA 5CVFA 4A9RA 5J5TA 3ZSIA 3DJ5A 3N4VA 3SG8A 3TDWA 4DEDA 5GZ8A 1OIQA 1LEZA 3QQLA 4IACA 5CQWA 4F9WA 2WQBA 5HBHA 4GW8A 4AUAA 3EZVA 3F9NA 4FVRA 1PF8A 2HIWA 3OXIA 2R7BA 3BHYA 5LWNA 5GZ9A 2H9VA 4HZSA 3SGCA 3O23A 4NKAA 1YHVA 3QD2B 5HZNA 4M0ZA 4CFXA 4DFUA 3PY0A 4LL5A 4FIEA 2JLDA 2PUUA 4PMTA 3PRIA 1YWRA 1PKDA 1PW2A 4FMQA 3FMMA 3WILA 4F0FA 1JVPP 4FV9A 4F7JA 5JFXA 3QCXA 4JT3A 5EDPA 5C01A 1TQIA 2A2AA 3HRCA 1Z5MA 2QG5A 2X6DA 4LFIA 5HVYA 2RFDA 2UZTA 4R3PA 3JY0A 3VUKA 2GNIA 2B4SB 2CNUA 5CAPA 3EQGA 3LJ1A 5E8YA 2XCKA 3F2AA 3AC3A 3BEGA 3R7UA 2WIPA 5M4UA 2ZYBA 2QNJA 4KKHA 4XP0A 4EH9A 2PUPA 1UA2A 4E5WA 4KRDA 4W4VA 2CGVA 3RK7A 1JSUA 3BYSA 3PZHA 4FKVA 4MXYA 2NRYA 4N70A 5HCYA 2VTSA 3EFLA 4X2KA 4QMSA 3I7CA 2XBJA 4USFA 4F65A 1P2AA 5M07A 2XNGA 4U3ZA 3HNGA 4D28A 3MSSA 4N4SA 1FGIA 4QRCA 3O8UA 2QU5A 4Q9ZA 5CYIA 4RIWB 5M55A 3LIJA 2QOLA 1JSVA 3ZOSA 4O81A 5AR3A 5AP3A 4CQEA 1ZXEA 1FVRA 2XJ2A 3Q60A 4OW8A 4FTQA 3WIGA 4YUQA 3DJ7A 2XS0A 3IQ7A 4LM5A 4XG3A 4F7NA 5J1VA 3QUDA 3KK8A 2RKUA 3RM6A 2FUMA 4BCQA 5A6NA 4Q2AA 5CVHA 2OF4A 3KFAA 3PPKA 3QALE 2GNFA 2YM5A 5EHYA 5CZHA 1M52A 4RA4A 3UYTA 3ACKA 4EK5A 3IW7A 3RHKA 4GG7A 2XNMA 3VBXA 1OIYA 1ZOGA 4QMLA 2X9FA 4IVDA 2YZAA 5IH6A 3EL7A 3FY0A 4L67A 3NW6A 4KUJA 1MRVA 4XJ0A 2ONLA 1S9IA 3EYGA 3LPBA 2W17A 4IE9A 1J1BA 5DT4A 3FXZA 4BDKA 5HU3A 3UO4A 4DBNA 2VZ6A 3SXFA 4ERWA 2CLXA 2JC6A 2W06A 3O71A 4MWHA 4B7TA 2J5EA 1Y57A 2OIQA 4OBPA 3LOKA 4FOBA 5IDNA 2OJ9A 4XUFA 1A9UA 5LMBA 2ERZE 3TNHA 1YOLA 3QWKA 2OO8X 4OTQA 3BYMA 4BTMA 5HORA 1R0EA 3Q96A 3QTXA 4A07A 2ITNA 1GZOA 3CE3A 3G33A 4BDCA 3UNJA 1WVYA 4RFMA 4ACDA 5A4TA 4WG3A 3KF7A 4YJTA 5I9ZA 3WZEA 5LVMA 2G15A 2GTNA 3FXXA 3MBLA 4G9RA 2ZDUA 4UB7A 5CSPA 3FV8A 3LFSA 5HI2A 5L2QA 1OIUA 4IDTA 2PZRA 3L9LA 4IAKA 2WU6A 4BDIA 1UU7A 2G2HA 3CR0A 3TI1A 4IMYA 2DUVA 2GNLA 3AMBA 3L9NA 4S34A 5TF9A 4CMUA 3PLAE 4M84A 2ZAZA 1Q3DA 3C9WA 3CJGA 3UTOA 3KVXA 1IR3A 4LGHA 3N4TA 4AA0A 1WBTA 4M7IA 3BE9A 4R7IA 1RE8A 5GJFA 3SDJA 4DF3A 4RZWA 5M44A 4D4VA 3V04A 2GQRA 3LFDA 1B39A 4PNIA 5HX6A 1JBPE 2W9FB 3C4FA 2C5YA 3G6HA 3NNWA 3O96A 4MF0A 5AP5A 2PYWA 5FBNC 3JVRA 1ZYLA 2ITWA 2I40A 5BUEA 2DQ7X 4LYNA 3A7JA 4BTKA 4WG5A 3ZFYA 3VBTA 3L8XA 5EDQA 1WZYA 3TJCA 4CRLA 2CLQA 3KXNA 5B2KA 5J1WA 4AZWA 3Q9ZA 4BCMA 2VTTA 3QA8A 4A9TA 2VUWA 3GVUA 4CFMA 1DM2A 3TKHA 5IUHA 4QMVA 4XHKB 3VUDA 5KBQA 4Y83A 5EM6A 3O8PA 4MQ1A 4GKHA 3ZU7A 3ZXTA 4CKJA 4OTPA 3P86A 4PRJA 4E3CA 4YU2A 3EQRA 4G3EA 3TACA 3UQCA 3HDMA 3OTVA 2BPMA 2RFNA 3E5AA 2CPKE 2IPXA 3U9CA 3CCNA 4GCJA 5F94A 3DBDA 4P7EA 5E8WA 3PSBA 1GJOA 2JKMA 3LFEA 4Y5HA 2UW0A 3SX9A 1ZYCA 4EK3A 3AD5A 2R3OA 1CTPE 1P5EA 4QYGA 4RVTA 5G6VA 4TYGA 3QX2A 3Q9WA 4PPAA 4U43A 4XLIA 4A06A 3CQEA 4BIDA 1RQQA 4X3FC 3ZUVA 4BDBA 4DGMA 2PK9A 4U80A 5IA2A 4DEHA 5CASA 4NUSA 1XH9A 2PVNA 3BGPA 2F7EE 2VNWA 2WD1A 3VULA 4BZOA 4OTGA 1YDTE 3W8QA 1OECA 5TOZA 1JQHA 5F20A 2OICA 2YFXA 5ICPA 1PXOA 1RJBA 4YO4A 1Q3WA 3GXLA 3L9MA 4JXFA 4X2JA 1Z9XA 4IB3A 5M4CA 4GT4A 4GFOA 5M08A 5HE2A 3WF6A 3OBJA 4M66A 5A14A 2J4ZA 3ZO2A 2WU7A 5DGZA 4PL3A 2BHEA 4AACA 3C7QA 3FPQA 4M14A 3UZRA 4RPVA 3CTHA 4I20A 4O83A 1SZMA 1JKKA 2UZLA 3PPZA 2RFEA 4IB0A 4C4FA 2OZAB 5HTIA 5HO6A 2BDFA 1TVOA 1XH5A 2VWWA 1LUFA 4XNEA 2X2KA 3GP0A 3MH0A 1IAHA 4J53A 2OWBA 2ITTA 2P2IA 3VS5A 2XB7A 4XLVA 4AGCA 4EK4A 2HENA 4BCOA 2QO9A 4J99A 2AC3A 3FY2A 3C5IA 4YHJA 5L8JA 4O0RA 2HXLA 4TWOA 5HESA 3QUEA 5JH6A 3FZRA 2G2FA 3BHTA 4NEUA 5AADA 5IU2A 3LKMA 2WQNA 1GIHA 1CSNA 3MJ1A 4TZRA 5IG1A 3ETAA 4HGLA 5EI2A 4AA4A 3MH1A 3DOGA 4XOZA 3WOWA 3HV3A 3E8NA 3C4WA 1BKXA 3P08A 3FMJA 4C7TA 1SNXA 2V7AA 2XK4A 1WBOA 5A4LA 3UIMA 2WMSA 4M3QA 2UW4A 2Z60A 4ANNA 4FZAB 3EQIA 3F3TA 2E9OA 3MWUA 3BQCA 4W4YA 1SNUA 4J8MA 4YLJA 5EOBA 1Y6AA 3V01A 4NW6A 5C8KA 3NW5A 3PXYA 3UVPA 4O7SA 2PVMA 4D55A 4BYIA 3DFCB 4H58A 4QTAA 2PVKA 5FBOA 3R8VA 2JDOA 3F82A 2I7QA 2PE1A 4DBXA 4FTJA 1REKA 3QQUA 3RM7A 3MVHA 2JFLA 3EQFA 4EOMA 3AC8A 5CALA 4FIGA 4XG9A 4TW9A 2VGOA 1T46A 2XKCA 5CEMA 5M4FA 2Q0NA 3DAEA 4RIOA 3VN9A 4FICA 1NY3A 4G6OA 4MQ2A 2YWPA 4RRVA 4QYYA 3F5PA 4TNDA 3VO3A 5JKGA 3ZO4A 2V62A 4FKOA 4DFBA 4GJ2A 5DR6A 4RSSA 4E5AX 5K4JA 4JDKA 4DG3E 2R5TA 3D7TA 5BVNA 4PTEA 3I79A 2I1MA 3NWWA 2FO0A 3EFJA 4XG2A 3R7IA 2R3NA 4HCTA 3NUYA 5AV0A 4D1XA 1J7UA 2BHHA 2V0DA 4HZRA 2QOOA 1U5QA 3R8PA 3UODA 4QP1A 4L7FA 3W2SA 3WE8A 3QD4A 4FGRA 4RIXA 3DAJA 3AGLA 4F99A 5T68A 5I9YA 2RGPA 4BDDA 4S32A 4BWKA 2QR7A 3ACJA 3D7ZA 5A4EA 3UQFA 4ONAA 2J0JA 5AUVA 2QHNA 4I6BA 2I0YA 4R7HA 2Z7SA 5CU6A 3I6WA 4TN6A 4QQJA 3ENHA 3M2WA 2YCRA 4Y5QA 3F3WA 3Q53A 3P0MA 1KE6A 4QTBA 3T9TA 2IW9A 4JBPA 3FMKA 2BIYA 3ZLYA 2P2HA 3IW5A 3PVWA 2YM7A 4RGJA 4FTNA 4TTHB 4U40A 3TTIA 4AG8A 2WNTA 2WMRA 3LFBA 3COKA 2BMCA 3B2WA 3KF4A 4LRJA 4IHPA 4U0IA 3QZIA 5EYMA 4EEVA 1GAGA 3MA6A 4MVFA 3BKBA 4FV4A 2F2CB 3A2CA 3V5TA 4JBQA 2JD5A 3ZLWA 2XIZA 3DPKA 5IUGA 3FLZA 4OTRA 1MRUA 3RCDA 2QOCA 4ZSEA 4WSQA 4RJ4A 4JRNA 3OXZA 4Y73A 1MP8A 4R77A 5JGAA 4QPAA 3N51A 3O51A 5ACKA 4BGHA 4TPTA 1WBPA 3KMWA 4NZWB 4CFFA 2HELA 3VBYA 3A7IA 2CKQA 2X4ZA 3UGCA 2RL5A 2X6EA 5AV2A 5BVKA 3A8WA 3R9NA 4OT5A 5DI1A 4C38A 4FL3A 5T6KA 3TTJA 4AU8A 4IAIA 4E6QA 2QG7A 4IX6A 3R1YA 5LQFA 4YTIA 3CD8A 3FMEA 1H1WA 2CKOA 5FDXA 3KULB 3R2BA 2NO3A 2XYNA 5DRBA 4A4XA 4IAZA 4O86A 3V8TA 5L3AA 4X3FA 4RWJA 4BCHA 4USEA 2XNEA 3C4XA 5I9UA 5AUXA 4MXAA 1FINA 4LG4A 5KX8A 4ZTNA 3CQUA 4KWPA 5DOSA 5I4NA 4K8AA 3CQWA 4ZEGA 3KN5A 3VWAA 3AD6A 4LUDA 3ZH8A 3ZXZA 4E6DA 3EQPA 3MFSA 2QURA 4RC3A 2PUNA 3MI9A 2X8EA 5CANA 1URCA 5KKRC 2BKZA 4OGRA 2H6DA 3BEAA 2AC5A 4MH7A 3TNIA 1OMWA 2PMLX 3FKOA 5AR7A 4LUEA 3NYXA 2QR8A 2NRUA 4DCAA 4HYHA 4JAJA 2XH5A 3RNIA 3RCJA 4F4PA 4ASDA 3G0FA 4ZTMA 2BALA 5AR2A 2QODA 2O8YA 3FYJX 5HO8A 4FTMA 5HD4A 5CAQA 3MVLA 3UNZA 2BDJA 3R9RA 3PPJA 3B8QA 3DZOA 3NYNA 2R3LA 3HV4A 5D41A 5DEWA 5LVPA 2I0HA 3DKFA 4WKQA 4EQMA 3IKAA 3KKVA 4NT4A 2C0OA 2I6LA 5CY3A 2IW6A 3HA8A 5ANJA 4MD8E 2QLUA 3LVPA 5FLFA 4NU1A 3PSCA 5C27A 4AN3A 1HCLA 3DAKA 3FYKX 5A46A 5L2TA 3VHKA 1ERKA 1PJKA 1YXSA 2HCKA 4E20A 3ZM9A 4AZEA 5CSWA 3U6JA 4QMMA 4ERKA 1OPKA 3MY0A 3G9LX 3F69A 3JY9A 3TEIA 5ANOA 3TZ8A 2W1EA 2QD9A 4NM5A 3V6SA 4G3CA 4Z9LA 4ZSAA 5L6PA 4EH6A 3QKLA 4FR4A 4H05A 2ESMA 2C68A 3KA0A 4ZOGA 1P4OA 2YA9A 3FSKA 4DGNA 4AZFA 3OY3A 2B1PA 3KY2A 1F5QA 4JX7A 4QO9A 3ALNA 4TKSA 5JRQA 3ZC5A 1FBNA 2FSTX 3CIKA 3CS9A 1OPJA 3IOPA 4AN9A 1DS5A 4TL0A 3IO7A 4CMTA 1W98A 4CYJA 4PMSA 4UMTA 4UV0A 3QTUA 3SV0A 4JQ8A 1ZY5A 1VZOA 2Y6OA 4M15A 3SOCA 2QKRA 3ERKA 3ET7A 3WZUA 4XS2A 2UUEA 3RINA 4RIYA 3PJ8A 3Q4UA 1YDSE 3E64A 4NH1A 5AP2A 3QD3A 4X21A 3RZBA 2VV9A 2XIRA 1JKTA 3A7HA 4P5ZA 4PL5A 3F2RA 3DBQA 2Z7LA 4NM3A 3JR1A 3LQ5A 4U9AA 3F5XA 1WBVA 5F4NA 3C1XA 5B2LA 3W2RA 4KA3A 2E2BA 3I0QA 3MB7A 4OTDA 5CF4A 4QMNA 2WPAA 4G9CA 3O2MA 3C4ZA 3AC1A 3IS5A 4O7ZA 4C34A 3U6IA 4BICA 5KZ0A 4IXPA 4BDEA 4F70A 3R00A 4MXXA 3QLGA 3FZ1A 4II5A 5DA3A 3RAHA 1H24A 4DH8A 4PPCA 3SC1A 3R21A 4XBRA 4BCFA 1UU9A 2PMNX 4NW5A 2PU8A 3SW4A 3GC8A 4S33A 1KOAA 3HDNA 4Y95A 2YCQA 3GNIB 3VS3A 4Q9SA 3H10A 3FDNA 3Q3BA 1UNLA 5I3RA 4HPTE 4BI2A 3ZM4A 2BFYA 1P4FA 2J2IB 4IAYA 4X3JA 3HAMA 5IKWA 4PMMA 3VVHA 4YSMA 3LCDA 3CTJA 4ITJA 4FV0A 4FGBA 3QKKA 3Q4TA 2PZYA 2CDZA 4PWNA 3F5UA 4QQTA 5DR9A 3GU4A 2BRBA 1PHKA 5IQCA 2P33A 4TXCA 3HRFA 5CF6A 3QGWA 2VWUA 4BYJA 1AD5A 2C6IA 4M0YA 2XMYA 2C6LA 3TIZA 4J8NA 3PJ3A 3BRBA 4BKJA 4JNWA 2JBOA 3VBWA 2EWAA 1AGWA 1WBSA 4CFVA 4M68A 5CXHA 2ITXA 3LE6A 4E4XA 5GJDA 2Z7RA 5AA8A 3LFCA 3NGAA 3CKWA 3E8DA 3HGKA 1PXLA 4BTFA 4C4HA 4Q5HA 2OLCA 3FEGA 3R8LA 1JLUE 1PMEA 4LGDA 2PMOX 4O0XA 5AV4A 4QYEA 2R9SA 3KEXA 4C59A 2BZJA 3DZQA 4DEGA 2O5KA 2PMIA 5H8BA 4QMQA 3MH3A 3TIYA 2EUFB 3PP1A 2PPQA 1PYEA 5HBJA 4O7YA 2R3FA 4L9IA 4AE6A 5I3OA 2XJ1A 3PVGA 3Q4ZA 4NFMA 3VUMA 5I5ZA 3PDTA 3MTFA 2VO6A 2Y6MA 4Z55A 3PJ1A 4AW2A 5FGKA 3IW6A 4WT6A 3RJCA 4L44A 2YM3A 2Z2WA 4EWHA 2G01A 4EKLA 3H0YA 4JS8A 4FZDB 3PXQA 5JT2A 3BHVA 1LEWA 1OPLA 3BHHA 2PZ5A 1GZNA 3GFWA 3SHEA 5LWMA 3W8LA 2PL0A 2A4LA 4AW0A 4AP7A 3RGFA 1DAWA 3V8WA 2GCDA 4GYGA 3ATSA 4DH7A 5GINE 1YKRA 3UIUA 3ATTA 5EHOA 4V0GA 3T9IA 4U6RA 3W2PA 4O0YA 4IM3A 5E1EA 2WMXA 4FKWA 2FVDA 4WHZA 4O1PA 5J87A 3RPOA 4A9UA 2OG8A 1VEBA 3VUIA 2F2UA 3BI6A 2QHMA 3K2LA 4HJOA 5FP6A 3RHXA 3TNPC 2XK7A 2XYUA 2EB3A 4FKIA 4HNIA 2OH0E 2WKMA 4NFNA 1ZOHA 5DNRA 4CYIA 5DR2A 3FMHA 3GGFA 4EYJA 2O2UA 5K0KA 3REPA 3VC4A 5ETCA 4BTJA 4IAFA 3GEQA 4ENXA 2B7AA 2UW3A 4KB8A 2R4BA 3FLQA 5GIOE 5BMMA 1O6LA 3QWJA 3W55A 2BAQA 3FE3A 1UNGA 1UU3A 3PIXA 4L00A 5FXQA 2ITOA 4I0RA 4JRVA 4E5BA 4F09A 5CXZA 4B8LA 3HX4A 4U41A 3FKNA 2WQOA 3QD0A 1ZYJA 1Z57A 4N6YA 1J91A 2UW8A 3BLHA 4JJRA 3QC9A 3CPBA 1QPCA 5EYKA 2J7TA 4QP7A 4KKGA 2GFSA 4BIBA 3ZSGA 1G8AA 3R01A 4APCA 4USDA 4RX9A 4BKZA 4D9TA 3MPTA 2XBAA 3C4EA 4Z7HA 3HKOA 2JBPA 4Y8DA 4FKGA 5HHWA 1ZYDA 4YJPA 4NCTA 3TZ9A 4CTBA 2E9PA 5CEOA 4IFGA 1H1RA 3UP7A 2ETKA 4RZVA 5IUIA 4CXAA 1UNHA 4LMUA 3PXZA 4P4CA 1FOTA 5AJQA 3RBWA 4ZSLA 3AT4A 5C8NA 3KXGA 5CU2A 4LMNA 3ULIA 2EXCX 4B99A 3LLAA 4MWIA 4O7WA 3ZBXA 3QFVA 4D9UA 4EH7A 4FKQA 2ZM1A 5J79A 2H96A 3BQRA 4L7SA 1U54A 4BR3A 4YNEA 3W16A 4ZLZA 4FC0A 2XVDA 3COMA 4EONA 3QQFA 4I5CA 4IWDA 2PSQA 5E8SA 5AV1A 1NA7A 4FV7A 4IJ9A 5BVDA 3UIXA 4BHNA 4EH4A 2W4JA 1XQZA 1ND4A 2XJ0A 2HY81 4JBVA 3Q52A 3RAIA 3D7TB 4DFLA 2PULA 3PIZA 5EYCA 4IB5A 4Y85A 4BIEA 2R0IA 4QQCA 3NZ0A 4J7BA 3R6XA 2X2LA 2F4JA 3CJFA 2ZDTA 1WCCA 2W05A 4K33A 4D2RA 5IA4A 3SG9A 1LR4A 3ORIA 5GZAA 3MW1A 5E8UA 5AP0A 4AZSA 1H01A 4FK6A 4LL0A 1KE9A 4ZIMA 3W1FA 3LCSA 4G3DA 3F3ZA 2B55A 2O65A 2JIIA 5AAFA 3DB8A 4FK3A 3WBLA 4CFUA 4OBQA 3FUPA 4YC8A 3QU0A 2IZUA 4RIXB 5AV3A 3TXOA 4I92A 4QMWA 4UMQA 2QOQA 4FEUA 3PJCA 4JG7A 2PWLA 4PTCA 3FPMA 1OL2A 4GU9A 5ETFA 5HNGA 3QCSA 1U4DA 5IH5A 4DLJA 1OBGA 3I5NA 4WBOA 4HW7A 2CN8A 3AC5A 3SRVA 5I0BA 3PP0A 5C4KA 3S00A 3ZZWA 3G2FA 4XOYA 4F6SA 2WMAA 4JQEA 4TYEA 4NTSA 2VTRA 5LMAA 2BROA 1ZRZA 5KMIA 4F64A 3HEGA 4C4IA 3MFRA 3D2KA 4WUNA 2WHBA 4IW0A 3ZMMA 3FLWA 3TZMA 1DI9A 4C3FA 1T45A 2GHLA 5K5XA 5L2SA 5DMZA 1P14A 3BLRA 4IM0A 2CNVA 4W4WA 3AD4A 2PVYA 2ZM4A 4HNFA 4TWCA 2GS6A 4KSQA 3D5VA 4BF2A 3PG1A 4LV5A 3NLBA 4F1OA 1ZLTA 3QTQA 4BC6A 4DG2E 4YJQA 2BAKA 3BBWA 4ZP5A 5D1JA 2Z7QA 5A4QA 2C6DA 2J0LA 4WIHA 4BBEA 3Q2MA 2W9ZB 4ZAUA 4O7RA 4AQCA 4HVIA 4L3LA 3H4JA 3GB2A 2R3RA 3EFKA 4PQNA 2Z8CA 3VF9A 4RMZA 4KAOA 3HRBA 3ZRMA 3OCGA 5C8MA 2R3MA 4GEOA 4EORA 2HYYA 4I5HA 4MCVA 5D7VA 5B2MA 5E8ZA 3ZEPA 4RJ3A 3DQWA 3OFMA 3PFQA 3Q9XA 5JN2A 1Q4LA 3TL8A 4D2PA 4X3FB 4E6CA 4QOXA 4FEQA 4RC4A 3ZFXA 3R9OA 4H3QA 5E1SA 4FSUA 2BKKA 2RSVA 3NUNA 5DT3A 4B0GA 1M2QA 4EH8A 4O7TA 1ZMWA 3UG1A 3EN6A 4E7WA 4DT9A 3NDMA 5JFWA 3ORZA 3R2YA 3F61A 1YOJA 4ZLYA 4FIHA 3DS6A 5CT0A 4X2FA 4C37A 4XCUA 4AAAA 1V1KA 5HKMA 1H28A 3W18A 2OZOA 2VWZA 3G0EA 3NUUA 4YHFA 4DYMA 3QTIA 3T8OA 4YJUA 4FV8A 4OUCA 2Y0AA 2ZV8A 4WNOA 4BCPA 3C13A 3PRFA 3EKKA 3MPAA 1H27A 4I0SA 2WAJA 3OOMA 3VRZA 3ZSHA 4EK8A 4HOKA 3V5QA 4YPSA 2C3LA 2PVHA 3EN4A 4F9YA 3F3UA 3TUCA 4JL9A 3VS7A 2OJFE 4FKUA 2VWIA 3H9FA 3ZRKA 4QPMA 4ZZNA 3UVRA 2HZ0A 2WMTA 2VAGA 5M57A 2VX1A 4IDVA 3UOLA 3OW3A 2QU6A 4YZDA 4CLJA 4U97A 2CJMA 2ZMCA 3V8SA 5J5SA 4DT8A 4JX3A 4K77A 5E92A 5CU4A 3V5JA 2VO0A 1QPDA 3M42A 1KE7A 4Z3VA 2WB8A 4AWIA 5HGIA 2ETMA 2UZBA 4FTUA 2W1DA 5D10A 3RPSA 3DT1A 3MVMA 5HIDA 4EC8A 4O2ZA 3GQIA 3P1AA 3HAVA 3MV5A 3T3VA 4KS7A 3P79A 4M67A 2X39A 4ANOA 3DKCA 4BCJA 2OI4X 3U54A 3PZEA 4DGGA 2XKDA 5BPYA 1IEPA 3BE2A 4AOIA 5EG3A 3EL8A 3EZRA 3OCSA 2P4IA 2HY0A 4KBCA 4CZUA 3R28A 4MNFA 3ZLXA 4D4SA 2WXVA 4NM0A 2PVJA 3OWKA 3LXNA 3FHIA 4CT1A 2XNOA 3R9HA 4FBXA 3WE4A 1U46A 4D0WA 2OU7A 3PIYA 3QGYA 4GT5A 3SVVA 3N4UA 2ZM3A 5CENA 5K9IA 3G51A 3ZTXA 4FV2A 2YZLA 1ZY4A 5H3QA 3PA5A 1R78A 5AUWA 3DK3A 3E62A 4PX6A 5F95A 3CPCA 3TKUA 4ZXTA 3I60A 2JEDA 5M4IA 5EM5A 4AA5A 4XG4A 4L01A 3PY3A 2VTIA 5IZFA 4RIYB 4I93A 1KE8A 4EZ7A 2YERA 3HV6A 4B4LA 4Y46A 5CWZA 3BV3A 4EBWA 4ANQA 5EQEA 2BCJA 4P90A 1Q61A 4MNEA 3OWJA 4DEIA 4UN0C 4FEVA 4I21A 4HGSA 1QCFA 3UMXA 1WBWA 2R0UA 1CKJA 4RVMA 3C50A 4XMOA 4YGAA 5TE0A 2OIDA 2R64A 4N0SA 5BVFA 2WO6A 4AW1A 3U6HA 2OF2A 3C0GA 3MDYA 2QOIA 3VS0A 3S95A 4C36A 2O3PA 3GBZA 2UZNA 1K2PA 3C0HA 3TM0A 3OUKA 1YWNA 1RDQE 5LOHA 2IVUA 4P2KA 3MVJA 2WMVA 3FMNA 5HVKA 5HCXA 4XV1A 4L52A 4RQVA 3FLYA 3KB7A 3QKMA 2JDVA 4FL2A 2W1GA 3H0ZA 4K18A 3MTLA 5BNJA 1L8TA 4L45A 1BLXA 5KE0A 4EHZA 1MUOA 2OBJA 4M13A 3QZFA 5JFSA 3OCBA 1J7LA 2YJSA 4MTAA 3E63A 4PDYA 2OSCA 3DB6A 3GI3A 2JDSA 2PTKA 3FMLA 3R7OA 3FWQA 4CKIA 4KRCA 1H1QA 4E93A 4A4LA 4ZSJA 4FODA 4B6LA 4ZS4A 3R1SA 4LOPA 3KCFA 2XP2A 4EH3A 5IQDA 1V0OA 5CTPA 5EM8A 4G2FA 5DHJA 5M53A 4Z7GA 1B6CB 2GNGA 1M7NA 3DBEA 5A54A 3SXRA 4YJOA 4I1ZA 3CBLA 2IN6A 4M12A 3PE2A 3TNWA 4L8MA 4GKIA 4BWPA 2W1IA 2HWPA 4ENYA 2ITQA 2J6MA 3G5DA 5ANIA 4AF3A 3MY1A 1SYKA 5LJJA 4G3FA 3RPYA 1NXKA 5CSXA 5BYZA 4EHVA 4C35A 4GIIA 1IG1A 2HOGA 2XKEA 1OKYA 3L8VA 3BCEA 3OC1A 4WNKA 5J8IA 4OTWA 4GT3A 2ETRA 4X2NA 5AM6A 1YI3A 3FKLA 4KIQA 4BZDA 2WELA 2UZOA 4FTAA 1OITA 5KNJA 4L53A 3KMMA 4ORKA 4QYHA 4TY1A 5L8LA 2IJMA 3QL8A 3POOA 4Z16A 2KULA 2X8IA 1H0WA 4ZSGA 1CMKE 3RPVA 4J71A 1PY5A 4YPDA 3BBTB 5HE3A 1ZWSA 2WZJA 3OVVA 4F1TA 5B7VA 1J1CA 4RFZA 3IDCA 5KKRB 3H30A 2VO7A 3ROCA 3FLSA 1VJYA 3FJQE 3IGGA 4IH8A 4RJ6A 1YI4A 2WGJA 4O7VA 3FAAA 3QHWA 1PXIA 2XM9A 3MESA 2JGZA 3IK3A 4ALWA 3SLSA 5IQHA 5BUIA 1XH8A 3EIDA 3IW8A 4DA5A 4V0GB 4QYFA 5FP5A 1PMUA 3IECA 3KXZA 3TV6A 4QMOA 1SM2A 4D2SA 1YRPA 2YN8A 3BLQA 3R63A 4OR5A 5AWMA 1WVWA 3MFUA 1W83A 2RF9A 2XK9A 3C4CA 3EN7A 4QP6A 4EJNA 4OTIA 4UZDA 3TNQB 3II5A 4GJ3A 4I0TA 4BKYA 4F9AA 4XP3A 4ASXA 3OMVA 3O50A 3P4KA 5L6WL 1UKHA 2UZVA 2ZVAA 3VBVA 2IG7A 5KMKA 3CGFA 2GQSA 2X2MA 2CCIA 4R3RA 3MN3A 2Y9QA 3GQLA 1GIIA 4IAAA 3Q4CA 1U59A 3Q32A 3QTWA 4UALA 4U44A 4AGUA 3EOCA 3PJ2A 1OM1A 4RVKA 1I09A 1ZARA 3OWPA 4LRKA 3VS2A 4DEAA 4NYEA 1ZOEA 4DFXE 2C4GA 2RG6A 2JIUA 2X9EA 4YTCA 1K9AA 4EUTA 3AMAA 5DH3A 4DG0E 2C30A 4QP4A 4ZS0A 2X0GA 3ZBFA 3SA0A 4BDJA 4UX9A 4DHFA 2QOHA 2JFMA 2R2PA 3QRKA 3PSDA 4CRSA 1LP4A 3CLYA 5D9HA 4ACGA 4N57A 5FTGA 4WSYA 1YXUA 4O2PA 5BQ0A 4O38A 3AQVA 4AT3A 4DGOA 5J9YA 3BPRA 5E7RA 4F9CA 5BUJA 3BU3A 5FEQA 5CAOA 4G34A 2JAVA 1NVRA 3LCKA 3MGYA 5CLPA 5IF1A 1SMHA 3PA4A 3H3CA 1H4LA 4DH1A 3CC6A 5K3YA 4U79A 3NYVA 3R22A 4TYIA 3OHTA 4XRLA 3Q9YA 3WYXA 5L2WA 2GFCA 5IA1A 5HE0A 5J95A 4DTAA 3HZTA 3CEKA 4EL9A 3KXMA 2R3GA 5J7HA 4GFMA 2BZHB 2ERKA 3NNUA 1U54B 4J98A 1YHSA 4IANA 3U8WA 2B9FA 3ZUUA 5IPJA 4XG7A 2PZIA 1M2RA 2ITVA 5EHLA 3E93A 3RNYA 4E1ZA 2R3QA 5IQIA 5HIBA 3ITZA 3ZRLA 4IWQA 4FSQA 5CF5A 4Y72A 2JDTA 3LW0A 2I0VA 2YCSA 2A19B 4L68A 3BZ3A 3PVUA 3NCGA 5IQEA 1YWVA 2Q0BA 3A60A 4DTBA 5EW3A 2QQ7A 2W99B 4FSWA 4QNAA 3FI8A 5M56A 3NX8A 1M7QA 3UE4A 3DTCA 2C6KA 1OZ1A 4AE9A 4EOJA 5AM7A 1W84A 1H07A 5IA5A 3K5UA 2XEZA 1H8FA 2LAVA 1CDKA 1XHAA 3QQGA 3BWJA 4I6QA 5L4QA 3KRWA 3R8ZA 4HYSA 2WEIA 2XIKA 3QZHA 1H00A 3D15A 4PDOA 2CMWA 4BRXA 4CV9A 2PVFA 5HNBA 5E9EA 2W1HA 3D5XA 4JAIA 4R8QA 5IQAA 2OGVA 1Y8GA 3IGOA 5HQ0A 5BMSA 3MS9A 4U81A 3NMUF 4BN1A 3UP2A 2C69A 3FHRA 4HYUA 5H2UA 5C9CA 4KD1A 2UW7A 4TYHA 3PY1A 4UXLA 2J51A 3SRVB 4AFEA 1E1XA 1Y8YA 3QQHA 3ZONA 4BL1A 5CQUA 1FMOE 2ITZA 3EWHA 5CEIA 3VUGA 2B9HA 4DFNA 5AP7A 2YAAA 1O6YA 1CKIA 4IC7A 5AAEA 4UYNA 2W1ZA 4R1VA 2ITPA 4RJ7A 3SKCA 4WUAA 3HVCA 4AOJA 5HTBA 1BL7A 2PVLA 2CGWA 1UKIA 4HYIA 4RBLA 3ZCLA 1MQBA 2QLQA 4QTDA 2HW6A 3MJ2A 2YDJA 4ZJVA 1JSTA 3ELJA 1J7IA 3FLNC 4EQCA 1VYWA 5M06A 2XCHA 5AX3A 4BDFA 3E87A 4F08A 4L3PA 3WI6A 4FKTA 3VNTA 3ANQA 2WMUA 4U3YA 3NNXA 4IX4A 3FI2A 2UZUE 3HMNA 4GFGA 2XRWA 4C2VA 5IEXA 3BV2A 1YDRE 4MAOA 4PF4A 3CTQA 4R5SA 4OLIA 4BDHA 2BILB 3L8SA 5AIRA 3MYGA 5JGBA 3LM5A 4EUUA 1YI6A 1BL6A 3ZYAA 4ALUA 1URWA 5IEVA 3VIDA 3NAYA 4LGGA 4FG8A 1Q5KA 2QOFA 2PZPA 4O0UA 3FZTA 4EK6A 4A4OA 4C57A 2C47A 1V0BA 1GOLA 4L42A 3FXWA 3QRUA 4FIFA 2VWBA 3E3PA 2OIBA 3R73A 3L1SA 2VGPA 1O9UA 1BI7A 2P55A 4FKRA 4YZNA 4BFMA 5ITAA 3UIBA 1Y6BA 5AP1A 5CEQA 1JKLA 1OUYA 4L6QA 4S31A 5AX9A 4FSMA 5L6OA 4GUBA 2F7XE 2XNNA 2C0IA 4FIIA 3UPZA 3ZHPC 1XBAA 4IZ7A 3EKNA 2OXDA 3JVSA 4U42A 5JGDA 2WTKB 3BHUA 1UVRA 4RG0A 3OTUA 4C4JA 2F57A 4GS6A 4A9SA 4HVGA 5HX8A 1FMKA 2Y8OA 3MA3A 3QXPA 4CSVA 3GCQA 4O6LA 1OVEA 3R7EA 1M14A 4BB4A 4CG9A 2DYLA 2Y4IB 1Q99A 5A3XA 2UW9A 3W2CA 3QA0A 3M11A 3I4BA 3FBVA 4FTIA 4G17A 3S0OA 3VBQA 3U55A 3DK6A 3VHEA 3LXLA 3TV4A 3O7LD 4J1RA 5JRSA 1QMZA 3V5LA 4G6LA 3ORLA 3NRMA 3ORNA 3EYHA 2F7ZE 2P3GX 2VU3A 4I4EA 4EYMA 2Y7JA 5DRDA 4YJVA 2HWOA 3BWFA 2VTLA 5ACBC 4BI0A 4O0SA 1HCKA 3E8CA 3O17A 4PP9A 3GCSA 3LZBA 5CU0A 3R30A 5LVOA 3KL8A 2IZTA 4FT0A 2C3JA 3TKIA 4XG8A 4FVQA 3ALOA 3V51A 4CTCA 4K1BA 5KCVA 2VTJA 3PXRA 3VS6A 1M17A 3GENA 3COHA 3QRIA 4D4YA 4YZMA 4JDJA 2VD5A 3LJ0A 4O91A 1IASA 2I0EA 4I5MA 5TR6A 2BVAA 3ZS5A 2V5QA 4FEXA 2CKEA 2J0MB 5ANGA 1MRYA 4R78A 3DDPA 1Y91A 3UO5A 4PDSA 1OGUA 3IDPA 4B8MA 4MBLA 2X7FA 3LCTA 5IA3A 3DV3A 2ITUA 3S1HA 3P78A 4KS8A 5JMSA 4DC2A 3R83A 4FA2A 1NVQA 4CZYB 4KIOA 2OJIA 1KV1A 3HP5A 1XO2B 4FTLA 4KABA 4S2ZA 4XH6A 3IW4A 3KVWA 5DE2A 5EH0A 4R5YA 3ZC6A 3BYOA 5CVGA 4UMUA 3SD0A 1IAJA 3LFQA 3ODZX 1SVEA 3P9JA 1KWPA 3KRXA 4DE4A 3DA6A 4XV9A 3DBFA 1YXVA 3GC7A 2JDRA 4S30A 3IOKA 4G3GA 4A9YA 3QF9A 3OWLA 3UMWA 5DBXA 4PMPA 3MIYA 1E9HA 4XYFA 2P0CA 4YO6A 5B0XA 2JKKA 5D11A 1EH4A 1Q8ZA 3GCVA 2YLEA 4FIJA 4MNEB 1V0PA 1Q62A 4HVHA 4AT4A 4GG5A 5E8VA 4WOVA 4EBVA 4BDGA 1Q41A 3ORMA 4G6NA 3S4QA 4C62A 2C5NA 4JLCA 4MHAA 3RAKA 4QP2A 3PYYA 3D4QA 1ZAOA 4CT2A 5IISA 3OD6X 3ZO1A 4M8TA 3Q6UA 2B9IA 3DNEA 2XUUA 3RAWA 1KOBA 3KQ7A 2UVXA 3R1QA 5DPVA 4C8BA 3C51A 1HOWA 2OFVA 4FI1A 3D94A 3LJ2A 4TRLA 3PA3A 2BAJA 3D5WA 3DCVA 4X6RA 2IVSA 1YW2A 4ACMA 4FSTA 3QTRA 3OROA 4IZYA 3NAXA 4NIFA 3HMIA 3DGKA 3MIAA 2XM8A 3VUHA 4BI1A 3KREA 5AFVA 5AEPA 3OG7A 1VYZA 3ZLSA 3EFWA 4IWOA 2RG5A 4NM7A 1NT2A 3A7GA 4QD6A 2BR1A 3OT3A 3I5ZA 4EOLA 3VUTA 5M09A 3B2TA 4KBAA 1J3HA 3GOKA 1G3NA 4I4FA 4BDAA 2YIYA 3Q5ZA 2H34A 4UMRA 3TUDA 2GHGA 3OY1A 3F88A 3A62A 4YBKA 4AT5A 1GY3A 5JK3A 1JNKA 2XK8A 3E3BX 4AS0A 3U51A 2QOKA 4LOQA 4DFZE 2XIXA 3TN8A 4MBIA 5GHVA 4ZJIA 3TDVA 4WBBB 4FTTA 1R0PA 2J9MA 3FL4A 5AUYA 1OI9A 4FSZA 4FV6A 3QRJA 5FM2A 2PUIA 4B9DA 3R1NA 5M51A 4FVPA 2W96B 4FG9A 4D5KA 4EOOA 4ASEA 1APME 4QMTA 5IQGA 2VTQA 3GT8A 1XH4A 4IEBA 4FNXA 2LGCA 4XV3A 2X8DA 5TKDA 4ANSA 4GK2A 4FTRA 4F6UA 3R9DA 3HP2A 5I9WA 1IRKA 2DS1A 2O64A 3F2NA 4FSRA 3HMMA 4MYGA 4DAWA 1Q8YA 4XX9A 4F7LA 4YTFA 4I23A 2J0KA 1UWHA 4WA9A 3OOGA 2EVAA 2NNWB 2VTHA 2A27A 3W10A 1O6KA 3BELA 4JG6A 2ZV2A 4C3RA 5FWKK 3QXOA 4NWMA 2XNPA 2AUHA 4NTTA 1A06A 1YHWA 4PNKA 5AP4A 2XEYA 3DNDA 5ETIA 1WMKA 5EKNA 4WD5A 4MX9A 3OS3A 4F1MA 4FYOA 4AGDA 2EXEA 2WOUA 3GU6A 5FXSA 4O27B 5KZIA 2V22A 2SRCA 3GCPA 2G2IA 3BU5A 2CN5A 2EU9A 4W8DA 4YZ9A 4ZTHA 3TZ7A 3UO6A 2B53A 1OUKA 1X8BA 3A7FA 2C3KA 3RI1A 3SOAA 3NIEA 4WNPA 4YC6A 3A99A 3AC2A 3ENMA 5CZIA 4C2WA 2VX3A 4FNYA 3THBA 4BHZA 1Q8TA 4CEGA 5K4IA 1KV2A 5EYDA 4EQUA 4AN2A 4DN5A 3DK7A 4C3PA 1F3MC 4HPUE 3ZO3A 1OKVA 3TV7A 2BRGA 1YXXA 4WRSA 4C61A 5CEKA 3QC4A 4IIRA 4BCKA 4IWPA 4CGAA 4MXCA 4ZMFA 2HK5A 4C0TA 2BRMA 5I9XA 4AX8A 4ZTQA 3JXWA 4M69A 3EN5A 4AXAA 2PVRA 5FD2A 4C4EA 2X7GA 1PXMA 3WF7A 1W0XC 3DXNA 3NYOA 2G1TA 3FSFA 4V05A 5AUZA 5BVWA 3R71A 4KIPA 5HD7A 1I44A 3AT3A 1PXNA 3BX5A 3QYZA 3V6RA 1KUTA 4A7CA 4ITIA 5HBEA 3BGZA 4D0XA 4QMZA 5AIKA 4D58A 3R8UA 3D9VA 1UV5A 5L8KA 3UOJA 3GC0A 4HVDA 2HZIA 2BRHA 3D83A 5FTOA 3RWPA 2JKQA 5EFQA 5F1ZA 2O63A 3SQQA 2VTOA 3QQKA 5HTCA 2YWVA 4RWKA 1JOWB 2XNBA 2IZRA 4XBUA 5CU3A 4DTKA 4O84A 3OT8A 3OUNB 3R7GA 4QP8A 3EN9A 4RJ5A 3P23A 4RQKA 5BVOA 2WIHA 3WF5A 3RP9A 3DQXA 2YM6A 3MPMA 5C26A 4ASZA 5HLPA 3UC4A 4MK0A 3FI4A 4IBMA 5A9UA 3NVMB 3I6UA 1H0VA 4FTKA 2R7IA 1OIRA 1XBCA 1JWHA 3FZSA 1KSWA 3NUPA 3LCOA 1CKPA 5TT7A 4EZ3A 5HOAA 5HNIX 3LXKA 4RFYA 2VWVA 4UXQA 2YITA 3HV5A 3ULZA 4FSYA 4G1WA 3F7ZA 1AQ1A 4DITA 1WBNA 5KMMA 5CNNA 3NUSA 4FUYA 4FL1A 4EI4A 2CNQA 2X4FA 2XK6A 5JEBA 4QQ5A 1PXJA 3EHAA 5LXMA 2FSOX 2C3IB 3OZ6A 3IDBA 3LAUA 1ZMVA 5HIEA 4KIKA 2J5FA 4K11A 4GV1A 4FV1A 4FUXA 3RWQA 2PY3A 3IPHA 4QP9A 2YISA 2UZEA 5T3QA 5JZJA 2ZB1A 2OJGA 3HL7A 5AUTA 2XIYA 3ORKA 5IQFA 1OL7A 2YDIA 4GVAA 5HE1A 4EWQA 2F9GA 4YBJA 3OXTA 4BWXA 4EZ5A 3UOKA 4K2RA 1GIJA 3NNVA 2FB8A 3PUPA 2WTWA 5FQDC 1L3RE 4RX7A 2IZSA 4I41A 5FDPA 3KCKA 4FZFB 3ZUTA 3L9PA 4IM2A 4OAVB 4FTOA 1ZZ2A 3E8EA 4LRMA 2IWIA 2R3PA 4G5JA 5IEYA 2FSLX 2IVTA 2UW6A 3ZZEA 1NW1A 1FPUA 4TYHB 4IVCA 3B8RA 4YHTA 5BVEA 4ZY4A 5JFVA 3MB6A 1OB3A 3K3JA 4JIKA 2WFYA 2WQMA 4L3JA 3IG7A 3QYWA 2HXQA 2KTYA 4QMPA 1QL6A 4GU6A 1B38A 4CD0A 3KN6A 2CGUA 4E6AA 4JR3A 4UWBA 4FKLA 5DG5A 3S2PA 1XJDA 3O7LB 4J97A 2WMBA 3PVBA 4PUZA 4EKKA 5GIPE 3D0EA 4E73A 5FRIA 2GU8A 2EXMA 1PKGA 3DFAA 4ACCA 4D5HA 2WMQA 3NCZA 4JDHA 4PL4A 4E4LA 4LV8A 4BGGA 4HVSA 3M1SA 2GPHA 4IX3A 3QCYA 4EOIA 4YJRA 4E4NA 3ANRA 3BU6A 5DVRA 5D7AA 4L46A 4G5PA 2J50A 4D2WA 5DYJA 3CKXA 2VTMA 4ARKA 3SXSA 3QTZA 2W4KA 3ORTA 4IADA 4E26A 3QTSA 1BX6A 4WO5A 5AR4A 4K9YA 4RWIA 4WG4A 5DEYA 3BGQA 2YAKA 2VX0A 3QLFA 3O8TA 4H3BA 1FQ1B 2QKWB 3LLTA 3COIA 2GQGA 4K0YA 5HG7A 4DH3A 5LMKC 3VQUA 1YQJA 2RFSA 2UZDA 2B9JA 2H8HA 3P7CA 2WEVA 2ZV7A 3C5UA 4FKPA 3RPRA 5AAGA 4KINA 3GU5A 3FC1X 5IDPA 3H9RA 5FTQA 4YNOA 2X81A 2ZMDA 5LARA 2A1AB 2YJRA 3DDQA 2XRUA 1H08A 4O0VA 5A6OA 5KUPA 4O82A 2GHMA 4ZY5A 5K0XA 3WARA 4HGTA 1OL1A 1FGKA 2WQEA 5BYYA 4IC8A 5AUUA 1H26A 4ZMEA 4GH2A 4FOCA 3Q6WA 1E1VA 3WZKA 2W5HA 4O22A 4FT7A 1H25A 5E8XA 1OBDA 4CLIA 1PXPA 4YZBA 4YMJA 3P5KA 4IVAA 4DFYA 5J9ZA 4D1SA 3ODYX 4CFWA 4FX3A 1H1PA 3D14A 4CV8A 1ATPE 3OCTA 3DXPA 5IQBA 3LMGA 4MKCA 4RA5A 3I7BA 2J0IA 4I5PA 4JIAA 2UV2A 1LPUA 4CCUA 2YEXA 4PTGA 4H1JA 4DGLC 2BRNA 2QO7A 1OKWA 3LFFA 3Q04A 5LCKA 2C6TA 2GMXA 2Z02A 3TWJA 5EW8A 5CNOA 2EB2A 4GVJA 2VN9A 3DBCA 4JR7A 2GNHA 2GS7A 4RLKA 3BYVA 4X7QA 2UVYA 5F9EA 2AYPA 1H1SA 1U5RA 2OK1A 2E9NA 3Q5IA 4UZHA 1QPEA 3HMOA 5IMXA 3EQBA 3OW4A 2ZB0A 4PY1A 4F7SA 4YZCA 2QI8A 1JAMA 4F9BA 5CS6A 5DWRA 3R0TA 3UDBA 4ANLA 5H9BA 4AZVA 3R8MA 4ALVA 4IQ6A 2C6EA 5KHWA 4O7LA 5EI8A 4BGQA 3QRTA 3GUBA 3CGOA 5CAUA 3VQHA 4KSPA 3BIZA 3DY7A 1F0QA 3EQCA 1UWJA 3IONA 4ID7A 4RVLA 1TQPA 4W9XA 3V5PA 4BBFA 4DH5A 5AMNA 3UVQA 2B0QA 2YIRA 3KRLA 4AZTA 3R7VA 2BZIB 2YIXA 4RIWA 4MD9E 3W32A 3NS9A 3QCQA 3VW6A 4X2GA 1BMKA 4BY9E 1BI8A 5CI7A 3SW7A 4ZJJA 2FH9A 1SVHA 2BDWA 4XP2A 2E9VA 2JIVA 4OTHA 4E8AA 1WFCA 2ZOQA 4DLIA 3U4UA 4RC2A 4V01A 4D2VA 5K5NA 2CGXA 4IFCA 3TG1A 3KMUA 1KE5A 5CSHA 4ZK5A 4YSJA 5KMJA 2B54A 2UW5A 5HEZA 4BBMA 2FSMX 3EH9A 3FQSA 3GFEA 3LFNA 5G1XA 4EOPA 4V04A 2CCHA 4BCIA 3LXPA 3UBDA 4QMYA 2C1BA 2OJJA 1SVGA 2GTMA 3KRJA 3UOHA 4JG8A 4UBAA 4MD7E 1W8CA 3N9XA 4MEDA 5H8EA 4P5QA 2VWYA 2B52A 4D4RA 4QPSA 3VJNA 2E9UA 5I9VA 2NPQA 3DXQA 1JPAA 4UEUA 1OL6A 3F7WA 3BYUA 5FUTA 5JZNA 3OP5A 4RX8A 2BZKB 4UYAA 3LQ8A 3T3UA 3I81A 5EM7A 3A61A 2GS2A 4C4GA 5HU9A 4X0MA 3I0OA 4GL9A 4ZTRA 3AT2A 4NKSA 2QONA 4TWPA 4CFNA 2X7OA 4U8ZA 1BUHA 4F0IA 4H39A 5KO1A 3RVGA 5E4HA 5LVNA 3HYHA 2W1CA 4H36A 5HLNA 4R7BA 2NP8A 4NIFB 3ORPA 4TT7A 1YXTA 4LOOA 3KK9A 5HVJA 4OT6A 4WRGA 4JOAA 4HCVA 1REJA 2WTDA 2YLFA 3VRYA 4I24A 3U4WA 4EOKA 3G9NA 4TNBA 3ZDIA 3E7OA 5DLSA 3RALA 3FZOA 2O0UA 3EMGA 5C1QB 2PE2A 4MXZA 4GYIA 1XBBA 4FNWA 1YOMA 4FSNA 3FQHA 5FEDA 3U9NA 4DINA 4IZ5A 5BYLA 3A4PA 1IA9A 4GSBA 5A4CA 2GSFA 4FT5A 1Q8UA 3ORXA 4RWLA 4LI5A 4UWYA
chains in the Genus database with same CATH superfamily
4R3CA 3RTPA 4C58A 2FYSA 1W82A 2RIOA 3EJ1A 4O0WA 3RK9A 3H9OA 3O0GA 5EI6A 2HAKA 4D1ZA 5AP6A 2BIKB 4GUEA 4DCEA 3ZFMA 3V5WA 5CT7A 3GOPA 3BL7A 4H3PA 4QT1A 2C5OA 4AW5A 5HG9A 1OKZA 3P7BA 4U5JA 3ID6C 2A98A 2R3JA 4AFJA 2VTNA 3F66A 4RX5A 4EH2A 2JITA 3NIZA 2XZSA 4DEBA 2C5XA 2QO2A 4CMOA 3P7AA 3K5VA 4NJ3A 3WF9A 4XRJA 4EH5A 3S3IA 5LMKA 4YLKA 3F6XA 5LCJA 4L43A 1DI8A 3LMIA 2BFXA 4GMYA 3Q2JA 4FNZA 4GK4A 4O4DA 3VW8A 4EHGA 4QNYA 3MFTA 2FGIA 5AR5A 3NEWA 3KXHA 4BVUA 4XV2A 4ZTSA 2YM4A 3VAPA 1ZZLA 3W2OA 4DEEA 5AR8A 4YR8A 3FC2A 4JBOA 5EDRA 4QTEA 2XA4A 2ZJWA 1XH7A 3MY5A 4I6FA 5DN3A 3NUAA 2BUJA 5L2IA 3JPVA 5FEEA 1R1WA 3VONA 2Y4PA 3QAME 2R3KA 3NW7A 3FI3A 3AXWA 1IA8A 4FEWA 5LVLA 1XH6A 4JDIA 3K54A 2IVVA 1R3CA 1TQMA 4CCBA 5KMLA 4EOSA 2W0JA 3AOXA 3HA6A 3UG2A 4CQGA 3G15A 2V55A 3ZEWA 5JSMA 4G31A 4C33A 2A0CX 5HG5A 4NJDA 5E90A 3W2QA 4PP7A 3OBGA 3D2IA 4HGEA 2YCFA 2C6OA 4FT3A 1WAKA 3HMPA 4U45A 4XG6A 4BCGA 3LHJA 4NL0A 2BTSA 3NUXA 3PXFA 5AA9A 4ACHA 4NCTC 4M97A 4D2TA 4NK9A 4ZLOA 4EJ7A 3HUCA 1STCE 3GCUA 4YURA 4ZZOA 4BZNA 5EK7A 4MBJA 4M69B 3DJ6A 3QX4A 3TUBA 4QMXA 1XR1A 3A8XA 3EQHA 4ANBA 4AXFA 3HLLA 1G8SA 3POZA 2OXXA 4FV5A 3UQGA 3LM0A 1RW8A 4OAUC 5ANEA 5C03A 3RK5A 2WTVA 4EOQA 3EB0A 3VS1A 5CF8A 1JKSA 1ST4A 4MF1A 1FVTA 2UVZA 4E4MA 4RJ8A 3NR9A 2CSNA 2OKRA 2OZAA 2YHVA 4IVBA 2IO6A 1W2CA 5HICA 3G90X 3R02A 4FTCA 1BYGA 3FL5A 3CD3A 2PE0A 3CY2A 2QOBA 3HV7A 5CSVA 5HO7A 2W5BA 4N6ZA 4F6WA 3GC9A 5H8GA 4X6QC 5KMNA 3A4OX 5HCZA 3C0IA 4I3ZA 4ITHA 3L8PA 3TCPA 3KRRA 3LFAA 3F5GA 4MXOA 4FF8A 2HW7A 4AOTA 5CX9A 5KBRA 3DLSA 4O6EA 2VTAA 4YC3A 5ETAA 5IMEA 4R6VA 4W4XA 5KMOA 3QHRA 1ZMUA 3RMFA 4CKRA 4FKSA 2ITYA 2HZNA 2PHKA 2WMWA 2OFUA 3K3IA 2JAMA 1S9JA 3PWYA 3R04A 4I94A 3R7YA 3DTWA 5E8TA 3OF0A 3WZJA 3QQJA 3U87A 4GK3A 4HCUA 4KKEA 1WVXA 4JQ7A 1FVVA 3OEFX 2OXYA 4AGWA 4J52A 2DWBA 1XKKA 3TJDA 3F3VA 3CY3A 2QVSE 1PYXA 5JQ8A 2C6MA 4H1MA 3GU7A 1GZ8A 3CP9A 3JUHA 4IX5A 3AG9A 3E7VA 4J95A 3V3VA 4ZZMA 3RZFA 3WIKA 4O96A 5JQ5A 4QEBA 5EOLA 4IJPA 5IH4A 1W7HA 2W1FA 4BCNA 4FZ6A 4OBOA 4U7ZA 4QTCA 4APPA 3LMHA 4IZAA 2WTCA 5E91A 4KIKB 2QC6A 4NSTA 2YDKA 4KNBA 2V7OA 3PE1A 5ANDA 2ONLC 3GU8A 2R3IA 4PDPA 4YJSA 3E92A 4FV3A 3I1AA 4WNMA 2YIWA 2VTPA 2C0TA 2XK3A 2XF0A 3TT0A 5EQPA 1GNGA 1DAYA 3AGMA 4C02A 3PLSA 4FKJA 4I6HA 2ACXA 2Q83A 2F49A 5ANKA 1K3AA 2CKPA 2YM8A 2CHLA 2YIQA 4ZTLA 3KGAA 4CNHA 2JKOA 2REIA 4YJNA 3SAYA 4EHEA 4ANMA 3DU8A 2GDOA 2QCSA 3UPXA 4GIHA 3QUPA 5IA0A 1PMVA 2OH4A 2WTJA 1PRYA 3WF8A 3PXKA 2BTRA 3ZDUA 1QPJA 3UNKA 2VNYA 2W7XA 3RKBA 3AC4A 4PPBA 4EC9A 4FE2A 2X1NA 3E88A 3NPCA 4CZTA 1Q24A 2GNJA 3FQEA 5CAVA 3ROYA 1PMNA 3PTGA 4CG8A 3FMDA 4LQMA 2C1AA 5BX0A 5J9LA 5D12A 4G16A 3WZDA 3FZPA 2WOTA 3D5UA 2OW3A 3DKOA 3DKGA 1Q97A 4O1OA 1G8KA 4O0TA 5EKOA 3LQ3A 4F0GA 3G6GA 3OEZA 3PWDA 4FZ7A 4F63A 1A48A 4KBKA 4W8EA 5GNKA 4QMUA 1VR2A 3UJGA 2YACA 4CVAA 1GZKA 2VWXA 2UZWE 4J96A 5GJGA 5DIAA 1MQ4A 1M2PA 1ZYSA 4R1YA 4YP8A 5C4LA 3VF8A 4UMPA 3HUBA 2W5AA 3KU2A 3UZTA 1Q8WA 2HZ4A 4UWCA 4UY9A 5CEPA 2WTKC 1G8JA 5J7BA 2WTIA 4YLLA 2R3HA 4QP3A 4JVGA 1G5SA 5KHXA 2G9XA 3AMYA 3KXXA 3JS2A 2XKFA 3DLZA 3PG3A 4TWNA 5TO8A 3WYYA 3AKJA 2C5VA 2VO3A 1XWSA 2ZV9A 1NVSA 4GRBA 4FYNA 4JI9A 3UC3A 5FG8A 3VS4A 3W33A 5FXRA 2YABA 1CM8A 2Y4IC 3UYSA 3KC3A 4FG7A 5DFPA 4IB1A 5FM3A 3UZPA 1OL5A 2J90A 3QZGA 4O21A 3VJOA 3NVKI 4RT7A 1PXKA 3CXWA 1UU8A 3EQDA 3CSVA 3NSZA 4I22A 3MH2A 4FT9A 3QBNA 1R39A 2FA2A 4Q5EA 4TYJA 5HG8A 5CI6A 1TKIA 5HLWA 4PV0A 5DT0A 3UDZA 1YVJA 4XEYA 2VRXA 4ZY6A 4YTHA 4K6ZA 4OTFA 4W9WA 4O7NA 3JYAA 3KULA 5EQYA 2W4OA 5EW9A 2IW8A 4RLLA 3HECA 5CVFA 4A9RA 5J5TA 3ZSIA 3DJ5A 3N4VA 3SG8A 3TDWA 4DEDA 5GZ8A 1OIQA 1LEZA 4I6LA 3QQLA 4IACA 5CQWA 4F9WA 2WQBA 5HBHA 4GW8A 4AUAA 3EZVA 3F9NA 4FVRA 4DDGA 1PF8A 2HIWA 3OXIA 2R7BA 3BHYA 5LWNA 5GZ9A 2H9VA 4HZSA 3SGCA 3O23A 4NKAA 1YHVA 3QD2B 5HZNA 4M0ZA 4CFXA 4DFUA 3PY0A 4LL5A 4FIEA 2JLDA 2PUUA 4PMTA 2X0QA 3PRIA 1YWRA 1PKDA 1PW2A 4FMQA 3FMMA 3WILA 4F0FA 1JVPP 4FV9A 4F7JA 5JFXA 2X0PA 3QCXA 4JT3A 5EDPA 5C01A 1TQIA 2A2AA 3HRCA 3KIOC 1Z5MA 2QG5A 2X6DA 4LFIA 5HVYA 2RFDA 2UZTA 4R3PA 3JY0A 3VUKA 2GNIA 2B4SB 2CNUA 5CAPA 3EQGA 3LJ1A 5E8YA 2XCKA 3F2AA 3AC3A 3BEGA 3R7UA 2WIPA 5M4UA 2ZYBA 2QNJA 4KKHA 4XP0A 4EH9A 1XMMA 2PUPA 1UA2A 4E5WA 4KRDA 4W4VA 2CGVA 3RK7A 1JSUA 3BYSA 3PZHA 4FKVA 4MXYA 2NRYA 4N70A 3W0RA 5HCYA 2VTSA 3EFLA 4X2KA 4QMSA 3I7CA 2XBJA 4USFA 4F65A 1P2AA 5M07A 2XNGA 4U3ZA 3HNGA 4D28A 3MSSA 4N4SA 1FGIA 4QRCA 3O8UA 2QU5A 4Q9ZA 5CYIA 4RIWB 5M55A 3LIJA 2QOLA 1JSVA 3ZOSA 4O81A 5AR3A 5AP3A 4CQEA 1ZXEA 1FVRA 2XJ2A 3Q60A 4OW8A 4FTQA 3WIGA 4YUQA 3DJ7A 2XS0A 3IQ7A 4LM5A 4XG3A 4F7NA 5J1VA 3QUDA 3KK8A 2RKUA 3RM6A 2FUMA 4BCQA 5A6NA 4Q2AA 5CVHA 2OF4A 3KFAA 3PPKA 3QALE 2GNFA 2YM5A 5EHYA 5CZHA 1M52A 4RA4A 3UYTA 3ACKA 4EK5A 3IW7A 3RHKA 4GG7A 2XNMA 3VBXA 1OIYA 1ZOGA 4QMLA 2X9FA 4IVDA 2YZAA 5IH6A 3EL7A 3FY0A 4L67A 3NW6A 4KUJA 1MRVA 4XJ0A 2ONLA 1S9IA 3EYGA 3LPBA 2W17A 4IE9A 1J1BA 5DT4A 3FXZA 4BDKA 2XANA 5HU3A 3UO4A 4DBNA 2VZ6A 3SXFA 4ERWA 2CLXA 2JC6A 2W06A 3O71A 4MWHA 4B7TA 2J5EA 1Y57A 2OIQA 4OBPA 3LOKA 4FOBA 5IDNA 2OJ9A 4XUFA 1A9UA 5LMBA 2ERZE 3TNHA 1YOLA 3QWKA 2OO8X 4OTQA 3BYMA 4BTMA 5HORA 1R0EA 3Q96A 3QTXA 4A07A 2IEWA 1GZOA 2ITNA 3CE3A 3G33A 4BDCA 3UNJA 1WVYA 4RFMA 4ACDA 5A4TA 4WG3A 3KF7A 4YJTA 5I9ZA 3WZEA 5LVMA 2G15A 2GTNA 3FXXA 3MBLA 4G9RA 2ZDUA 4UB7A 5CSPA 3FV8A 3LFSA 5HI2A 5L2QA 1OIUA 4IDTA 2PZRA 3L9LA 4IAKA 2WU6A 4BDIA 1UU7A 2G2HA 3CR0A 3TI1A 4IMYA 2DUVA 2GNLA 3AMBA 3L9NA 4S34A 5TF9A 4CMUA 3PLAE 4M84A 2ZAZA 1Q3DA 3C9WA 3CJGA 3UTOA 3KVXA 1IR3A 4LGHA 3N4TA 4AA0A 1WBTA 4M7IA 3BE9A 4R7IA 1RE8A 5GJFA 3SDJA 4DF3A 4RZWA 5M44A 4D4VA 3V04A 2GQRA 3LFDA 1B39A 4PNIA 5HX6A 1JBPE 2W9FB 3C4FA 2C5YA 3G6HA 3NNWA 3O96A 4MF0A 5AP5A 2PYWA 5FBNC 3JVRA 1ZYLA 2ITWA 2I40A 5BUEA 2DQ7X 4LYNA 3A7JA 4BTKA 4WG5A 3ZFYA 3VBTA 3L8XA 5EDQA 1WZYA 3TJCA 4CRLA 2CLQA 3KXNA 5B2KA 5J1WA 4AZWA 3Q9ZA 4BCMA 2VTTA 3QA8A 4A9TA 2VUWA 3GVUA 4CFMA 1DM2A 3TKHA 5IUHA 4QMVA 4XHKB 3VUDA 5KBQA 4Y83A 5EM6A 3O8PA 4MQ1A 4GKHA 3ZU7A 3ZXTA 4CKJA 4OTPA 3P86A 4PRJA 4E3CA 4YU2A 2IF8A 3EQRA 4G3EA 3TACA 3UQCA 3HDMA 3OTVA 2BPMA 2RFNA 3E5AA 2CPKE 2IPXA 3U9CA 3CCNA 4GCJA 5F94A 3DBDA 4P7EA 5E8WA 3PSBA 1GJOA 2JKMA 3LFEA 4Y5HA 2UW0A 3SX9A 1ZYCA 4EK3A 3AD5A 2R3OA 1CTPE 1P5EA 4QYGA 4RVTA 5G6VA 4TYGA 3QX2A 3Q9WA 4PPAA 4U43A 4XLIA 4A06A 3CQEA 4BIDA 1RQQA 4X3FC 3ZUVA 4BDBA 4DGMA 2PK9A 4U80A 5IA2A 4DEHA 5CASA 4NUSA 1XH9A 2PVNA 3BGPA 2F7EE 2VNWA 2WD1A 3VULA 4BZOA 3NFFB 4OTGA 1YDTE 3W8QA 1OECA 5TOZA 1JQHA 5F20A 2OICA 2YFXA 5ICPA 1PXOA 1RJBA 4YO4A 1Q3WA 3GXLA 3L9MA 4JXFA 4X2JA 1Z9XA 4IB3A 5M4CA 4GT4A 4GFOA 5M08A 5HE2A 3WF6A 3OBJA 4M66A 5A14A 2J4ZA 3ZO2A 2WU7A 5DGZA 4PL3A 2BHEA 4AACA 3C7QA 3FPQA 4M14A 3UZRA 4RPVA 3CTHA 4I20A 4O83A 1SZMA 1JKKA 2UZLA 3PPZA 2RFEA 4IB0A 4C4FA 2OZAB 5HTIA 5HO6A 2BDFA 1TVOA 1XH5A 2VWWA 1LUFA 4XNEA 2X2KA 3GP0A 3MH0A 1IAHA 4J53A 2OWBA 2ITTA 2P2IA 3VS5A 2XB7A 4XLVA 4AGCA 4EK4A 2HENA 4BCOA 2QO9A 4J99A 2AC3A 3FY2A 3C5IA 4YHJA 5L8JA 4O0RA 2HXLA 4TWOA 5HESA 3QUEA 5JH6A 3FZRA 2G2FA 3BHTA 4NEUA 5AADA 5IU2A 3LKMA 2WQNA 1GIHA 1CSNA 3MJ1A 4TZRA 5IG1A 3ETAA 4HGLA 5EI2A 4AA4A 3MH1A 3DOGA 4XOZA 3WOWA 1W2FA 3HV3A 3E8NA 3C4WA 1BKXA 3P08A 3FMJA 4C7TA 1SNXA 2V7AA 2XK4A 1WBOA 5A4LA 3UIMA 2WMSA 4M3QA 2UW4A 2Z60A 4ANNA 4FZAB 3EQIA 3F3TA 2E9OA 3MWUA 3BQCA 4W4YA 1SNUA 4J8MA 4YLJA 5EOBA 1Y6AA 3V01A 4NW6A 5C8KA 3NW5A 3PXYA 3UVPA 4O7SA 2PVMA 4D55A 4BYIA 3DFCB 4H58A 4QTAA 2PVKA 5FBOA 3R8VA 2JDOA 3F82A 2I7QA 3P5JC 2PE1A 4DBXA 4FTJA 1REKA 4AQKA 3QQUA 3RM7A 3MVHA 2JFLA 3EQFA 4EOMA 3AC8A 5CALA 4FIGA 4XG9A 4TW9A 1TZDA 2VGOA 1T46A 2XKCA 5CEMA 5M4FA 2Q0NA 3DAEA 4RIOA 3VN9A 4FICA 1NY3A 4G6OA 4MQ2A 2YWPA 4RRVA 4QYYA 3F5PA 4TNDA 3VO3A 5JKGA 3ZO4A 2V62A 4FKOA 4DFBA 4GJ2A 5DR6A 4RSSA 4E5AX 5K4JA 4JDKA 4DG3E 2R5TA 3D7TA 5BVNA 4PTEA 3I79A 2I1MA 2NYAA 3NWWA 2FO0A 3EFJA 4XG2A 3R7IA 2R3NA 4HCTA 3NUYA 5AV0A 4D1XA 1J7UA 2BHHA 2V0DA 4HZRA 2QOOA 1U5QA 3R8PA 3UODA 4QP1A 4L7FA 2XAOA 3W2SA 3WE8A 3QD4A 4FGRA 4RIXA 3DAJA 3AGLA 4F99A 5T68A 5I9YA 2RGPA 4BDDA 4S32A 4BWKA 2QR7A 3AKKA 3ACJA 3D7ZA 5A4EA 3UQFA 4ONAA 2J0JA 5AUVA 2QHNA 4I6BA 2I0YA 4R7HA 2Z7SA 5CU6A 3I6WA 4TN6A 4QQJA 3ENHA 3M2WA 2YCRA 4Y5QA 3F3WA 3Q53A 3P0MA 1KE6A 4QTBA 3T9TA 2IW9A 4JBPA 3FMKA 2BIYA 3ZLYA 2P2HA 3IW5A 3PVWA 2YM7A 4RGJA 4FTNA 4TTHB 4U40A 3TTIA 4AG8A 2WNTA 2WMRA 3LFBA 3COKA 2BMCA 3B2WA 3KF4A 4LRJA 4IHPA 4U0IA 3QZIA 5EYMA 4EEVA 1GAGA 3MA6A 4MVFA 3BKBA 4FV4A 2F2CB 3A2CA 3V5TA 4JBQA 2JD5A 3ZLWA 2XIZA 3DPKA 5IUGA 3FLZA 4OTRA 1MRUA 3RCDA 2QOCA 4ZSEA 4WSQA 4RJ4A 4JRNA 3OXZA 4Y73A 1MP8A 4R77A 5JGAA 4QPAA 3N51A 3O51A 5ACKA 1TFFA 4FJVA 4BGHA 4TPTA 1WBPA 3KMWA 4NZWB 4CFFA 2HELA 3VBYA 3A7IA 2CKQA 2X4ZA 3UGCA 2RL5A 2X6EA 5AV2A 5BVKA 3A8WA 3R9NA 4OT5A 5DI1A 4C38A 4FL3A 5T6KA 3TTJA 4AU8A 4IAIA 4E6QA 4LV7A 2QG7A 4IX6A 3R1YA 5LQFA 4YTIA 3CD8A 3FMEA 1H1WA 2CKOA 5FDXA 3KULB 3R2BA 2NO3A 2XYNA 5DRBA 4A4XA 4IAZA 4O86A 3V8TA 5L3AA 4X3FA 4RWJA 4BCHA 4USEA 2XNEA 3C4XA 5I9UA 5AUXA 4MXAA 1FINA 4LG4A 5KX8A 4ZTNA 3CQUA 4KWPA 5DOSA 5I4NA 4K8AA 3CQWA 4ZEGA 3KN5A 3VWAA 3AD6A 4LUDA 3ZH8A 3ZXZA 4E6DA 3EQPA 3MFSA 2QURA 4RC3A 2PUNA 4O4CA 3MI9A 2X8EA 5CANA 1URCA 5KKRC 2BKZA 4OGRA 2H6DA 3BEAA 2AC5A 4MH7A 3TNIA 1OMWA 2PMLX 3FKOA 5AR7A 4LUEA 3NYXA 2QR8A 2NRUA 4DCAA 4HYHA 4JAJA 2XH5A 3RNIA 3RCJA 4F4PA 4ASDA 3G0FA 4ZTMA 2BALA 5AR2A 2QODA 2O8YA 3FYJX 5HO8A 4FTMA 5HD4A 5CAQA 3MVLA 3UNZA 2BDJA 3R9RA 3PPJA 3B8QA 3DZOA 3NYNA 2R3LA 3HV4A 5D41A 5DEWA 5LVPA 2I0HA 3DKFA 4WKQA 4EQMA 3IKAA 3KKVA 4NT4A 2C0OA 2I6LA 5CY3A 2IW6A 3HA8A 5ANJA 4MD8E 2QLUA 3LVPA 5FLFA 4NU1A 3PSCA 5C27A 4AN3A 1HCLA 3DAKA 3FYKX 5A46A 5L2TA 3VHKA 1ERKA 1PJKA 1YXSA 2HCKA 4E20A 3ZM9A 4AZEA 5CSWA 3U6JA 4QMMA 4ERKA 1OPKA 3MY0A 3G9LX 3F69A 3JY9A 3TEIA 5ANOA 3TZ8A 2W1EA 2QD9A 4NM5A 3V6SA 4G3CA 4Z9LA 4ZSAA 5L6PA 4EH6A 3QKLA 4FR4A 4H05A 2ESMA 2C68A 3KA0A 4ZOGA 1P4OA 2YA9A 3FSKA 4DGNA 4AZFA 3OY3A 2B1PA 3KY2A 1F5QA 4JX7A 4QO9A 3ALNA 4TKSA 5JRQA 3ZC5A 1FBNA 2FSTX 3CIKA 3CS9A 1OPJA 3IOPA 4AN9A 1DS5A 4TL0A 3IO7A 4CMTA 1W98A 4CYJA 4PMSA 4UMTA 4UV0A 3QTUA 3SV0A 4JQ8A 1ZY5A 1VZOA 2Y6OA 4M15A 3SOCA 2QKRA 3ERKA 3ET7A 3WZUA 4XS2A 2UUEA 3RINA 4RIYA 3PJ8A 3Q4UA 1YDSE 3E64A 4NH1A 5AP2A 3QD3A 4X21A 3RZBA 2VV9A 2XIRA 1JKTA 3A7HA 4P5ZA 4PL5A 3F2RA 3DBQA 2Z7LA 4NM3A 3JR1A 3LQ5A 4U9AA 3F5XA 1WBVA 5F4NA 3C1XA 5B2LA 3W2RA 4KA3A 2E2BA 3I0QA 3MB7A 4OTDA 5CF4A 4QMNA 2WPAA 4G9CA 3O2MA 3C4ZA 3AC1A 3IS5A 4O7ZA 4C34A 3U6IA 4BICA 5KZ0A 4IXPA 4BDEA 4F70A 3R00A 4MXXA 3QLGA 3FZ1A 4II5A 5DA3A 3RAHA 1H24A 4DH8A 4O4FA 4PPCA 3SC1A 3R21A 4XBRA 4BCFA 1UU9A 2PMNX 4NW5A 2PU8A 3SW4A 3GC8A 4S33A 1KOAA 3HDNA 4Y95A 2YCQA 3GNIB 3VS3A 3PFYA 4Q9SA 3H10A 3FDNA 3Q3BA 1UNLA 5I3RA 4HPTE 4BI2A 3ZM4A 3O5AA 2BFYA 1P4FA 2J2IB 4IAYA 4X3JA 3HAMA 5IKWA 4PMMA 3VVHA 4YSMA 3LCDA 3CTJA 4ITJA 4FV0A 4FGBA 3QKKA 3Q4TA 2PZYA 2CDZA 4PWNA 3F5UA 4O4BB 5DR9A 4QQTA 3GU4A 2BRBA 1PHKA 5IQCA 2P33A 4TXCA 3HRFA 5CF6A 3QGWA 2VWUA 4BYJA 1AD5A 2C6IA 4M0YA 2XMYA 2C6LA 3TIZA 4J8NA 3PJ3A 3BRBA 4BKJA 4JNWA 2JBOA 3VBWA 2EWAA 1AGWA 1WBSA 4CFVA 4M68A 5CXHA 2ITXA 3LE6A 4E4XA 5GJDA 2Z7RA 5AA8A 3LFCA 3NGAA 3CKWA 3E8DA 3HGKA 1PXLA 4BTFA 4C4HA 4Q5HA 2OLCA 3FEGA 3R8LA 1JLUE 1PMEA 4LGDA 2PMOX 4O0XA 5AV4A 4QYEA 2R9SA 3KEXA 4C59A 2BZJA 3DZQA 4DEGA 2O5KA 2PMIA 5H8BA 4QMQA 3MH3A 3TIYA 2EUFB 3PP1A 2PPQA 1PYEA 5HBJA 4O7YA 2R3FA 4L9IA 4AE6A 5I3OA 2XJ1A 3PVGA 3Q4ZA 4NFMA 3VUMA 5I5ZA 3PDTA 3MTFA 2VO6A 2Y6MA 4Z55A 3PJ1A 4AW2A 5FGKA 3IW6A 4WT6A 3RJCA 4L44A 2YM3A 2Z2WA 4EWHA 2G01A 4EKLA 3H0YA 4JS8A 4FZDB 3PXQA 5JT2A 3BHVA 1LEWA 4BJJA 1OPLA 3BHHA 2PZ5A 1GZNA 3GFWA 3SHEA 5LWMA 3W8LA 2PL0A 2A4LA 4AW0A 4AP7A 3RGFA 1DAWA 3V8WA 2GCDA 4GYGA 3ATSA 4DH7A 5GINE 1YKRA 3UIUA 3ATTA 5EHOA 4V0GA 3T9IA 4U6RA 3W2PA 4O0YA 4IM3A 5E1EA 2WMXA 4FKWA 2FVDA 4WHZA 4O1PA 5J87A 3RPOA 4A9UA 2OG8A 1VEBA 3VUIA 4DDIA 2F2UA 3BI6A 2QHMA 3K2LA 4HJOA 5FP6A 3RHXA 3TNPC 2XK7A 2XYUA 2EB3A 4FKIA 4HNIA 2OH0E 2WKMA 4NFNA 1ZOHA 5DNRA 4CYIA 5DR2A 3FMHA 3GGFA 4EYJA 2O2UA 5K0KA 3REPA 3VC4A 5ETCA 4BTJA 4IAFA 3GEQA 4ENXA 2B7AA 2UW3A 4KB8A 2R4BA 3FLQA 5GIOE 5BMMA 1O6LA 3QWJA 3W55A 2BAQA 3FE3A 1UNGA 1UU3A 3PIXA 4L00A 5FXQA 2ITOA 4I0RA 4JRVA 4E5BA 4F09A 5CXZA 4B8LA 3HX4A 4U41A 3FKNA 2WQOA 3QD0A 1ZYJA 1Z57A 4N6YA 1J91A 2UW8A 3BLHA 4JJRA 3QC9A 3CPBA 1QPCA 5EYKA 2J7TA 4QP7A 4KKGA 2GFSA 2AQXA 3ZSGA 4BIBA 3R01A 1G8AA 4APCA 4USDA 4RX9A 4BKZA 4D9TA 3MPTA 2XBAA 3C4EA 4Z7HA 3HKOA 2JBPA 4Y8DA 4FKGA 5HHWA 1ZYDA 4YJPA 4NCTA 3TZ9A 4CTBA 2E9PA 5CEOA 4IFGA 1H1RA 3UP7A 2ETKA 4RZVA 5IUIA 1XMLA 4CXAA 1UNHA 4LMUA 3PXZA 4P4CA 1FOTA 5AJQA 3RBWA 4ZSLA 3AT4A 5C8NA 3KXGA 5CU2A 4LMNA 3ULIA 2EXCX 4B99A 3LLAA 4MWIA 4O7WA 3ZBXA 3QFVA 4D9UA 4EH7A 4FKQA 2ZM1A 5J79A 2H96A 3BQRA 4L7SA 1U54A 4BR3A 4YNEA 3W16A 4ZLZA 4FC0A 2XVDA 3COMA 4EONA 3QQFA 4I5CA 4IWDA 2PSQA 5E8SA 5AV1A 1NA7A 4FV7A 4IJ9A 5BVDA 3UIXA 4BHNA 4EH4A 2W4JA 1XQZA 1ND4A 2XJ0A 2HY81 4JBVA 3Q52A 3RAIA 3D7TB 4DFLA 2PULA 3PIZA 5EYCA 4IB5A 4Y85A 4BIEA 2R0IA 4QQCA 3NZ0A 4J7BA 3R6XA 2X2LA 2F4JA 3CJFA 2ZDTA 1WCCA 2W05A 4K33A 4D2RA 5IA4A 3SG9A 1LR4A 3ORIA 5GZAA 3MW1A 4O4EA 5E8UA 5AP0A 1H01A 4FK6A 4LL0A 1KE9A 4ZIMA 3W1FA 3LCSA 4G3DA 4AZSA 3F3ZA 2B55A 2O65A 2JIIA 5AAFA 3DB8A 4FK3A 3WBLA 4CFUA 4OBQA 3FUPA 4YC8A 3QU0A 2IZUA 4RIXB 5AV3A 3TXOA 4I92A 4QMWA 4UMQA 2QOQA 4FEUA 3PJCA 4JG7A 2PWLA 4PTCA 3FPMA 1OL2A 4GU9A 5ETFA 5HNGA 3QCSA 1U4DA 5IH5A 4DLJA 1OBGA 3I5NA 4WBOA 4HW7A 2CN8A 3AC5A 3SRVA 5I0BA 3PP0A 5C4KA 3S00A 3ZZWA 3G2FA 4XOYA 4F6SA 2WMAA 4JQEA 4TYEA 4NTSA 2VTRA 5LMAA 2BROA 1ZRZA 5KMIA 4F64A 3HEGA 4C4IA 3MFRA 3D2KA 4WUNA 2WHBA 4IW0A 3ZMMA 3FLWA 3TZMA 1DI9A 4C3FA 1T45A 2GHLA 5K5XA 5L2SA 5DMZA 1P14A 3BLRA 4IM0A 2CNVA 4W4WA 3AD4A 2PVYA 4DHIB 2ZM4A 4HNFA 4TWCA 2GS6A 4KSQA 3D5VA 4BF2A 3PG1A 4LV5A 3NLBA 4F1OA 1ZLTA 3QTQA 4BC6A 4DG2E 4YJQA 2BAKA 3BBWA 4ZP5A 5D1JA 2Z7QA