3O23A

Human unphosphorylated igf1-r kinase domain in complex with an hydantoin inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
293
structure length
293
Chain Sequence
EWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Insulin-like growth factor 1 receptor
publication title Discovery of the first non-ATP competitive IGF-1R kinase inhibitors: Advantages in comparison with competitive inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 293
sequence length 293
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o23A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o23A01
5IH5A 1BUHA 4DF3A 2XNBA 3GU4A 3UODA 3UOKA 4GK4A 4FKQA 4FEUA 2QI8A 3JPVA 3QD3A 2JEDA 2VTRA 3VNTA 2OSCA 2CKQA 3QCSA 2C69A 2PVJA 3HRFA 2JFMA 4O81A 3KMWA 5D7VA 2BIYA 3NAXA 1TQIA 3FLWA 5HX6A 2UW6A 3RPVA 4CTCA 3P79A 4MXYA 2X9EA 5AEPA 4G1WA 5E9EA 3EQCA 4GV1A 3PZHA 1DAWA 1NXKA 2YDKA 3A4OX 4EOMA 2GS6A 3P0MA 2VO3A 5AADA 3VBYA 3NUYA 2PHKA 5IA0A 1KSWA 2W1DA 3BV2A 4LV8A 3KN6A 1MUOA 3E5AA 4K9YA 5KBRA 1L8TA 5CT0A 3D2IA 4FUYA 2IG7A 2WZJA 5CU2A 5IQDA 1KE5A 1SVEA 4HVIA 1PXOA 2ETKA 5ANEA 3VS3A 1M2RA 1PXPA 2V7AA 3RBWA 5FBNC 4CMTA 4UMRA 4BDJA 4C37A 3TTIA 1BX6A 2VAGA 4M0ZA 3UPZA 4DCAA 4FKWA 5BQ0A 5B0XA 3GOKA 5AR4A 1IRKA 1X8BA 1YOLA 2C0TA 5I3RA 5ETCA 2UW7A 4AN2A 2AC5A 2H8HA 4J95A 2W4KA 4GCJA 4TYHA 4CYJA 3UYTA 1WBVA 3ZLYA 1SYKA 3Q53A 4QPSA 2PULA 4L7SA 3UMWA 5CXZA 3TL8A 4C02A 5DRDA 1REJA 3NYXA 4OTIA 5BVOA 3OWPA 4IDVA 3FI3A 4I24A 4PUZA 3ZDUA 4ASXA 4V0GB 3EFJA 3I6UA 3O17A 4J52A 4C4EA 5L3AA 4BDCA 2OXDA 3TJDA 4BN1A 4GIIA 4ZY4A 5J9YA 4XRLA 3ZFXA 4HYUA 3AMBA 5FWKK 3KA0A 3MH1A 4ACGA 2IVUA 4B7TA 3O7LD 3F69A 2YCFA 4JQ7A 3LE6A 1K2PA 1ZOGA 3PTGA 3D7ZA 3P1AA 3KXXA 5HHWA 3ZO3A 1J1BA 2ITQA 2J7TA 2JC6A 3FQHA 3V04A 1QPDA 2W1HA 4FL2A 4HOKA 5ANGA 1SNXA 4C33A 4EK6A 3QGYA 4GU6A 4AOJA 4NK9A 3P86A 4IX4A 4TYIA 4NUSA 4G2FA 2BDFA 4QMSA 5FTOA 2OH0E 5H8GA 5B2KA 1W8CA 4FT0A 3MFUA 2Z7RA 4ZSGA 4N6ZA 1V1KA 4CLIA 2UZWE 2W99B 2C5OA 3AMAA 4UB7A 3UG2A 4PDSA 3MA6A 4UMQA 2IZUA 2XIZA 4BCGA 1LP4A 2FUMA 5G6VA 3ZEWA 3RNIA 1FGIA 2OZOA 4W4VA 4L52A 5EW3A 5HE2A 5C01A 4USEA 4GUBA 3TNIA 1U54A 2YM6A 3ALOA 3DDPA 4NM3A 3U9NA 2GMXA 3AOXA 4QP3A 2VWBA 3OS3A 1QL6A 5AV3A 4ZMFA 3LXNA 3EN6A 3BEGA 5CU3A 4BKJA 4L00A 4F64A 3ZSGA 1LPUA 3LCTA 3R9NA 2XEYA 2XMYA 4FG8A 1OIQA 3DZQA 4N6YA 2OH4A 3DKFA 3QX4A 5AP0A 4AX8A 3TNHA 4ZZMA 5LWNA 4NJDA 3RVGA 4WUNA 4MWHA 4C8BA 4XMOA 1OPLA 3PG1A 4CKJA 3RPRA 2I0EA 5KNJA 3FMEA 1Y57A 4BDIA 4IWDA 3QKLA 1OUYA 2BZIB 2BZKB 2XS0A 4MXAA 4A07A 1ERKA 3JY9A 3PSBA 4G5PA 3IONA 3NR9A 5AR8A 4CFNA 3Q52A 3FKLA 3PRIA 1XO2B 3OVVA 2GHMA 4M67A 4KD1A 4O27B 4RIYB 5IG1A 3ZU7A 2VTSA 2VTNA 4M12A 2F57A 5I3OA 3IG7A 4WRGA 4FKPA 4JJRA 2FGIA 3GOPA 2O3PA 4JBPA 3LKMA 1PYXA 4RVKA 4A4OA 4I3ZA 3PXKA 4R8QA 4LUEA 4F9CA 4OW8A 1YHWA 1QPJA 3ZBFA 4YHTA 3OY1A 5M51A 4PL3A 4YLLA 4QPMA 2QNJA 3U6IA 3RWPA 2KULA 3FMMA 3ZZEA 5DNRA 4H36A 4GG5A 5HU9A 1P4FA 5CEMA 5E1EA 2WTCA 3E7OA 4IACA 4EJ7A 4EH5A 3CY2A 4RBLA 4XP2A 3I81A 3FMKA 1BYGA 3VBTA 4NM7A 2PUPA 3QRTA 3BHTA 4QP4A 2WMQA 5L2WA 4NKSA 5IQHA 3OUKA 3B2WA 4BICA 5DEYA 1JKKA 3MTFA 2CLQA 2EB3A 4GU9A 5LCKA 4U42A 4DG3E 3KXGA 3RI1A 1F3MC 4U3ZA 2XJ0A 5HCXA 4F65A 3HMNA 4RT7A 5DA3A 4S31A 3PVUA 4UMUA 4RC2A 3U55A 2XA4A 4NEUA 1SM2A 3F7WA 3OUNB 1PRYA 4TYEA 5HE3A 4MVFA 2B9JA 4D0WA 1Z9XA 3VW6A 3KEXA 1GAGA 3QWKA 3R1QA 4O84A 2VRXA 2X7GA 2HXQA 3HDNA 4NKAA 5HNBA 4RLKA 3TCPA 3GC8A 5AAEA 2V0DA 2OIDA 1OL5A 3KRRA 2O64A 3VBXA 3VF9A 4LQMA 2X8EA 2UW5A 2C3IB 2WMAA 3MH2A 3V8WA 4RWLA 2X7OA 4A06A 5TO8A 3ODZX 2FSLX 3V3VA 4A4LA 4EEVA 5A6NA 3OT8A 5FTGA 3BI6A 2A19B 3Q6UA 5A4LA 4QP8A 4YJRA 3V8SA 3MI9A 2H9VA 3QUDA 4KINA 4I0TA 5E7RA 2OF4A 4EH2A 2EVAA 4XG8A 3W1FA 3CKWA 5AR5A 5EYKA 3ZUTA 3ELJA 2HZ0A 5KMIA 4QT1A 1PF8A 4RJ4A 3W10A 1P2AA 1W82A 2WEVA 5DMZA 3SW7A 1UV5A 1WVXA 3LFAA 4ANOA 3VIDA 1JKTA 3QKKA 5D11A 1K3AA 3GFEA 1B6CB 5AFVA 3IW7A 4E4MA 5IQIA 3O23A 4FKSA 3NAYA 2CCHA 1SZMA 4KABA 5DT3A 5CF8A 5L4QA 1ZZ2A 2HENA 1Y8YA 4XG2A 3QQLA 2XVDA 5HI2A 3HNGA 4JX7A 3H9OA 3PJ2A 2RGPA 4ALVA 5IF1A 3ZFYA 2P4IA 4F1OA 5L2SA 3BHHA 4ACDA 2R0IA 4OAVB 1H4LA 2B9IA 3FV8A 4QP6A 3G5DA 2VO0A 3O8PA 3C4ZA 1Q8WA 4AUAA 4BDGA 2YJRA 4DAWA 3KMMA 4MXOA 4WO5A 4CSVA 1CKIA 3W2CA 1Q5KA 1E1XA 1WBPA 4DEAA 4HCUA 3G9LX 4H05A 4WG4A 1VEBA 3MJ1A 3MPMA 4AOIA 4BVUA 1FQ1B 5CNOA 4TWCA 4U6RA 4L3JA 2WIHA 3PXYA 4C58A 4DH1A 5GJFA 4OTDA 3QFVA 4FV9A 3R7VA 2VZ6A 4G3GA 3DAKA 2IZSA 4PQNA 3ENMA 2GNJA 4ANQA 5HEZA 3SAYA 2PE0A 4FV3A 2IW9A 2ITUA 2DYLA 4YO4A 2QVSE 2XIXA 1IEPA 1UWHA 4IX5A 4H58A 4R78A 4DFUA 3HMIA 4FTQA 1O9UA 4R3PA 4BDHA 4W8EA 5HTCA 3EL8A 2H34A 4CEGA 4FTOA 1PXIA 4EHEA 3LMHA 5HLWA 4IB1A 3QU0A 4TW9A 4BF2A 3CGFA 2QODA 3NUAA 4RA4A 3W2RA 4GMYA 4BHZA 5AUUA 2B55A 4DFLA 4F63A 3WIKA 3ORPA 1JSVA 2C6DA 4HVSA 1HCKA 4JG7A 3QD2B 2R3HA 2XKFA 2YM3A 1ZZLA 1OIRA 4JR7A 2J5FA 4JQEA 3A8XA 4U79A 4AE6A 4FUXA 4BFMA 3ROYA 3V5LA 1U46A 4UXLA 3VBQA 3VUMA 1XH8A 5K5NA 3UG1A 2C5NA 2R3MA 3V5PA 5EYDA 1XH5A 3R1SA 4LRJA 3GQLA 4X2FA 4FKUA 2PTKA 3M11A 2QOQA 3IW4A 4IWOA 2IW8A 4FT9A 2RKUA 1YXSA 2ZV9A 2HW7A 1U59A 4BI0A 3KN5A 4WNPA 4ANNA 3BV3A 3HDMA 3HAMA 4YZDA 3KB7A 3HV4A 4XP0A 1CMKE 3CGOA 1NVQA 5CNNA 2HZIA 3CQUA 4AACA 4D5HA 2Y7JA 3VBWA 2QU5A 3AD5A 4BB4A 4GVAA 5HO8A 5CEQA 3MW1A 3LFDA 4FNXA 1URWA 3NUUA 4X7QA 2XJ1A 4D28A 2B0QA 3ULZA 3BE2A 3LLTA 3AT4A 3QGWA 2JBOA 1WBSA 4I1ZA 5CVHA 5DR2A 4ZS4A 3LAUA 4D1XA 4Y85A 3LXLA 3L9MA 2VTHA 3DZOA 4XH6A 4ACHA 3L8VA 4RIWB 4QMWA 1TVOA 3CTJA 4F99A 3G6HA 5HU3A 1H08A 3JY0A 5CEOA 4MD8E 4CRSA 1Y91A 1U5RA 3ZO2A 1OKWA 4BTMA 4OUCA 5DI1A 5KBQA 3BEAA 2PMLX 3IQ7A 4KBCA 5FEEA 2ZOQA 4IMYA 3WF6A 4O7NA 4R7BA 5AJQA 1H1RA 4QYGA 2QKRA 4TNBA 2VTIA 3BU3A 5CALA 3LXKA 4Y95A 5AV2A 5CZHA 5JKGA 5M4FA 3IDBA 3AMYA 3C51A 3H0YA 2GU8A 4ERKA 3BQRA 3GU6A 4XG4A 2JGZA 3GBZA 5E8XA 3NEWA 3UVQA 2FA2A 3ZUVA 5DYJA 4CYIA 2GHLA 3PWDA 5FTQA 4BIEA 2J9MA 3FZOA 3R30A 3NUSA 3P9JA 4NH1A 1ZARA 2W7XA 1A9UA 3LOKA 4R77A 4FVQA 2JKKA 3ORIA 3QRUA 3BHYA 3COMA 4IDTA 2WTWA 5AM6A 5E92A 3IECA 3KL8A 2ZJWA 3G2FA 4MXCA 3RZBA 3PXRA 5TF9A 3BX5A 4EK4A 1Y8GA 5IQCA 3U87A 5BVDA 3OCBA 3VO3A 5HCYA 4DGLC 4BBEA 2J90A 5FM3A 2R3GA 2RFSA 3CS9A 3ZRLA 5HX8A 2F49A 4TYJA 4E93A 5T3QA 2WTJA 4K33A 5IDNA 3RAHA 2PZYA 4RPVA 2JIIA 4B99A 4P7EA 4AZWA 5CAUA 1XQZA 5HQ0A 3NZ0A 3GB2A 5AX9A 3VWAA 4K8AA 4O7RA 4B0GA 1WAKA 5IQAA 4O7LA 1OM1A 4DTKA 3IGGA 5C1QB 4FSWA 4KBKA 3SHEA 3WIGA 2BRNA 3POZA 4WBOA 1UNLA 2VX1A 2XK9A 4OTFA 1QPEA 1S9JA 3ERKA 4FT3A 4C62A 2ZM1A 2VX0A 2ETMA 1OMWA 1V0PA 4O21A 5BVWA 2WTIA 3S4QA 2PL0A 4EOLA 4ZTRA 3FY2A 3HYHA 2QHMA 4DFZE 2XIKA 2OZAA 5B2LA 2XNMA 5A9UA 5FEQA 4M68A 1WBOA 2BRGA 3DKCA 2RF9A 3F5PA 4U3YA 4X2KA 2X8IA 3GU7A 4L9IA 5HLPA 4K6ZA 4BWPA 5EM8A 5FDPA 3I1AA 2R3IA 4OR5A 3LPBA 4H1MA 4OGRA 4PMSA 3GUBA 3C9WA 3JYAA 4M7IA 2F7EE 5C27A 4AG8A 3QD4A 1Q41A 4CLJA 2BALA 1EH4A 3VJNA 4A9SA 4GT3A 2PUNA 2WMVA 5AUTA 1H24A 3U4UA 2RL5A 1OKYA 2WMXA 4IAFA 3KK9A 1YOJA 4CFMA 3BZ3A 4RX5A 4AZEA 3G90X 2E9NA 4AWIA 3DTWA 2Q0NA 4XG7A 5DH3A 4FV2A 5IEYA 2O63A 2WU6A 2X81A 2GPHA 3Q04A 3DK7A 5E4HA 4A9YA 3LJ0A 4F1MA 5AV1A 5JEBA 1LUFA 4FTIA 2E9VA 3N51A 1OL7A 5EM7A 3EKKA 5GZ9A 3SXRA 3NUXA 2CN8A 2J0MB 3ORNA 3Q5ZA 3SA0A 3F2AA 3LFBA 5DBXA 4BWKA 5KKRB 1UNHA 3DU8A 5KMJA 1M14A 2IO6A 1YW2A 2G2HA 3D7TB 3G15A 1R78A 3ITZA 4I6QA 3ZCLA 4TYGA 5M44A 4AN9A 2SRCA 4X2GA 3TKIA 1JOWB 2JIUA 4AW1A 2ITYA 3U8WA 4MTAA 1GNGA 1HCLA 4Y83A 5GIPE 4YSMA 3LFQA 4ZS0A 3VHKA 3BE9A 3EL7A 4IC7A 4EZ3A 4JI9A 2IWIA 5B2MA 5BYLA 4O0SA 2H6DA 3RK5A 3RMFA 4BDDA 4CQGA 3F3ZA 2I0YA 3FZTA 4V0GA 4PTEA 4A7CA 3UZPA 5FM2A 4QMTA 3NRMA 3RM7A 1H25A 5F95A 3TG1A 4G17A 4IB3A 5JFWA 4DFBA 5KMKA 3TDVA 3NLBA 3R0TA 4HYSA 2XKEA 3TKHA 5DR6A 1YVJA 2UVYA 3N9XA 2J6MA 3E7VA 3DBDA 3GU5A 3FKOA 3NUPA 4FVRA 5LMBA 3R9RA 4MEDA 3UZRA 3QC9A 3R1NA 3HV6A 3MV5A 3PFQA 3RTPA 1J91A 4JDJA 4ZEGA 5M06A 4DTBA 3HVCA 4JR3A 4RC4A 2W96B 5M4IA 2RG5A 3D5XA 3KMUA 4AA0A 2WTVA 4S33A 3BELA 2XF0A 4DGGA 2HZ4A 3AC5A 4F09A 3NPCA 2WOUA 4QQJA 4WSQA 1STCE 2YLEA 1NW1A 4E26A 3WF8A 2LGCA 3FXXA 5A54A 4FYOA 3ZO1A 1M17A 4M69B 2UZLA 4Q5HA 4L44A 5IMEA 2YM7A 3HMPA 4UWBA 2BDWA 4WNKA 5JK3A 4LMNA 2GHGA 2UW0A 4YZCA 4DH5A 3GCUA 4ITIA 4W9WA 3A2CA 2E2BA 4QRCA 4KS7A 4EI4A 5LWMA 4MH7A 3BBWA 3EYGA 4IVCA 2EU9A 4TTHB 3PY0A 4CZTA 1WZYA 2OXXA 4MXXA 5M55A 1XJDA 5F1ZA 4R1VA 3JVRA 4GKIA 5IQEA 3MBLA 2V7OA 2PE2A 3SOCA 2XNNA 3BYMA 4AQCA 5C4LA 2PSQA 4KS8A 4IW0A 2XZSA 4ERWA 1ND4A 2X6EA 4O0RA 2YACA 4YJSA 3PRFA 5AR2A 5AUXA 2NP8A 3LM5A 5HOAA 4F0IA 4O38A 4U40A 4O0UA 5ANJA 4LOPA 3HRCA 5CT7A 1GIIA 1MP8A 4RMZA 4QMXA 5DG5A 4CRLA 4GKHA 5CAOA 2ITTA 2W5AA 5EYCA 3LFSA 2BTRA 3OXZA 4BHNA 5TE0A 4D4SA 4FGBA 3IDPA 4AGCA 2CMWA 3D94A 3R8UA 1WMKA 3IPHA 4E5AX 4NW5A 5CX9A 4HGTA 3ZTXA 2HY0A 4RLLA 4FEQA 4ORKA 3SV0A 1OVEA 2CJMA 3KK8A 4RIYA 3L8SA 2OIQA 3CR0A 4QO9A 2R5TA 3SOAA 4USFA 2VTAA 1OECA 3QCQA 5M4UA 4O7WA 4BIDA 4XJ0A 3EFLA 2FB8A 4OTPA 3UMXA 4AZFA 4WT6A 1XH7A 3C0HA 3QZFA 4C34A 3PG3A 4FZDB 1WBTA 2F9GA 3FHRA 3K5UA 4FT5A 3FXZA 1M7NA 2UZBA 2JDVA 4W4YA 4U0IA 5CSPA 4O7VA 3PSDA 5F94A 1W0XC 5IH6A 4G6NA 4U80A 3AGMA 4U8ZA 2RSVA 4YJQA 3BKBA 3CKXA 2GQSA 2C4GA 3EMGA 3UVPA 4MNEB 4KBAA 5IPJA 3TUBA 3KC3A 1FVRA 2I6LA 5AMNA 1KE9A 5CF5A 2GSFA 3TDWA 4AT5A 3NNVA 4L53A 3LJ2A 3W2SA 1VYZA 3QZGA 3LW0A 5CU4A 3M42A 2XNOA 3IOPA 3Q9ZA 3DS6A 3WZDA 4FKLA 3CEKA 4QQTA 4TRLA 2UUEA 3ACKA 1R3CA 4OTHA 4FTUA 3RHXA 2X0GA 2ZV2A 2VWXA 2VTOA 3EH9A 2VNWA 3GVUA 4D0XA 5D9HA 4UYAA 2UZDA 4GUEA 2HK5A 5DFPA 4U41A 4BTFA 4YZNA 5LOHA 1G8AA 2W5HA 3HV5A 4F7LA 2I7QA 3BIZA 3DKOA 3GXLA 3POOA 5C4KA 3TTJA 3K3IA 4E5WA 1ZYCA 3HV7A 4FODA 3WYXA 3S2PA 4K77A 3BYOA 1PXKA 2XIRA 2Y9QA 5TKDA 2QHNA 1LEWA 4CKIA 4CG9A 3EN5A 2FSOX 2X2MA 5EM6A 4GT4A 4JBQA 5BMMA 2X8DA 4O6EA 4YP8A 5JRSA 5C8KA 4EK5A 3VRZA 2WGJA 2PUIA 4MBIA 4DYMA 4X2JA 3E8CA 4FTLA 4JOAA 5IA2A 3U4WA 1ZMWA 4FTMA 2UW9A 3ZS5A 4BCMA 2WU7A 4JXFA 2C5YA 5CU6A 3CPBA 3RALA 1OI9A 4O96A 3UYSA 4D9UA 4DEGA 3NNXA 4KRCA 4BTJA 4C7TA 5KKRC 1WVWA 2V55A 1GZKA 3LQ5A 2W0JA 2XB7A 4FEXA 1MQ4A 3FSKA 3FYJX 1YQJA 4FK3A 3DY7A 2OI4X 3DQXA 4UYNA 4ZJIA 4X3FB 3ZBXA 5C8NA 3L8PA 2P0CA 1SVGA 3OTVA 5EH0A 3QALE 5F4NA 5GINE 4IAZA 4YJTA 4E4XA 1Q97A 3MY5A 4IJ9A 3H0ZA 1H27A 3RZFA 2PVRA 3C0IA 4IAAA 3ZSHA 3SG9A 3Q32A 3ODYX 4QOXA 4BR3A 2PVMA 1ZYLA 3T9IA 1NA7A 4HNIA 4WUAA 5J9LA 3DB8A 3E92A 4CXAA 3LVPA 4QMOA 4GYIA 3LQ3A 4O6LA 3KULB 4ANSA 2OJFE 3EOCA 1PY5A 3BLQA 3EZVA 4OTRA 5J9ZA 1RDQE 4O7YA 3GCSA 4IWPA 1VYWA 2YA9A 3SW4A 4DCEA 4G6OA 3GU8A 4BY9E 3MESA 4BI1A 3VULA 4CQEA 3HV3A 5AUYA 2VWIA 3FZSA 3OBGA 4YJVA 3R7IA 4CT2A 4XUFA 2ITWA 4IH8A 4W9XA 2Y6OA 2WMBA 2YIRA 3I79A 3RAKA 4DT8A 2YWVA 3NW7A 1WBNA 1YI3A 3R73A 3QUPA 4J71A 1FMKA 2PVKA 4YLKA 2XBAA 1IASA 3MYGA 4XBUA 3BYSA 4PPBA 4IXPA 3I0OA 4QTBA 4USDA 4TY1A 2P2IA 2GNLA 2P33A 3NSZA 4JG8A 5LVLA 1MRUA 2B53A 3UIMA 2P55A 3UIXA 2QO9A 4TL0A 3D5WA 2I0VA 3E93A 1NVRA 3P78A 4E8AA 1XBCA 4GVJA 3VS4A 4AU8A 1CM8A 3QQGA 3DCVA 3UPXA 1UU7A 3P4KA 1FBNA 3AGLA 2CNQA 4YJUA 3H9RA 3C4FA 2PVNA 5DIAA 2X9FA 3RHKA 2UZUE 3TWJA 4OT6A 3DA6A 4C2WA 3DV3A 3NW6A 4GT5A 2GQRA 4J97A 4EQUA 3D4QA 5BUJA 1PMNA 1GOLA 3OFMA 4XS2A 4MKCA 3E88A 4MWIA 3TZ9A 3ID6C 1BI8A 3ZLXA 5IMXA 3ALNA 4KSQA 3ZRMA 3FC1X 3L1SA 3FLQA 3F2NA 5EI6A 1V0BA 4C59A 4FK6A 1GJOA 4TWNA 5C8MA 5J79A 1JKSA 3P23A 4EORA 4F9AA 3Q3BA 4D2RA 5B7VA 4BCPA 1YI4A 2G01A 5AP6A 1DAYA 1OITA 4J53A 4O2PA 1J7UA 3ANQA 4C3FA 3DQWA 2UVZA 3PXFA 1H1QA 1J7IA 2Z8CA 1YDTE 2ZB1A 4C35A 5K0XA 3EWHA 4PPAA 4RVLA 4XG6A 3SQQA 4L8MA 4IX6A 4ACCA 2C6TA 4A9RA 1KUTA 5EOLA 5IKWA 2FSMX 3A7JA 3K2LA 5HORA 5JRQA 3NX8A 5JGDA 4LUDA 5FP5A 3ZYAA 5KHXA 3KU2A 4GRBA 4GFOA 5ANIA 3R01A 3CTHA 3W16A 3I7BA 3MA3A 4KNBA 2ZM3A 4NM0A 4NM5A 4QMPA 4YHJA 4MQ1A 2WMWA 4E20A 2W06A 2YCSA 2NRUA 5CAVA 4UX9A 3DLSA 4BL1A 3F61A 3QD0A 4FIIA 3JXWA 2R64A 4I6FA 4O0VA 4XEYA 4ZTNA 5K3YA 2X4ZA 1OIYA 3BGZA 3WBLA 3RK7A 5M09A 3LQ8A 5A3XA 2YITA 2JDTA 4TPTA 2PWLA 4IAKA 4YC3A 3KRJA 3BBTB 3GGFA 2R3OA 4FIHA 3GP0A 5CLPA 2Q83A 2HWPA 2C0IA 3FE3A 4JBOA 2QOHA 3OXTA 2VTQA 1KV1A 3AC8A 3H9FA 3VUTA 2XK3A 4DBXA 3U6HA 3E62A 1BLXA 2C6KA 3CC6A 3HKOA 4GW8A 4F6WA 5CI6A 3QWJA 2G1TA 4RJ5A 1M7QA 3E8EA 3RP9A 5AP5A 3W18A 4BDKA 3A8WA 5HGIA 1IA8A 4K2RA 1FGKA 2BAKA 3A7GA 2XM9A 2C47A 5AUWA 4ZSJA 1J1CA 2WQOA 4WRSA 5GHVA 3BYUA 4PNIA 4FTKA 5HICA 3EHAA 1Q8UA 4AZTA 5HIBA 3QHWA 4FV7A 5IA3A 3UQGA 3D15A 4MD7E 2W1ZA 4IVBA 4O7TA 4J96A 1W84A 3I60A 3H10A 4X3FC 2OU7A 4FSYA 4KSPA 4KWPA 3U54A 2PZIA 4WG5A 5CSXA 3WF7A 3UQFA 4FG9A 3O0GA 4HJOA 4QP9A 3BU5A 4G34A 4NFMA 4RRVA 3UC3A 5IISA 4J1RA 4D2WA 1R1WA 3II5A 3UVRA 4EYJA 1L3RE 4WNOA 3F82A 3V8TA 2G9XA 1VZOA 3MPTA 1MRVA 1H1WA 2G2FA 2YIYA 5D12A 5CQUA 5CVGA 4LL5A 5AR3A 4AT4A 3ORMA 2W1FA 5E8UA 4PP7A 5EFQA 5JH6A 2W1EA 1BI7A 4HVHA 5LVMA 4FBXA 3UJGA 4AGWA 3ZC5A 4BBMA 5I4NA 2OFVA 3VS1A 3AC4A 4BCKA 3Q4UA 3QHRA 1Z5MA 5J5SA 1Y6AA 4C4FA 4I5PA 2IZRA 3QYWA 3BHVA 4XV2A 1H0WA 2PZRA 4MYGA 1PMUA 5CQWA 1WVYA 4O1OA 5AP4A 5AA8A 3O2MA 2CHLA 3W2QA 3ORLA 3IS5A 5L6WL 2QC6A 4YLJA 5FXRA 3R21A 3NYVA 4FL3A 3ZMMA 3TEIA 5AV0A 1OPKA 4FKTA 4FX3A 3MB6A 2WAJA 4P5QA 4K1BA 2JLDA 3Q9YA 3CD3A 2ERZE 4QNYA 3VQUA 5J7BA 5JN2A 1GIHA 4ZTHA 2ITXA 4XLVA 5CVFA 4I6HA 5LVNA 2XRUA 3MJ2A 2QO7A 2R3LA 3BYVA 4MQ2A 2XK7A 2VU3A 5EM5A 3DFCB 4GK3A 3RK9A 3CBLA 3CQWA 4XG9A 3TZ8A 3UBDA 4EYMA 3W8QA 4DGOA 2VTLA 3ORXA 4IB5A 3OWKA 5E1SA 5BVFA 3QCXA 3EQPA 4UV0A 5DE2A 3SX9A 2V22A 4CT1A 3OW4A 1ZMUA 2ZDTA 4AFEA 4MNFA 3TNQB 5AP7A 4ANLA 3E3BX 5AV4A 3GQIA 1BKXA 3OBJA 4RX7A 3RAWA 4FC0A 4NSTA 1WBWA 4XRJA 4FV8A 2BHHA 2VO7A 4DH3A 3SVVA 4LG4A 4FYNA 3PP1A 4IAYA 2ITOA 4KKHA 2PYWA 1XKKA 4II5A 4D1SA 5GNKA 2ZVAA 2R2PA 1G5SA 3GCVA 3F2RA 2PMNX 3C4CA 3DJ5A 3ORKA 2XRWA 5H2UA 4TYHB 5IQFA 5H9BA 5DT0A 2BVAA 2J0LA 3DK6A 3SKCA 4QMQA 2VWUA 5HLNA 2I0HA 3DLZA 3VS2A 4DFXE 4HCTA 3ZXZA 5A4QA 4TNDA 4ARKA 4E6AA 2ACXA 5GJDA 1YI6A 3ZONA 2EXCX 1FMOE 4Z7GA 3C0GA 1LEZA 1FINA 4DH8A 3TM0A 4LV5A 2OJ9A 4U7ZA 4ZY5A 5EQYA 4L3PA 4FVPA 2OWBA 1FVTA 4GH2A 4EUTA 3OW3A 1OBDA 4YURA 4DG0E 3EQHA 2R3FA 3VQHA 4OBOA 4FSRA 3SRVA 1O6LA 2PPQA 4X0MA 3EQRA 3AD4A 3DK3A 2NO3A 3QLGA 3LJ1A 4UWYA 5AP1A 5H8EA 3GENA 3MVLA 5E91A 4ZSAA 5I9XA 2C5XA 4NZWB 5BX0A 5JFXA 3C1XA 1OBGA 5I9YA 4YJPA 2WB8A 4APCA 4F4PA 4BCQA 4KUJA 4FSZA 5HTBA 2O8YA 4RZWA 4Z3VA 4C36A 4I5MA 4Z7HA 3SDJA 3NNWA 4AFJA 5AUZA 3TT0A 3EQIA 5FP6A 4K11A 2IN6A 2Z7SA 5KE0A 5HNIX 1KV2A 1Q4LA 3NIEA 4IZAA 3EQBA 4DGMA 5I0BA 3F88A 2DQ7X 4BWXA 2PVLA 3OEFX 4J98A 2BAQA 1U54B 5ETIA 1UU3A 1PKDA 1ZRZA 2W4OA 2IVVA 2YIXA 4WHZA 3E8NA 3NCGA 3KXHA 2E9OA 3PP0A 2QG7A 1ZWSA 4BCNA 2YWPA 2F7XE 3JVSA 3P7BA 5TOZA 2GNFA 1PXJA 3C4EA 3PY3A 3EN4A 3F3VA 3ZSIA 4BGHA 2GTMA 4FIJA 4DEIA 4C4JA 5FDXA 3L9PA 1XH9A 4JAJA 2JAVA 4CGAA 2OK1A 4ANBA 3KGAA 4E4NA 4KRDA 4ZP5A 4QP1A 4XLIA 5EDQA 1XHAA 3R7YA 3EIDA 4MF0A 5HG8A 3MVHA 4BZNA 4Z55A 3S95A 3RPSA 3WE4A 3LCDA 4PMMA 2YERA 3IO7A 4XNEA 4R3RA 4F0FA 5HBEA 2W17A 2WXVA 2WMSA 4BIBA 2F2CB 4FIFA 2OO8X 4JVGA 4YHFA 5A46A 2RFDA 2GFSA 4F08A 4PV0A 2NRYA 4U97A 5LVOA 3NMUF 1IAHA 3NYOA 2YDJA 4EUUA 3TUCA 1GZ8A 4CG8A 1WCCA 4H3PA 1UKHA 2OBJA 4MNEA 3UNZA 3WILA 1GIJA 4QPAA 4IX3A 3HECA 4KAOA 3AC2A 2IVTA 2QOLA 3EQGA 5HTIA 1REKA 4FZAB 4C0TA 4EC8A 3A7IA 5EDPA 5CEKA 2VN9A 2PVHA 3DPKA 3H4JA 3HP2A 3DKGA 4UXQA 4EH8A 2HZNA 2B7AA 4XHKB 3WARA 1ATPE 3GCPA 1XH6A 4M84A 4FZ7A 4CKRA 2R9SA 5L6OA 4GS6A 4RIXB 4ENYA 3OD6X 4ONAA 5IZFA 5EI8A 4DEBA 1PMEA 3R2YA 2B1PA 3SC1A 4DT9A 3KCFA 2NPQA 5BNJA 5K9IA 2Z7QA 5JFSA 3ZO4A 4LRKA 2XJ2A 3FYKX 1KE7A 2HCKA 4G3DA 4L67A 1H8FA 3QYZA 2OIBA 3FHIA 4I21A 3I0QA 3F6XA 3FMNA 1QMZA 1YOMA 2XH5A 1YXUA 3EFWA 1OKVA 4CZYB 3I5ZA 3LHJA 4RVMA 3WZKA 5EKNA 4S34A 3EKNA 5DT4A 5AUVA 2VGPA 5HG9A 4GEOA 4S32A 4FMQA 3NIZA 5EG3A 3ZXTA 4DG2E 3EZRA 4HVDA 5BYYA 2QR7A 3D5UA 4X3FA 3MFRA 3PXZA 4RFZA 4EBVA 4PP9A 2XEZA 3E87A 3MTLA 2KTYA 4WIHA 4ZZNA 4QP2A 4EL9A 2IJMA 3QAME 4DLJA 2C68A 2W1IA 5CY3A 1W98A 3R8PA 4IVDA 2BZHB 4UY9A 2QOIA 4OLIA 2HIWA 4PDYA 5FQDC 4FL1A 2ZM4A 3PJ8A 4ZZOA 4FV5A 4YR8A 3QQHA 3ULIA 3DNDA 3B8RA 2VX3A 3QC4A 3BLHA 1TKIA 4X21A 3CJFA 3FL4A 4IIRA 2UV2A 1PKGA 5BUEA 2HELA 3LCSA 2WHBA 2UZTA 4TXCA 3O8TA 3UIUA 1XBBA 3MVMA 3SXSA 2BDJA 3A60A 2E9UA 4TN6A 3ZDIA 4BZOA 4EWQA 5C26A 5L8KA 4TZRA 4GJ3A 3D2KA 4YPSA 4FOCA 5EHYA 5CU0A 1IG1A 5LXMA 4I94A 4MBLA 2ESMA 3NWWA 5T68A 5FBOA 4J8MA 2X39A 1JWHA 1Q99A 4BCHA 3HAVA 5G1XA 3OOMA 3Q96A 5HD7A 2B52A 3HMMA 1IAJA 4FTRA 2AUHA 2QURA 1F5QA 4N0SA 2WQMA 1E9HA 4FSNA 4K18A 1YWRA 2X6DA 2XK6A 4ZMEA 4FOBA 5T6KA 1U4DA 2C0OA 3L8XA 2PVYA 3AD6A 3QZIA 4RJ8A 3VN9A 4DGNA 2YHVA 2QU6A 4LM5A 4QYHA 3TXOA 3TUDA 4YJNA 2R0UA 4PTCA 4O0WA 3KVWA 3WE8A 4ASEA 2HXLA 4ASZA 2BFYA 5KMNA 4JX3A 3FSFA 4I20A 4YC8A 4F70A 4KB8A 3R7UA 2XNEA 2YM4A 3W32A 1KE8A 3KRXA 5CSHA 4NCTC 5BPYA 1IA9A 3CXWA 3HX4A 5IEVA 3KKVA 2RG6A 3MIYA 4OTGA 3RPYA 2R3NA 4QD6A 5KUPA 3NCZA 5H3QA 3Q4CA 3VUKA 2BIKB 3DJ6A 3MH0A 2GS7A 2WFYA 3R22A 4YTCA 1YDSE 4E5BA 3F5XA 4H39A 1NT2A 5KCVA 4JL9A 4ZSEA 4BC6A 4ENXA 1H00A 3ET7A 3MDYA 4IQ6A 3GEQA 5FEDA 3VUDA 1JLUE 2R7IA 3MWUA 2A2AA 3F3WA 4UEUA 4A4XA 3QQFA 4GYGA 4YTIA 4S2ZA 4I22A 4IM3A 2A27A 4BDEA 2RIOA 5LMAA 4CFUA 4WA9A 2C5VA 5LQFA 3CJGA 4DN5A 2CLXA 3K5VA 3CLYA 4CVAA 4AT3A 5JGAA 5HNGA 3C4WA 2JBPA 1YHVA 2ITPA 4YBJA 3TJCA 3PPZA 5AP3A 4EQMA 4IJPA 3C50A 4FA2A 4E6QA 1Q62A 4JG6A 1B38A 2WMUA 4DLIA 2QOKA 3N4VA 2R3RA 4K0YA 2CKOA 2OJGA 3QBNA 3ETAA 3Q6WA 3VS6A 2FYSA 3G0EA 2JDSA 3G9NA 3Q9XA 5ETAA 5LVPA 5EQPA 4UBAA 3TACA 4N4SA 3BU6A 3COKA 5KHWA 3PWYA 2Y6MA 4KA3A 1XH4A 5DOSA 5AIRA 5HIEA 2VTMA 4QTCA 2BKZA 1FOTA 2OJJA 5E8YA 2ERKA 4EHZA 5ACKA 2ITVA 3FQSA 2C1BA 4LMUA 4QMMA 1UNGA 3BQCA 4DFNA 4AW5A 2YZAA 4IB0A 3LMIA 4ASDA 4ZTLA 2J2IB 1XBAA 2X2KA 2PMIA 4IHPA 3JUHA 4V01A 3BRBA 2QCSA 4WD5A 3GC7A 3QA0A 5L8JA 4E1ZA 3DJ7A 4IANA 5E8TA 3AC1A 4MD9E 2OJIA 2WO6A 2JIVA 3FKNA 4OTWA 4DE4A 1PXLA 4RA5A 3RNYA 4C61A 2W05A 5GIOE 4X2NA 2BMCA 2IZTA 1Z57A 1ZXEA 4WKQA 3H30A 3MS9A 4N70A 3NNUA 1PMVA 3PJCA 4Q2AA 2B9HA 3MY0A 1A48A 4PF4A 5H8BA 1YRPA 2GQGA 4EZ7A 1CDKA 2W5BA 5AWMA 5CSVA 2VWZA 1XR1A 4FR4A 2GFCA 5HVJA 4JRNA 5JGBA 2FSTX 3LCKA 5AAGA 3VF8A 3EYHA 3CQEA 3ZZWA 2DWBA 4P90A 3WI6A 1PXNA 5HIDA 4AZVA 1O6KA 3TZ7A 4D5KA 2GNIA 4MF1A 2VGOA 4M0YA 3AG9A 4C57A 2ONLC 1XWSA 4DA5A 4AZSA 3PLAE 2UZNA 1ZOHA 4RWJA 4AGUA 4JNWA 3TIYA 4BYIA 1DI9A 3MFSA 2Y0AA 4CMUA 3OCSA 4FTAA 4PY1A 4FZFB 3HLLA 4Q5EA 4XV3A 5EDRA 4X6QC 1S9IA 4C38A 3DAEA 4DEEA 3FLNC 4EWHA 3FEGA 4NW6A 4TKSA 4ZTQA 3G51A 3W55A 4AN3A 4FKGA 4MX9A 5D7AA 4W4WA 4CNHA 1A06A 2E9PA 2WIPA 3BPRA 3A7FA 4ZSLA 4O1PA 4RIOA 4YBKA 2CGUA 2JD5A 2CNUA 3ZEPA 4AXAA 3S3IA 5HG7A 2C30A 1PYEA 3NGAA 5KMOA 4O7ZA 2VTPA 1ZY5A 2CSNA 2PMOX 1OGUA 4RJ6A 2XP2A 5BVNA 3R71A 4QNAA 3AT3A 4LFIA 3IW5A 3OG7A 4OT5A 5F20A 4J7BA 4YSJA 2EWAA 4FSTA 4XV1A 4EBWA 3EQFA 4WBBB 4U43A 3D5VA 1DS5A 2J0KA 4FSQA 4IM0A 4EOJA 1H07A 4O91A 4HYIA 4NTSA 2CNVA 3PDTA 3RPOA 3QRIA 3NVKI 5HKMA 4X3JA 3AXWA 4RJ7A 4IFGA 4I41A 4G31A 4FNWA 1OIUA 2CN5A 2OZAB 4U5JA 3OP5A 2YN8A 4E7WA 1P4OA 4O0YA 3GNIB 1P5EA 2QOOA 2R3QA 3PZEA 3RKBA 1DM2A 3TV6A 2OICA 3R00A 1H28A 3D0EA 4QMYA 2QO2A 3QRKA 3OROA 5TR6A 5A4TA 4QMZA 2UZOA 5L2TA 2REIA 1G3NA 3ZRKA 2OW3A 1H1PA 5EOBA 3R9DA 2QR8A 4F7JA 1M2PA 2ZAZA 4KIKB 4M13A 3VJOA 4D2TA 2QLQA 3U6JA 4NYEA 3FI4A 3UO4A 4NIFB 3A7HA 3DGKA 2YM5A 4UZDA 3TZMA 2X4FA 3FUPA 4LRMA 2O2UA 4MHAA 3RCJA 3HUCA 4ZJVA 5L8LA 5CASA 3GC9A 1KWPA 3R7EA 5EQEA 3S0OA 4IAIA 3OY3A 5I9UA 3MSSA 1AGWA 4FV6A 4I0SA 3R8MA 3TV4A 3NVMB 5EKOA 4EJNA 4ZTMA 4PDPA 3RJCA 4HW7A 3TV7A 1Q8TA 4JAIA 4PWNA 1O6YA 1OPJA 3OF0A 4FNZA 3V6RA 5DR9A 4FSMA 2CGWA 2OLCA 3FAAA 1H0VA 2C3JA 4FTTA 2WTKB 4HGSA 1YXTA 3HUBA 4TWOA 3OWJA 4ZXTA 3Q2JA 3MFTA 3FMDA 4G5JA 5JT2A 3P7CA 4G9CA 4AW2A 3FLSA 1HOWA 1B39A 3PVGA 3V5JA 4D2VA 5CANA 3QTIA 2YCQA 3DXQA 2B4SB 2IW6A 3ORTA 3Q2MA 4APPA 3CCNA 3R8LA 3E3PA 5J87A 3V51A 4OBQA 5EK7A 1SMHA 2O5KA 5EHLA 3R83A 2WMTA 3CIKA 5EW9A 5IUIA 3R9HA 4AAAA 2CGXA 3IDCA 3QA8A 3G6GA 4RX8A 2QLUA 4TWPA 4B9DA 1J7LA 4YZ9A 3R8ZA 5L2QA 1Q24A 5M56A 3ORZA 4O83A 5DLSA 1SNUA 4F6SA 5M53A 2ZV7A 4JS8A 3FMHA 2P3GX 3FJQE 4J99A 2BPMA 3COHA 2B54A 2BILB 2JKQA 2C6LA 2VO6A 5BUIA 4JIKA 3ACJA 3PIZA 5GZAA 1UU9A 2OGVA 4MAOA 3UP7A 3IKAA 1FPUA 4PMTA 3P7AA 3GC0A 2XBJA 3PXQA 2RFNA 2F7ZE 4GFMA 4IEBA 3QCYA 5FG8A 3L9NA 3F5GA 4G16A 4RG0A 3OOGA 4ZTSA 4RX9A 3ROCA 5I9WA 5IA1A 3ZOSA 5IEXA 4NCTA 5DEWA 3S1HA 4ZLOA 2J50A 2VWVA 3JR1A 3E63A 2A1AB 4FV4A 3QTXA 1ZYSA 5A14A 4CFXA 3DOGA 2WQEA 3KF7A 4FNYA 3TNPC 2IPXA 4E6CA 4A9UA 5M57A 3UC4A 4LOOA 4L68A 1WFCA 2Z2WA 3FDNA 5I9VA 5IDPA 4JDKA 3WZEA 3I4BA 1ZAOA 3PYYA 3T3UA 4XCUA 4RIWA 4DINA 1R0PA 3Q9WA 4UALA 3CSVA 4JLCA 2UZEA 3L9LA 3R6XA 2XK4A 4ZOGA 4BCJA 3QLFA 5LARA 4NJ3A 4C3RA 1UA2A 4QQCA 4FGRA 3UOHA 5HE0A 4EOQA 4F9BA 2PE1A 3OMVA 4FTNA 4BDBA 4FV1A 4D1ZA 4XBRA 1OL6A 5I5ZA 2HW6A 4L46A 4M66A 5J8IA 5A4EA 5JQ5A 5CTPA 1URCA 5DHJA 4FG7A 5JSMA 2EXEA 3THBA 2OXYA 5AM7A 2JITA 3HP5A 3FL5A 1U5QA 4HZSA 4V04A 5FLFA 5CEIA 4PNKA 4MBJA 3NS9A 3C5IA 3FQEA 4CV9A 2O65A 4YO6A 1NY3A 4O0TA 5IUGA 3A61A 4PTGA 2PZ5A 3DTCA 4QMLA 3DFAA 1CKPA 4AS0A 2YDIA 5KO1A 2V5QA 4EOKA 3DDQA 1GZNA 3VHEA 4YMJA 4EK3A 5DRBA 4ZAUA 3FLZA 1KOBA 2BRMA 3O51A 4XV9A 3QQJA 4CMOA 5D1JA 5ITAA 5HBJA 4ZLYA 3QTSA 2W9ZB 1DI8A 4EQCA 2UW3A 3UNKA 5DPVA 2ZDUA 4RIXA 3UTOA 2ZYBA 4E3CA 3S00A 4EOOA 4EOPA 4Y8DA 5CF4A 4D4YA 2O0UA 2V62A 3DBCA 4GL9A 4BZDA 2NNWB 1JAMA 4MCVA 4NU1A 3QXOA 4PDOA 1RE8A 2W1GA 4N57A 3QTRA 3Q5IA 5DVRA 2YEXA 3V5QA 1QCFA 5IQBA 4F7SA 2J0JA 5J95A 4BI2A 4F9YA 4H1JA 4PMPA 3GT8A 3KY2A 5FRIA 3BLRA 3N4TA 3IW8A 4G3FA 2CKEA 2GDOA 2C1AA 2PK9A 4I92A 4XOZA 4C3PA 4FE2A 1Q3WA 1GY3A 4Y5QA 1BL6A 3EFKA 3E8DA 2CCIA 5HVYA 5FXSA 2JFLA 3T3VA 4KIPA 3R28A 4O82A 2PY3A 4JDHA 3PE2A 2J0IA 4W4XA 3VW8A 3OXIA 2Q0BA 3CY3A 5LJJA 3DAJA 2C6IA 4HPUE 4YJOA 3HA8A 2YIQA 4EH6A 3NW5A 2ONLA 2RFEA 2G2IA 2HYYA 2WTKC 3FXWA 4I0RA 4RWKA 5ACBC 3VS0A 1OUKA 5KX8A 2F4JA 4B8MA 3FZ1A 4XP3A 4RFMA 2BROA 3QUEA 3PVBA 1CTPE 3QTQA 4IZ5A 5DN3A 4Q9SA 5HD4A 5J1VA 4IBMA 4R7HA 2XIYA 3GFWA 3W2OA 2EUFB 3NUNA 3QTUA 2Z7LA 3CPCA 2ITNA 2Y4IB 1MRYA 2AC3A 2X7FA 3QXPA 4QTDA 2FVDA 4O0XA 4OBPA 4QYYA 3KREA 3VBVA 2WMRA 3ZM9A 3KF4A 5BVEA 1R0EA 4D4RA 5CXHA 4I4EA 3ZUUA 3D7TA 1Q8YA 4HVGA 2QOCA 4ZIMA 3SXFA 3ZH8A 2XCKA 5ANDA 4DEHA 2YLFA 5CSWA 1F0QA 3KCKA 2BUJA 3UO5A 4LGDA 4RFYA 3KQ7A 3VRYA 2C6EA 3Q60A 4IADA 3RM6A 5HG5A 2I40A 1YWNA 3HEGA 1JNKA 3UOJA 1SVHA 2WQNA 3LMGA 4RGJA 5CENA 3DBEA 1H01A 4IC8A 3QRJA 3LFNA 3P08A 3FY0A 4JDIA 3DT1A 4H3BA 3REPA 3VC4A 4FEVA 3KRWA 2XCHA 3QF9A 4FKJA 5BYZA 4ALUA 4HZRA 2VTJA 4IZ7A 3JS2A 3PSCA 4S30A 5EHOA 3IOKA 4EH4A 2UVXA 2CDZA 4P5ZA 4CD0A 4WNMA 3LZBA 3DNEA 2WQBA 5K4JA 2XNGA 2YIWA 3D9VA 3EN7A 3OC1A 3MGYA 1OL1A 1M52A 1APME 3TN8A 5IH4A 4R6VA 4QTAA 4TT7A 2GTNA 4Y46A 3T8OA 4FI1A 4L7FA 3RCDA 3ZM4A 4O22A 4FV0A 4Q9ZA 3PIXA 4AE9A 5IA4A 3ATTA 4QYFA 3UDBA 4IM2A 5FD2A 1NVSA 4M69A 2BHEA 4BGQA 4ANMA 3MN3A 1YHSA 4NWMA 3BGQA 5I9ZA 4ALWA 1MQBA 4R3CA 3CP9A 3WOWA 4HPTE 5KMLA 4CCUA 3OEZA 5LMKC 4R1YA 5IQGA 2DS1A 4YTHA 4AA4A 2R3PA 1JSTA 4I6BA 4G6LA 4PX6A 4NFNA 2XNPA 2XYUA 1ZY4A 4DBNA 2C6OA 4BDAA 2YABA 3C7QA 3K3JA 3CTQA 3BWJA 1E1VA 4GFGA 4HYHA 5DGZA 2JAMA 3RWQA 2IVSA 3I5NA 3OWLA 4YTFA 3LLAA 3M1SA 2QG5A 4D55A 1I44A 2BRBA 1YXVA 4L3LA 4P4CA 2XK8A 3MY1A 3LFCA 2FO0A 5KMMA 3R2BA 1W83A 3TI1A 2QQ7A 4C4GA 5CI7A 3MIAA 3UOLA 3ZFMA 3R02A 1M2QA 2BFXA 2UW4A 2GS2A 4DHFA 5J7HA 5JMSA 3PIYA 2VTTA 4DEDA 5AA9A 4DFYA 4YUQA 3WZJA 4Y73A 3DXNA 4BYJA 2H96A 3KXZA 3KXMA 4O86A 3GCQA 3OCGA 4UZHA 1BMKA 4V05A 5AIKA 3N4UA 2YISA 4QYEA 5AAFA 1OZ1A 4EZ5A 1KE6A 4NL0A 3O8UA 3PE1A 5ETFA 1T45A 2BKKA 2OKRA 4G3CA 3Q4ZA 2WD1A 5FXQA 4GSBA 4IWQA 4MXZA 3A62A 2YCRA 4L6QA 3PPKA 4FIGA 4F9WA 2AYPA 4EKLA 5E8WA 3TKUA 2XM8A 5CS6A 4I5HA 4EH9A 3P5KA 4D9TA 3F66A 2X2LA 3R63A 5E90A 3TIZA 2YJSA 5ANKA 3Q4TA 3PVWA 4PL5A 2R4BA 4LI5A 4QP7A 2A0CX 2XKCA 3C13A 3FZPA 4LGHA 4WSYA 4ZK5A 5TT7A 3U9CA 4ZLZA 4DTAA 3GI3A 1T46A 1G8SA 4Y72A 3D14A 3V01A 3VS5A 4EC9A 2UZVA 3KRLA 3ZLSA 5LCJA 3FMLA 4FKRA 3FI8A 3FBVA 5D41A 3VS7A 1RJBA 3QX2A 2QOBA 3KVXA 3LCOA 4KKGA 4BDFA 3G0FA 5K0KA 4B4LA 5CYIA 3R04A 3FMJA 4FTCA 3FC2A 3LFEA 4RC3A 4OAUC 4FEWA 3SD0A 3EJ1A 2UW8A 2QOFA 3R9OA 4GK2A 3WYYA 4EONA 1YDRE 3MB7A 5ANOA 5HCZA 5CEPA 1PHKA 2ZMCA 4KIOA 1Q61A 4D2SA 3DBQA 4U81A 4BRXA 3O96A 4IE9A 1V0OA 4OTQA 3BGPA 3LIJA 4M97A 2Y4IC 3UGCA 5K4IA 3ANRA 1JQHA 5E8ZA 2W4JA 2VV9A 3OCTA 3UP2A 1AD5A 2OG8A 3RGFA 3F9NA 2QD9A 3FPMA 1UKIA 2BAJA 3O7LB 2ZMDA 2CGVA 5AP2A 4NT4A 3SGCA 3CD8A 4LL0A 4UMTA 5EYMA 3UNJA 3PJ1A 1Q8ZA 3F3UA 4HCVA 4I4FA 5AR7A 5HBHA 3PUPA 2LAVA 3BWFA 5HESA 4XG3A 2FH9A 4EHVA 4U9AA 3FZRA 3I7CA 4W8DA 4EOSA 4JRVA 3HA6A 4A9TA 4YGAA 4EK8A 4FT7A 3QZHA 5ICPA 3ENHA 4WOVA 4BKYA 4G9RA 4FKVA 4EKKA 1LR4A 3NYNA 3V5TA 2CPKE 2J4ZA 2HAKA 5CZIA 3O71A 2PUUA 1R39A 4AP7A 4UN0C 4FTJA 1JSUA 1YXXA 3W33A 4RVTA 4F7NA 5CAQA 3KULA 2EXMA 4UMPA 4C2VA 5M07A 2GCDA 2W1CA 1Q3DA 4HGLA 3TNWA 1FVVA 2C3KA 4CFFA 3OTUA 5C9CA 3IK3A 3UO6A 5JZJA 4CZUA 1JVPP 3PA4A 4JIAA 4GJ2A 4BBFA 2C6MA 5EI2A 3KXNA 4CTBA 2VWYA 1P14A 1RW8A 4KIKA 2YAKA 2WOTA 1ZYJA 4EH7A 4NIFA 2HWOA 2CKPA 2JKOA 2PU8A 1H26A 5KZIA 5FUTA 4ACMA 2WKMA 3V6SA 2J5EA 2A4LA 3QTZA 4X6RA 3AQVA 4FICA 3RINA 2JDRA 4AF3A 2R7BA 4E73A 4M14A 3LM0A 4JT3A 5GZ8A 1YKRA 3E64A 5A4CA 4QQ5A 2G15A 4L45A 3F5UA 1JPAA 2B9FA 3NDMA 4G3EA 4IFCA 4FKOA 3QL8A 4YNOA 4BTKA 1TQPA 5GJGA 1PXMA 3SG8A 4LGGA 5HO7A 2Z60A 2PZPA 3AT2A 4KIQA 3W2PA 3VUIA 3QQKA 2YFXA 1PW2A 4JBVA 3C4XA 4CV8A 2XYNA 3DBFA 4M8TA 4D58A 3U51A 4XYFA 2WPAA 1OL2A 3IGOA 1W7HA 4QTEA 4O7SA 4PL4A 3WZUA 1K9AA 4I5CA 4D4VA 2BZJA 2W9FB 4MK0A 4FKIA 4RQVA 5CF6A 2BTSA 3PLSA 3F7ZA 4M3QA 5M4CA 1AQ1A 4PPCA 1QPCA 3DB6A 2X1NA 4BCOA 5HZNA 3UQCA 3R7OA 5M08A 1UWJA 3CE3A 3LFFA 4IVAA 4WG3A 2XKDA 1VJYA 5EW8A 4I93A 3RAIA 1H1SA 5A6OA 2R3KA 3PA3A 1PJKA 2WEIA 2DUVA 4BCFA 4DH7A 2BR1A 5L2IA 3BHUA 3WF5A 4C4IA 4YU2A 2ITZA 3SRVB 2I1MA 2BCJA 4Z9LA 3HRBA 3VUGA 4Z16A 2PVFA 3D83A 3G33A 2ETRA 4FSUA 2YAAA 5KZ0A 4XX9A 1CSNA 5J1WA 1JKLA 3MH3A 4GG7A 1BL7A 4B8LA 5D10A 3LXPA 4RWIA 5L6PA 4XOYA 4CFVA 4ZY6A 2YZLA 3FPQA 4NTTA 3A99A 4YZBA 5IA5A 4O2ZA 4R5SA 1OKZA 2Y4PA 4FZ6A 5F9EA 3OT3A 5C03A 4YC6A 1ZMVA 4F0GA 3QKMA 2WNTA 4RQKA 4I23A 3IW6A 3PPJA 4AOTA 5IU2A 3MPAA 4L42A 3DXPA 3C5UA 4QMNA 1GZOA 2HY81 3UZTA 3FWQA 3R1YA 5HO6A 5BMSA 5DWRA 4CCBA 3F3TA 3EN9A 1IR3A 3V5WA 2ZB0A 4LYNA 4J8NA 2Z02A 5LMKA 4M15A 4E4LA 4GIHA 2F2UA 1UU8A 4BGGA 4HNFA 3HGKA 4H3QA 4QMUA 2BRHA 3B2TA 2QKWB 4C4HA 4YPDA 4P2KA 4AA5A 1I09A 4JQ8A 1KOAA 4B6LA 4L01A 2XUUA 2GNGA 1OB3A 4FF8A 5JZNA 4U45A 5HVKA 2VWWA 4ID7A 4R5YA 4R7IA 3W8LA 3UE4A 1Y6BA 4DC2A 4AGDA 2YM8A 4ITHA 3WF9A 3OZ6A 2GNHA 2C3LA 3KFAA 4CFWA 3HZTA 3R8VA 4EH3A 5JFVA 1YWVA 5CWZA 4F1TA 2JKMA 3M2WA 3A4PA 4HGEA 3SLSA 4IZYA 2P2HA 4YNEA 4F6UA 4RSSA 3MVJA 5BVKA 4EOIA 3VVHA 2R3JA 3T9TA 2HOGA 2Y8OA 1JBPE 3EQDA 3ATSA 4E6DA 3QTWA 1VR2A 1ZYDA 5IUHA 4D2PA 2VD5A 2VUWA 4EHGA 4FIEA 3PA5A 2ZV8A 3I6WA 4PRJA 4U44A 4UWCA 2J51A 2WELA 4Y5HA 3BCEA 4RJ3A 3R7GA 4L43A 3VAPA 4AW0A 5FGKA 3QQUA 5CAPA 3FI2A 3H3CA 4YZMA 5K5XA 2WTDA 2JDOA 5AX3A 3AC3A 1ZOEA 3HMOA 5J5TA 4ZJJA 3EB0A 3UIBA 2OFUA 2OF2A 3ZLWA 5JQ8A 3O50A 2EB2A 5E8VA 1CKJA 1TQMA 2VNYA 3COIA 3PJ3A 3ZHPC 3B8QA 3OHTA 4BCIA 4ITJA 1ZLTA 4BKZA 2QONA 5E8SA 1J3HA 3VUHA 3K54A 4RZVA 4DITA 1RQQA 4LOQA 4KKEA 4QMVA 3FLYA 3HL7A 1UVRA 5HE1A 3ZC6A 3PY1A
chains in the Genus database with same CATH superfamily
5IH5A 1BUHA 4DF3A 2XNBA 3GU4A 3UODA 3UOKA 4GK4A 2X0OA 4FKQA 4FEUA 2QI8A 3JPVA 3QD3A 2JEDA 2VTRA 3VNTA 2OSCA 2CKQA 3QCSA 2C69A 2PVJA 3HRFA 2JFMA 4O81A 3KMWA 5D7VA 2BIYA 3NAXA 1TQIA 3FLWA 5HX6A 2UW6A 3RPVA 4CTCA 3P79A 4MXYA 2X9EA 5AEPA 4G1WA 5E9EA 3EQCA 4GV1A 3PZHA 1DAWA 1NXKA 2YDKA 3A4OX 4EOMA 2GS6A 3P0MA 2VO3A 5AADA 3VBYA 3NUYA 2PHKA 5IA0A 1KSWA 2W1DA 3BV2A 4LV8A 3KN6A 1MUOA 3E5AA 4K9YA 5KBRA 1L8TA 5CT0A 3D2IA 4FUYA 2IG7A 2WZJA 5CU2A 5IQDA 1KE5A 1SVEA 4HVIA 1PXOA 2ETKA 5ANEA 3VS3A 1M2RA 1PXPA 2V7AA 3RBWA 5FBNC 4CMTA 4UMRA 4BDJA 4C37A 3TTIA 1BX6A 2VAGA 4M0ZA 3UPZA 4DCAA 4FKWA 5BQ0A 5B0XA 3GOKA 5AR4A 1IRKA 1X8BA 1YOLA 2C0TA 5I3RA 5ETCA 2UW7A 4AN2A 2AC5A 2H8HA 4J95A 2W4KA 4GCJA 4TYHA 4CYJA 3UYTA 1WBVA 3ZLYA 1SYKA 3Q53A 4QPSA 2PULA 4L7SA 3UMWA 5CXZA 3TL8A 4C02A 5DRDA 1REJA 3NYXA 4OTIA 5BVOA 3OWPA 4IDVA 3FI3A 4I24A 4PUZA 3ZDUA 4ASXA 1ST4A 4V0GB 3EFJA 3I6UA 3O17A 4J52A 4C4EA 5L3AA 4BDCA 2OXDA 3TJDA 4BN1A 4GIIA 4ZY4A 5J9YA 4XRLA 3ZFXA 4HYUA 3AMBA 5FWKK 3KA0A 3MH1A 4ACGA 2IVUA 4B7TA 3O7LD 3F69A 2YCFA 4JQ7A 3LE6A 1K2PA 1ZOGA 3PTGA 3D7ZA 3P1AA 3KXXA 5HHWA 3ZO3A 1J1BA 2ITQA 2J7TA 2JC6A 3ML1A 3FQHA 3V04A 1QPDA 2W1HA 4FL2A 4HOKA 5ANGA 1SNXA 4C33A 4EK6A 3QGYA 4GU6A 4AOJA 4NK9A 3P86A 4IX4A 4TYIA 4NUSA 4G2FA 2BDFA 4QMSA 5FTOA 2OH0E 5H8GA 5B2KA 1W8CA 4FT0A 3MFUA 2Z7RA 4ZSGA 4N6ZA 1V1KA 4CLIA 2UZWE 2W99B 2C5OA 3AMAA 4UB7A 3UG2A 4PDSA 3MA6A 4UMQA 2IZUA 2XIZA 4BCGA 1LP4A 2FUMA 5G6VA 3ZEWA 3RNIA 1FGIA 2OZOA 4W4VA 4L52A 5EW3A 5HE2A 5C01A 4USEA 4GUBA 3TNIA 1U54A 2YM6A 3ALOA 3DDPA 4NM3A 3U9NA 2GMXA 3AOXA 4QP3A 2VWBA 3OS3A 1QL6A 5AV3A 4ZMFA 3LXNA 3EN6A 3BEGA 5CU3A 4BKJA 4L00A 4F64A 3ZSGA 1LPUA 3LCTA 3R9NA 2XEYA 2XMYA 4FG8A 1OIQA 3DZQA 4N6YA 2OH4A 3DKFA 3QX4A 5AP0A 4AX8A 3TNHA 4ZZMA 5LWNA 4NJDA 3RVGA 2X0QA 4WUNA 4MWHA 4C8BA 4XMOA 1OPLA 3PG1A 4CKJA 3RPRA 2I0EA 5KNJA 3FMEA 1Y57A 4BDIA 3BLAA 4IWDA 3QKLA 1OUYA 2BZIB 2BZKB 2XS0A 4MXAA 4A07A 1ERKA 3JY9A 3PSBA 4G5PA 3IONA 3NR9A 5AR8A 4CFNA 3Q52A 2AEGA 3FKLA 3PRIA 3TMOA 1XO2B 3OVVA 2GHMA 4M67A 4KD1A 4O27B 4RIYB 5IG1A 3ZU7A 2VTSA 2VTNA 4M12A 2F57A 5I3OA 3IG7A 4WRGA 4FKPA 4JJRA 2FGIA 3GOPA 2O3PA 4JBPA 3LKMA 1PYXA 4RVKA 4A4OA 4I3ZA 3PXKA 4R8QA 4LUEA 4F9CA 4OW8A 1YHWA 1QPJA 3ZBFA 4YHTA 3OY1A 5M51A 4PL3A 4YLLA 4QPMA 2QNJA 3U6IA 3RWPA 2KULA 3FMMA 3ZZEA 5DNRA 4H36A 4GG5A 5HU9A 1P4FA 5CEMA 5E1EA 2WTCA 3E7OA 4IACA 4EJ7A 4EH5A 3CY2A 4RBLA 4XP2A 3I81A 3FMKA 1BYGA 3VBTA 4NM7A 2PUPA 3QRTA 3BHTA 4QP4A 2WMQA 5L2WA 4NKSA 5IQHA 3OUKA 3B2WA 4BICA 5DEYA 1JKKA 3MTFA 2CLQA 1VLRA 2EB3A 4GU9A 5LCKA 4U42A 4DG3E 3KXGA 3RI1A 1F3MC 4U3ZA 2XJ0A 5HCXA 4F65A 3HMNA 4RT7A 5DA3A 4S31A 3PVUA 4UMUA 3W0NA 4RC2A 3U55A 2XA4A 4NEUA 1SM2A 3F7WA 3OUNB 1PRYA 4TYEA 5HE3A 4MVFA 2B9JA 4D0WA 1Z9XA 3VW6A 3KEXA 1GAGA 3QWKA 3R1QA 4O84A 2VRXA 2X7GA 2HXQA 3HDNA 4NKAA 5HNBA 4RLKA 3TCPA 3GC8A 5AAEA 2V0DA 2OIDA 1OL5A 3KRRA 2O64A 3VBXA 3VF9A 4LQMA 2X8EA 2UW5A 2C3IB 2WMAA 3MH2A 3V8WA 4RWLA 2X7OA 4A06A 5TO8A 3ODZX 2FSLX 3V3VA 4A4LA 4EEVA 5A6NA 3OT8A 5FTGA 3BI6A 2A19B 3Q6UA 5A4LA 4QP8A 4YJRA 3V8SA 3MI9A 2H9VA 3QUDA 4KINA 4I0TA 5E7RA 2OF4A 4EH2A 1TFFA 2EVAA 4XG8A 3W1FA 3CKWA 5AR5A 5EYKA 3ZUTA 3ELJA 2HZ0A 5KMIA 4QT1A 1PF8A 4RJ4A 3W10A 1P2AA 1W82A 2WEVA 5DMZA 3SW7A 1UV5A 1WVXA 3LFAA 4ANOA 3VIDA 1JKTA 3QKKA 5D11A 1K3AA 3GFEA 1B6CB 5AFVA 3IW7A 4E4MA 5IQIA 3O23A 4DDGA 4FKSA 3NAYA 2CCHA 1SZMA 4KABA 5DT3A 5CF8A 5L4QA 1ZZ2A 2HENA 1Y8YA 4XG2A 3QQLA 2XVDA 5HI2A 3HNGA 4JX7A 3H9OA 3PJ2A 2RGPA 4ALVA 5IF1A 3ZFYA 2P4IA 4F1OA 5L2SA 3BHHA 4ACDA 2R0IA 4OAVB 1H4LA 2B9IA 3FV8A 4QP6A 3G5DA 2VO0A 3O8PA 3C4ZA 1Q8WA 4AUAA 4BDGA 2YJRA 4DAWA 3KMMA 4MXOA 4WO5A 4CSVA 1CKIA 3W2CA 1Q5KA 1E1XA 1WBPA 4DEAA 4HCUA 3G9LX 4H05A 4WG4A 1VEBA 3MJ1A 3MPMA 4AOIA 4BVUA 1FQ1B 5CNOA 4TWCA 4U6RA 4L3JA 1G8JA 2WIHA 3PXYA 4C58A 4DH1A 5GJFA 4OTDA 3QFVA 4FV9A 3R7VA 2VZ6A 4G3GA 3DAKA 2IZSA 4PQNA 3ENMA 2GNJA 4ANQA 5HEZA 3SAYA 2PE0A 4FV3A 2IW9A 2ITUA 2DYLA 4YO4A 2QVSE 2XIXA 1IEPA 1UWHA 4IX5A 4H58A 4R78A 2IEWA 4DFUA 3HMIA 4FTQA 4QDVA 1O9UA 4R3PA 4BDHA 4W8EA 5HTCA 3EL8A 2H34A 4CEGA 4FTOA 1PXIA 4EHEA 3LMHA 5HLWA 4IB1A 3QU0A 4TW9A 4BF2A 3CGFA 2QODA 3NUAA 4RA4A 3W2RA 4GMYA 4BHZA 5AUUA 2B55A 4DFLA 4F63A 3WIKA 3ORPA 1JSVA 2C6DA 4HVSA 1HCKA 4JG7A 3QD2B 2R3HA 2XKFA 2YM3A 1ZZLA 1OIRA 4JR7A 2J5FA 4JQEA 3A8XA 4U79A 4AE6A 4FUXA 4BFMA 3ROYA 3V5LA 1U46A 4UXLA 3VBQA 3VUMA 1XH8A 5K5NA 3UG1A 2C5NA 2R3MA 3V5PA 5EYDA 1XH5A 3R1SA 4LRJA 3GQLA 2ZFYA 4X2FA 4FKUA 2PTKA 3M11A 2QOQA 3IW4A 4IWOA 2IW8A 4FT9A 2RKUA 1YXSA 2ZV9A 2HW7A 1U59A 4BI0A 3KN5A 4WNPA 4ANNA 3BV3A 3HDMA 3HAMA 4YZDA 3KB7A 3HV4A 4XP0A 1CMKE 3CGOA 4AAYA 1NVQA 5CNNA 2HZIA 3CQUA 4AACA 4D5HA 2Y7JA 3VBWA 2QU5A 3AD5A 4BB4A 4GVAA 5HO8A 5CEQA 3MW1A 3LFDA 4FNXA 1URWA 3NUUA 4X7QA 2XJ1A 4D28A 2B0QA 3ULZA 3BE2A 3LLTA 3AT4A 3QGWA 2JBOA 1WBSA 4I1ZA 5CVHA 5DR2A 4ZS4A 3LAUA 4D1XA 4Y85A 3LXLA 3L9MA 2VTHA 3DZOA 4XH6A 4ACHA 3L8VA 4RIWB 4QMWA 1TVOA 3CTJA 4F99A 3G6HA 5HU3A 1H08A 3JY0A 5CEOA 4MD8E 4CRSA 1Y91A 1U5RA 3ZO2A 1OKWA 4BTMA 4OUCA 5DI1A 5KBQA 3BEAA 2PMLX 3IQ7A 4KBCA 5FEEA 2ZOQA 4IMYA 3WF6A 4O7NA 4R7BA 5AJQA 1H1RA 4QYGA 2QKRA 4TNBA 2VTIA 3BU3A 5CALA 3LXKA 4Y95A 5AV2A 5CZHA 5JKGA 5M4FA 3IDBA 3AMYA 3C51A 3H0YA 2GU8A 4ERKA 3BQRA 3GU6A 4XG4A 2JGZA 3GBZA 5E8XA 3NEWA 3UVQA 2FA2A 3ZUVA 5DYJA 4CYIA 2GHLA 3PWDA 5FTQA 4BIEA 2J9MA 3FZOA 3R30A 3NUSA 3P9JA 4NH1A 1ZARA 2W7XA 1A9UA 3LOKA 4R77A 4FVQA 2JKKA 3AKLA 3ORIA 3QRUA 3BHYA 3COMA 4IDTA 2WTWA 5AM6A 5E92A 3UDSA 3IECA 3KL8A 2ZJWA 3G2FA 4MXCA 3RZBA 3PXRA 5TF9A 3BX5A 4EK4A 1Y8GA 5IQCA 3U87A 5BVDA 3OCBA 3VO3A 5HCYA 4DGLC 4BBEA 2J90A 5FM3A 2R3GA 2RFSA 3CS9A 3ZRLA 5HX8A 2F49A 4TYJA 4E93A 5T3QA 2WTJA 4K33A 5IDNA 3RAHA 2PZYA 4RPVA 2JIIA 4B99A 4P7EA 4AZWA 5CAUA 1XQZA 5HQ0A 3NZ0A 3GB2A 5AX9A 3VWAA 4K8AA 4O7RA 4B0GA 1WAKA 5IQAA 4O7LA 1OM1A 4DTKA 3IGGA 5C1QB 4FSWA 4KBKA 3SHEA 3WIGA 2BRNA 3POZA 2NYAA 4WBOA 1UNLA 2VX1A 2XK9A 4OTFA 1QPEA 1S9JA 3ERKA 4FT3A 4C62A 2ZM1A 2VX0A 2ETMA 1OMWA 1V0PA 4O21A 5BVWA 2WTIA 3S4QA 2PL0A 4EOLA 4ZTRA 3FY2A 3HYHA 2QHMA 4DFZE 2XIKA 2OZAA 5B2LA 2XNMA 5A9UA 5FEQA 4M68A 1WBOA 2BRGA 3DKCA 2RF9A 3F5PA 4U3YA 4X2KA 2X8IA 3GU7A 4L9IA 5HLPA 4K6ZA 4BWPA 5EM8A 5FDPA 3I1AA 2R3IA 4OR5A 3LPBA 4H1MA 4OGRA 4PMSA 3GUBA 3C9WA 3JYAA 4M7IA 2F7EE 5C27A 4AG8A 3QD4A 1Q41A 4CLJA 2BALA 1EH4A 3VJNA 4A9SA 4GT3A 2PUNA 2WMVA 5AUTA 1H24A 3W0PA 3U4UA 2RL5A 1OKYA 2WMXA 4IAFA 3KK9A 1YOJA 4CFMA 4O4DA 3BZ3A 4RX5A 4AZEA 3G90X 2E9NA 4AWIA 3DTWA 2Q0NA 4XG7A 5DH3A 4FV2A 5IEYA 2O63A 2WU6A 2X81A 2GPHA 3Q04A 3DK7A 5E4HA 4A9YA 3LJ0A 4F1MA 5AV1A 5JEBA 1LUFA 4FTIA 2E9VA 3N51A 1OL7A 5EM7A 3EKKA 5GZ9A 3SXRA 3NUXA 2CN8A 2J0MB 3ORNA 3Q5ZA 3SA0A 3F2AA 3LFBA 5DBXA 4BWKA 5KKRB 4AXFA 1UNHA 3DU8A 5KMJA 1M14A 2IO6A 1YW2A 2G2HA 3D7TB 3G15A 1R78A 3ITZA 4I6QA 3ZCLA 4TYGA 5M44A 4AN9A 4DDIA 2SRCA 4X2GA 3TKIA 1JOWB 2JIUA 4AW1A 2ITYA 3U8WA 4MTAA 1GNGA 1HCLA 4Y83A 5GIPE 4YSMA 3LFQA 4ZS0A 3VHKA 3BE9A 3EL7A 4IC7A 4EZ3A 4JI9A 2IWIA 5B2MA 5BYLA 4O0SA 2H6DA 3RK5A 3RMFA 4BDDA 4CQGA 3F3ZA 2I0YA 3FZTA 4V0GA 4PTEA 4A7CA 3UZPA 5FM2A 4QMTA 3NRMA 3RM7A 1H25A 5F95A 3TG1A 4G17A 4IB3A 5JFWA 4DFBA 5KMKA 3AKJA 3TDVA 3NLBA 3R0TA 4HYSA 2XKEA 3TKHA 5DR6A 1YVJA 2UVYA 3N9XA 2J6MA 3E7VA 3DBDA 3GU5A 3FKOA 3NUPA 4FVRA 5LMBA 3R9RA 4MEDA 3UZRA 3QC9A 3R1NA 3HV6A 3MV5A 3PFQA 3RTPA 1J91A 4JDJA 4O4EA 4ZEGA 5M06A 4DTBA 3HVCA 4JR3A 4RC4A 2W96B 5M4IA 2RG5A 3D5XA 3KMUA 4AA0A 2WTVA 4S33A 3BELA 2XF0A 4DGGA 2HZ4A 3AC5A 4F09A 3NPCA 2WOUA 4QQJA 4WSQA 1STCE 2YLEA 1NW1A 4E26A 3WF8A 2LGCA 3FXXA 5A54A 4FYOA 3ZO1A 1M17A 4M69B 2UZLA 4Q5HA 4L44A 5IMEA 2YM7A 3HMPA 4UWBA 2BDWA 4WNKA 5JK3A 4LMNA 2GHGA 2UW0A 4YZCA 4DH5A 3GCUA 4ITIA 4W9WA 3A2CA 2E2BA 4QRCA 4KS7A 4EI4A 5LWMA 3W0RA 4MH7A 3BBWA 3EYGA 4IVCA 2EU9A 4TTHB 3PY0A 4CZTA 1WZYA 2OXXA 4MXXA 5M55A 1XJDA 5F1ZA 4R1VA 3JVRA 4GKIA 3O5AA 5IQEA 3MBLA 2V7OA 2PE2A 3SOCA 2XNNA 3BYMA 4AQCA 4FJVA 1W2CA 5C4LA 2PSQA 4KS8A 4IW0A 2XZSA 4ERWA 1ND4A 2X6EA 4O0RA 2YACA 4YJSA 3PRFA 5AR2A 5AUXA 2NP8A 3LM5A 5HOAA 4F0IA 4O38A 4U40A 4O0UA 5ANJA 4LOPA 3HRCA 5CT7A 1GIIA 1MP8A 4RMZA 4QMXA 5DG5A 4CRLA 4GKHA 5CAOA 2ITTA 2W5AA 5EYCA 3LFSA 2BTRA 3OXZA 4BHNA 5TE0A 4D4SA 4FGBA 3IDPA 4AGCA 2CMWA 3D94A 3R8UA 1WMKA 3IPHA 4E5AX 4NW5A 5CX9A 4HGTA 3ZTXA 2HY0A 4RLLA 4FEQA 3W0MA 4ORKA 3SV0A 1OVEA 2CJMA 3KK8A 4RIYA 3L8SA 2OIQA 3CR0A 4QO9A 2R5TA 3SOAA 4USFA 2VTAA 1OECA 3QCQA 5M4UA 4O7WA 4BIDA 4XJ0A 3EFLA 2FB8A 4OTPA 3UMXA 4AZFA 4WT6A 1XH7A 3C0HA 3QZFA 4C34A 3PG3A 4FZDB 1WBTA 2F9GA 3FHRA 3K5UA 4FT5A 3FXZA 1M7NA 2UZBA 2JDVA 4W4YA 4U0IA 5CSPA 4O7VA 3PSDA 5F94A 1W0XC 5IH6A 4G6NA 3TYKA 4U80A 3AGMA 4U8ZA 2RSVA 4YJQA 3BKBA 3CKXA 2GQSA 2C4GA 3EMGA 3UVPA 4MNEB 4KBAA 5IPJA 3TUBA 2XANA 3KC3A 1FVRA 2I6LA 5AMNA 1KE9A 5CF5A 2GSFA 3TDWA 4AT5A 3NNVA 4L53A 3LJ2A 3W2SA 1VYZA 3QZGA 3LW0A 5CU4A 3M42A 2XNOA 3IOPA 3Q9ZA 3DS6A 3WZDA 4FKLA 3CEKA 4QQTA 4TRLA 2UUEA 3ACKA 1R3CA 4OTHA 4FTUA 3RHXA 2X0GA 2ZV2A 2VWXA 2VTOA 3EH9A 2VNWA 3GVUA 4D0XA 5D9HA 4UYAA 2UZDA 4GUEA 2HK5A 5DFPA 4U41A 4BTFA 4YZNA 5LOHA 1G8AA 2W5HA 3HV5A 4F7LA 2I7QA 3BIZA 3DKOA 3GXLA 3POOA 5C4KA 3TTJA 3K3IA 4E5WA 1ZYCA 3HV7A 4FODA 3WYXA 3S2PA 4K77A 3BYOA 1PXKA 2XIRA 2Y9QA 5TKDA 2QHNA 1LEWA 4CKIA 4CG9A 3EN5A 2FSOX 2X2MA 5EM6A 4GT4A 4JBQA 5BMMA 2X8DA 4O6EA 4YP8A 5JRSA 5C8KA 2IF8A 4EK5A 3VRZA 2WGJA 2PUIA 4MBIA 4DYMA 4X2JA 3E8CA 4FTLA 4JOAA 5IA2A 3U4WA 1ZMWA 4FTMA 2UW9A 3ZS5A 4BCMA 2WU7A 4JXFA 2C5YA 5CU6A 3CPBA 3RALA 1OI9A 4O96A 3UYSA 4D9UA 4DEGA 3NNXA 4KRCA 4BTJA 4C7TA 5KKRC 1WVWA 2V55A 1GZKA 3LQ5A 2W0JA 2XB7A 4FEXA 1MQ4A 3FSKA 3FYJX 1YQJA 4FK3A 3DY7A 2OI4X 3DQXA 4UYNA 4ZJIA 4X3FB 3ZBXA 5C8NA 3L8PA 2P0CA 1SVGA 3OTVA 5EH0A 3QALE 5F4NA 5GINE 4IAZA 4YJTA 4E4XA 1Q97A 3MY5A 4IJ9A 3H0ZA 1H27A 3RZFA 2PVRA 3C0IA 4IAAA 3ZSHA 3SG9A 3Q32A 3ODYX 4QOXA 4BR3A 2PVMA 1ZYLA 3T9IA 1NA7A 4HNIA 4WUAA 5J9LA 3DB8A 3E92A 4CXAA 4FRFA 3LVPA 4QMOA 4GYIA 3LQ3A 4O6LA 3KULB 4ANSA 2OJFE 3EOCA 1PY5A 3BLQA 3EZVA 4OTRA 5J9ZA 1RDQE 4O7YA 3GCSA 4IWPA 1VYWA 2YA9A 3SW4A 4DCEA 4G6OA 3GU8A 4BY9E 3MESA 4BI1A 3VULA 4CQEA 3HV3A 5AUYA 2VWIA 3FZSA 3OBGA 4YJVA 3R7IA 4CT2A 4XUFA 2ITWA 4IH8A 4W9XA 2Y6OA 2WMBA 2YIRA 3I79A 3RAKA 3PFYA 2YWVA 4DT8A 3NW7A 1WBNA 1YI3A 3R73A 3QUPA 4J71A 1FMKA 2AQXA 2PVKA 4YLKA 2XBAA 1IASA 3MYGA 4XBUA 3BYSA 4PPBA 4IXPA 3I0OA 4QTBA 4USDA 4TY1A 2P2IA 2GNLA 2P33A 3NSZA 4JG8A 5LVLA 1MRUA 2B53A 3UIMA 2P55A 3UIXA 2QO9A 4TL0A 3D5WA 2I0VA 3E93A 1NVRA 3P78A 4E8AA 3P5JC 1XBCA 4GVJA 3VS4A 4AU8A 1CM8A 3QQGA 3DCVA 3UPXA 1UU7A 3P4KA 1FBNA 3AGLA 2CNQA 4YJUA 3H9RA 3C4FA 2PVNA 5DIAA 2X9FA 3RHKA 2UZUE 3TWJA 4OT6A 3DA6A 4C2WA 3DV3A 3NW6A 4GT5A 2GQRA 4J97A 4EQUA 3D4QA 5BUJA 1PMNA 1GOLA 3OFMA 4XS2A 4MKCA 3E88A 4MWIA 3TZ9A 3ID6C 1BI8A 3ZLXA 5IMXA 3ALNA 4KSQA 3ZRMA 3FC1X 3L1SA 3FLQA 3F2NA 5EI6A 1V0BA 4C59A 4FK6A 1GJOA 4TWNA 5C8MA 5J79A 1JKSA 3P23A 4EORA 4F9AA 3Q3BA 4D2RA 5B7VA 4BCPA 1YI4A 2G01A 4O4BB 5AP6A 4NYEA 1DAYA 1OITA 4J53A 4O2PA 1J7UA 3ANQA 4C3FA 3DQWA 2UVZA 3PXFA 1H1QA 1J7IA 2Z8CA 1YDTE 2ZB1A 4C35A 5K0XA 3EWHA 4PPAA 4RVLA 4XG6A 3SQQA 4L8MA 4IX6A 4ACCA 2C6TA 4A9RA 1KUTA 5EOLA 5IKWA 2FSMX 3A7JA 3K2LA 5HORA 5JRQA 3NX8A 5JGDA 4LUDA 5FP5A 3ZYAA 5KHXA 3KU2A 4GRBA 4GFOA 5ANIA 3R01A 3CTHA 3W16A 3I7BA 3MA3A 4KNBA 2ZM3A 4NM0A 4NM5A 4QMPA 4YHJA 4MQ1A 2WMWA 4E20A 2W06A 2YCSA 2NRUA 5CAVA 4UX9A 3DLSA 4BL1A 3F61A 3QD0A 4FIIA 3JXWA 2R64A 4I6FA 4O0VA 4XEYA 4ZTNA 5K3YA 2X4ZA 1OIYA 3BGZA 3WBLA 3RK7A 5M09A 3LQ8A 5A3XA 2YITA 2JDTA 4TPTA 2PWLA 4IAKA 4YC3A 3KRJA 3BBTB 3GGFA 2R3OA 4FIHA 3GP0A 4O4CA 5CLPA 2Q83A 2HWPA 2C0IA 3FE3A 4JBOA 2QOHA 3OXTA 2VTQA 1KV1A 3AC8A 3H9FA 3VUTA 2XK3A 4DBXA 3U6HA 3E62A 3VONA 1BLXA 2C6KA 3CC6A 3HKOA 4GW8A 4F6WA 5CI6A 3QWJA 2G1TA 4RJ5A 1M7QA 3E8EA 3RP9A 5AP5A 3W18A 4BDKA 3A8WA 5HGIA 1IA8A 4K2RA 1FGKA 2BAKA 3A7GA 2XM9A 2C47A 5AUWA 4ZSJA 1J1CA 2WQOA 4WRSA 5GHVA 3BYUA 4PNIA 4FTKA 5HICA 3EHAA 1Q8UA 4AZTA 5HIBA 3QHWA 4FV7A 5IA3A 3UQGA 3D15A 4MD7E 2W1ZA 4IVBA 4O7TA 4J96A 1W84A 3I60A 3H10A 4X3FC 2OU7A 4FSYA 4KSPA 4KWPA 3U54A 2PZIA 4WG5A 5CSXA 3WF7A 3UQFA 4BJJB 4FG9A 3O0GA 4HJOA 4QP9A 3BU5A 4G34A 4NFMA 4RRVA 3UC3A 5IISA 4J1RA 4D2WA 1R1WA 3II5A 3UVRA 4EYJA 1L3RE 4WNOA 3PUFC 3F82A 3V8TA 2G9XA 1VZOA 3MPTA 1MRVA 1H1WA 2G2FA 2YIYA 5D12A 5CQUA 5CVGA 4LL5A 5AR3A 4AT4A 3ORMA 2W1FA 5E8UA 4PP7A 5EFQA 5JH6A 2W1EA 1BI7A 4HVHA 5LVMA 4FBXA 3UJGA 4AGWA 3ZC5A 4BBMA 5I4NA 2OFVA 2X0PA 3AC4A 3VS1A 4BCKA 3Q4UA 3UDZA 3QHRA 1Z5MA 5J5SA 1Y6AA 4C4FA 4I5PA 2IZRA 3QYWA 3BHVA 4XV2A 1H0WA 2PZRA 4MYGA 1PMUA 5CQWA 1WVYA 4O1OA 5AP4A 5AA8A 3O2MA 2CHLA 3W2QA 3ORLA 3IS5A 5L6WL 2QC6A 4YLJA 5FXRA 3R21A 3NYVA 4FL3A 3ZMMA 3TEIA 5AV0A 1OPKA 4FKTA 4FX3A 3MB6A 2WAJA 4MUQA 4P5QA 4K1BA 2JLDA 3Q9YA 3CD3A 2ERZE 4QNYA 3VQUA 5J7BA 5JN2A 1GIHA 4ZTHA 2ITXA 4XLVA 5CVFA 4I6HA 5LVNA 2XRUA 3MJ2A 2QO7A 2R3LA 3BYVA 4MQ2A 2XK7A 2VU3A 5EM5A 3DFCB 4GK3A 3RK9A 3CBLA 3CQWA 4XG9A 3TZ8A 3UBDA 4EYMA 3W8QA 4DGOA 2VTLA 3ORXA 4IB5A 3OWKA 5E1SA 5BVFA 3QCXA 3EQPA 4UV0A 5DE2A 3SX9A 2V22A 4CT1A 3OW4A 1ZMUA 2ZDTA 4AFEA 4MNFA 3TNQB 5AP7A 4ANLA 3E3BX 5AV4A 1XMLA 3GQIA 1BKXA 3OBJA 4RX7A 3RAWA 4FC0A 4NSTA 1WBWA 4XRJA 4FV8A 2BHHA 2VO7A 4DH3A 3SVVA 4LG4A 4FYNA 3PP1A 4IAYA 2ITOA 4KKHA 2PYWA 1XKKA 4II5A 4D1SA 5GNKA 2ZVAA 2R2PA 1G5SA 3GCVA 3F2RA 2PMNX 3C4CA 3DJ5A 3ORKA 2XRWA 5H2UA 4TYHB 5IQFA 5H9BA 5DT0A 2BVAA 2J0LA 3DK6A 3SKCA 4QMQA 2VWUA 5HLNA 2I0HA 3DLZA 3VS2A 4DFXE 4HCTA 4QEBA 3ZXZA 5A4QA 4DHIB 4TNDA 4ARKA 4E6AA 2ACXA 5GJDA 1YI6A 3ZONA 2EXCX 1FMOE 4Z7GA 3C0GA 1LEZA 1FINA 4DH8A 3TM0A 4LV5A 2OJ9A 4U7ZA 4ZY5A 5EQYA 4L3PA 4FVPA 2OWBA 1FVTA 4GH2A 3BL7A 4EUTA 3OW3A 1OBDA 4YURA 4F78A 4DG0E 3EQHA 2R3FA 3VQHA 4OBOA 4FSRA 3SRVA 1O6LA 2PPQA 4X0MA 3EQRA 3AD4A 3DK3A 2NO3A 3QLGA 3LJ1A 4UWYA 5AP1A 2XALA 5H8EA 3GENA 3MVLA 5E91A 4ZSAA 5I9XA 2C5XA 4NZWB 5BX0A 5JFXA 3C1XA 1OBGA 5I9YA 1XMMA 4YJPA 2W