4YO6A

Irak4-inhibitor co-structure
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
286
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEQVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Potent and Selective Amidopyrazole Inhibitors of IRAK4 That Are Efficacious in a Rodent Model of Inflammation.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 286
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yo6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yo6A01
3SG9A 4XX9A 3JY9A 2C47A 3ZFMA 2YN8A 2Y0AA 2FGIA 4FKUA 3BV2A 3VNTA 1P4OA 3ZCLA 4H3QA 1H8FA 3OUNB 1YI6A 4DEAA 4E1ZA 3WI6A 4FTNA 4ERKA 1OKYA 2OXDA 2IW9A 3TKIA 4QYGA 1M2QA 3Q2MA 3U87A 2C4GA 4C4HA 5BQ0A 3E8EA 4JIKA 3LHJA 4PDPA 3AMYA 4IACA 4FKGA 4NM5A 5CI6A 4MXYA 3MVHA 3OHTA 4KSQA 3ZRLA 4DG2E 3JR1A 2YCSA 4BCOA 2VTPA 4D0WA 4QYYA 4L42A 4ZY6A 2PHKA 2XMYA 3KRWA 4X6RA 2O8YA 5BVEA 2JITA 3CS9A 3RBWA 4XRLA 4FV0A 1WBSA 3SQQA 3DKFA 2QOQA 3PPJA 1XKKA 3VS1A 2CKPA 1OIYA 3U4WA 3DXQA 3HVCA 2ZAZA 4O7SA 2DWBA 5BVKA 2BVAA 1CKIA 2IVUA 3OUKA 2QHMA 3FYJX 3GU8A 5IQHA 4ZTNA 4TYJA 1GJOA 3DKOA 4J96A 4UMUA 5HORA 4I5PA 5CU6A 5CTPA 1Q8WA 4UEUA 3UODA 2ZM3A 3PXYA 4I1ZA 1ZRZA 4NM7A 3OBJA 5ANGA 5HIBA 3TUDA 2PY3A 4C7TA 5JGAA 5JZNA 5L4QA 4A4LA 2NRYA 2J5FA 4TYEA 3AMBA 3FUPA 2W1IA 4CTBA 1I44A 4F0FA 2WQBA 2F2UA 2EWAA 2IG7A 2BKZA 1LPUA 5L8LA 2GNIA 3DA6A 1CSNA 4O7TA 4F9BA 2E9PA 3BLQA 3BIZA 3EQRA 4AW1A 4JBVA 4HZRA 1WBNA 2J0MB 3FPMA 3HAMA 4ZY4A 3FY0A 3Q9XA 4F0IA 3R8PA 5L8JA 3Q6UA 5EYKA 4O7RA 4GT3A 4L45A 4MH7A 4G17A 2JDTA 4KIKA 5M4UA 1H1QA 4DITA 4EZ5A 3ORNA 4U7ZA 2XNNA 3L9LA 2OJJA 3OW3A 3PVBA 4JDJA 1H00A 3SC1A 4F6WA 4MNEA 5CAOA 4IXPA 4UWYA 5C4LA 3JUHA 2CLQA 3OXIA 4D1SA 3FZTA 4IWDA 3F2NA 5I9WA 3RWQA 4DEGA 2ZB0A 4IW0A 3PDTA 5FXRA 4K18A 3EOCA 3IKAA 5ETFA 5LVOA 3SXRA 2QCSA 3V8TA 5AR3A 4GIIA 3H30A 2GSFA 4FTAA 3WYXA 1PXJA 2C6OA 3WARA 3A7GA 4O0RA 1NVQA 5EI6A 3WIGA 1WCCA 3R1NA 5KX8A 2H6DA 2OK1A 5CXZA 4U80A 5DRDA 1JSVA 5M56A 2Z8CA 2CN5A 3PJ2A 3NGAA 5CQUA 2CN8A 3UE4A 3MWUA 4OR5A 1H27A 3KU2A 3NIEA 4X3FA 3R8ZA 5EI8A 3OCTA 4O7YA 2P0CA 3GP0A 4JG6A 2E9UA 5CASA 2O5KA 1BX6A 2VV9A 2VZ6A 2XKDA 3QTXA 4GS6A 4QMVA 5EQYA 1Y8GA 3QKLA 1ND4A 3TIYA 1Q24A 2WZJA 4LGDA 3MDYA 1FINA 2RKUA 3AD4A 3R7VA 1XH7A 4GU9A 3VUMA 1L8TA 2I0VA 4FNYA 2XK7A 2JAMA 3BHVA 3VHEA 3ANQA 5M55A 2Y4PA 2R3JA 3LFNA 3MJ2A 3VWAA 1W82A 2VTRA 5AIRA 4JBPA 5GJFA 2E9OA 5HEZA 4BB4A 4BDKA 4BCFA 5CF5A 4CG9A 2QURA 1PMUA 1BL6A 4BHNA 2HWPA 3OF0A 5C03A 5AUXA 4L3PA 2XZSA 2H8HA 4RIYA 5CU4A 5LMAA 5IA2A 3A60A 4FT7A 3P7AA 5FBNC 5JQ5A 5FDXA 5DI1A 3BQRA 4G6LA 3PE1A 3ORTA 1KE9A 2J5EA 4MD7E 2QHNA 4GV1A 3V5JA 1PXOA 3P23A 4P7EA 3RVGA 4AN9A 4QMTA 3C51A 2A27A 1E1VA 3D7TA 5LMBA 4QMZA 3DAKA 4ZZMA 2JDOA 3D9VA 3O23A 2EB3A 3ZU7A 4QMQA 3P86A 4C0TA 3Q6WA 1SMHA 4CXAA 4CV9A 4EOMA 4I4EA 5BMSA 3KXXA 3G2FA 4AGCA 3RKBA 1Y91A 4DT9A 2J7TA 3QLGA 1OM1A 5EOLA 1XHAA 3M2WA 4G31A 2ITQA 4F08A 1FGIA 3CCNA 1BL7A 2R3HA 3AMAA 4MWHA 2HY0A 1Q61A 2PUUA 2WKMA 3EFJA 5IUIA 1GZKA 2C6EA 3FQEA 4OAUC 1A48A 1BI8A 4RA5A 4EH2A 5AV0A 3N9XA 4IAZA 2WD1A 5M4CA 1LUFA 2IVSA 3O7LD 4YJTA 4AXAA 1GAGA 1XR1A 4OBOA 2P3GX 4QPSA 1H26A 4LRMA 2ITNA 4QTAA 1YDRE 2O3PA 4U8ZA 3GB2A 3ZEWA 5K9IA 3MH2A 3PA5A 2BALA 4HJOA 4FBXA 3BI6A 3F3ZA 3QTIA 4IDVA 4ZJIA 3TUCA 1UA2A 3II5A 1V0OA 1GIJA 4HGTA 5I9XA 2VTMA 4FT5A 3ZXTA 2YFXA 3D2KA 5F1ZA 3VS0A 3TXOA 2A0CX 3EL8A 3HV3A 4FV4A 4OTHA 4EC8A 3DCVA 4ENYA 3PIZA 5LARA 5IUHA 2NRUA 5AP3A 2YJRA 4FTLA 5EKOA 4QPAA 4FTRA 4CCUA 4E4XA 2ZB1A 4FTQA 1KOBA 2CNQA 2QOCA 4YJOA 3RCDA 3QHWA 3ENMA 5KCVA 1W7HA 4O0SA 4OT5A 3VQHA 4RMZA 4EBWA 2UW0A 2UZOA 4W4VA 2Y6OA 3PWDA 2WTJA 3C0IA 4FV6A 3VS6A 5DEWA 2W1ZA 3I60A 4E3CA 3E64A 3PA4A 4F4PA 4DEDA 3EKNA 4OT6A 1OL2A 4DG0E 3FLYA 3LQ3A 1PW2A 1YHSA 3F3WA 2JIUA 4L53A 2OW3A 4EUTA 4X2JA 5FEDA 4I41A 4OTRA 4WSQA 5HBJA 3QUDA 5IISA 2WMBA 2VTIA 5IA3A 4DGOA 4FKQA 2UZTA 3BLHA 3ZRMA 1UU7A 4YJSA 4UMTA 5C4KA 4DINA 5BVNA 3ITZA 3LMHA 4L68A 1SM2A 2W06A 4ZIMA 2FH9A 2GHGA 2X39A 3ORIA 5KHXA 1G8AA 4AW5A 5J8IA 1B39A 5BMMA 1DI9A 2QO9A 4O0VA 5TF9A 5FP5A 1J3HA 3GI3A 4C35A 4WBBB 3AT2A 1ZOHA 2RGPA 5FBOA 2F49A 2YEXA 3AOXA 4XOYA 5A3XA 3VO3A 4B6LA 1QPJA 5L2TA 3LLAA 4F9YA 2FVDA 4FVRA 3BV3A 5AUUA 3PZHA 3GU6A 1YWNA 1JVPP 3MFTA 3P4KA 2Z02A 3QFVA 3KRRA 5J79A 3ZMMA 2RFEA 3VN9A 2YIQA 3I0OA 5L8KA 1GOLA 4IMYA 4E4MA 4CFMA 3QL8A 1PXNA 2W5AA 4UMRA 5HHWA 3E8DA 4X2GA 3QTZA 5ITAA 4DEEA 2V7OA 3CKWA 4D2TA 4NW5A 4U42A 2PVFA 5AR7A 3U4UA 2WU6A 4FK3A 4FEXA 1JAMA 4MF0A 4ANSA 4OAVB 3QRTA 3I6UA 3DZOA 1IAJA 3W2PA 5AM7A 3QXPA 4N70A 2GNLA 5FQDC 3LFQA 4XP0A 3IGOA 3QQGA 4IAYA 2PZPA 3PWYA 3EN6A 5DT4A 1S9IA 2YABA 4IVAA 4RQVA 2PUIA 1WBVA 4IX6A 2XVDA 2C3KA 4DG3E 5CZIA 2ZM4A 3LCDA 3NAXA 3NYXA 4U9AA 3KMUA 4MBJA 2UW7A 5HU9A 5J7HA 3AC5A 3B2WA 3DGKA 2P2IA 2QG7A 3LZBA 5E8SA 4C61A 2YM5A 1MQ4A 3PXKA 2XBJA 3NNWA 2FA2A 3DFCB 4GK4A 2WMQA 3VS2A 3W2SA 4CEGA 3KMMA 4ANNA 5GIPE 3TIZA 3UMWA 3VUTA 2WAJA 4CFUA 1VYWA 2UVZA 3KF4A 4FUXA 3VS7A 2B9JA 4EKLA 5JKGA 2OF2A 4C37A 4YURA 3OROA 3HA6A 1ZMVA 2F9GA 2W1EA 4EQMA 1BYGA 4JBOA 4XV9A 1XBBA 5AAEA 2PE1A 3BBWA 4O7WA 2X1NA 5J95A 3QCXA 2XS0A 4USEA 3TZ9A 3H3CA 4CSVA 3GCQA 5ACBC 3PJCA 3CBLA 2J9MA 4JG7A 2JGZA 4KWPA 4K0YA 2W0JA 4BYJA 4UV0A 3UO4A 3G6HA 3S95A 4RIXB 4YC8A 1A9UA 2PMLX 5I3OA 3ZS5A 4RIOA 1ZAOA 4AW0A 4IVCA 2BFYA 4OTWA 2UVXA 1TQIA 4FKVA 4G5PA 2YWVA 2YLFA 3BWFA 3DKCA 5A4CA 1JSUA 2G01A 2PVHA 4B9DA 4FZDB 2YDKA 5HNGA 2BRMA 1MRVA 2WEVA 4BDFA 2OO8X 3N4TA 1JKLA 4RJ6A 2PVYA 3T3UA 3KK8A 4AW2A 4C34A 2ZM1A 3LOKA 3BGPA 2HCKA 3Q5ZA 4D28A 5LCJA 4XG8A 3W32A 3TI1A 5EHYA 3ZBXA 3GBZA 3IW8A 4KKHA 3VBQA 3LM0A 5KHWA 3O51A 1OPKA 4RJ7A 4NSTA 4Y5QA 1U5QA 3HMNA 5GIOE 4FICA 4AOJA 3NR9A 2V62A 2X2KA 4PP9A 4N4SA 4O7VA 3MTFA 4ACGA 3FXZA 2WHBA 4FSYA 4AT3A 3FHRA 3IS5A 1UU9A 4BKZA 4LRJA 3GOPA 3RM7A 5HD4A 5K4IA 3DKGA 1KV1A 1PRYA 5IQAA 5IEYA 1MRYA 3PVWA 4LFIA 5EYCA 4YZDA 2WMAA 3OG7A 3DDPA 3TG1A 2W5BA 1K3AA 2VAGA 3E92A 1MQBA 4I5CA 4IAFA 4RFYA 4EUUA 5KKRC 3U51A 1B38A 3V5PA 3O71A 3QQJA 4QP9A 4S30A 1QPCA 3R30A 3ZDUA 2WO6A 4IB0A 1ZMUA 1R39A 3MY5A 5DIAA 5BYZA 4CMTA 4YJNA 5T6KA 4FODA 4HVHA 4H1MA 5TOZA 4XG7A 3KXZA 2XM9A 3EKKA 4CRSA 2IJMA 4UMPA 3CXWA 4DLIA 4QMLA 5HU3A 3LLTA 3TTJA 3RP9A 1VJYA 3U6HA 1OIUA 4ALUA 3FLQA 3V6SA 5HGIA 2QVSE 5BYYA 4IAKA 4RWLA 4FOCA 5H3QA 4RG0A 1WVWA 4YNOA 4JDKA 4FIGA 4KKGA 4FGBA 4L46A 1Q8ZA 1O9UA 3AGLA 2V22A 3PXZA 4EYJA 5J9LA 2ETRA 3H9OA 3NUUA 5KZ0A 3G0FA 4PNKA 4RA4A 3EQCA 2WMSA 3DPKA 2HXQA 2P55A 3FSKA 3PPZA 1DAWA 3QUEA 4Y73A 2CCIA 4RT7A 4BCMA 5M4IA 3KFAA 5FP6A 2ETMA 3W2OA 2GNHA 5CX9A 2UZVA 3F82A 1WMKA 3UQGA 2W05A 4IJPA 4EOIA 2R3QA 4M69B 1OKWA 3R7GA 3FZRA 4JBQA 5FRIA 3CD3A 5KZIA 4ACHA 2ZMCA 3DB8A 3FQHA 4V0GA 4YZNA 4YMJA 4J95A 4RJ3A 4AFEA 5IMXA 4YJVA 4BCJA 4UXQA 4KS8A 4AAAA 1REJA 5FXSA 4C4EA 4CTCA 5J1WA 1SNXA 1H4LA 4FTJA 3OMVA 1YW2A 3DQXA 2G1TA 2IW6A 2C6MA 3KXNA 4FKIA 4TWOA 2C6KA 4L67A 2W1FA 3Q9ZA 4EK3A 3EMGA 4E93A 5LMKA 1G5SA 2JIVA 1DAYA 4AT4A 5AA9A 2X4ZA 4Y8DA 4B4LA 3BLRA 2C0OA 4LG4A 3ZO4A 4YTFA 3VBXA 4PV0A 4DFBA 4QP8A 4MCVA 4M66A 5ANEA 2VWIA 3ORZA 3V04A 4CV8A 2UW5A 1UV5A 3MYGA 5L2WA 3BU6A 4D58A 2YCQA 4I94A 4OW8A 5AP6A 3PIXA 1KUTA 4GJ3A 5GNKA 4E6QA 3R21A 5JFXA 3OOMA 4ZLYA 4F6UA 4GCJA 3IDCA 3DDQA 4QNAA 2PUNA 4M8TA 5CSVA 2XEYA 4AOIA 2VTNA 1J1BA 4CMOA 3R83A 2Z7RA 4EK6A 5CAUA 4JOAA 2QONA 4QOXA 3R0TA 3PRFA 1KV2A 3RHKA 3W55A 5CT7A 4B99A 3ZUTA 1KE6A 2J6MA 3JPVA 2WQEA 4D9TA 3MB7A 3FC1X 4KBCA 2QR8A 4O22A 4Z7GA 4M97A 3M11A 3NW5A 2ITOA 2PTKA 4FKOA 1E9HA 1P14A 4BBMA 1OL6A 4ITJA 2QU5A 2XJ0A 3L1SA 4AOTA 2OZAB 4DYMA 4FMQA 3VHKA 3CIKA 2Y6MA 2YM6A 4M84A 2ITTA 5T68A 1K9AA 2BAJA 4BCIA 5LMKC 4XH6A 3ULIA 4HPUE 4LV8A 4J99A 4J8NA 3TN8A 3ELJA 3ZH8A 4XS2A 4AF3A 4C33A 2OI4X 1YOLA 3NIZA 4MD8E 2JEDA 1UU3A 2CGWA 3KULB 2VWBA 3PG3A 4PL4A 3CGFA 3RINA 2Q83A 3NUAA 3DT1A 3MIAA 4I0SA 2VTSA 5B2LA 3V51A 3RK9A 3KGAA 2YLEA 5E9EA 1IA8A 5J87A 4YJQA 2I1MA 4OTQA 4IC8A 3NNUA 1PF8A 2JBPA 5BVWA 1B6CB 2UW6A 4YSMA 5A4QA 4ZMFA 3MIYA 4I6FA 2WMTA 4RVMA 4XG4A 5AX9A 2WQOA 1H0WA 2IVVA 3BEGA 3VJOA 4W4XA 2DS1A 1H1WA 3UTOA 1R0PA 2YDJA 3JYAA 4HCVA 3TACA 4BC6A 5A4LA 4BDJA 5GJDA 1WVYA 3M1SA 4YZ9A 4AZEA 3Q2JA 4RIXA 3BQCA 4Y95A 5HD7A 5HG5A 3CSVA 4XMOA 1ZLTA 1YXXA 3K3JA 2ITPA 3ZTXA 4M0YA 4H3BA 1OL5A 4Z7HA 2YM8A 3UOLA 2QOBA 3TWJA 4CKJA 4FC0A 1IRKA 4QT1A 5IEXA 4BBEA 4D2VA 3MY1A 3UDBA 1BUHA 3U55A 2J0IA 3EIDA 3P9JA 4NL0A 3LAUA 4R3PA 5C01A 4IFGA 4C38A 3N51A 4JQ8A 5DGZA 2HELA 3SW4A 5I9VA 5GZ8A 3DXPA 3COKA 4LOPA 4L52A 3S0OA 4MXAA 5DBXA 2WEIA 1KSWA 4RX7A 5E8WA 4UY9A 3HRBA 4UXLA 4AUAA 2OZOA 2YM4A 3QX4A 3IECA 4JL9A 4DF3A 1PMEA 5C8NA 5CENA 5FXQA 2O65A 3Q52A 1OPLA 4U44A 1H1PA 2C1BA 3R9HA 4AZSA 2BKKA 3FMKA 4S33A 3IK3A 3MY0A 4TN6A 3FSFA 4LRKA 1U54B 1JNKA 4DBNA 4K2RA 3R7UA 4M12A 2XK4A 4W8DA 4F9AA 3LIJA 3KQ7A 4I22A 2QC6A 2OIBA 4ACCA 4E5BA 4BKJA 2ITYA 5FD2A 3CTJA 2OJGA 2UZBA 4M3QA 5KMNA 3EQBA 2F2CB 3LFFA 2OH4A 3VBTA 3NCGA 5AUWA 2HXLA 4BCKA 4EEVA 3SAYA 4Y72A 5D7VA 1G3NA 2PSQA 4OGRA 1QCFA 4QTBA 1OL1A 1PKDA 3ORMA 4O38A 2FYSA 5KMJA 3IW4A 4JS8A 1YHVA 2GPHA 5IH4A 3I6WA 4EOKA 2PVMA 3EYGA 3EZVA 4S2ZA 3C4FA 4FV5A 2VTHA 2ZV7A 3MH1A 2X8DA 5HE2A 3RZBA 3UGCA 5TKDA 5E8UA 4BRXA 4JRVA 3IQ7A 4C3RA 5IA1A 4AU8A 4D2WA 4F1MA 3FI4A 3L8PA 1M17A 5AADA 5HQ0A 4YUQA 1IG1A 3QZIA 3CPBA 2WELA 4IDTA 4FIJA 4HYIA 3BGQA 1JPAA 4TNBA 3ODYX 3OW4A 3REPA 1CTPE 4DCEA 4X2NA 4EWHA 4DEIA 4EZ7A 4F63A 4LOOA 4J52A 3ZUUA 2V7AA 1OVEA 4M69A 1M52A 2AUHA 4UWCA 3T3VA 3PFQA 4CKRA 5CVHA 5BYLA 3G90X 3LJ0A 4FKPA 4G9CA 2QKRA 3TV6A 2GCDA 3A2CA 1SNUA 4MKCA 5CVGA 3TNWA 4BDHA 4F70A 4CFXA 3UIXA 4C58A 2BR1A 1YKRA 4IB3A 2YIRA 4O0YA 2QI8A 4LUDA 5BPYA 4G9RA 3EQDA 3F6XA 3OY1A 2RFSA 5EM7A 5DT0A 4AP7A 3HA8A 1ZARA 3DK7A 4ZOGA 3GT8A 5KMLA 2BPMA 3HYHA 5EYMA 3G33A 4UALA 3V5TA 3F5GA 1PXLA 5TO8A 3AT4A 4U40A 4BGQA 3EFKA 4C4JA 3UIMA 3P7BA 4P5ZA 4XG3A 4HVGA 3WF9A 3I4BA 3IOKA 3UJGA 1F3MC 4A07A 2LGCA 4ZY5A 3GFWA 5E1SA 1GIIA 5K5XA 5AV1A 3G51A 4UZDA 4YPDA 1XBCA 4DTBA 3R9RA 3I1AA 3KRXA 3KVWA 5IA5A 4XLIA 3LFAA 2Y9QA 2BRGA 4BZNA 3G15A 3R7YA 3QA0A 4QMNA 3WZKA 3SG8A 4FKSA 1DI8A 3CD8A 2PULA 4NFNA 5DNRA 3DS6A 5JRSA 4APCA 4TNDA 4O7ZA 5FUTA 3L9NA 3P79A 2KULA 4IH8A 2XNGA 4RFZA 5HO8A 3GCVA 3GFEA 4KABA 4RWJA 4Y5HA 3PY0A 2C3IB 4PMPA 4BI1A 2VTLA 2IVTA 2BTRA 1BLXA 2HYYA 4Z3VA 3FWQA 4C02A 2HZNA 5HTCA 4K9YA 4HCTA 3ZC6A 3GQLA 3OXTA 4XRJA 2WTVA 5AUTA 2GS2A 2W9ZB 3PA3A 2OZAA 2UZWE 4RWKA 4ZS4A 2VUWA 2XYNA 3P08A 2BAQA 4FV9A 5DYJA 2VGPA 4DE4A 4BWXA 3QUPA 2B0QA 1PY5A 4ZTMA 3EJ1A 1Z57A 3SLSA 4ZSAA 5HIEA 2XRWA 5IQIA 4P2KA 3Q96A 3RZFA 4WA9A 2GFSA 1OPJA 1JQHA 4XCUA 5FTGA 3GU7A 3KULA 3C5UA 4CD0A 3OTUA 5L3AA 4FEVA 1UNHA 3CKXA 1GZNA 2CKOA 5IDPA 3OFMA 1BKXA 1ZYLA 3KCKA 1YWVA 4EL9A 4AGWA 4PMTA 2PZRA 4MQ2A 3FMMA 2CNVA 4CT2A 4FNXA 4JR7A 2BRHA 2GQSA 2RIOA 1P4FA 3DZQA 4WKQA 2XIRA 2XM8A 1APME 4IQ6A 2FB8A 4DFYA 4RC3A 4O0WA 3PG1A 5KKRB 1STCE 3D94A 3RMFA 2BZIB 5KMIA 2W17A 3KXGA 5IQBA 4JAIA 4FKLA 2P33A 3A8XA 4C8BA 4CYIA 5E8VA 1FMKA 4K6ZA 3C4WA 4DFUA 2Y8OA 3QX2A 3EN7A 4A9TA 3O2MA 4OTIA 3S2PA 5HZNA 3CE3A 2OICA 3QC4A 3W2RA 2ONLA 2PZIA 3ZRKA 3QTSA 4YU2A 3OXZA 4M68A 3K5VA 2WPAA 3WE4A 4P5QA 1REKA 4QP4A 5BVOA 1QPEA 5JFVA 5KMKA 3FC2A 3BU3A 4BICA 3CGOA 2JDRA 4V01A 3F3VA 4L43A 4M67A 3VUIA 5HO7A 3NDMA 3ULZA 4O6LA 1FBNA 3F88A 4O0UA 2PU8A 1UWJA 5I9YA 2REIA 2HY81 4TWNA 5AP4A 4F64A 3I81A 4FTTA 4L01A 2JDSA 4EONA 3U9NA 3KL8A 3Q5IA 3OWJA 2RFDA 3QTQA 4LQMA 3BRBA 1T46A 2XUUA 5EHLA 4NWMA 4CT1A 4O2PA 3UZPA 3RM6A 4RZVA 5DG5A 2WOTA 4KIOA 4F6SA 3WE8A 4LGHA 3SX9A 2OFUA 3RHXA 2XYUA 1U54A 3FZSA 2XEZA 3C9WA 2O63A 5M44A 4FEUA 4G3GA 2QOLA 4TT7A 5JRQA 4YHFA 3S00A 3D15A 3LM5A 4NJ3A 1ZYCA 5E8YA 4IB1A 4HZSA 3EQFA 4BN1A 2WTKC 1U46A 3ZLXA 1JKKA 1OB3A 2QOFA 4FVQA 4CRLA 1OECA 4AGUA 3CTHA 4DGNA 4IM0A 4Q9ZA 4W4YA 4FZFB 4KBAA 1YXTA 5A54A 2OJIA 1J7IA 3E88A 4UX9A 2ONLC 5ANKA 2JKMA 2CDZA 2HZIA 2GHMA 3NWWA 3V8WA 4CFFA 2AC3A 4EZ3A 4WG4A 1J7UA 4U81A 4PMMA 5DR9A 4I23A 5BVDA 3BGZA 5D1JA 5DWRA 3DJ7A 4CMUA 4GFMA 4F99A 2IZTA 4TTHB 2G15A 1RQQA 2YM7A 3ACJA 3QD4A 2W99B 3V5WA 1FOTA 3PP1A 3FL4A 4WOVA 4BDBA 2XNMA 5IEVA 4O83A 3D5WA 2F7ZE 3UIBA 3UBDA 4EBVA 5BVFA 2ZJWA 4DH8A 4GIHA 3AD5A 3QTRA 3DXNA 4LGGA 4WT6A 1ZXEA 3D5UA 4FTUA 3UQFA 1ZY4A 1MRUA 1YI3A 3GEQA 3RK5A 4BDEA 1OBGA 5CT0A 3QAME 3OCBA 5HESA 3SV0A 3RPVA 2GFCA 2XK6A 1FGKA 4FF8A 1PXKA 3O96A 1R1WA 3QRKA 1H24A 2X4FA 4YBJA 4ZTLA 4HW7A 4LV5A 4GG7A 4NM0A 4G16A 4EJ7A 3CQWA 4OTDA 2YIWA 5M51A 4CCBA 1NVSA 2BRNA 3DBCA 2CLXA 4BDDA 2PK9A 5LWNA 3R1QA 4OBQA 1WBOA 2XA4A 4FKTA 1Q41A 5CSHA 4RBLA 4L8MA 4BTFA 5JQ8A 5KMMA 4EK5A 3HKOA 2QO2A 3E3BX 3PP0A 3PTGA 3MPAA 4MVFA 4W4WA 3UVRA 4L9IA 4WUNA 4AZTA 2W1GA 1X8BA 3FXWA 2CHLA 3L9PA 2XBAA 3CLYA 3IW5A 4G3FA 4JT3A 1ZZLA 2QU6A 4JQ7A 2HZ4A 4Q9SA 2PWLA 4F9CA 4USFA 5KE0A 2UW9A 3PYYA 1XH5A 4EQCA 5DH3A 3ZSHA 5DMZA 3OWPA 4GFOA 3FYKX 2X7FA 1YXVA 3BCEA 5EDPA 4RRVA 4LL0A 4FNZA 5FTQA 2X0GA 3UOKA 4ZP5A 4F0GA 1PYEA 4LM5A 5DR6A 5HE1A 4FEWA 5CXHA 3UPXA 2V5QA 3WZEA 2ZMDA 4FSTA 5AAGA 3P0MA 4R7HA 2WQMA 5IH5A 1ZYJA 5HE0A 3HP5A 3EN4A 3PVUA 2FUMA 5EYDA 2RFNA 4H1JA 4DGMA 2JAVA 3VW6A 1Q99A 4ZLZA 3LFCA 3NUXA 2HAKA 4LYNA 1DM2A 4KBKA 4PQNA 2W7XA 2X2LA 3F2AA 3E7OA 3NVKI 4O96A 4ZEGA 1YVJA 3CJGA 3U9CA 4O27B 3E8NA 3MH3A 1Q8YA 5LCKA 4GG5A 4ANBA 4D2RA 2H34A 4ZLOA 1LP4A 4YJRA 4N6YA 5HKMA 3IDPA 4XHKB 3HX4A 1XQZA 2XKEA 3QC9A 1HCLA 1P2AA 4F1TA 4QQTA 1FVRA 3D4QA 5DE2A 4BI2A 4DHFA 4BY9E 5HG8A 3HZTA 2G2HA 3MTLA 3R2BA 5CANA 2DUVA 1A06A 1EH4A 1TVOA 3NNVA 3ID6C 4ZTSA 4A4XA 2B9FA 3PY1A 1H28A 1M7QA 3LCTA 4Y85A 2JFLA 4FUYA 4J7BA 3Q4TA 1Z9XA 1XBAA 3FY2A 4PDOA 4JIAA 3SVVA 3PE2A 2PVRA 4L3LA 3C4CA 4U0IA 3ACKA 4N57A 5DFPA 4PL5A 3FKLA 3VRYA 4QYFA 3GXLA 1ERKA 4QP2A 4G6OA 5ANOA 3BHHA 3FV8A 4IJ9A 3Q4ZA 4IM2A 3LCOA 4JX7A 4BFMA 4BIEA 5I9ZA 3H9RA 3FZ1A 2EUFB 4UYAA 4C4IA 3R9DA 4C2VA 4PTEA 3KXMA 3CEKA 4CFNA 2PYWA 4IX4A 4AZWA 1KWPA 1Y6BA 3DV3A 1FQ1B 4TWPA 4FR4A 4EHZA 3ALOA 4O86A 3OOGA 3ZZWA 4BDAA 3JY0A 3MPTA 3O50A 3O7LB 4QQJA 5EG3A 3JVSA 4AE6A 4BDCA 3AC2A 5JK3A 3W16A 2EXMA 2B4SB 1QPDA 2H9VA 3EFLA 5J9ZA 4YHTA 4AA5A 4N0SA 5A14A 2BAKA 4S32A 4RVKA 2F57A 2BDFA 2EXEA 3KB7A 1W84A 5L6PA 4PDYA 4MXCA 3BX5A 4J97A 4QPMA 3TV4A 4G3EA 1RJBA 4AN2A 2ZV9A 3MFSA 4HGEA 4WHZA 5EI2A 2RL5A 3ZO2A 5FEQA 5IPJA 5L6WL 4K11A 4QD6A 3SOAA 4EORA 4DA5A 4FT0A 3SD0A 4BVUA 4E4NA 4O81A 4D1ZA 2XCHA 4C2WA 4PTCA 3RNYA 1PXMA 4A06A 4EH5A 3SA0A 2E9VA 1SVHA 2XF0A 3SRVB 4FI1A 2GMXA 4MBLA 1J7LA 3OEZA 4RSSA 4QMOA 2JC6A 2VWWA 3CR0A 4M14A 2NO3A 1M7NA 2XK9A 3A62A 3Q9WA 3QCQA 4YLLA 3W1FA 3LQ8A 3PLSA 4FSNA 3ZO1A 4A9UA 4E4LA 4D1XA 3NEWA 3TDWA 1SVGA 5AUVA 5HX6A 3GC8A 3R7IA 2BZHB 3EWHA 4NH1A 3BPRA 4OTPA 4HOKA 3DLZA 3A7JA 3QLFA 3UZRA 4E6DA 4RX5A 4KRDA 3PIYA 3ZHPC 3EQGA 3RAKA 3BYSA 3E8CA 3ZLSA 3IW6A 4XJ0A 4D4VA 4EH9A 5EW8A 5AR2A 5GINE 2WMWA 4EH3A 2XNEA 2R3RA 3Q4CA 4DFZE 4OTFA 1URCA 2XIZA 3V6RA 2X6EA 3VULA 1IAHA 5EW9A 3BEAA 2YZAA 4M0ZA 5AV3A 2UW3A 3QYZA 4KINA 4N6ZA 4BZOA 1VEBA 3SOCA 5CF8A 2SRCA 3TM0A 2VTAA 4GYIA 3VBWA 4RLKA 3P78A 3C4XA 2UUEA 4PTGA 2P2HA 1J1CA 1WBPA 3ZSIA 4X6QC 4YZBA 4ZZNA 2VU3A 3K3IA 4BI0A 2GNJA 4BDGA 2HOGA 4IZ5A 4AGDA 2O0UA 3VUDA 5E92A 4I6BA 2JFMA 1OBDA 4BGGA 2QODA 3L8SA 3SW7A 1M14A 4DLJA 5EDRA 3DU8A 3PJ8A 4KB8A 4G1WA 5M53A 2VN9A 3AG9A 4I4FA 5DEYA 3NUYA 2IO6A 4TYIA 1AQ1A 5EDQA 4CQEA 2JLDA 2QLQA 3LJ2A 4B8MA 3RTPA 3VUHA 5FGKA 3DJ6A 4AQCA 3E87A 5HNBA 4BBFA 4DEHA 4EHEA 4QTEA 4L00A 2BROA 4BWPA 3KN5A 3KA0A 3LMIA 2WIPA 3O8TA 3C1XA 5HVYA 2WTDA 5F94A 4I0TA 4NYEA 5JT2A 3Q32A 4O0XA 4U6RA 4CGAA 2BMCA 3A99A 2B54A 3NYVA 2YCFA 3IONA 3THBA 4XYFA 5A46A 2I0YA 3VIDA 3TDVA 2AYPA 4L7FA 5CQWA 2HZ0A 2ETKA 4YC3A 4B0GA 5ETAA 1R78A 1JKSA 5CYIA 5M06A 2C0TA 5IDNA 3QU0A 3HRCA 3Q04A 4MXZA 4WRSA 1CM8A 4OTGA 3R8UA 3R8VA 4H58A 4EK4A 4ZJVA 2B7AA 3EQHA 3R1SA 1OUKA 3MFUA 4YJPA 2GTNA 4QYEA 2GHLA 4J98A 3WF8A 4DFNA 4TZRA 1SZMA 5FTOA 5CEMA 5JH6A 3UNKA 5AP5A 3H4JA 1CDKA 3DQWA 5EKNA 5LWMA 3WBLA 3LW0A 2UZUE 3F7ZA 3KKVA 3BZ3A 5EOBA 4RWIA 1CMKE 2RG5A 1P5EA 1NW1A 4R1YA 5F20A 1YWRA 3E5AA 4FIEA 3DK3A 4G3CA 3HNGA 4ZK5A 2QOKA 2YM3A 5A6OA 3OCGA 2OG8A 5IZFA 4BGHA 3ZXZA 2C68A 3OWKA 3ZLWA 4OBPA 5HCZA 4FIFA 2C0IA 4U43A 4I5MA 4S34A 3RPYA 4I6HA 4GK2A 1Y57A 4XLVA 1Q3WA 2YIYA 3DK6A 2QOHA 3UYTA 4ERWA 5LJJA 2UW8A 3OD6X 5IUGA 4WIHA 3FZPA 5H8BA 1WVXA 4HVIA 3MB6A 5M4FA 4JR3A 2PMOX 5CY3A 4O7NA 3NUPA 5HICA 3NYOA 3HAVA 3H9FA 5JGBA 2A19B 3EB0A 4AA4A 5HOAA 3MV5A 4LL5A 4JNWA 5CLPA 3RAWA 4B7TA 3QF9A 2V55A 3QZGA 3GNIB 1FVTA 4NTTA 1I09A 3BYVA 4DGLC 4YTCA 2JKKA 1H1RA 3SHEA 4GEOA 4YZCA 2BZKB 3QHRA 5K0KA 3Q3BA 3W10A 1YDTE 3UQCA 2R3MA 4FTOA 4FTKA 2QO7A 2VTTA 1J91A 1QL6A 3MS9A 4MF1A 5AP0A 5M57A 3TUBA 3HMPA 4UB7A 3AC1A 4YP8A 4Q5HA 4GUBA 4WO5A 4TWCA 3WF6A 2PVNA 5DR2A 3FXXA 4IBMA 3RCJA 3QRJA 3UVPA 4NKAA 2Z7QA 3AC8A 2YHVA 3DNEA 3G9NA 4WRGA 3VF8A 1Y8YA 1YDSE 3L8VA 4XV1A 3TNHA 1XH4A 4J71A 4XEYA 3KEXA 4IM3A 2VGOA 4U3YA 3E93A 4D4RA 4DFLA 4CZUA 4HNIA 4EH6A 1UNLA 2OU7A 2HENA 1RE8A 1RW8A 3ROYA 3G5DA 3I7BA 4BZDA 2WTKB 3C5IA 4FL3A 4G34A 5IKWA 3AC3A 3NX8A 3PJ1A 4C62A 1V0PA 4FG8A 5JN2A 3VBVA 1AGWA 2CNUA 4NJDA 3SKCA 1MP8A 1F5QA 4HCUA 5CSXA 4AWIA 3UO6A 2PUPA 2BILB 2I40A 5CEIA 4ENXA 2WMRA 4W9XA 5EK7A 4V04A 3QGWA 3F5PA 3NMUF 4FNWA 2G2FA 4E8AA 3QA8A 4JAJA 2WOUA 2C6TA 3HMIA 3PY3A 3ZONA 3CY3A 5HG9A 5LVNA 4IC7A 4KRCA 3G6GA 4F9WA 2WMXA 3MGYA 3UP7A 2G9XA 5CU2A 2J51A 1XWSA 5C26A 4BCGA 5BNJA 5J9YA 3MA6A 1GY3A 4ZSGA 3SXFA 3HDMA 2I7QA 1YI4A 4XBUA 3LCKA 3C4ZA 3SRVA 3DAEA 4X0MA 4ZAUA 2C5NA 3D7ZA 3UC4A 1LR4A 5CAQA 3E63A 3COIA 3FKNA 4EH4A 5AM6A 3QWJA 4I93A 4R3CA 4R7BA 4RVLA 5B7VA 3LKMA 4GU6A 5AV2A 3EL7A 4ARKA 3LJ1A 4IB5A 3UO5A 1SYKA 2C3JA 2H96A 2HIWA 1W8CA 4FSRA 2VX3A 2IN6A 2B53A 2WFYA 3EZRA 2PE2A 3BWJA 3QQHA 2Q0BA 5CAPA 4RJ4A 2R3GA 2R4BA 3NUNA 3F69A 2ESMA 4FSQA 4KIQA 3HV5A 3QZFA 2OIDA 2R64A 3UOHA 4AACA 4CLIA 5ANIA 1WBTA 2BTSA 2R3PA 2VNWA 2J0LA 3F61A 3MH0A 4FK6A 4U97A 4TYHB 3RNIA 2UV2A 4BHZA 3Q9YA 4RX9A 3MA3A 3UZTA 3E62A 5C27A 4M7IA 3R7OA 4I24A 3SDJA 2VO6A 1IASA 2R3LA 3KK9A 4XP3A 4AT5A 3CP9A 3POOA 4ORKA 5AWMA 2OBJA 3D5VA 3T9TA 3PJ3A 4USDA 2ITXA 1O6LA 3PXRA 4FTIA 4KNBA 2W9FB 5HTIA 1NY3A 3HV6A 3FKOA 2PZ5A 3UMXA 5I0BA 3EQPA 4ZTQA 3V01A 5CEQA 2YAKA 5FEEA 3OWLA 3OVVA 4L6QA 3HGKA 4ZTHA 3OTVA 4L3JA 4ZXTA 5AIKA 1VZOA 4GL9A 3SGCA 4ANOA 3R02A 1UWHA 2CGUA 4K8AA 2R3FA 3IGGA 5EFQA 4BTKA 4J53A 5DHJA 4NUSA 3ZLYA 1PYXA 2PL0A 4FYNA 4MQ1A 2XJ2A 4YJUA 3UNJA 3BHUA 1ZOGA 3VUGA 4GK3A 3MJ1A 1ZY5A 1GNGA 5A4EA 4TL0A 2OIQA 4TW9A 4CG8A 4NCTC 3P1AA 3R71A 4XG2A 4DAWA 2B55A 1VR2A 3VJNA 5BUIA 2C3LA 4J1RA 2W4JA 4EOSA 5DA3A 3W2CA 4KA3A 5K0XA 1SVEA 2YIXA 3OY3A 3QKMA 4HYUA 3D14A 4E5WA 4ZMEA 3BYUA 4F65A 3ZYAA 3DJ5A 5I9UA 3UYSA 4FSMA 1KE8A 3MI9A 2ITZA 3ZFYA 5I3RA 3VUKA 3QKKA 4O6EA 4DC2A 3R2YA 1JKTA 5LOHA 3CC6A 4IZ7A 3DFAA 2WMUA 1W83A 3P7CA 2F4JA 3B8QA 4YC6A 3A8WA 3CY2A 3C0HA 3N4VA 3ODZX 1YOMA 4UYNA 3MPMA 4H05A 5J7BA 1OGUA 5HG7A 1M2RA 4K33A 2X8IA 4IVDA 3TEIA 3DBEA 2ERKA 5AJQA 3IOPA 5FG8A 3ZOSA 4DH7A 5CSPA 3R9NA 2OXYA 2HW6A 3ZUVA 3Q4UA 3LFBA 3HECA 3F3TA 1Q4LA 3FMLA 1UKHA 3TL8A 4JVGA 5L2SA 3MBLA 5E8ZA 3OEFX 2I6LA 3BBTB 3H0ZA 3GCSA 3FJQE 3QRIA 2ERZE 2WTWA 2GS7A 4UMQA 4OUCA 1WAKA 3CQEA 4TRLA 3UNZA 3F3UA 4FA2A 3POZA 2YWPA 4GKHA 3NRMA 4C3PA 4ITIA 2B52A 3QD2B 4P4CA 2CKQA 1YOJA 3FZOA 5CEPA 3W18A 1TKIA 3KC3A 1WBWA 3PUPA 4QMWA 1XO2B 3C7QA 2XIYA 3LVPA 3COMA 4FZ6A 4BIBA 1T45A 3GC7A 3TZ8A 3I5NA 1U59A 2WGJA 5JZJA 4HGSA 4NW6A 3R6XA 5J5TA 3ALNA 2VO3A 4UZHA 3TTIA 4D4SA 2OXXA 4I0RA 3RI1A 3WOWA 4JG8A 4ASZA 4BTJA 1FPUA 3A7HA 5ICPA 4IE9A 3NAYA 4YGAA 4EI4A 4WNMA 2YDIA 4MTAA 5CU0A 2ZYBA 3NYNA 5EHOA 3LFDA 3H0YA 5KBRA 3UIUA 4FV8A 5EW3A 2BHEA 4O0TA 3ZSGA 3QTUA 3F5XA 4R7IA 3VS4A 4EHVA 1R3CA 4R5YA 3K2LA 5ANJA 4BWKA 5H8EA 5JSMA 3I7CA 3MN3A 4H3PA 4YLKA 4LMNA 2X6DA 5DT3A 3FDNA 2GNFA 3BHTA 3IG7A 4PRJA 4PWNA 5HTBA 3U6JA 2BRBA 2UZEA 2X2MA 4R6VA 2FSLX 3LFSA 2F7XE 4ZTRA 4FZAB 2CCHA 1KE5A 2BFXA 2P4IA 2DQ7X 1WZYA 3QZHA 4RVTA 3VBYA 3TJDA 5M07A 2QQ7A 4WG3A 3W2QA 3OZ6A 4D4YA 4F7NA 4FL1A 4A4OA 3HL7A 3IDBA 3P5KA 1NT2A 4D9UA 1OL7A 3HMMA 2OKRA 5E90A 2NP8A 1Q8UA 5AP1A 5AR5A 3F5UA 4FKJA 4QRCA 4F7SA 2FSMX 4CLJA 3S1HA 4Z9LA 1H01A 1LEWA 3S3IA 1JOWB 2UZLA 4D2SA 4EOQA 3W8LA 5J1VA 2VO7A 4PNIA 5AA8A 4O1OA 5TR6A 5J5SA 5A9UA 2OFVA 2B9IA 3ENHA 3QWKA 4UBAA 2CSNA 4WNOA 3VC4A 4KAOA 5HCXA 3R04A 1OIRA 2XP2A 4FKRA 4HYHA 1QMZA 4YSJA 4LUEA 3VRZA 1JLUE 3OP5A 3EHAA 3QD0A 4EJNA 3UPZA 2OWBA 5AP7A 3UP2A 3FLZA 4EOLA 3GU5A 3PPKA 3WZJA 4EYMA 2GNGA 2G2IA 5D10A 2IPXA 3NZ0A 5DPVA 1OKZA 2XKCA 4FSWA 5F95A 5HLPA 5EQPA 4X2KA 5T3QA 4L7SA 3FI2A 3B2TA 3KF7A 2UW4A 2ITVA 5EM8A 3FE3A 4U41A 4IANA 4NIFB 3LXNA 3CPCA 2QG5A 3WILA 2YISA 4M15A 4ZZOA 5D7AA 2QLUA 4X21A 2W1CA 1W98A 4TYHA 2FSTX 5H8GA 3FLSA 4X3FC 5IF1A 2QKWB 2V0DA 4LMUA 5IA4A 4R77A 4TPTA 1XH8A 4GVJA 3COHA 4EQUA 4JXFA 4QTCA 3DOGA 2PVLA 4MEDA 2WMVA 4QMSA 5LXMA 1OUYA 4IFCA 5K4JA 4O1PA 3L9MA 2VWYA 4U45A 4WUAA 5L2QA 3D5XA 2JDVA 4I20A 2Y4IC 2CMWA 3UC3A 4MK0A 4C4GA 2XKFA 3TZMA 4FVPA 3VVHA 4U5JA 2Z60A 2BCJA 2ZV8A 3U6IA 3NS9A 2BHHA 4IIRA 2EU9A 1CKPA 4R3RA 4RQKA 4A9YA 3NLBA 5HVKA 2XNOA 4YHJA 2CJMA 1NVRA 3BKBA 4DN5A 3AC4A 4EC9A 5ACKA 1MUOA 1ZYSA 5K3YA 3ORLA 3Q53A 5AFVA 3UVQA 4GFGA 3WF7A 5LVLA 3TV7A 3OBGA 3FLWA 4IZAA 3PVGA 5CU3A 5C1QB 3RGFA 3MSSA 5M09A 2QR7A 4RLLA 1Q97A 3VF9A 4FIHA 4RZWA 4XUFA 1KE7A 5AP2A 5HO6A 3MESA 2PVKA 4WG5A 4ASXA 4E7WA 2X9EA 5E8TA 1PKGA 5DRBA 5LVMA 4ASEA 4E6AA 4W8EA 2GQRA 3CJFA 1UU8A 1YXSA 2NNWB 3HEGA 4Q2AA 4U79A 5AX3A 5JFWA 4V0GB 2UZDA 3HRFA 2YAAA 4GUEA 2B1PA 3FPQA 4HVSA 1XJDA 4B8LA 4F7LA 3UOJA 4KKEA 1LEZA 4IADA 1PXPA 2A1AB 5CALA 3TZ7A 2X7OA 5K5NA 4WD5A 5AR8A 3NCZA 3N4UA 3KCFA 4GT5A 3KREA 1M2PA 2W4OA 5E1EA 1ZOEA 3PXFA 5BUJA 1Q3DA 2PPQA 2CPKE 3ORKA 1NA7A 5AUZA 3S4QA 3UG2A 2WQNA 3GCUA 4MYGA 4ACDA 1VYZA 3RAHA 4FTCA 3C50A 3WZUA 4XBRA 3TNQB 1ZYDA 3WYYA 3W8QA 2J90A 3KRJA 3PRIA 4YO6A 4FE2A 3GCPA 5IA0A 3WZDA 4EH7A 1R0EA 2W5HA 2YERA 2OSCA 1V1KA 5EM6A 3R8MA 4FSUA 5HX8A 1G8SA 4YLJA 2GS6A 3LXKA 3ZC5A 2VTJA 3EN5A 3MVMA 5G6VA 2WTCA 1GIHA 4RJ5A 2BDWA 4WNKA 3R63A 4QMPA 2VRXA 2XIKA 5IMEA 3KMWA 2BZJA 4RC4A 2ITWA 4TKSA 3RK7A 1YRPA 2E2BA 2I0HA 3BYMA 3QQKA 4MNFA 3F7WA 4UWBA 4BCPA 4FEQA 3ZEPA 4E20A 5DVRA 3NNXA 3OCSA 4APPA 5H2UA 4FYOA 1JSTA 3QQUA 3SXSA 4O84A 5IQEA 3PLAE 3LXLA 2A4LA 4RIWB 4ASDA 1OI9A 2R9SA 2JKOA 2F7EE 4FIIA 2OJFE 4NM3A 4XV2A 4XV3A 4X3JA 4GT4A 4BTMA 3DTCA 3QXOA 3RPOA 2Z7LA 4BKYA 5H9BA 4CFVA 5ETIA 3G0EA 1UVRA 2Z7SA 4O21A 5HLWA 4FOBA 4PL3A 4A9RA 4DTKA 3TJCA 1K2PA 1HOWA 4IVBA 5IH6A 1AD5A 2J2IB 4D5HA 3GC0A 2C30A 4U3ZA 3KVXA 3HV7A 4X7QA 5HCYA 3EFWA 1BMKA 2GDOA 2QOIA 4OLIA 4GW8A 2QOOA 2WXVA 4C3FA 3FLNC 3U8WA 4HNFA 5FM3A 3LCSA 3OT3A 4FG7A 5AUYA 5FM2A 5C8KA 5KBQA 4DH1A 3M42A 5E7RA 1IEPA 4ONAA 2IWIA 2VD5A 1HCKA 2FSOX 4EWQA 4PP7A 3BHYA 5IQCA 5LVPA 1XH6A 1Q8TA 2XJ1A 2CGVA 4A7CA 4NTSA 3O17A 2NPQA 2ZDTA 5HIDA 3TNIA 4EKKA 5B2KA 2QD9A 1ZZ2A 3FAAA 3FMJA 4KS7A 4QP1A 4FV1A 4ITHA 4JDIA 4O7LA 4G2FA 3R22A 3R1YA 3VS3A 3QCYA 1E1XA 4CFWA 4DH3A 5CZHA 4DT8A 1YQJA 2YACA 3ZM4A 2AC5A 2BIKB 4IX3A 5DN3A 2GU8A 3GGFA 4CZYB 3R01A 4IWOA 5AR4A 2W1DA 3A4PA 3NPCA 4ACMA 1FMOE 2VWXA 3JVRA 3G9LX 5ANDA 4FTMA 1GZ8A 3PXQA 3TKHA 3DBQA 2VWVA 2YITA 4QP6A 3V8SA 4I6QA 4II5A 2JKQA 4JX3A 2QNJA 5G1XA 3R7EA 3UG1A 3DTWA 3FI8A 5AAFA 2OJ9A 2IW8A 4PPCA 5C8MA 3VQUA 4GSBA 4IWPA 4G5JA 4FT9A 3R9OA 1UNGA 2R3IA 2IZSA 4GMYA 3FEGA 3FMHA 2R3NA 4FX3A 4QNYA 5A6NA 4TY1A 5HE3A 3A61A 2R7BA 4G6NA 4NIFA 4AN3A 1KOAA 2B9HA 4BYIA 4EH8A 2PVJA 4KUJA 2GQGA 5HLNA 1PMVA 4LOQA 3ZDIA 5EQEA 4JJRA 5CAVA 2XK3A 3R8LA 2WU7A 4PX6A 2W1HA 4MXXA 5CNOA 4BDIA 4QO9A 4C59A 2YZLA 2C6IA 2XNBA 4I3ZA 4O2ZA 5ETCA 3ORXA 5C9CA 2R3OA 4FGRA 5GZ9A 1NXKA 4F7JA 3A7IA 4A9SA 3JS2A 5E91A 3CTQA 4W9WA 3AQVA 3D2IA 1U4DA 3IW7A 3QCSA 4MXOA 2OH0E 3QBNA 3BELA 4NZWB 4RGJA 1Q5KA 2RSVA 3MFRA 5CNNA 4DEBA 5LQFA 2IZUA 3GVUA 5E4HA 5M08A 5FDPA 3OC1A 3AGMA 4JI9A 5D9HA 1PMNA 2E9NA 4GH2A 3ETAA 3IPHA 4I21A 2J0KA 5BX0A 3ZM9A 1W0XC 4ID7A 5CWZA 2VTQA 4J8MA 2ITUA 4XP2A 4MBIA 5DLSA 3TNPC 2J50A 2X7GA 2O64A 4KSPA 2PMIA 3QQLA 3HDNA 4NKSA 2W96B 2FO0A 4YZMA 4AX8A 3WF5A 3C4EA 3ZBFA 3QYWA 4PMSA 4MX9A 2YJSA 3DAJA 1O6YA 3DB6A 3ET7A 4D0XA 4EHGA 3F66A 4MD9E 2R3KA 2W4KA 4WBOA 2EVAA 4TXCA 2J4ZA 3DY7A 2O2UA 3T9IA 4ALWA 2IZRA 2VTOA 4H39A 3K54A 2GTMA 4QMUA 3AD6A 4E73A 4C4FA 1OZ1A 2C69A 3KY2A 3TT0A 4IHPA 4AS0A 4P90A 4DGGA 4QQ5A 3RAIA 4YO4A 4O91A 2XNPA 4QMYA 4BF2A 4HGLA 3VW8A 4KIPA 2R0IA 4XG6A 3T8OA 4YR8A 3RJCA 2VNYA 3BE9A 1URWA 2C6LA 2PE0A 4F1OA 4QMXA 1H1SA 3FHIA 3OT8A 2VX1A 1JWHA 2YCRA 3HV4A 3R28A 4FV3A 4S31A 3NW6A 4FZ7A 2ZDUA 3MVLA 3O0GA 5CI7A 3I79A 5TE0A 2CKEA 1L3RE 3BE2A 3PZEA 4QMMA 3QALE 5HVJA 2R5TA 5A4TA 5L6OA 1Q62A 3DNDA 5HBEA 2DYLA 4JRNA 4E6CA 2JIIA 4QQCA 2LAVA 5TT7A 2ZV2A 3NVMB 4PF4A 5BUEA 4IEBA 3RPRA 4WNPA 2WB8A 1BI7A 3A7FA 5JFSA 4AZFA 2X8EA 3NW7A 4EOOA 1OMWA 1S9JA 4ZSEA 4ANMA 2A2AA 3LMGA 4AG8A 4R78A 5HI2A 4O82A 4UN0C 4IWQA 4YTIA 5KO1A 2J0JA 4QP7A 4DCAA 2OGVA 3PSCA 2JBOA 4KD1A 4Z16A 4AFJA 1Y6AA 3TCPA 1IR3A 4EK8A 2R2PA 3R00A 2VO0A 3VAPA 3V3VA 5CEOA 1GZOA 4PPAA 1CKJA 3KRLA 4M13A 1H07A 4JLCA 4R5SA 3A4OX 2XCKA 3LE6A 4FSZA 4BCHA 2XIXA 1RDQE 1H25A 3DBFA 3E3PA 2XK8A 3QRUA 4I92A 4KIKB 4RIWA 3TKUA 4FV2A 4XNEA 2JD5A 2VWUA 4RPVA 5IG1A 4MWIA 3PSDA 4YNEA 3FQSA 3IO7A 1ZWSA 4WSYA 2XH5A 1DS5A 5F9EA 3LPBA 3GU4A 3FMNA 4HYSA 3ATSA 4GJ2A 5JGDA 3EQIA 4MNEB 4IAIA 5HNIX 4CVAA 3ANRA 1H08A 4K77A 4ZJJA 3GQIA 4E5AX 3E7VA 3VS5A 2C6DA 2Q0NA 3MW1A 4GVAA 5DOSA 1OITA 4FL2A 3K5UA 4CNHA 5IU2A 2PZYA 2YA9A 1IA9A 4ALVA 4NK9A 1H0VA 4GYGA 1PJKA 3O8UA 1ZMWA 5EH0A 3RPSA 3CQUA 4BCQA 2HK5A 3QTWA 3F9NA 3MVJA 3Q60A 4V05A 3HLLA 4FT3A 4IZYA 3PSBA 2Y7JA 4R1VA 1OKVA 4MAOA 4YBKA 5AMNA 2ZOQA 5AV4A 3D83A 3GC9A 2KTYA 5JEBA 4Y83A 4MHAA 2BIYA 3HUBA 4NFMA 2C5XA 5F4NA 3H10A 5E8XA 4PPBA 4X3FB 5FLFA 3RWPA 3V5LA 4BL1A 3QGYA 1XH9A 3BYOA 3GOKA 5D11A 1UKIA 1YXUA 4RX8A 4XOZA 4ANLA 3LXPA 3NSZA 5CS6A 4QYHA 4E26A 2RF9A 2ZVAA 1OIQA 2WNTA 1F0QA 3EN9A 4RC2A 3QD3A 3ROCA 3O8PA 4PUZA 5AEPA 2X81A 4NT4A 5FWKK 2Y4IB 4DH5A 5CVFA 4F09A 5KMOA 4PDSA 2Z2WA 2BDJA 4BIDA 4L44A 5HBHA 2C5YA 2WIHA 4LI5A 2CGXA 3EH9A 3ZFXA 4IAAA 4TYGA 4CZTA 5I5ZA 2PMNX 5GZAA 3GUBA 4RIYB 5B0XA 3R73A 4Y46A 4FKWA 1U5RA 3JXWA 4NEUA 3ZO3A 1ATPE 4GKIA 4RJ8A 5JMSA 4BR3A 4CKIA 2UVYA 5KNJA 5CF6A 2EXCX 2VX0A 3HMOA 4FG9A 4Z55A 4GRBA 4QTDA 1FVVA 3RALA 1TQPA 3D7TB 4ZSJA 4AE9A 4ANQA 5D12A 4IX5A 4NU1A 3FL5A 4D55A 3FBVA 1PHKA 4X2FA 4NCTA 4C36A 1YHWA 3F2RA 4R8QA 4YPSA 5IQDA 4AZVA 3LFEA 1V0BA 4YTHA 4BCNA 3AT3A 2C5VA 3BU5A 5CSWA 5D41A 5CF4A 2C1AA 4RFMA 4ZS0A 4C57A 4DFXE 3V5QA 3ERKA 4H36A 2X9FA 4HVDA 1JBPE 4XG9A 4D2PA 5CEKA 3NUSA 2XB7A 5I4NA 1PXIA 3OS3A 3DBDA 5L2IA 3ORPA 2HW7A 3I0QA 4JQEA 4Q5EA 2OLCA 5KUPA 1O6KA 3ZZEA 3KN6A 5IQGA 2EB2A 1Z5MA 1WFCA 2BUJA 3WIKA 4AA0A 3EYHA 3GENA 3FMDA 2I0EA 5IQFA 3QQFA 3HP2A 4G3DA 1TQMA 4PY1A 2R7IA 2C5OA 4JDHA 4ZSLA 3LQ5A 3U54A 2HWOA 4CQGA 3B8RA 2RG6A 4HPTE 4D5KA 3AXWA 3ATTA 4DBXA 4I5HA 3D0EA 3I5ZA 4QP3A 5B2MA 2ACXA 4CYJA 3FI3A 3DLSA 4DTAA 5EM5A 5GHVA 4EOJA 4K1BA 2R0UA 2OF4A 2XRUA 3W33A 5GJGA 3C13A 2UZNA 3C0GA 4EOPA 2VWZA 3L8XA 3FMEA 4FV7A 3KXHA 2WTIA 3HUCA
chains in the Genus database with same CATH superfamily
3SG9A 4XX9A 3JY9A 2C47A 3ZFMA 2YN8A 2Y0AA 2FGIA 4FKUA 3BV2A 3VNTA 1P4OA 3ZCLA 4H3QA 1H8FA 3OUNB 1YI6A 4DEAA 4E1ZA 3WI6A 4FTNA 4ERKA 1OKYA 2OXDA 2IW9A 3TKIA 4QYGA 1M2QA 3Q2MA 3U87A 2C4GA 4C4HA 5BQ0A 3E8EA 4JIKA 3LHJA 4PDPA 3AMYA 4IACA 4FKGA 4NM5A 5CI6A 4MXYA 3MVHA 3OHTA 4KSQA 3ZRLA 4DG2E 3JR1A 2YCSA 4BCOA 2VTPA 4D0WA 4QYYA 4L42A 4ZY6A 2PHKA 2XMYA 3KRWA 4X6RA 2O8YA 5BVEA 2JITA 3CS9A 3RBWA 4XRLA 4FV0A 1WBSA 3SQQA 3DKFA 2QOQA 3PPJA 1XKKA 3VS1A 2CKPA 1OIYA 3U4WA 3DXQA 3HVCA 2ZAZA 4O7SA 2DWBA 5BVKA 2BVAA 1CKIA 2IVUA 3OUKA 2QHMA 3FYJX 3AKJA 3GU8A 5IQHA 4ZTNA 4TYJA 1GJOA 3DKOA 4J96A 4UMUA 5HORA 4I5PA 5CU6A 5CTPA 1Q8WA 4UEUA 3UODA 2ZM3A 3PXYA 4I1ZA 1ZRZA 4NM7A 3OBJA 5ANGA 5HIBA 3TUDA 3W0SA 2PY3A 4C7TA 5JGAA 3TMOA 5JZNA 5L4QA 4A4LA 2NRYA 2J5FA 4TYEA 3AMBA 3FUPA 2W1IA 4CTBA 1I44A 4F0FA 2WQBA 2F2UA 2EWAA 2IG7A 2BKZA 1LPUA 5L8LA 2GNIA 2AEGA 3DA6A 1CSNA 4O7TA 4F9BA 2E9PA 3VONA 3BLQA 3BIZA 3EQRA 4AW1A 4JBVA 4HZRA 1WBNA 2J0MB 3FPMA 3HAMA 4ZY4A 3FY0A 3Q9XA 4F0IA 3R8PA 1W2DA 5L8JA 3Q6UA 5EYKA 4O7RA 4GT3A 4L45A 4MH7A 4G17A 4AXCA 2JDTA 4KIKA 5M4UA 1H1QA 4DITA 4EZ5A 3ORNA 4U7ZA 2XNNA 3L9LA 2OJJA 3OW3A 3PVBA 4JDJA 1H00A 3SC1A 4F6WA 4MNEA 5CAOA 4IXPA 4UWYA 5C4LA 3JUHA 2CLQA 3OXIA 4D1SA 3FZTA 4IWDA 3F2NA 5I9WA 3RWQA 4DEGA 2ZB0A 4IW0A 3PDTA 5FXRA 4K18A 3EOCA 3IKAA 5ETFA 5LVOA 3SXRA 2QCSA 3V8TA 5AR3A 4GIIA 3H30A 2GSFA 4FTAA 3WYXA 1PXJA 2C6OA 3WARA 3A7GA 4O0RA 1NVQA 5EI6A 3WIGA 1WCCA 3R1NA 5KX8A 2H6DA 2OK1A 5CXZA 4U80A 5DRDA 1JSVA 5M56A 2Z8CA 2CN5A 3PJ2A 3NGAA 5CQUA 2CN8A 3UE4A 3MWUA 4OR5A 1H27A 3KU2A 3NIEA 4X3FA 3R8ZA 5EI8A 3OCTA 4O7YA 2P0CA 3GP0A 4JG6A 2E9UA 5CASA 2O5KA 1BX6A 2VV9A 2VZ6A 2XKDA 3QTXA 4GS6A 4QMVA 5EQYA 1Y8GA 3QKLA 1ND4A 3TIYA 1Q24A 2WZJA 4LGDA 3MDYA 1FINA 2RKUA 3AD4A 3R7VA 1XH7A 4GU9A 3VUMA 1L8TA 2I0VA 4FNYA 2XK7A 2JAMA 3BHVA 3VHEA 3ANQA 5M55A 2Y4PA 2R3JA 3LFNA 3MJ2A 3VWAA 1W82A 2VTRA 5AIRA 4JBPA 5GJFA 2E9OA 5HEZA 4BB4A 4BDKA 4BCFA 5CF5A 4CG9A 2QURA 1PMUA 1BL6A 4BHNA 2HWPA 3OF0A 5C03A 5AUXA 4L3PA 2XZSA 2H8HA 4RIYA 5CU4A 5LMAA 5IA2A 3A60A 4FT7A 3P7AA 5FBNC 5JQ5A 5FDXA 5DI1A 3BQRA 4G6LA 3PE1A 1VLRA 3ORTA 1KE9A 2J5EA 4MD7E 2QHNA 4GV1A 3V5JA 1PXOA 3P23A 4P7EA 3RVGA 4AN9A 4QMTA 3C51A 1XMLA 2A27A 1E1VA 3D7TA 5LMBA 4QMZA 3DAKA 4ZZMA 2JDOA 3D9VA 3O23A 2EB3A 3ZU7A 4QMQA 3P86A 4C0TA 4AQKA 3Q6WA 1SMHA 4CXAA 4CV9A 4EOMA 4I4EA 5BMSA 3KXXA 2XAOA 3G2FA 4AGCA 3RKBA 1Y91A 4DT9A 2J7TA 3QLGA 1OM1A 5EOLA 1XHAA 3M2WA 4G31A 2ITQA 4F08A 1FGIA 3CCNA 1BL7A 2R3HA 3AMAA 4MWHA 2HY0A 1Q61A 2PUUA 2WKMA 3EFJA 5IUIA 4DDGA 1GZKA 2C6EA 3FQEA 4OAUC 1A48A 1BI8A 4RA5A 4EH2A 5AV0A 3N9XA 4IAZA 4AXEA 2WD1A 5M4CA 1LUFA 2IVSA 3O7LD 4YJTA 4AXAA 1GAGA 1XR1A 4OBOA 2P3GX 4QPSA 1H26A 4LRMA 2ITNA 4QTAA 1YDRE 2O3PA 4U8ZA 3GB2A 3ZEWA 5K9IA 3MH2A 3PA5A 2BALA 4HJOA 4FBXA 3BI6A 3F3ZA 3QTIA 4IDVA 4ZJIA 3TUCA 1UA2A 3II5A 1V0OA 1GIJA 4HGTA 5I9XA 2VTMA 4FT5A 3ZXTA 2YFXA 3D2KA 5F1ZA 3VS0A 3TXOA 2A0CX 3EL8A 3HV3A 4FV4A 4OTHA 4EC8A 3DCVA 4ENYA 3PIZA 5LARA 5IUHA 2NRUA 5AP3A 2YJRA 4FTLA 5EKOA 4QPAA 4FTRA 4CCUA 4E4XA 2ZB1A 4FTQA 1KOBA 2CNQA 2QOCA 4YJOA 4JMQA 3RCDA 3QHWA 3ENMA 5KCVA 1W7HA 4O0SA 4OT5A 3VQHA 4RMZA 4EBWA 2UW0A 2UZOA 4W4VA 2Y6OA 3PWDA 2WTJA 3C0IA 4FV6A 3VS6A 5DEWA 2W1ZA 3I60A 4E3CA 3E64A 3PA4A 4F4PA 4DEDA 3EKNA 4OT6A 1OL2A 4DG0E 3FLYA 3LQ3A 1PW2A 1YHSA 3F3WA 2JIUA 4L53A 2OW3A 4EUTA 4X2JA 5FEDA 4I41A 4OTRA 4WSQA 5HBJA 3QUDA 5IISA 2WMBA 2VTIA 5IA3A 4DGOA 4FKQA 2UZTA 3BLHA 3ZRMA 1UU7A 4YJSA 4UMTA 5C4KA 4DINA 5BVNA 3ITZA 3LMHA 4L68A 1SM2A 2W06A 4ZIMA 2FH9A 2GHGA 2X39A 3ORIA 5KHXA 4FRFA 1G8AA 4AW5A 5J8IA 1B39A 5BMMA 1DI9A 2QO9A 4O0VA 5TF9A 5FP5A 1J3HA 3GI3A 4C35A 4WBBB 3AT2A 1ZOHA 2RGPA 5FBOA 2F49A 2YEXA 3AOXA 4XOYA 5A3XA 3VO3A 4B6LA 1QPJA 5L2TA 3LLAA 4F9YA 2FVDA 4FVRA 3BV3A 5AUUA 3PZHA 3GU6A 1YWNA 1JVPP 3MFTA 3P4KA 2Z02A 3QFVA 3KRRA 5J79A 3ZMMA 2RFEA 3VN9A 2YIQA 3I0OA 5L8KA 1GOLA 4IMYA 4E4MA 4CFMA 3QL8A 1PXNA 2W5AA 4UMRA 5HHWA 3E8DA 4X2GA 3QTZA 5ITAA 4DEEA 2V7OA 3CKWA 4D2TA 4NW5A 4U42A 2PVFA 5AR7A 3U4UA 2WU6A 4FK3A 4FEXA 1JAMA 4MF0A 4ANSA 4OAVB 3QRTA 3I6UA 3DZOA 1IAJA 3W2PA 5AM7A 3QXPA 4N70A 2GNLA 5FQDC 3LFQA 4XP0A 3IGOA 3QQGA 4IAYA 2PZPA 3PWYA 3EN6A 5DT4A 1S9IA 2YABA 4IVAA 4RQVA 2PUIA 1WBVA 4IX6A 2XVDA 2C3KA 4DG3E 5CZIA 2ZM4A 3LCDA 3NAXA 3NYXA 4U9AA 3KMUA 4MBJA 2UW7A 5HU9A 5J7HA 3AC5A 3B2WA 3DGKA 2P2IA 2QG7A 3LZBA 5E8SA 4C61A 2YM5A 1MQ4A 3PXKA 2XBJA 3NNWA 2FA2A 3DFCB 4GK4A 2WMQA 3VS2A 3W2SA 4CEGA 3KMMA 4ANNA 1ST0A 5GIPE 3TIZA 3UMWA 3VUTA 2WAJA 4CFUA 1VYWA 2UVZA 3KF4A 4FUXA 3VS7A 2B9JA 4EKLA 5JKGA 2OF2A 4C37A 4YURA 3OROA 3HA6A 1ZMVA 2F9GA 2W1EA 4EQMA 1BYGA 4JBOA 4XV9A 1XBBA 5AAEA 3O5AA 2PE1A 3BBWA 4O7WA 2X1NA 5J95A 3QCXA 2XS0A 4USEA 3TZ9A 3H3CA 4CSVA 3GCQA 5ACBC 3PJCA 3CBLA 2J9MA 4JG7A 2JGZA 4KWPA 4K0YA 2W0JA 4BYJA 4UV0A 3UO4A 3G6HA 3S95A 4RIXB 4YC8A 1A9UA 2PMLX 5I3OA 3ZS5A 4RIOA 1ZAOA 4AW0A 4IVCA 2BFYA 4OTWA 2UVXA 1TQIA 4FKVA 4G5PA 2YWVA 2YLFA 3BWFA 3DKCA 5A4CA 1JSUA 2G01A 2PVHA 4B9DA 4FZDB 2YDKA 5HNGA 2BRMA 1MRVA 2WEVA 4BDFA 2OO8X 3N4TA 1JKLA 4RJ6A 2PVYA 3T3UA 3KK8A 4AW2A 4C34A 2ZM1A 3LOKA 3BGPA 2HCKA 3Q5ZA 4D28A 5LCJA 4XG8A 3W32A 3TI1A 5EHYA 3ZBXA 3GBZA 3IW8A 4KKHA 3VBQA 3LM0A 5KHWA 3O51A 1OPKA 4RJ7A 4NSTA 4Y5QA 1U5QA 3HMNA 5GIOE 4FICA 4AOJA 3NR9A 2V62A 2X2KA 4PP9A 4N4SA 4O7VA 3MTFA 4ACGA 3FXZA 2WHBA 4FSYA 4AT3A 3FHRA 3IS5A 1UU9A 4BKZA 4LRJA 3GOPA 3RM7A 5HD4A 5K4IA 3DKGA 1KV1A 1PRYA 5IQAA 3W0OA 5IEYA 1MRYA 3PVWA 4LFIA 5EYCA 4YZDA 2WMAA 3OG7A 3DDPA 3TG1A 2W5BA 1K3AA 2VAGA 3E92A 1MQBA 4I5CA 4IAFA 4RFYA 4EUUA 5KKRC 3U51A 1B38A 3V5PA 3O71A 3QQJA 4QP9A 4S30A 1QPCA 3R30A 3ZDUA 2WO6A 4IB0A 1ZMUA 1R39A 3MY5A 5DIAA 5BYZA 4CMTA 4YJNA 5T6KA 4FODA 4HVHA 4H1MA 5TOZA 4XG7A 3KXZA 2XM9A 3EKKA 4CRSA 2IJMA 4UMPA 3CXWA 4DLIA 4QMLA 5HU3A 3LLTA 3TTJA 3RP9A 1VJYA 3U6HA 1OIUA 4ALUA 3FLQA 3V6SA 5HGIA 2QVSE 5BYYA 4IAKA 4RWLA 4FOCA 5H3QA 4RG0A 1WVWA 4YNOA 4JDKA 3BLAA 4FIGA 4KKGA 4FGBA 4L46A 1Q8ZA 1O9UA 3AGLA 2V22A 3PXZA 4EYJA 5J9LA 2ETRA 3H9OA 3NUUA 5KZ0A 3G0FA 4PNKA 4RA4A 3EQCA 2WMSA 3DPKA 2HXQA 2P55A 3FSKA 3PPZA 1DAWA 3QUEA 4Y73A 2CCIA 4RT7A 4BCMA 5M4IA 3KFAA 5FP6A 2ETMA 3W2OA 2GNHA 5CX9A 2UZVA 3F82A 1WMKA 3UQGA 2W05A 4IJPA 4EOIA 2R3QA 4M69B 1OKWA 3R7GA 3FZRA 4JBQA 5FRIA 3CD3A 5KZIA 4ACHA 2ZMCA 3DB8A 3FQHA 4V0GA 4YZNA 4YMJA 4J95A 4RJ3A 4AFEA 5IMXA 4YJVA 4BCJA 4UXQA 4KS8A 4AAAA 1REJA 5FXSA 4C4EA 4CTCA 5J1WA 1SNXA 1H4LA 4FTJA 3OMVA 1YW2A 3DQXA 2G1TA 2IW6A 2C6MA 3KXNA 4FKIA 4TWOA 2C6KA 4L67A 2W1FA 3Q9ZA 4EK3A 3EMGA 4E93A 5LMKA 1G5SA 2JIVA 1DAYA 4AT4A 5AA9A 2X4ZA 4Y8DA 4B4LA 3BLRA 2C0OA 4LG4A 3ZO4A 4YTFA 3VBXA 4PV0A 1OGYA 4DFBA 4QP8A 4MCVA 4M66A 5ANEA 2VWIA 3ORZA 3V04A 4CV8A 2UW5A 1UV5A 3MYGA 5L2WA 3BU6A 4D58A 2YCQA 4I94A 4OW8A 5AP6A 3PIXA 1KUTA 4GJ3A 5GNKA 4E6QA 3R21A 5JFXA 3OOMA 4ZLYA 4F6UA 4GCJA 3IDCA 3DDQA 4QNAA 2PUNA 4M8TA 5CSVA 2XEYA 4AOIA 2VTNA 1J1BA 4CMOA 3R83A 2Z7RA 4EK6A 5CAUA 4JOAA 2QONA 4QOXA 3R0TA 3PRFA 1KV2A 3RHKA 3W55A 5CT7A 4B99A 3ZUTA 1KE6A 2J6MA 3JPVA 2WQEA 4D9TA 3MB7A 3FC1X 4KBCA 2QR8A 4O22A 4Z7GA 4M97A 3M11A 3NW5A 2ITOA 2PTKA 4FKOA 1E9HA 1P14A 4BBMA 1OL6A 4ITJA 2QU5A 2XJ0A 3L1SA 4AOTA 2OZAB 4DYMA 4FMQA 3VHKA 3CIKA 2Y6MA 2YM6A 4M84A 2ITTA 1G8KA 5T68A 1K9AA 2BAJA 4BCIA 5LMKC 4XH6A 3ULIA 4HPUE 4LV8A 4J99A 4J8NA 3TN8A 3ELJA 3ZH8A 3UDSA 4XS2A 4AF3A 4C33A 2OI4X 1YOLA 3NIZA 4MD8E 2JEDA 1UU3A 2CGWA 3KULB 2VWBA 3PG3A 4PL4A 3CGFA 3RINA 2Q83A 3NUAA 3DT1A 3MIAA 4I0SA 2VTSA 5B2LA 3V51A 3RK9A 3KGAA 2YLEA 4O4CA 5E9EA 1IA8A 5J87A 4YJQA 2I1MA 4OTQA 4IC8A 3NNUA 1PF8A 2JBPA 5BVWA 1B6CB 2UW6A 4YSMA 5A4QA 4ZMFA 3MIYA 4I6FA 2WMTA 4RVMA 4XG4A 5AX9A 2WQOA 1H0WA 2IVVA 3BEGA 3VJOA 4W4XA 2DS1A 1H1WA 3UTOA 1R0PA 2YDJA 3JYAA 4HCVA 3TACA 4BC6A 5A4LA 4BDJA 5GJDA 1WVYA 3M1SA 4YZ9A 4AZEA 3Q2JA 4RIXA 3BQCA 4Y95A 5HD7A 5HG5A 3CSVA 4XMOA 1ZLTA 1YXXA 3K3JA 2ITPA 3ZTXA 4M0YA 4H3BA 1OL5A 4Z7HA 2YM8A 3UOLA 2QOBA 3TWJA 4CKJA 4FC0A 1IRKA 4QT1A 5IEXA 4BBEA 4D2VA 4AXFA 3MY1A 3UDBA 1BUHA 3U55A 2J0IA 3EIDA 3P9JA 4NL0A 3LAUA 4R3PA 5C01A 4IFGA 4C38A 3N51A 4JQ8A 5DGZA 2HELA 3SW4A 5I9VA 5GZ8A 3DXPA 3COKA 4LOPA 4L52A 3S0OA 4MXAA 5DBXA 2WEIA 1KSWA 4RX7A 5E8WA 4UY9A 3HRBA 4UXLA 4AUAA 2OZOA 2YM4A 3QX4A 3IECA 4JL9A 4DF3A 1PMEA 5C8NA 5CENA 5FXQA 2O65A 3Q52A 1OPLA 4U44A 1H1PA 2C1BA 3R9HA 4AZSA 2BKKA 3FMKA 4S33A 3IK3A 3MY0A 4TN6A 3FSFA 4LRKA 1U54B 1JNKA 4DBNA 4K2RA 3R7UA 4M12A 2XK4A 4W8DA 4F9AA 3LIJA 3KQ7A 4I22A 2QC6A 2OIBA 4ACCA 4E5BA 4BKJA 2ITYA 5FD2A 3CTJA 2OJGA 2UZBA 4M3QA 5KMNA 3EQBA 2F2CB 3LFFA 2OH4A 3VBTA 3NCGA 5AUWA 2HXLA 4BCKA 4EEVA 3SAYA 4Y72A 5D7VA 1G3NA 2PSQA 4OGRA 1QCFA 4QTBA 1OL1A 1PKDA 3ORMA 4O38A 2FYSA 5KMJA 3IW4A 4JS8A 1YHVA 2GPHA 5IH4A 3I6WA 4EOKA 2PVMA 3EYGA 3EZVA 4S2ZA 3C4FA 4FV5A 2VTHA 2ZV7A 3MH1A 2X8DA 5HE2A 3RZBA 3UGCA 5TKDA 5E8UA 4BRXA 4JRVA 3IQ7A 4C3RA 5IA1A 4AU8A 4D2WA 4F1MA 3FI4A 3L8PA 1M17A 5AADA 5HQ0A 4YUQA 1IG1A 3QZIA 3CPBA 2WELA 4IDTA 4FIJA 4HYIA 3BGQA 1JPAA 4TNBA 3ODYX 3OW4A 3REPA 1CTPE 4DCEA 4X2NA 4EWHA 4DEIA 4EZ7A 4F63A 4LOOA 4J52A 3ZUUA 2V7AA 1OVEA 4M69A 1M52A 2AUHA 4UWCA 3T3VA 3PFQA 4CKRA 5CVHA 5BYLA 3G90X 3LJ0A 4FKPA 4G9CA 2QKRA 3TV6A 2GCDA 3A2CA 1SNUA 4MKCA 5CVGA 3TNWA 4BDHA 4F70A 4CFXA 3UIXA 4AXDA 4C58A 2BR1A 1YKRA 4IB3A 2YIRA 4O0YA 2QI8A 4LUDA 5BPYA 4G9RA 3EQDA 3W0QA 3F6XA 3OY1A 2RFSA 5EM7A 5DT0A 4AP7A 3NFGB 3HA8A 1ZARA 3DK7A 4ZOGA 3GT8A 5KMLA 2BPMA 3HYHA 5EYMA 3G33A 4UALA 3V5TA 3F5GA 1PXLA 5TO8A 3AT4A 4U40A 4BGQA 3EFKA 4C4JA 3UIMA 3P7BA 4P5ZA 4XG3A 4HVGA 3WF9A 3I4BA 3IOKA 3UJGA 1F3MC 4A07A 2LGCA 4ZY5A 3GFWA 5E1SA 1GIIA 5K5XA 5AV1A 3G51A 4UZDA 4YPDA 1XBCA 4DTBA 3R9RA 3I1AA 3KRXA 3KVWA 5IA5A 4XLIA 3LFAA 2Y9QA 2BRGA 4BZNA 3G15A 3R7YA 3QA0A 4QMNA 3WZKA 3SG8A 4FKSA 1DI8A 3CD8A 2PULA 4NFNA 5DNRA 3DS6A 5JRSA 4APCA 4TNDA 4O7ZA 5FUTA 3L9NA 3P79A 2KULA 4IH8A 2XNGA 4RFZA 5HO8A 3GCVA 3GFEA 4KABA 4RWJA 4Y5HA 3PY0A 2C3IB 4PMPA 4BI1A 2VTLA 2IVTA 2BTRA 1BLXA 2HYYA 4Z3VA 3FWQA 4C02A 2HZNA 5HTCA 4K9YA 3PUFC 4HCTA 3ZC6A 3GQLA 3OXTA 4XRJA 2WTVA 5AUTA 2GS2A 2W9ZB 3PA3A 2OZAA 2UZWE 4RWKA 4ZS4A 2VUWA 2XYNA 3P08A 2BAQA 4FV9A 5DYJA 2VGPA 4DE4A 4BWXA 3QUPA 2B0QA 1PY5A 4ZTMA 3EJ1A 1Z57A 3SLSA 4ZSAA 5HIEA 2XRWA 5IQIA 4P2KA 3Q96A 3RZFA 4WA9A 2GFSA 1OPJA 1JQHA 4XCUA 2X0OA 3GU7A 3KULA 5FTGA 3C5UA 4CD0A 3OTUA 5L3AA 4FEVA 1UNHA 3CKXA 1GZNA 2CKOA 5IDPA 3OFMA 1BKXA 1ZYLA 3KCKA 1YWVA 4EL9A 4AGWA 4PMTA 2PZRA 4MQ2A 3FMMA 1W2CA 2CNVA 4CT2A 4FNXA 4JR7A 2BRHA 2GQSA 2RIOA 1P4FA 3DZQA 4WKQA 2XIRA 2XM8A 1APME 4IQ6A 2FB8A 4DFYA 4RC3A 4O0WA 3PG1A 5KKRB 1STCE 3D94A 3RMFA 2BZIB 5KMIA 2W17A 3KXGA 5IQBA 4JAIA 4FKLA 2P33A 3A8XA 4C8BA 4CYIA 5E8VA 1FMKA 4K6ZA 3C4WA 4DFUA 2Y8OA 3QX2A 3EN7A 4A9TA 3O2MA 4OTIA 3S2PA 5HZNA 3CE3A 2OICA 3QC4A 3W2RA 2ONLA 2PZIA 3ZRKA 3QTSA 4YU2A 3OXZA 4M68A 3K5VA 2WPAA 3WE4A 4P5QA 1REKA 4QP4A 5BVOA 1QPEA 5JFVA 5KMKA 3FC2A 3BU3A 4BICA 3CGOA 3PFYA 2JDRA 4V01A 3F3VA 4L43A 4M67A 3VUIA 5HO7A 3NDMA 3ULZA 4O6LA 1FBNA 3F88A 4O0UA 2PU8A 1UWJA 5I9YA 2REIA 2HY81 4TWNA 5AP4A 4F64A 3I81A 4FTTA 4L01A 2JDSA 4EONA 3U9NA 3KL8A 3Q5IA 3OWJA 2RFDA 3QTQA 4LQMA 3BRBA 1T46A 2XUUA 5EHLA 4NWMA 4CT1A 4O2PA 3UZPA 3KIOC 3RM6A 4RZVA 5DG5A 2WOTA 4KIOA 4F6SA 3WE8A 4LGHA 3SX9A 2OFUA 3RHXA 2XYUA 1U54A 3FZSA 2XEZA 3C9WA 2O63A 5M44A 4FEUA 4G3GA 2QOLA 4TT7A 5JRQA 4YHFA 3S00A 3D15A 3LM5A 4NJ3A 2XALA 1ZYCA 5E8YA 4IB1A 4HZSA 3EQFA 4BN1A 2WTKC 1U46A 3ZLXA 1JKKA 1OB3A 2QOFA 4FVQA 4CRLA 1OECA 4AGUA 3CTHA 4DGNA 4IM0A 4Q9ZA 4W4YA 4FZFB 4KBAA 1YXTA 5A54A 2OJIA 1J7IA 3E88A 4UX9A 2ONLC 5ANKA 2JKMA 2CDZA 2HZIA 2GHMA 3NWWA 3V8WA 4CFFA 2AC3A 4EZ3A 4WG4A 1J7UA 4U81A 4PMMA 5DR9A 4I23A 5BVDA 3BGZA 5D1JA 5DWRA 3DJ7A 4CMUA 4GFMA 4F99A 2IZTA 4TTHB 2G15A 1RQQA 2YM7A 3ACJA 3QD4A 2W99B 3V5WA 1FOTA 3PP1A 3FL4A 4WOVA 4BDBA 2XNMA 5IEVA 4O83A 3D5WA 2F7ZE 3UIBA 3UBDA 4EBVA 5BVFA 3W0RA 2ZJWA 4DH8A 4GIHA 3AD5A 3QTRA 3DXNA 4LGGA 4WT6A 1ZXEA 3D5UA 4FTUA 3UQFA 1ZY4A 1MRUA 1YI3A 3GEQA 3RK5A 4BDEA 1OBGA 5CT0A 3QAME 3OCBA 5HESA 3SV0A 3RPVA 2GFCA 2XK6A 1FGKA 4FF8A 1PXKA 3O96A 1R1WA 3QRKA 1H24A 2X4FA 4YBJA 4ZTLA 4HW7A 4LV5A 4GG7A 4NM0A 4G16A 4EJ7A 3CQWA 4OTDA 2YIWA 5M51A 4CCBA 1NVSA 2BRNA 3DBCA 2CLXA 4BDDA 2PK9A 5LWNA 3R1QA 4OBQA 1WBOA 2XA4A 4FKTA 1Q41A 5CSHA 3BL7A 4RBLA 4L8MA 4BTFA 5JQ8A 5KMMA 4EK5A 3HKOA 2QO2A 3E3BX 3PP0A 3PTGA 3MPAA 4MVFA 4W4WA 3UVRA 4L9IA 4WUNA 4AZTA 2W1GA 1X8BA 3FXWA 2CHLA 3L9PA 2XBAA 3CLYA 3IW5A 4G3FA 4JT3A 1ZZLA 2QU6A 4JQ7A 2HZ4A 4Q9SA 2PWLA 4F9CA 4USFA 5KE0A 2UW9A 3PYYA 1XH5A 4EQCA 5DH3A 3ZSHA 5DMZA 3OWPA 4GFOA 3FYKX 2X7FA 1YXVA 3BCEA 5EDPA 4RRVA 4LL0A 4FNZA 5FTQA 2X0GA 3UOKA 4ZP5A 4F0GA 1PYEA 4LM5A 5DR6A 5HE1A 4FEWA 5CXHA 3UPXA 2V5QA 3WZEA 2ZMDA 4FSTA 5AAGA 3P0MA 4R7HA 2WQMA 5IH5A 1ZYJA 5HE0A 3HP5A 3EN4A 3PVUA 2FUMA 5EYDA 2RFNA 4H1JA 4DGMA 2JAVA 3VW6A 1Q99A 4ZLZA 3LFCA 3NUXA 2HAKA 4LYNA 1DM2A 4KBKA 4PQNA 5BV3A 2W7XA 2X2LA 3F2AA 3E7OA 3NVKI 4O96A 4ZEGA 1YVJA 3CJGA 3U9CA 4O27B 3E8NA 3MH3A 1Q8YA 5LCKA 4GG5A 4ANBA 4D2RA 2H34A 4ZLOA 1LP4A 4YJRA 4N6YA 5HKMA 3IDPA 4XHKB 3HX4A 1XQZA 2XKEA 3QC9A 1HCLA 1P2AA 4F1TA 4QQTA 1FVRA 3D4QA 5DE2A 4BI2A 4DHFA 4BY9E 5HG8A 3HZTA 2G2HA 3MTLA 3R2BA 5CANA 2DUVA 1A06A 1EH4A 1TVOA 3NNVA 3ID6C 4ZTSA 4A4XA 2B9FA 3PY1A 1H28A 1M7QA 3LCTA 4Y85A 1TZDA 2JFLA 4FUYA 4J7BA 3Q4TA 1Z9XA 1XBAA 3FY2A 4PDOA 4JIAA 3SVVA 3PE2A 2PVRA 4L3LA 3C4CA 4U0IA 3ACKA 4N57A 5DFPA 4MUQA 4PL5A 3FKLA 3VRYA 4QYFA 3GXLA 4DHJA 1XMMA 1ERKA 4QP2A 4G6OA 5ANOA 3BHHA 3FV8A 4IJ9A 3Q4ZA 4IM2A 3LCOA 4JX7A 4BFMA 4BIEA 5I9ZA 3H9RA 3FZ1A 2EUFB 4UYAA 4C4IA 3R9DA 4C2VA 4PTEA 3KXMA 3CEKA 4CFNA 2PYWA 4IX4A 4AZWA 1KWPA 1Y6BA 3DV3A 1FQ1B 4TWPA 4FR4A 4EHZA 3ALOA 4O86A 3OOGA 3ZZWA 4BDAA 3JY0A 3MPTA 3O50A 3O7LB 4QQJA 5EG3A 3JVSA 4AE6A 4BDCA 3AC2A 5JK3A 3W16A 2EXMA 2B4SB 1QPDA