3FC1X

Crystal structure of p38 kinase bound to pyrimido-pyridazinone inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELIWEVPERYQNLSPVSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Evaluating the molecular mechanics poisson-boltzmann surface area free energy method using a congeneric series of ligands to p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fc1X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fc1X01
2GNFA 1FBNA 3MI9A 4UYAA 3PLAE 5JFVA 4AOTA 3ZBXA 2E9VA 3BCEA 5HHWA 5AP6A 1P5EA 5JGAA 2JAMA 5F20A 3U6HA 2WMSA 3BLRA 4MXXA 1FVRA 4GT4A 3RBWA 3ROCA 4U3ZA 2FO0A 3Q4ZA 4BZNA 2XH5A 3DTWA 4U7ZA 1SMHA 4QQJA 3EQDA 4IZAA 3VS0A 4CZUA 3SC1A 4F6WA 5E8XA 5JZJA 2ZMCA 2RG6A 1OBGA 3UODA 1OL1A 5IQBA 3QF9A 4ZSGA 2JIVA 1OIYA 4FTMA 1YI3A 3ACKA 2JIIA 3VBQA 1P4OA 2PMIA 3F5PA 2VN9A 1PKGA 3PXRA 1BX6A 1NA7A 4JBVA 4OTHA 1OIQA 3FPQA 3UYTA 4MXAA 3UP2A 3E3PA 5CALA 2RFDA 2OZAA 4U43A 2BAKA 4XX9A 3PLSA 2BCJA 3E64A 3G0EA 5HO8A 5J95A 1AD5A 4E73A 3U55A 3HGKA 3NWWA 4YJOA 4U44A 3DBEA 5JT2A 3CIKA 5C03A 4ANMA 2HW7A 3AC4A 3ZLSA 5LARA 2ITUA 2UZOA 3Q53A 1XH4A 2PTKA 5GJFA 1JLUE 2BDJA 2R3PA 2FGIA 3K3JA 3KXXA 3R22A 3WF9A 4D0WA 2QKWB 4O96A 2UV2A 4C34A 4M7IA 2WMAA 4ENXA 4F4PA 5AR8A 2UW9A 3MFUA 2C3KA 3F9NA 4JQ8A 4M97A 3W2RA 3KK9A 5IISA 2WTIA 1RDQE 3AGLA 2B54A 5KBQA 4C4EA 5EQEA 4DHFA 3C4EA 5BQ0A 2W4OA 2QCSA 2C6EA 3EQIA 5G1XA 4TNBA 4HYHA 3PJ2A 4PP9A 4MQ2A 2WIPA 4PWNA 4ALUA 1S9IA 3ZTXA 4APCA 2ZJWA 5K0XA 2QG7A 4GVJA 5TR6A 4Y73A 3HDMA 4L8MA 4I21A 2JFMA 3O17A 2VUWA 5DGZA 3N4TA 3RAWA 3PG3A 1H07A 4D55A 1DI8A 4F7NA 4QMZA 1VYZA 4I5MA 4BBMA 4I4EA 2YABA 1IASA 2UVYA 2OGVA 3P7BA 1CKJA 1QPJA 4FC0A 3D15A 2IG7A 4NCTA 4GK4A 3NDMA 2WQNA 4UXQA 2XNMA 4RJ3A 3HRBA 3V01A 3ZC5A 4WRSA 3DFCB 5CY3A 1PXLA 4CCBA 3R0TA 4CSVA 4ZTHA 5CYIA 5BMMA 2ZMDA 4D58A 4O0UA 5KZIA 4PL3A 4HZRA 3K2LA 4DTAA 3GU7A 4IVAA 4KIKB 3LVPA 4FZAB 2G9XA 3GVUA 1UU9A 3KFAA 5LMKA 3JY9A 3OZ6A 4O0RA 4O1OA 3UVQA 5IPJA 5M07A 2YCRA 4PTGA 5DR2A 3O23A 5HNBA 4DLJA 1HCKA 2FA2A 3HV3A 3U9NA 4EBWA 1V0OA 4IJ9A 4E4MA 3SVVA 1K9AA 2ACXA 2XB7A 5KMNA 3UPZA 2W5BA 2PYWA 2QVSE 2ITOA 3RMFA 1SM2A 2NP8A 1BYGA 3IONA 5C8NA 3UPXA 4RFZA 2IVSA 2CNUA 4LOOA 3OCTA 2H8HA 5CU0A 1Q3DA 4I5CA 2RF9A 5D41A 2R3QA 2WTKB 5EDQA 3TKIA 4FIIA 2RFNA 1PY5A 3QTXA 2QOCA 1G8SA 4HZSA 3N9XA 4U81A 4JQEA 2CGUA 4WT6A 3TIYA 1SYKA 3F2RA 3FZOA 3TDWA 4DCAA 2XCKA 3OCSA 4P5ZA 2V5QA 2VTNA 1O6LA 4O0YA 5B2MA 4G2FA 3R2BA 4FNWA 2BR1A 4I23A 2PVLA 1FVTA 3P7CA 4Y83A 3IECA 2O2UA 2CGVA 3LJ1A 4FSUA 4JDHA 4WG5A 4X6RA 2EUFB 2C30A 2WQBA 4HJOA 5HLNA 4NM7A 4QP8A 1K3AA 1Q8TA 3UDBA 5FRIA 4JJRA 3WBLA 3WE4A 1FMOE 2PUIA 3DDPA 4GS6A 4FT0A 4I6FA 4P5QA 3CQEA 4AX8A 3LW0A 3ETAA 3NW7A 4GG5A 3EH9A 1H0VA 5JK3A 5KUPA 2Z7RA 4K11A 2BAQA 3DOGA 4UX9A 3OVVA 4KIKA 3HV7A 2O8YA 3MH1A 4WKQA 1ND4A 4O7RA 2Y4PA 4MX9A 4ZS0A 3PY1A 3ZO1A 3A61A 3HMOA 4XUFA 5AR5A 2UZTA 4CCUA 2UZNA 5T3QA 3ZLYA 2XJ0A 2XBJA 3RPOA 2CCHA 1OVEA 3DT1A 3EQBA 5J9YA 3RZBA 4AZWA 5LWMA 5I9UA 3GU5A 2YZLA 3BHHA 3PG1A 3FHIA 4C4GA 4MVFA 3GENA 4ZTLA 3FSFA 3SGCA 2CNVA 3ULZA 4OAVB 5A4TA 4RVTA 2UW0A 4JVGA 3MGYA 2HCKA 4Z16A 4ALWA 4ZSJA 4DA5A 4X7QA 3RM7A 2CKPA 4XJ0A 3RNIA 3ERKA 3FHRA 2GTNA 2B52A 3OUKA 4XH6A 5LMAA 4G6LA 3CC6A 1UNHA 1O9UA 2Y0AA 3W18A 4AGDA 1JVPP 3DQWA 3AMAA 2FYSA 1YDRE 4KNBA 4C59A 4C4FA 2PMLX 5CLPA 1OPLA 5DN3A 4XV2A 4RIWB 5DPVA 4ANLA 3H3CA 5HE0A 4GVAA 5KBRA 5DVRA 4L45A 5ETAA 5A54A 4AZEA 4TWCA 3UYSA 1QMZA 3LOKA 4EOPA 3BHVA 1K2PA 4Y72A 3ODZX 3G33A 4DGGA 1OMWA 4FKGA 3GU6A 5LMKC 5IQDA 2EB3A 3LLTA 2BZJA 4M68A 3NYVA 3W2CA 4ZK5A 3CTJA 3SDJA 4U5JA 4QYFA 3ZOSA 4F64A 1NVRA 4WNPA 3ORMA 4ZLYA 2C4GA 4AW1A 2ZDUA 4EH7A 3OEFX 2VGPA 3F3VA 4FIGA 5I9VA 1YHSA 1W83A 3DNDA 4IBMA 2XM9A 4YU2A 2X4FA 2ETKA 2C47A 2R3RA 4XYFA 1RJBA 3LQ8A 5DI1A 3TI1A 4AT4A 2QQ7A 4GK2A 3RI1A 2JKKA 2YM8A 2I0HA 5AX9A 3VJNA 2GS6A 1ZMVA 3FI8A 4WG4A 1XO2B 2W99B 3LE6A 3NSZA 4LI5A 2PHKA 4F09A 2VAGA 1W82A 1KE6A 3W10A 4AQCA 4HVHA 4G5PA 5CU4A 4D5HA 3PRFA 3TNIA 4UZHA 4DEHA 3E62A 3UQFA 2EVAA 3DCVA 1Q8ZA 4G3EA 5HG7A 3RM6A 3ZHPC 4EOLA 2WQMA 4N6YA 5IMEA 5M51A 2GFCA 4JG8A 2R0IA 4O82A 2GNIA 2C6TA 4F1TA 3Q4CA 3OW4A 2DUVA 1DAWA 2W96B 5E7RA 3O2MA 5IKWA 4M12A 4CZTA 3EFWA 4GEOA 5FM3A 5EI8A 2QU5A 1CKIA 5ANGA 2WHBA 3ZSHA 1V0BA 4IB3A 4BCNA 4FZDB 3H30A 4GYGA 3R2YA 3UVRA 3JS2A 4O81A 3C50A 3FSKA 4EC8A 3PIXA 2XKDA 2BAJA 3QTSA 1LUFA 4BI1A 5L6PA 4YTCA 2CKEA 3EOCA 2NNWB 3EL8A 3JY0A 3AG9A 3EQPA 3KK8A 5HCXA 3U6IA 5IG1A 5KMLA 3NVMB 3D9VA 3GC0A 3QCSA 3SRVA 3UBDA 4HNFA 5I9WA 4I24A 1YXTA 3R7YA 4I20A 4TPTA 2BFXA 5CI6A 1RQQA 4JNWA 4F1OA 5J1VA 4YJRA 4UMTA 3QD4A 3G6HA 4Y5HA 5FEQA 5AUZA 3R7GA 3GOKA 3S95A 1UU3A 3KKVA 2PVRA 3DFAA 3MPAA 4K18A 3ZMMA 3HMIA 2OXYA 4AFJA 5JFWA 5E8YA 1GZNA 4DEEA 3FY0A 3GU4A 4IZ5A 4EOMA 5K9IA 3GOPA 4CMOA 4O0TA 5AV4A 3COKA 5KMJA 5DWRA 1U4DA 3T8OA 2RKUA 4O0WA 2JKMA 3QHRA 4IAKA 2G2IA 4BDCA 2WOTA 5I4NA 2W1GA 3FZSA 3M42A 2OSCA 5HZNA 4BBEA 3KRJA 1Z9XA 2C0OA 2PY3A 2WGJA 3FLQA 3UNZA 3AT3A 3GCSA 3L1SA 2VTAA 2XNBA 3P08A 2VD5A 4HNIA 5LVLA 4YZ9A 5ANKA 4E6AA 1UVRA 3F7ZA 2XK7A 3HUCA 4JS8A 4RGJA 4MNEB 1YDSE 4RJ8A 2ETMA 4K8AA 5FDXA 4KKGA 1Q99A 3R9NA 4D2TA 3V8TA 4X3FA 5J87A 4FSNA 1SVGA 2CGXA 4YC3A 3BGPA 1H01A 4TWNA 3HMNA 3Q5ZA 4BKZA 4PPAA 2OJJA 3PE1A 4FT5A 2ITQA 1IEPA 2QR8A 4L00A 1CM8A 4RJ6A 2VX3A 4U40A 4O0VA 4EZ7A 4CRLA 4S32A 5DR9A 5CEKA 4W4XA 5KMKA 2XCHA 2R3NA 4E8AA 3FEGA 4JR3A 1GJOA 1J3HA 2YFXA 1ZWSA 5HVKA 1ZYDA 3A7HA 3W1FA 3ZH8A 4GU6A 3VBXA 3OT8A 5AAEA 3R9DA 2X8EA 2J4ZA 3UIMA 3VULA 5E4HA 2J2IB 1M14A 1ZOHA 4NK9A 4ZSAA 3QQJA 1Q3WA 3COHA 4QMVA 5DT3A 4KS8A 4JBPA 4O38A 5TOZA 4I6QA 3TZMA 3VS6A 2HAKA 4O21A 2W4KA 4BCFA 4RIXB 4D1XA 1OZ1A 4PRJA 2P55A 3Q32A 3HZTA 4XV3A 4RC2A 5DYJA 3QLFA 4KRCA 4MXYA 4BGGA 3L8SA 3RK7A 5HE1A 3CLYA 4R7IA 2JGZA 5HLPA 1U54B 2R7BA 3LZBA 4MWIA 2R3LA 4B8MA 2ZB1A 3LJ2A 4PDOA 3F3ZA 4G31A 4XP3A 4FV4A 3NCGA 5HE2A 4A4LA 1GY3A 5EQPA 4FGBA 5I9XA 4FTUA 4IVCA 4L7FA 2CGWA 4BGHA 2HW6A 3TZ8A 3IW5A 3ORIA 5EKOA 3G6GA 3TZ7A 4MNEA 3QRKA 3D5XA 3MSSA 2YN8A 4U0IA 4DLIA 1UNLA 3IW6A 3UTOA 3GT8A 2JC6A 2PULA 1A9UA 4C58A 4EWQA 3BZ3A 5FUTA 3ZEWA 3G0FA 2C68A 5EOLA 4DFLA 4B7TA 4E6CA 3BBWA 5CSVA 4ZXTA 3COIA 3VC4A 3R30A 4LQMA 4M66A 2JDRA 3DLSA 2VWWA 3T3UA 3TN8A 3KVWA 3WZUA 3KC3A 4RLKA 2ERKA 2J51A 5HO7A 3KULA 5ICPA 1OKZA 3QGWA 4I0RA 2IWIA 2O64A 5EYKA 5I3OA 3KQ7A 5FEEA 4O7WA 2IVTA 3R1NA 3TZ9A 5L2WA 4ACDA 4AFEA 3PJCA 3ZRKA 3CTQA 4KABA 2ITVA 4D9UA 4D0XA 3GCPA 4IM3A 4Z7HA 3NCZA 5CANA 4KKEA 4AT5A 4CQGA 2B1PA 4D4YA 3DXQA 4RIXA 2XRWA 1G5SA 1QPCA 3QZHA 3Q9YA 4EQCA 3UIXA 3UZPA 2DYLA 4LGHA 4BIBA 4F6SA 3QKLA 2JIUA 2F2CB 4JIKA 5EG3A 2OICA 3RPRA 4WG3A 2W1HA 1TQMA 1U54A 3PTGA 2XIKA 1HOWA 2YEXA 2VWVA 3QWJA 4JDIA 1UWHA 3MIYA 3OOGA 4L42A 5BVWA 3QBNA 4BZOA 4ASEA 4ID7A 5FBNC 3VS5A 3OW3A 3MH0A 4XBRA 4ACHA 5IH5A 4IB1A 3VS3A 3DBQA 2C5XA 5JQ8A 1WBVA 3OWJA 3QQKA 5CSXA 3SA0A 4UMUA 3E8EA 4KS7A 4I3ZA 3OXIA 5HI2A 3IW7A 2Q0NA 2H96A 1JKLA 5GIOE 4CKRA 5E90A 5DOSA 2WTDA 3ZBFA 4AU8A 3RCDA 4PMTA 3IO7A 3IGOA 3DV3A 3U87A 1H1QA 5F1ZA 3EYHA 4MBLA 3I6UA 2VTHA 5CASA 3NUAA 4L52A 2HWOA 3NNUA 3LM0A 5EM5A 4HYIA 3RAIA 2QG5A 4FL2A 4YC8A 3GB2A 5JSMA 3EMGA 4GV1A 2QURA 3EN4A 4MEDA 4XS2A 4ERWA 4QYGA 4PDYA 2H9VA 2HZ0A 5JZNA 4OTDA 4R3CA 4YZNA 4HYSA 5HU9A 2XK8A 3UIUA 3CGOA 4MTAA 4I0SA 4K33A 5EI2A 4FI1A 2VWUA 4QTEA 2WTCA 1ZAOA 4ZOGA 4H58A 1OL6A 4E4NA 1FVVA 1IG1A 3IOPA 5FQDC 5IUIA 4XHKB 3LXNA 5M44A 3A62A 2R3HA 2KULA 4EORA 2FB8A 5A4EA 4EH8A 2XEYA 4QMMA 4PUZA 3EKKA 3BYMA 3R8UA 3C4XA 4AOIA 3F3UA 3O0GA 4RIOA 3DA6A 3OCGA 4RWIA 5CI7A 4YTHA 4AAAA 4RA5A 3PSBA 4BYJA 3E8DA 3T9TA 3Q9XA 2FSTX 3TKHA 1JNKA 4BDBA 1XHAA 2XJ1A 4ZY5A 4IH8A 2YCSA 3FC2A 5LMBA 4JBQA 3EIDA 4LYNA 2ITZA 3PA3A 2I0YA 4P4CA 4RWKA 1OL5A 2X1NA 3CR0A 4O7SA 3LCTA 4M67A 3VQHA 4O0SA 1H1WA 1QPEA 2YITA 1R0EA 4FGRA 4PNIA 3TACA 4YJQA 2EXCX 2HELA 2R3JA 2GHGA 3O7LD 3R9HA 4FSWA 3C13A 4RVMA 5L8JA 4OTGA 4X21A 4LOPA 4L43A 1DM2A 2PUUA 1LPUA 4L9IA 4RSSA 4DH5A 4E20A 2IVUA 4IWDA 2PZYA 4F99A 5AV3A 3L9LA 2ZOQA 4GJ2A 3FMJA 4WSQA 4RPVA 4AT3A 3FYKX 3UGCA 3KXHA 2P33A 4OW8A 3NW6A 4IANA 4PL4A 4NFNA 5KKRC 3VHKA 5GHVA 5AR3A 4B9DA 4DEBA 1JQHA 1OIUA 1OKVA 5L2SA 3KCFA 4CTBA 3BLHA 3QFVA 3QC4A 5J7HA 4LV8A 4YZCA 3PIZA 4XLVA 2HXLA 5HNGA 3ZFMA 5M57A 4EBVA 1FINA 2OG8A 3EL7A 3KXNA 3R8ZA 4O2ZA 4YHTA 3Q52A 5AIRA 4CFNA 1W0XC 1YOMA 4DYMA 1J1CA 3IDCA 1R39A 3FLSA 4FV0A 5AAGA 1FMKA 5LVPA 3RNYA 4E4LA 4ZTRA 5EFQA 5ACBC 3IW8A 5C8MA 4RG0A 4R3PA 5AUUA 1MRYA 2Y6MA 3WF8A 1F5QA 2R7IA 4G9RA 1Y8GA 5M56A 1T45A 3MV5A 4ENYA 4G1WA 4RQKA 4AACA 2OZAB 4DITA 3Q9WA 2OJIA 5E8SA 3TV7A 4EH2A 4KUJA 4DN5A 3PXKA 3DJ7A 4BY9E 4DFUA 2PMNX 4MXOA 4EH6A 5BVFA 5H9BA 2YM5A 3VVHA 4NJDA 3CP9A 1NVSA 3R8MA 5AP1A 4EKKA 3QCQA 4USEA 4EYMA 4B8LA 2JITA 4GMYA 2AC5A 4QMWA 5CTPA 2RG5A 2QO7A 3BGZA 5EHYA 4NM5A 4FOBA 4IB0A 5AFVA 3VJOA 5EOBA 4YPDA 4DGNA 2R3FA 4JX7A 4PTCA 4UWYA 1MP8A 4QP4A 4AWIA 5M08A 4FKTA 2IZSA 3L8XA 4XMOA 5T6KA 1W98A 4I92A 5KE0A 5CEOA 5FBOA 2A2AA 2BDFA 2JEDA 2C6KA 2E9PA 4KSPA 3PRIA 5CVFA 5EYMA 2AC3A 3V3VA 4E5BA 2VGOA 2BHEA 5HG9A 4IC7A 5D1JA 3DXPA 4DT8A 2C5YA 1W8CA 4YZMA 5T68A 4BCHA 2OXXA 3ZO2A 3V6RA 5DH3A 3PXZA 4S2ZA 3KF4A 2VTJA 4R1VA 1FOTA 3O8PA 5EI6A 4NH1A 2YISA 4EH3A 3MJ2A 2WIHA 1R3CA 3KL8A 1J7UA 3MY0A 3PSCA 4ZLZA 3UNKA 1JKKA 2C3LA 4MHAA 2YERA 4J98A 2W06A 4A9RA 2EWAA 4JRVA 2WQEA 5CZHA 3LCDA 4M8TA 3TCPA 3VAPA 4LGDA 4B99A 1IRKA 3IDPA 4C3FA 3A99A 2I7QA 1VR2A 4JG7A 2OLCA 2QI8A 4U45A 2OKRA 4QMXA 4G6OA 5H3QA 3V5PA 3KRRA 2YWVA 4IFGA 5CXHA 1REJA 2WFYA 4NKSA 3W33A 4EOOA 2W05A 2C6OA 4X2GA 3QA8A 5BYYA 5EKNA 3GBZA 5LQFA 1U59A 3RGFA 3NVKI 3TTIA 5AX3A 5TKDA 2PVNA 4GSBA 3QQUA 4D5KA 3O51A 4IX3A 4BR3A 4N70A 3K54A 3F69A 4FK6A 3AC2A 3QKMA 1ZLTA 3BBTB 3MA3A 3ACJA 2CHLA 4RBLA 3ZM4A 4EL9A 3AGMA 3NEWA 1WVYA 3R71A 3WYXA 2QOHA 1H4LA 2OF2A 4GW8A 3VS2A 5IDPA 4GUEA 4DGOA 2W1CA 4LRKA 4C02A 3TUBA 2W5HA 1UU7A 1OPKA 3E5AA 1QPDA 3QZFA 3ENHA 3TV6A 2YIWA 5DEYA 5FD2A 3KMUA 5K5XA 4FTNA 4PDPA 3CGFA 5DBXA 4EJNA 5GINE 3GUBA 4EZ5A 5J1WA 2PMOX 4FV9A 4GG7A 4QYYA 4F9CA 4FMQA 3VF9A 3O8TA 2HY81 4OTWA 3HA6A 3O96A 4UWCA 3QUDA 4ZY6A 3WIGA 5DT4A 1BKXA 3G9NA 2OJ9A 5FXRA 2IW8A 4CNHA 4GRBA 5C27A 1ZYJA 5KO1A 4YHJA 3EFLA 4CXAA 3UO5A 3FMDA 4N4SA 5JRQA 5CWZA 4TYEA 5EYCA 3R8PA 5D11A 2ITXA 3OWLA 1URCA 1CTPE 3HVCA 4DEAA 5EM7A 5C01A 5L3AA 2J0IA 4IAYA 1H00A 4BF2A 4YGAA 4NM0A 1YHVA 3RWQA 4AE9A 3U8WA 2R0UA 4ZJJA 4CYJA 3HAVA 4V01A 3ZDUA 3O8UA 1YXUA 3I0OA 3HRCA 4ZAUA 3AC5A 4IZYA 3DQXA 3H0ZA 4FF8A 4KINA 2WTVA 4QPMA 5HIEA 4UYNA 4BDJA 2WEVA 4CMUA 2X7GA 4MBIA 4R7HA 4DC2A 4KB8A 3KEXA 4WBOA 1Q8YA 4K6ZA 5LCKA 4DFYA 2W0JA 4ZZNA 3AD4A 2YHVA 1YHWA 5HCZA 2WMVA 4DCEA 5BUJA 1PYEA 3HKOA 4HCTA 4RFYA 3HRFA 1I44A 1OM1A 3RHXA 3DY7A 3F66A 4RIYA 2VU3A 3Q2JA 2W1ZA 5BVNA 5AV1A 1WVXA 1ATPE 3OMVA 5E8WA 4XG8A 1H8FA 4Y95A 4FTIA 2XYNA 3PWYA 3W2OA 3ZSGA 5CEPA 4USFA 1V0PA 1KWPA 3EKNA 3FMNA 1XBAA 5M4FA 3QXPA 4C8BA 2BIKB 5B7VA 3ZUVA 5K4JA 4L3PA 3ZS5A 3COMA 5DEWA 4FG7A 5M4CA 3R7IA 4PX6A 4QP9A 4P2KA 4YMJA 3C51A 3FMEA 4JAIA 5AP2A 5E92A 5HG8A 3AC8A 3PPKA 2HZ4A 4WNKA 2XNPA 3KMMA 1H26A 1KE5A 2Y9QA 3GC8A 3UJGA 3CD8A 3BIZA 3DBFA 1WBNA 4DTBA 4FEUA 3SOCA 2B53A 3IK3A 1NXKA 1APME 2VNYA 5AP0A 3DBCA 4YZBA 3A8XA 3GCUA 4QMUA 2CJMA 4WUNA 3W8LA 3P4KA 2UZBA 4R1YA 4ITHA 2QODA 4H3QA 2XJ2A 5A4LA 3E8CA 3LM5A 4XG4A 2CNQA 3POOA 2J5EA 3Q04A 3OY3A 3LIJA 4M0YA 4U6RA 2ZM1A 4X2KA 4DAWA 5IQFA 3OC1A 3KXGA 4BB4A 4WA9A 3E63A 2WZJA 2OXDA 4A07A 5HQ0A 3BELA 4NYEA 4RFMA 3ORPA 2YCQA 2XM8A 5BYLA 3I60A 3QX2A 2A27A 3RJCA 5EHOA 4JOAA 4Z55A 5LVOA 2ZV2A 4YUQA 5FP6A 3CPCA 3TV4A 4FOCA 2VWXA 4KWPA 1XQZA 4S33A 2IPXA 5DRDA 4YR8A 4WUAA 3GEQA 4C4HA 3D7ZA 2DS1A 2F2UA 4FSRA 5IUHA 5A46A 2GQSA 4D1ZA 3N4VA 4UBAA 1KE7A 4OTPA 2F7EE 2J9MA 4Q5HA 4AUAA 3A4OX 3EZVA 2ITWA 3BYSA 3F2NA 4FKRA 3BQCA 4G34A 4IX4A 4GT5A 4PY1A 1Q24A 5C26A 4BBFA 4Y46A 4YSMA 3I6WA 5CSHA 4AGWA 4BDFA 2WD1A 3QA0A 4W4WA 5AM6A 4LMUA 2PPQA 4FKIA 4LL0A 5HORA 3IS5A 4LG4A 3LCSA 4AW0A 5FM2A 4DFNA 2Z7QA 2GPHA 4E7WA 5CQWA 4AGCA 5HX8A 4GFMA 3LXLA 2Y4IC 4YJNA 3KN5A 3MVLA 2WXVA 3SW7A 2F57A 2YM6A 4FUYA 5JEBA 3D94A 1OECA 2O0UA 1Y6BA 5K3YA 3REPA 4O7LA 3TNHA 3TNPC 4CKIA 2P2HA 1SVEA 2HYYA 2IO6A 3FV8A 5HG5A 3HX4A 5BVKA 3NR9A 5HU3A 2GHMA 1OGUA 3PPZA 3OTUA 4J7BA 4TT7A 3V8SA 3VF8A 3F6XA 3SRVB 2VO3A 3M11A 4TYGA 4QT1A 4XG7A 3UE4A 5BVDA 5GIPE 3L8VA 1XH6A 4II5A 2HY0A 4HGEA 4B6LA 2RFSA 3C9WA 3VS7A 4I5HA 4X6QC 4J96A 4CTCA 5AAFA 3O71A 3DJ6A 3QD0A 2X2LA 3UOHA 3CQUA 3KXZA 3SX9A 5BNJA 4ALVA 3ZO3A 2PL0A 3I0QA 2C6DA 3L9MA 1CDKA 2O5KA 3BYOA 4UMPA 5D9HA 3KY2A 3LPBA 2IZTA 2OJFE 3D14A 5IEYA 5KHWA 4FNYA 3R8LA 3GC9A 5K0KA 1ZOGA 3LFSA 5JMSA 1WBSA 4BCOA 3SXRA 3W55A 3ZFYA 5AEPA 3N4UA 1M7QA 3H9RA 3Q4TA 4GCJA 4I1ZA 4EEVA 4EHVA 4IMYA 2ETRA 4OTIA 1OUYA 2XUUA 3PZEA 3TL8A 3R8VA 2QKRA 4FTAA 5JRSA 4C36A 2VO6A 2RFEA 1JKTA 2JFLA 2YDJA 3P7AA 2PZIA 4CKJA 5LCJA 2WMXA 2CMWA 4TYJA 4ANSA 3OY1A 2R3OA 3N51A 4FKVA 2WKMA 3IQ7A 2GSFA 4BIEA 4EH9A 4HCUA 4JR7A 4CFWA 5DR6A 5FTOA 3DB8A 2ESMA 2R4BA 4EC9A 4WRGA 3ROYA 3RTPA 4MQ1A 1UV5A 2I40A 2JDTA 3PIYA 3PPJA 4XLIA 3HECA 5D10A 3TNWA 4IX6A 4X3FB 4ZIMA 4ARKA 3FUPA 4IWQA 4E6QA 3L9NA 2ERZE 1QL6A 3PJ1A 4G3CA 3UG2A 2QD9A 4FKQA 3TKUA 5KMOA 2X2MA 5BUEA 1G8AA 4YC6A 3RWPA 3UOJA 3OROA 5E8UA 3FLZA 4M3QA 5DLSA 3A60A 4XG9A 2LGCA 2CN5A 3U9CA 5JFXA 4FKPA 1XBCA 5AP3A 5HE3A 4RQVA 3SV0A 3G2FA 2JKQA 5LVNA 1EH4A 1WFCA 3PDTA 5AUTA 4ORKA 4W9XA 5AP5A 3F82A 3CPBA 3D5UA 5KZ0A 5I9YA 4FSZA 1YOLA 4NW5A 5AUYA 2CDZA 1M17A 3NYNA 4XG3A 3R9OA 3EFJA 1WCCA 3E7VA 3DK7A 5AUXA 1V1KA 4DE4A 2C0IA 3DXNA 4F65A 5FEDA 5IH6A 4FV7A 4IVBA 3QHWA 1Q61A 1KV2A 4OAUC 4FT7A 3VUTA 3ZZWA 5IA5A 1L8TA 3U54A 5J7BA 5CX9A 3MBLA 3ORZA 3QYZA 1PMNA 4FZ6A 1BMKA 1Q41A 3BV3A 5CENA 2CSNA 3OCBA 5FP5A 4E3CA 3Q6UA 3EN7A 1MRUA 4GK3A 3MW1A 1M2QA 4PP7A 2BKKA 4EJ7A 3R1QA 5CVGA 1KUTA 3VS1A 3R1YA 4FTCA 2NRUA 2QONA 5HVJA 4IWOA 3U6JA 1WMKA 4H05A 3VNTA 1PF8A 2Z7LA 5CAUA 2C6IA 2GNJA 2ZVAA 4JDJA 3ANRA 4NT4A 4F7LA 2YIRA 5IU2A 2ONLA 2J0MB 4C4JA 1AQ1A 4JRNA 3ZZEA 1GAGA 5CEIA 3WOWA 2QU6A 4RJ7A 2QOQA 4OUCA 4IM2A 4CFUA 1PW2A 2XKCA 3F3TA 1UWJA 4BYIA 3F2AA 3F5XA 2BDWA 2GHLA 4KAOA 3R7EA 3ZM9A 1YQJA 2VV9A 3BEGA 2DQ7X 3BEAA 1KE8A 3IOKA 4GH2A 3KULB 4G3DA 4MF0A 4QMLA 4R5YA 5ETIA 5BVEA 3FLWA 3WF7A 3P86A 3DB6A 2OWBA 1E9HA 1U5QA 2Z60A 3FI4A 4FK3A 5HBJA 4YSJA 4K2RA 3DPKA 1IA8A 1JOWB 3V04A 4MCVA 2PWLA 2C0TA 2YM4A 3EN6A 1H0WA 4FEXA 4FZ7A 4TRLA 2KTYA 4A4XA 3V8WA 5KKRB 4YLJA 3NUUA 3VUDA 3DK3A 4D4VA 2I1MA 1W84A 3TWJA 2UZWE 3PXQA 1BI8A 2XZSA 4L67A 5FGKA 5ITAA 2GCDA 3CEKA 3LAUA 1X8BA 2WO6A 1DAYA 3HUBA 4BI0A 4H39A 5C4KA 5TT7A 4YJSA 4TZRA 2OO8X 3C4FA 3K5UA 4FKWA 4WO5A 5AV2A 3SXSA 4AGUA 4Q9SA 4TYIA 5CSWA 1IAJA 2PU8A 4O6LA 2BRNA 1T46A 1XJDA 2ZV7A 4ZP5A 2F4JA 5LXMA 3V5LA 4BN1A 3BQRA 4XV1A 1ZMWA 3EQHA 4LM5A 5GZ8A 3II5A 3SQQA 1FQ1B 3DKCA 4A7CA 4MXCA 4ZEGA 3SG9A 3D0EA 3CJFA 2C5VA 3S4QA 3G90X 4BDEA 4XRJA 2GNLA 2C6LA 3MPTA 3SXFA 5CAPA 3MH3A 2ZV9A 4HPUE 3QRIA 3PSDA 3C5UA 3KXMA 2C3IB 3KRWA 3LXPA 2ITTA 4TL0A 4QP7A 3NX8A 5B2KA 1M52A 3KB7A 4JL9A 4GFGA 4LMNA 3UMWA 4M69A 1P4FA 5KMIA 2GDOA 2PK9A 4FL1A 2NRYA 2Q0BA 3VN9A 4FKUA 4EONA 5C9CA 2GFSA 3Q5IA 2VTTA 5TE0A 4GL9A 4F08A 3SAYA 3RKBA 2V0DA 4EYJA 4J71A 3PE2A 2GS2A 4HGLA 1YI6A 4O2PA 4I41A 3ZEPA 2XKEA 3PWDA 4FSTA 3CS9A 3HYHA 3IPHA 4NTSA 4XCUA 3ZRMA 4BWXA 4EQUA 4HVSA 3ENMA 1B6CB 4ERKA 4EK3A 3EQFA 4F0IA 4FSMA 3MB6A 3NUPA 3E7OA 3ULIA 4QMQA 1LEZA 1WAKA 2BRHA 2FSMX 3QD3A 5EYDA 4RJ5A 4PMSA 2RGPA 3CXWA 3HV4A 4L7SA 1ZOEA 2IVVA 4YJPA 5HD7A 3BPRA 2VTPA 3OOMA 3R04A 4XBUA 3RK5A 4CLIA 2CKQA 2Y7JA 1PXNA 2WTJA 3EB0A 4C57A 5A9UA 3RP9A 1BI7A 3HL7A 4O7TA 2C6MA 4DEGA 2OK1A 4IAFA 3PXYA 2IW9A 3ZXZA 2WOUA 5ETCA 3UZRA 3ZDIA 4QOXA 1XR1A 2B9FA 1P2AA 3FXZA 3FMKA 4J99A 4ITIA 3VUGA 4D4RA 4J95A 3BGQA 2OIQA 1WBWA 2ONLC 4CT2A 4BTFA 5CNNA 1Y57A 3A2CA 3EN5A 3Q4UA 4GKHA 2YDIA 2IJMA 1BL7A 5J8IA 1J7IA 1OB3A 2QOFA 3FJQE 4QPSA 5AP4A 3MFRA 2J5FA 4FX3A 4EH4A 2J6MA 3HAMA 2VWYA 3RALA 4K1BA 3E8NA 4TY1A 1NY3A 3ORXA 3OT3A 2A4LA 4L46A 4FT3A 3PUPA 3Q9ZA 4IDVA 1GIIA 4KBCA 3FYJX 5KNJA 1Z5MA 4DH3A 3JVSA 3BYUA 4D4SA 3AMYA 2IZUA 4C7TA 3RK9A 3TUDA 2OU7A 3VUIA 4GKIA 2Y6OA 3Q2MA 3KF7A 4ITJA 4Y8DA 3VW6A 3R83A 4DBXA 2PZ5A 4W8EA 4RWLA 4ANBA 3QCYA 1PMUA 3AC1A 3FKNA 5FTGA 5IEVA 4XP2A 2HIWA 2WMRA 3FE3A 3O50A 5F94A 1IAHA 3M2WA 4EH5A 4BICA 3EWHA 1GZ8A 2BALA 3MPMA 4FVRA 3IW4A 4L68A 5IA0A 3FWQA 4FKLA 4QP6A 3W32A 1OPJA 4AN2A 3E92A 2Z02A 3VS4A 3WZJA 1TVOA 4QQTA 5HTBA 4O84A 4GYIA 3SLSA 2W1IA 3ORNA 1ZYLA 4RRVA 5LVMA 3E87A 4J53A 2YACA 5IMXA 2XIZA 3I7CA 4KIPA 5M09A 1MQ4A 1URWA 2QO2A 3C7QA 2BVAA 4UWBA 1UNGA 2J50A 1YXSA 4F9AA 5DT0A 3LFCA 1PRYA 5AADA 2ZAZA 5G6VA 3QGYA 4RC4A 4BKYA 3RAKA 2UW5A 5L4QA 5CF6A 2G01A 2I0VA 4YJTA 5EQYA 2X6DA 3CQWA 2H34A 2X7FA 3G9LX 4FBXA 4AG8A 5KCVA 1VYWA 2PE2A 4IAAA 3KA0A 1E1XA 2REIA 3T9IA 5LWNA 2XP2A 3A7GA 1B38A 4B4LA 1OITA 4WSYA 5HGIA 3LFQA 5A6NA 1R1WA 5CT7A 3GCVA 4X0MA 3V5WA 2UZLA 3BHUA 3MFSA 3DBDA 3MFTA 2PUNA 4M13A 5ACKA 5CXZA 2OI4X 4YBKA 1ZMUA 2J90A 3PFQA 2BMCA 2XBAA 1XH5A 3LCOA 2HOGA 5IQEA 3ELJA 1YDTE 3ALOA 4M15A 2QHNA 4UB7A 4FA2A 5AA8A 4ASDA 3UQGA 4FKSA 4JIAA 2VX0A 3B8RA 3F61A 4C0TA 4ZMEA 4O83A 5FXQA 3MVHA 5EDRA 2R3KA 3OG7A 4F6UA 5HEZA 2BRGA 4G9CA 4BFMA 3RCJA 4PMPA 2WELA 3F7WA 5K5NA 3CSVA 4MK0A 3P78A 2PVYA 2R3MA 4ANQA 2VNWA 4C3PA 1STCE 1OKYA 1PMEA 4ZZOA 2H6DA 4DH7A 5HVYA 1F0QA 4U42A 3QTIA 3QWKA 5K4IA 4IHPA 3KRXA 2VRXA 2OH0E 4C37A 1ZARA 4BI2A 3DZOA 4N0SA 3T3VA 4IDTA 2PSQA 4QTBA 4O86A 3Q3BA 4KA3A 3PP1A 5CSPA 4BIDA 3DLZA 3HP5A 3NNVA 2YLFA 4ZJIA 4DFZE 3GQLA 3FZPA 4ANNA 3GFWA 4QNYA 4FV1A 4DG3E 5M53A 4TTHB 3RZFA 4OT5A 3H4JA 4I6HA 4QYEA 4FV3A 5KX8A 3C4WA 2V7AA 4XRLA 3QYWA 2GNHA 4L01A 3CJGA 5AP7A 2YM7A 2R9SA 2VTMA 5E8TA 2XIXA 4ASZA 3SOAA 4EUTA 5FDPA 4O7ZA 4YBJA 3ZO4A 2C3JA 3FQSA 2PVFA 5IQGA 3NAXA 4RMZA 3VBYA 4YJVA 4DFBA 4CZYB 3O7LB 3U51A 2X8DA 4BHNA 3QD2B 5KHXA 4CG8A 3PVBA 3GP0A 3BE2A 2GS7A 4C2WA 3NGAA 4CFFA 2XF0A 3VQUA 4ZSLA 4RX7A 3FLNC 3GFEA 3QQHA 4IC8A 3SD0A 5EW8A 5KMMA 3MJ1A 1PXIA 3OF0A 4G3FA 4J8NA 2VO0A 1JPAA 3ORTA 2PE1A 4WIHA 4EK6A 3D2KA 1YW2A 4GIHA 3QC9A 3I4BA 3C5IA 4OLIA 1J1BA 3ZYAA 4FV8A 1OL2A 3MYGA 5IZFA 3U4UA 4FV6A 2QNJA 4M84A 4FTRA 3ORKA 4I5PA 4A06A 2B55A 4QD6A 3QQLA 1J7LA 2VO7A 5H8GA 3VO3A 4BTKA 1UA2A 3I5NA 2Y4IB 3A7FA 4RLLA 4EK5A 2DWBA 5J9ZA 1NW1A 4QP3A 1VEBA 4OR5A 2W7XA 3DAEA 4F9YA 1XWSA 4YPSA 2ITNA 3IG7A 2WMBA 5ANIA 3QZGA 2XK6A 4GIIA 5DE2A 2PUPA 3W8QA 5IQCA 2XMYA 3CY2A 1P14A 4MXZA 2X9FA 3UOLA 4BCMA 5DFPA 5EDPA 3LFDA 1PHKA 4IZ7A 1H1SA 1M7NA 2G15A 3NRMA 5LOHA 1YXVA 3LQ3A 3I1AA 4D28A 5L8LA 2C69A 3MWUA 1BL6A 4F1MA 3I81A 3CKXA 3NZ0A 2UW8A 5AIKA 2J0JA 4RIYB 5IDNA 4CFMA 5A6OA 4CLJA 4U9AA 4EOKA 1BLXA 3DTCA 1JKSA 4IJPA 4IADA 3S1HA 2X2KA 4HPTE 1SNXA 2W1FA 3QXOA 4HVIA 2G2FA 4O6EA 4MKCA 4QQ5A 1OUKA 3QAME 3CCNA 2GQGA 3AD5A 4L3LA 4O27B 3V6SA 2EB2A 3D5WA 4BDHA 3W2QA 1ZYSA 4FE2A 5TO8A 5H8EA 3VWAA 1Q62A 2PVHA 3GI3A 3OUNB 4BZDA 4NSTA 2WQOA 5HBHA 4AXAA 4YURA 4OGRA 4CFXA 1WBPA 4FZFB 2QHMA 2F7ZE 5EK7A 4JXFA 1A06A 3S0OA 3F88A 3FZRA 4AN9A 4BRXA 4DEIA 3TDVA 4F7SA 3HMPA 5GJDA 4ZTMA 1O6KA 3H0YA 4J97A 2HWPA 4UY9A 5EW3A 2UZVA 3JXWA 3QRTA 1Q97A 3VHEA 5BVOA 5C8KA 2O63A 3JVRA 4ONAA 1OI9A 2VTOA 4CVAA 2XVDA 4V04A 5BPYA 1G3NA 4A9YA 4FEWA 3E3BX 2C1AA 1E1VA 3FLYA 1YOJA 2JDOA 4CD0A 1XKKA 4KRDA 4AP7A 2LAVA 4I6BA 3R9RA 2AUHA 3BYVA 3NNWA 4DT9A 4PF4A 4FIJA 4IVDA 4U97A 5L2TA 3TIZA 3LQ5A 2OIBA 3PY0A 5CF8A 2UUEA 3QQFA 4KD1A 1TQIA 3I5ZA 2RSVA 3KRLA 5AR2A 2XIYA 2BRBA 1M2PA 4JT3A 4YHFA 4F63A 4EWHA 4AW2A 5FWKK 1RE8A 5IA3A 3FBVA 2EXEA 2P0CA 2BTRA 3MN3A 5JGBA 2P3GX 3QRUA 2OIDA 3EZRA 1L3RE 4RC3A 4ZY4A 2HK5A 2QOLA 2XNNA 3D4QA 5GJGA 2E9OA 4NUSA 4XP0A 3NLBA 4W4VA 2G2HA 4EHGA 4EKLA 5LJJA 1ZY5A 3AT4A 3QTQA 3QU0A 5BMSA 1ERKA 2WNTA 5GNKA 4E1ZA 3UIBA 5A4CA 3HNGA 4PL5A 4FG9A 4FNXA 4ACCA 4CYIA 4FTJA 4ZSEA 3FQEA 3L9PA 4BGQA 3BE9A 3C4ZA 3A7IA 1MUOA 4U8ZA 1UKHA 1YVJA 2GNGA 4BCGA 2W4JA 4PPCA 4R78A 3MH2A 3WYYA 4TW9A 2JBOA 3P0MA 4F9BA 3QL8A 2B9JA 2E2BA 4BCPA 4EK8A 4N6ZA 3DKOA 3G5DA 3MA6A 2V7OA 3UO4A 3MDYA 4G16A 2BUJA 2HZNA 3BRBA 3DGKA 5ANDA 4BCKA 5JQ5A 1Y8YA 3OWPA 4L3JA 2QR7A 4RT7A 5TF9A 4E6DA 5L2QA 1ZYCA 5DG5A 3ZONA 4ASXA 4WOVA 5CU3A 5AR4A 3RPSA 2XYUA 1R78A 3EQGA 3K5VA 1PXJA 1VJYA 4QTAA 3B2TA 3NAYA 3QTWA 2ZDTA 2JDVA 4UV0A 4YNEA 4YLLA 3LFEA 3F3WA 4UZDA 2HZIA 4AZVA 1H1RA 2BZIB 4LV5A 3EQCA 1GIJA 4L6QA 1ZZ2A 4U3YA 4G17A 1BUHA 3FKLA 3QKKA 3TEIA 4QMYA 4QTDA 1PKDA 2J7TA 3GXLA 2R64A 3L8PA 4D9TA 4D2PA 3TJCA 1XBBA 3DJ5A 2BPMA 4QYHA 4AF3A 5BX0A 1CSNA 2JDSA 3IKAA 3GU8A 4JAJA 4W9WA 4FYOA 2YIQA 5BYZA 1OIRA 2XA4A 5M55A 3WZDA 3B8QA 3QUPA 2WMWA 3DDQA 4YJUA 2HXQA 4O22A 3S2PA 3KN6A 4AE6A 3UZTA 1JSTA 5JGDA 3R7OA 2JBPA 4ACGA 2YJRA 4CV8A 3FAAA 5FTQA 3FI3A 1MQBA 3MB7A 4QP1A 1QCFA 3R28A 4UMQA 4W8DA 5HICA 3HMMA 2A19B 3NUNA 2X0GA 4FTQA 3ZCLA 5I9ZA 1KSWA 4OTFA 3R01A 4LFIA 3NUSA 5HESA 5CF4A 5I5ZA 3NUYA 4A9TA 4JLCA 2X4ZA 5ANJA 3RINA 4G5JA 1WBOA 5H8BA 3S3IA 5C4LA 2VWBA 4QO9A 5A3XA 4WBBB 3NNXA 4EOJA 1IR3A 2UVXA 3QTZA 4NKAA 5CEMA 4MNFA 4C62A 2CPKE 4QRCA 4KBAA 4ZS4A 1KOBA 2XIRA 1HCLA 3HLLA 5L6OA 4H3PA 4J52A 3ALNA 2FH9A 4I4FA 4KSQA 5EH0A 4W4YA 3RPVA 3VUHA 3C0HA 2J0KA 2W5AA 3FY2A 5CU2A 3HV5A 3VRZA 4NCTC 1PXOA 3LMIA 1O6YA 4IACA 4AZTA 4FICA 4E4XA 2BFYA 5IF1A 4RZVA 3TNQB 1I09A 4GT3A 5AUVA 2JD5A 2A0CX 2OZOA 4M0ZA 2HENA 4CRSA 1PMVA 4PQNA 1Q8WA 3P1AA 2E9UA 3P23A 3QALE 2X7OA 4EOIA 4ZJVA 5IQIA 4OTRA 1M2RA 2YJSA 1PXPA 3DS6A 3PJ8A 3EJ1A 4KIOA 1GOLA 3OFMA 4FVQA 4BL1A 3THBA 4MBJA 2CCIA 4LRJA 3RVGA 1LP4A 3F5GA 3VUMA 3HEGA 3KVXA 3UG1A 5J5SA 3GGFA 4NW6A 1ZZLA 4U41A 4C61A 1ZRZA 5CAQA 2SRCA 3UQCA 3C4CA 3TM0A 4GU9A 3C1XA 4QPAA 5IH4A 3QTUA 4P90A 1OL7A 1Y91A 2R3GA 3HV6A 4FT9A 1DS5A 4D2WA 4HVDA 4CGAA 1B39A 3LMGA 2BZHB 4LL5A 2PVMA 2AYPA 5AWMA 2YM3A 2UVZA 3NW5A 4CQEA 2IZRA 3KMWA 3R7VA 2WAJA 2WU7A 5L2IA 2YZAA 3KU2A 4F70A 3R73A 1CMKE 4NTTA 2CLQA 1UU8A 3R63A 3A7JA 4Q5EA 2UW3A 4IQ6A 5FG8A 2O65A 2UW7A 3WARA 2BTSA 5AA9A 3PZHA 3FDNA 4UMRA 2IN6A 3DK6A 4E5WA 5HD4A 2YLEA 2XK3A 2OFUA 4XV9A 3TG1A 4PMMA 2Z7SA 4DINA 3AMBA 4TWOA 4JX3A 3QUEA 4BCJA 2YA9A 5HCYA 4FVPA 1YXXA 3LMHA 4PPBA 3C0IA 4FKOA 5B0XA 3FPMA 4FTTA 4D2SA 1NVQA 3FMHA 2UZDA 4XEYA 3WE8A 3JR1A 5EW9A 4NM3A 4ZZMA 3BX5A 1TKIA 4RIWA 3BHYA 4P7EA 2FUMA 2WTWA 2ZB0A 3DAKA 4AA5A 3MESA 2I6LA 1LR4A 5HKMA 4IFCA 1Z57A 4QQCA 3LLAA 4O7VA 3G51A 3WIKA 2E9NA 3OXTA 4FSYA 4YZDA 5AJQA 4RJ4A 4O7NA 3JUHA 5E1SA 4YTFA 3MS9A 2PZRA 3MVJA 3ATTA 2UZEA 3BU6A 1REKA 3H9FA 5GZ9A 2VZ6A 2PE0A 4GJ3A 2F9GA 4IW0A 4RVKA 5CEQA 1YKRA 2W17A 5CU6A 3PVGA 1PXMA 4S31A 5CT0A 2B4SB 5IEXA 3E93A 4LGGA 3BKBA 3FXXA 3OP5A 2EXMA 3PA5A 1KV1A 1H24A 2BILB 5CS6A 5F95A 4A4OA 4QMSA 4GUBA 1J91A 4RX8A 2C5NA 4AZFA 4B0GA 1WVWA 4FR4A 4EHEA 2QO9A 2R2PA 4C38A 4PTEA 3D83A 4L53A 2XK4A 2BHHA 4K0YA 4FTKA 4YP8A 4EUUA 2WEIA 3MTLA 3KCKA 3I79A 5A14A 4NJ3A 3BV2A 1FGKA 5F4NA 4QNAA 2WTKC 4FYNA 4C33A 2XS0A 5C1QB 5CAVA 2WU6A 2YIXA 3H9OA 5E8VA 3WZEA 4MF1A 3PXFA 4ZMFA 4CMTA 4AOJA 1LEWA 1H27A 3RAHA 3AC3A 4M69B 4NZWB 3D7TB 4BDDA 4X2NA 4Y85A 4R6VA 2UW4A 4RWJA 4IWPA 3FKOA 3BU3A 4BTJA 4EI4A 4A9UA 1XH7A 1F3MC 3OTVA 3R1SA 3TUCA 1Q8UA 1PXKA 2V62A 2UW6A 4XNEA 3SKCA 5CF5A 4FEVA 2ZV8A 3G15A 4M14A 4MYGA 1W7HA 4NWMA 4YTIA 4V05A 4IX5A 5B2LA 3EHAA 4AA4A 4E5AX 2VTQA 3PJ3A 3GNIB 3WI6A 3P79A 4JI9A 4Z9LA 3RPYA 3MTFA 4DTKA 3ZXTA 2YAAA 4RA4A 5DMZA 4AA0A 4TWPA 4TKSA 2A1AB 2ITPA 3KGAA 3LFNA 4FV5A 5E9EA 4KBKA 1H28A 4H36A 4DEDA 4FTOA 3AT2A 1CKPA 1PYXA 1TQPA 3MIAA 4E93A 5ANEA 2GQRA 4BDIA 4EHZA 4O91A 4ACMA 4ZLOA 3ATSA 4NU1A 4QMPA 3WF5A 3WF6A 1SZMA 2OJGA 4FTLA 2IW6A 5J79A 4XOZA 4BHZA 3FXWA 5JH6A 5HIBA 3HDNA 3BI6A 2OW3A 3OBGA 2X8IA 3WZKA 2EU9A 5AV0A 2PZPA 3CE3A 5IQAA 2WMQA 4YNOA 2I0EA 2ZYBA 3D5VA 3IGGA 3VBWA 1JWHA 4MD9E 3VBTA 3QRJA 2V55A 3FI2A 5HOAA 4UXLA 3R02A 3DU8A 4R8QA 3OEZA 4AW5A 2B7AA 5CQUA 4J8MA 4TXCA 3D7TA 2QLUA 3ZC6A 1YRPA 1YI4A 5HTIA 3UVPA 4BDKA 1IA9A 4IB5A 2X81A 3BU5A 4A9SA 2CKOA 2BZKB 4FG8A 3TT0A 3KREA 4R7BA 4R77A 3R21A 4E26A 2W9FB 3AD6A 4I93A 4AS0A 2NO3A 3FL5A 4HYUA 4AN3A 3NUXA 2OFVA 2FSLX 2JAVA 1UKIA 5ANOA 4BWPA 1AGWA 2QOOA 4X2FA 2OBJA 4FIHA 4F7JA 5IA1A 3LFFA 3QTRA 4FUXA 4X3JA 4Y5QA 2CN8A 3DKFA 4BVUA 5I3RA 2Y8OA 4CFVA 4Z7GA 1GZKA 1U5RA 2QOIA 2ZM3A 1PJKA 3FMMA 1A48A 3PVWA 2BROA 2GTMA 1ZY4A 1WZYA 4UEUA 4BKJA 4EK4A 3JYAA 5AR7A 5JN2A 4MH7A 1JBPE 1VZOA 2X39A 5HBEA 4HCVA 3CTHA 2C5OA 4IM0A 2XK9A 4D2VA 3NS9A 4DH1A 4O0XA 4RX9A 4FV2A 4IIRA 4NFMA 1H1PA 4YLKA 5H2UA 4APPA 3PYYA 3AOXA 5EHLA 5A4QA 2VTIA 2V22A 3QQGA 5L6WL 4U80A 3F5UA 1GNGA 1KE9A 4LUEA 5BUIA 4TYHB 4I22A 2WPAA 1WBTA 2F7XE 3C0GA 3MY5A 3LKMA 5EM8A 4K77A 3ORLA 3VRYA 3D2IA 4F9WA 4TN6A 3LFBA 3H10A 3RHKA 3LJ0A 4EOSA 4OTQA 3VIDA 4Z3VA 5F9EA 4NIFB 3A8WA 3SW4A 4UALA 3NPCA 2WB8A 3PVUA 3V5TA 2B0QA 5AMNA 3R7UA 1H08A 3EN9A 2OF4A 3AXWA 4WNOA 4Q9ZA 3UMXA 1Q5KA 3WILA 2QOBA 4DBNA 2BKZA 3P9JA 4DF3A 3HA8A 4H1MA 1YWNA 4BC6A 3CD3A 2BIYA 3IDBA 3LFAA 1XH9A 5FLFA 3NMUF 4X3FC 4ZTSA 5HX6A 3OBJA 5JFSA 1YWVA 3ZRLA 2XRUA 3K3IA 4TNDA 4WHZA 2CLXA 1S9JA 1U46A 3B2WA 4FODA 4J1RA 3UC3A 5E8ZA 5IQHA 3NIEA 3OHTA 4XG2A 3FZ1A 4Q2AA 4BWKA 2VWZA 3V5QA 2XEZA 3VW8A 4D2RA 4X2JA 4UN0C 5HO6A 3U4WA 3S00A 2PVKA 3V5JA 5AM7A 4BDGA 3R6XA 4IAZA 5HLWA 1R0PA 4FSQA 3Q96A 3PA4A 3SG8A 4RZWA 3FZTA 3OS3A 4F0FA 3P5KA 3BWJA 5CZIA 3POZA 3FQHA 3LCKA 5DA3A 1JSUA 5M4IA 3PP0A 4OBQA 3ZUUA 4PV0A 3ZFXA 4OT6A 5EM6A 2QLQA 2YAKA 5M4UA 5CAOA 3MVMA 4DGLC 4K9YA 3UP7A 3TXOA 2FSOX 2WMUA 2Z8CA 1FGIA 2W9ZB 4PDSA 2F49A 3M1SA 4V0GB 2QOKA 3ZUTA 2VTRA 4C35A 4TYHA 4LUDA 5IA4A 2O3PA 2P2IA 3BWFA 3ANQA 1GZOA 2J0LA 4QTCA 5IA2A 3BHTA 4IXPA 4CG9A 4HGTA 2X6EA 2YIYA 2XKFA 4MAOA 5ETFA 2RL5A 3LHJA 4NIFA 3ODYX 1YWRA 4JG6A 4BCIA 4DFXE 4KIQA 4EQMA 4BTMA 3BLQA 2W1EA 3VBVA 3W2SA 2VTSA 4XG6A 2XNOA 1XH8A 4HGSA 4FIFA 1JSVA 2VTLA 3DKGA 4MD8E 3UO6A 3DZQA 4H3BA 4I0TA 4RVLA 4OBOA 3ITZA 4IE9A 5HIDA 4RX5A 5J9LA 1ZXEA 4FNZA 3UOKA 4CV9A 3UNJA 4PNKA 3R00A 5CNOA 2Q83A 3QZIA 4BCQA 3GC7A 3UC4A 3V51A 4QMNA 4DG0E 2JKOA 3HP2A 3GQIA 4G6NA 4XOYA 3Q6WA 5DIAA 5E1EA 4OBPA 4FEQA 5D7VA 3JPVA 3A4PA 5J5TA 4N57A 2VWIA 2ITYA 5CVHA 3I7BA 1SNUA 4FIEA 3ZLWA 3EFKA 5AUWA 3W16A 3FMLA 4LRMA 4DG2E 5IUGA 2Z2WA 3QCXA 2XNEA 4KKHA 3Q60A 2VX1A 3PY3A 3VUKA 4QP2A 4JDKA 5D12A 3ZSIA 4F0GA 5E91A 3TTJA 2YCFA 2JLDA 4DH8A 3DNEA 5I0BA 3SHEA 5HNIX 3CBLA 1NT2A 4QMOA 4V0GA 2BRMA 5DRBA 4USDA 4IEBA 4O1PA 2PVJA 2OH4A 4DGMA 3ZLXA 4D1SA 5FXSA 5DNRA 5DHJA 2XNGA 1DI9A 3ET7A 1GIHA 3FC1X 4S34A 3QLGA 1OBDA 4O7YA 3EYGA 2UZUE 4JQ7A 2B9HA 2GMXA 2B9IA 1RW8A 4HOKA 5L8KA 4L44A 1MRVA 4R5SA 4ANOA 4FKJA 4WD5A 3CY3A 2C1BA 4C2VA 2P4IA 3NYOA 4MWHA 2YWPA 4HVGA 4U79A 4H1JA 2G1TA 1Y6AA 1OKWA 2GU8A 3MY1A 3OWKA 1SVHA 4C3RA 1FPUA 2ZM4A 4NEUA 1Q4LA 4ZTNA 3E88A 3ZU7A 4G3GA 2NPQA 3GCQA 3LXKA 2FVDA 2X9EA 4HW7A 3QX4A 3ID6C 2R5TA 4CT1A 3OD6X 4S30A 2RIOA 4IAIA 4WNMA 4C4IA 4CEGA 4EZ3A 4R3RA 4NL0A 4LOQA 4AZSA 4JBOA 5HTCA 4FL3A 1JAMA 3NIZA 4QMTA 4YO4A 4I94A 2WMTA 2W1DA 4ZTQA 2R3IA 4GFOA 3DAJA 1KOAA 5M06A 1H25A 3AQVA 3OXZA 3EQRA 4YO6A 4MD7E 2QC6A 2YDKA 4BDAA 3NYXA 4EOQA 3W2PA 5GZAA 5JKGA 5D7AA 3TJDA 3FL4A 3CKWA
chains in the Genus database with same CATH superfamily
2GNFA 1FBNA 3MI9A 4UYAA 3PLAE 5JFVA 4AOTA 3ZBXA 2E9VA 3BCEA 5HHWA 5AP6A 1P5EA 5JGAA 2JAMA 5F20A 3U6HA 2WMSA 3BLRA 1G8KA 4MXXA 1FVRA 4GT4A 3RBWA 3ROCA 4U3ZA 2FO0A 3Q4ZA 4BZNA 2XH5A 3DTWA 4U7ZA 1SMHA 4QQJA 3EQDA 4IZAA 3VS0A 4CZUA 3SC1A 4F6WA 5E8XA 5JZJA 2ZMCA 2RG6A 1OBGA 3UODA 1OL1A 5IQBA 3QF9A 4ZSGA 2JIVA 1OIYA 4FTMA 1YI3A 3ACKA 2JIIA 3VBQA 1P4OA 2PMIA 3F5PA 2VN9A 1PKGA 3PXRA 1BX6A 1NA7A 4JBVA 4OTHA 1OIQA 3FPQA 3W0SA 3UYTA 4MXAA 3UP2A 3E3PA 5CALA 2RFDA 2OZAA 4U43A 2BAKA 4XX9A 3PLSA 2BCJA 3E64A 3G0EA 5HO8A 5J95A 1AD5A 4E73A 3U55A 3HGKA 3NWWA 4YJOA 4U44A 3DBEA 5JT2A 3CIKA 5C03A 4ANMA 2HW7A 3AC4A 3ZLSA 5LARA 2ITUA 2UZOA 3Q53A 1XH4A 2PTKA 5GJFA 1JLUE 2BDJA 2R3PA 2FGIA 3K3JA 3KXXA 3R22A 3WF9A 4D0WA 2QKWB 4O96A 2UV2A 4C34A 4M7IA 2WMAA 4ENXA 4F4PA 5AR8A 2UW9A 3MFUA 2C3KA 3F9NA 4JQ8A 4M97A 3W2RA 3KK9A 5IISA 2WTIA 1RDQE 3AGLA 2B54A 5KBQA 4C4EA 5EQEA 4DHFA 3C4EA 5BQ0A 2W4OA 2QCSA 2C6EA 3EQIA 5G1XA 4TNBA 4HYHA 3PJ2A 4PP9A 4MQ2A 2WIPA 4PWNA 4ALUA 1S9IA 3ZTXA 4APCA 2ZJWA 5K0XA 2QG7A 4GVJA 5TR6A 4Y73A 3HDMA 4L8MA 4I21A 2JFMA 3O17A 2VUWA 5DGZA 3N4TA 3RAWA 3PG3A 1H07A 4D55A 1DI8A 4F7NA 4QMZA 1VYZA 4I5MA 4BBMA 4I4EA 2YABA 1IASA 2UVYA 2OGVA 3P7BA 1CKJA 1QPJA 4FC0A 3KIOC 3D15A 2IG7A 4NCTA 4GK4A 3NDMA 2WQNA 4UXQA 2XNMA 4RJ3A 3HRBA 3V01A 3ZC5A 4WRSA 3DFCB 5CY3A 1PXLA 4CCBA 3R0TA 4CSVA 4ZTHA 5CYIA 5BMMA 2ZMDA 4D58A 4O0UA 5KZIA 4PL3A 4HZRA 3K2LA 4DTAA 3GU7A 4IVAA 4KIKB 3LVPA 4FZAB 2G9XA 3GVUA 1UU9A 3KFAA 5LMKA 3JY9A 3OZ6A 4O0RA 4O1OA 3UVQA 5IPJA 5M07A 2YCRA 4PTGA 5DR2A 3O23A 5HNBA 4DLJA 1HCKA 2FA2A 3HV3A 3U9NA 4EBWA 1V0OA 4IJ9A 4E4MA 3SVVA 1K9AA 2ACXA 2XB7A 5KMNA 3UPZA 2W5BA 2PYWA 2QVSE 2ITOA 3RMFA 1SM2A 2NP8A 1BYGA 3IONA 5C8NA 3UPXA 4RFZA 2IVSA 2CNUA 4LOOA 3OCTA 2H8HA 2XAOA 5CU0A 1Q3DA 4I5CA 2RF9A 5D41A 2R3QA 2WTKB 5EDQA 3TKIA 4FIIA 2RFNA 1PY5A 3QTXA 2QOCA 5BV3A 1G8SA 4HZSA 3N9XA 4U81A 4JQEA 2CGUA 4WT6A 3TIYA 1SYKA 3F2RA 3FZOA 3TDWA 4DCAA 2XCKA 3OCSA 4P5ZA 2V5QA 2VTNA 1O6LA 4O0YA 5B2MA 4G2FA 3R2BA 4FNWA 2BR1A 4I23A 2PVLA 1FVTA 3P7CA 4Y83A 3IECA 2O2UA 2CGVA 3LJ1A 4FSUA 4JDHA 4WG5A 4X6RA 4DHIB 2EUFB 2C30A 2WQBA 4HJOA 5HLNA 4NM7A 4QP8A 1K3AA 1Q8TA 3UDBA 5FRIA 4JJRA 3WBLA 3WE4A 1FMOE 2PUIA 3DDPA 4GS6A 4FT0A 4I6FA 4P5QA 3CQEA 4AX8A 3LW0A 3W0OA 4DHZA 3ETAA 3NW7A 4GG5A 3EH9A 1H0VA 5JK3A 5KUPA 2Z7RA 4K11A 2BAQA 3DOGA 4UX9A 3OVVA 4KIKA 3HV7A 2O8YA 3MH1A 4WKQA 1ND4A 4O7RA 2Y4PA 4MX9A 4ZS0A 3PY1A 3ZO1A 3A61A 3HMOA 4XUFA 5AR5A 2UZTA 4CCUA 2UZNA 5T3QA 3ZLYA 2XJ0A 2XBJA 3RPOA 2CCHA 1OVEA 3DT1A 3EQBA 5J9YA 3RZBA 4AZWA 5LWMA 5I9UA 3GU5A 2YZLA 3BHHA 3PG1A 3FHIA 4C4GA 4MVFA 3GENA 4ZTLA 3FSFA 1VLRA 3SGCA 2CNVA 3ULZA 4OAVB 5A4TA 4RVTA 2UW0A 4JVGA 3MGYA 2HCKA 4Z16A 4ALWA 4ZSJA 4DA5A 4X7QA 3RM7A 2CKPA 4XJ0A 3RNIA 3ERKA 3FHRA 2GTNA 2B52A 3OUKA 4XH6A 5LMAA 4G6LA 3CC6A 1UNHA 1O9UA 2Y0AA 3W18A 4AGDA 1JVPP 3DQWA 3AMAA 2FYSA 1YDRE 4KNBA 4C59A 4C4FA 2PMLX 5CLPA 1OPLA 5DN3A 4XV2A 4RIWB 5DPVA 4ANLA 3H3CA 4F78A 5HE0A 4GVAA 5KBRA 5DVRA 4L45A 5ETAA 5A54A 4AZEA 4TWCA 3UYSA 1QMZA 3LOKA 4EOPA 3BHVA 1K2PA 4Y72A 3ODZX 3G33A 4DGGA 1OMWA 4FKGA 3GU6A 5LMKC 5IQDA 2EB3A 3LLTA 2BZJA 4M68A 3NYVA 3W2CA 4ZK5A 3CTJA 3SDJA 4U5JA 4QYFA 3ZOSA 4F64A 1NVRA 4WNPA 3ORMA 4ZLYA 2C4GA 4AW1A 2ZDUA 4EH7A 3OEFX 2VGPA 3F3VA 4FIGA 5I9VA 1YHSA 1W83A 3DNDA 4IBMA 3P5JC 2XM9A 4YU2A 2X4FA 2ETKA 2C47A 2R3RA 4XYFA 1RJBA 3LQ8A 5DI1A 3TI1A 4AT4A 2QQ7A 4GK2A 3RI1A 2JKKA 2YM8A 2I0HA 5AX9A 3VJNA 2GS6A 1ZMVA 3FI8A 4WG4A 1XO2B 2W99B 3LE6A 3NSZA 4LI5A 2PHKA 4F09A 2VAGA 1W82A 1KE6A 3W10A 4AQCA 4HVHA 4G5PA 5CU4A 4D5HA 3PRFA 3TNIA 4UZHA 4DEHA 3E62A 3UQFA 2EVAA 3DCVA 1Q8ZA 4G3EA 5HG7A 3RM6A 3ZHPC 4EOLA 2WQMA 4N6YA 5IMEA 5M51A 2GFCA 4JG8A 2R0IA 2XANA 4O82A 2GNIA 2C6TA 4F1TA 3Q4CA 3OW4A 2DUVA 1DAWA 2W96B 5E7RA 3O2MA 5IKWA 4M12A 4CZTA 3EFWA 4GEOA 5FM3A 5EI8A 2QU5A 1CKIA 5ANGA 2WHBA 3ZSHA 1V0BA 4IB3A 4BCNA 4FZDB 3H30A 4GYGA 3R2YA 3UVRA 3JS2A 4O81A 3C50A 3FSKA 4EC8A 3PIXA 2XKDA 2BAJA 3QTSA 1LUFA 4BI1A 5L6PA 4YTCA 2CKEA 3EOCA 2NNWB 3EL8A 3JY0A 3AG9A 3EQPA 3KK8A 5HCXA 3U6IA 5IG1A 5KMLA 3NVMB 3D9VA 3GC0A 3QCSA 3SRVA 3UBDA 4HNFA 5I9WA 4I24A 1YXTA 3R7YA 4I20A 4TPTA 2BFXA 5CI6A 1RQQA 4JNWA 4F1OA 5J1VA 4YJRA 4UMTA 3QD4A 3G6HA 4Y5HA 5FEQA 5AUZA 3R7GA 3GOKA 3S95A 1UU3A 3KKVA 2PVRA 3DFAA 3MPAA 4K18A 3ZMMA 3HMIA 2OXYA 4AFJA 5JFWA 5E8YA 1GZNA 4DEEA 3FY0A 3GU4A 4IZ5A 4EOMA 5K9IA 3GOPA 4CMOA 4O0TA 5AV4A 3COKA 5KMJA 5DWRA 1U4DA 3T8OA 2RKUA 4O0WA 2JKMA 3QHRA 4IAKA 2G2IA 4BDCA 2WOTA 5I4NA 2W1GA 3FZSA 3M42A 2OSCA 5HZNA 3W0PA 4BBEA 3KRJA 1Z9XA 2C0OA 2PY3A 2WGJA 3FLQA 3UNZA 1ST0A 3AT3A 3GCSA 3L1SA 2VTAA 2XNBA 3P08A 2VD5A 4HNIA 5LVLA 4YZ9A 5ANKA 4E6AA 1UVRA 3F7ZA 2XK7A 3HUCA 4JS8A 4RGJA 4MNEB 1YDSE 4RJ8A 2ETMA 4K8AA 5FDXA 4KKGA 1Q99A 3R9NA 4D2TA 3AKLA 3V8TA 4X3FA 5J87A 4FSNA 1SVGA 2CGXA 4DHJA 4YC3A 3BGPA 1H01A 4TWNA 3HMNA 3Q5ZA 4BKZA 4PPAA 2OJJA 3PE1A 4FT5A 2ITQA 1IEPA 2QR8A 4L00A 1CM8A 4RJ6A 2VX3A 4U40A 4O0VA 4EZ7A 4CRLA 4S32A 5DR9A 5CEKA 4W4XA 5KMKA 2AQXA 2XCHA 2R3NA 4E8AA 3FEGA 4JR3A 1GJOA 4BJJB 1J3HA 2YFXA 1ZWSA 5HVKA 1ZYDA 3A7HA 3W1FA 3ZH8A 4GU6A 3VBXA 3OT8A 5AAEA 3R9DA 2X8EA 2J4ZA 3UIMA 3VULA 5E4HA 2J2IB 1M14A 1ZOHA 4NK9A 4ZSAA 3QQJA 1Q3WA 3COHA 4QMVA 5DT3A 4KS8A 4JBPA 4O38A 5TOZA 4I6QA 3TZMA 3VS6A 2HAKA 4O21A 2W4KA 4BCFA 4RIXB 4D1XA 1OZ1A 4PRJA 2P55A 3Q32A 3HZTA 4XV3A 4RC2A 5DYJA 3QLFA 4KRCA 4MXYA 4BGGA 3L8SA 3RK7A 5HE1A 3CLYA 4R7IA 2JGZA 5HLPA 1U54B 2R7BA 3LZBA 4MWIA 2R3LA 4B8MA 3VONA 2ZB1A 3LJ2A 4PDOA 3F3ZA 4G31A 4XP3A 4FV4A 3NCGA 5HE2A 4A4LA 3W0MA 1GY3A 5EQPA 4FGBA 5I9XA 4FTUA 4IVCA 4L7FA 2CGWA 4BGHA 2HW6A 3TZ8A 3IW5A 3ORIA 5EKOA 3NFFB 3G6GA 3TZ7A 4MNEA 3QRKA 3D5XA 3MSSA 2YN8A 4U0IA 4DLIA 1UNLA 3IW6A 3UTOA 3GT8A 2JC6A 2PULA 1A9UA 4C58A 4EWQA 3BZ3A 5FUTA 3ZEWA 3G0FA 2C68A 5EOLA 4DFLA 4B7TA 4E6CA 3BBWA 5CSVA 4ZXTA 3COIA 3VC4A 3R30A 4LQMA 4M66A 2JDRA 3DLSA 2VWWA 3T3UA 3TN8A 3KVWA 3WZUA 3KC3A 4RLKA 2ERKA 2J51A 5HO7A 3KULA 5ICPA 1OKZA 3QGWA 4I0RA 2IWIA 2O64A 5EYKA 5I3OA 3KQ7A 5FEEA 4O7WA 4BJJA 2IVTA 3R1NA 3TZ9A 5L2WA 4ACDA 4AFEA 3PJCA 3ZRKA 3CTQA 4KABA 2ITVA 4D9UA 4D0XA 3GCPA 4IM3A 4Z7HA 3NCZA 5CANA 4KKEA 4AT5A 4CQGA 2B1PA 4D4YA 3DXQA 4RIXA 2XRWA 1G5SA 1QPCA 3QZHA 4AQKA 3Q9YA 4EQCA 3UIXA 3UZPA 2DYLA 4LGHA 4BIBA 4F6SA 3QKLA 2JIUA 2F2CB 4JIKA 5EG3A 2OICA 3RPRA 4WG3A 2W1HA 1TQMA 1U54A 3PTGA 2XIKA 1HOWA 2YEXA 2VWVA 3QWJA 4JDIA 1UWHA 3MIYA 3OOGA 4L42A 5BVWA 3QBNA 4BZOA 4AXCA 4ASEA 4ID7A 4O4DA 5FBNC 3VS5A 3OW3A 3MH0A 4XBRA 4ACHA 5IH5A 4IB1A 3VS3A 3DBQA 2C5XA 5JQ8A 1WBVA 3OWJA 3QQKA 5CSXA 3W0RA 3SA0A 4UMUA 3E8EA 4KS7A 4I3ZA 3OXIA 5HI2A 3IW7A 2Q0NA 2H96A 1JKLA 5GIOE 4CKRA 5E90A 5DOSA 2WTDA 3ZBFA 4AU8A 3RCDA 4PMTA 3IO7A 3IGOA 3DV3A 3U87A 1H1QA 5F1ZA 3EYHA 4MBLA 3I6UA 2VTHA 5CASA 3NUAA 4L52A 2HWOA 3NNUA 3LM0A 5EM5A 4HYIA 3RAIA 2QG5A 4FL2A 4YC8A 3GB2A 5JSMA 3EMGA 4GV1A 2QURA 3EN4A 4MEDA 4XS2A 4ERWA 4QYGA 4PDYA 2H9VA 2HZ0A 5JZNA 4OTDA 4R3CA 4YZNA 4HYSA 5HU9A 2XK8A 3UIUA 3CGOA 4MTAA 4I0SA 4K33A 5EI2A 4FI1A 2VWUA 4QTEA 2WTCA 1ZAOA 4ZOGA 4H58A 1OL6A 4E4NA 1FVVA 1IG1A 3IOPA 5FQDC 5IUIA 4XHKB 3LXNA 5M44A 3A62A 2R3HA 2KULA 4EORA 2FB8A 5A4EA 4EH8A 2XEYA 4QMMA 4PUZA 3EKKA 3BYMA 3R8UA 3C4XA 4AOIA 3F3UA 3O0GA 4RIOA 3DA6A 3OCGA 4RWIA 5CI7A 4YTHA 4AAAA 4RA5A 3PSBA 4BYJA 3E8DA 3T9TA 3Q9XA 2FSTX 3TKHA 1JNKA 4BDBA 1XHAA 2XJ1A 4ZY5A 4IH8A 2YCSA 3FC2A 5LMBA 4JBQA 3EIDA 4LYNA 2ITZA 3PA3A 2I0YA 4P4CA 4RWKA 1OL5A 2X1NA 3CR0A 4O7SA 3LCTA 4M67A 3VQHA 4O0SA 1H1WA 1QPEA 2YITA 1R0EA 4FGRA 4PNIA 3TACA 4YJQA 2EXCX 2HELA 2R3JA 2GHGA 3O7LD 3R9HA 4FSWA 3C13A 4RVMA 5L8JA 4OTGA 4X21A 4LOPA 4L43A 1DM2A 2PUUA 1LPUA 4L9IA 4RSSA 4DH5A 4E20A 2IVUA 4IWDA 2PZYA 1ST4A 4F99A 5AV3A 3L9LA 2ZOQA 4GJ2A 3FMJA 4WSQA 4RPVA 3UDSA 4AT3A 3FYKX 3UGCA 3KXHA 2P33A 4OW8A 3NW6A 4IANA 4PL4A 4NFNA 5KKRC 3VHKA 5GHVA 5AR3A 4B9DA 4DEBA 1JQHA 1OIUA 1OKVA 5L2SA 3KCFA 4CTBA 3BLHA 3QFVA 3QC4A 5J7HA 4LV8A 4YZCA 3PIZA 4XLVA 2HXLA 5HNGA 3ZFMA 5M57A 4EBVA 1FINA 2OG8A 3EL7A 3KXNA 3R8ZA 4O2ZA 4YHTA 3Q52A 5AIRA 4CFNA 1W0XC 1YOMA 2IEWA 1J1CA 3IDCA 1R39A 4DYMA 3FLSA 4FV0A 5AAGA 1FMKA 5LVPA 3RNYA 4E4LA 4ZTRA 5EFQA 5ACBC 3IW8A 5C8MA 4RG0A 4R3PA 5AUUA 1MRYA 2Y6MA 3WF8A 1F5QA 2R7IA 4G9RA 1Y8GA 5M56A 1T45A 3MV5A 4ENYA 4G1WA 4RQKA 4AACA 2OZAB 4DITA 3Q9WA 2OJIA 5E8SA 3TV7A 4EH2A 4KUJA 4DN5A 3PXKA 3DJ7A 4BY9E 4DFUA 2PMNX 4MXOA 4EH6A 5BVFA 5H9BA 2YM5A 3VVHA 4NJDA 3CP9A 1NVSA 3R8MA 5AP1A 4EKKA 3QCQA 4USEA 4EYMA 4B8LA 2JITA 4GMYA 2AC5A 4QMWA 5CTPA 2RG5A 2QO7A 3BGZA 5EHYA 4NM5A 4FOBA 4IB0A 5AFVA 3VJOA 5EOBA 4YPDA 4DGNA 2R3FA 4JX7A 4PTCA 4UWYA 1MP8A 4QP4A 4AWIA 5M08A 4FKTA 2IZSA 3L8XA 4XMOA 5T6KA 1W98A 4I92A 5KE0A 5CEOA 5FBOA 2A2AA 2BDFA 2JEDA 2C6KA 2E9PA 4KSPA 3PRIA 5CVFA 5EYMA 2AC3A 3V3VA 4E5BA 2VGOA 2BHEA 5HG9A 4IC7A 5D1JA 3DXPA 4DT8A 2C5YA 1W8CA 4YZMA 5T68A 4BCHA 2OXXA 3ZO2A 3V6RA 5DH3A 3PXZA 4S2ZA 3KF4A 2VTJA 4R1VA 1FOTA 3O8PA 5EI6A 4NH1A 2YISA 4EH3A 3MJ2A 2WIHA 1R3CA 3KL8A 1J7UA 3MY0A 3PSCA 4ZLZA 3UNKA 1JKKA 2C3LA 4MHAA 2YERA 4J98A 2W06A 4A9RA 2EWAA 4JRVA 2WQEA 5CZHA 3LCDA 4M8TA 3TCPA 3VAPA 4LGDA 4B99A 1IRKA 3IDPA 4C3FA 3A99A 2I7QA 1VR2A 4JG7A 2OLCA 2QI8A 4U45A 2OKRA 4QMXA 4G6OA 5H3QA 3V5PA 3KRRA 2YWVA 4IFGA 5CXHA 1REJA 2WFYA 4NKSA 3W0QA 3W33A 4EOOA 2W05A 4QDEA 2C6OA 4X2GA 3QA8A 5BYYA 5EKNA 3GBZA 5LQFA 1U59A 3RGFA 3NVKI 3TTIA 5AX3A 5TKDA 2PVNA 4GSBA 3QQUA 4D5KA 3O51A 4IX3A 4BR3A 4N70A 3O5AA 3K54A 3F69A 4FK6A 3AC2A 3QKMA 1ZLTA 3BBTB 3MA3A 3ACJA 2CHLA 4RBLA 3ZM4A 4EL9A 3AGMA 3NEWA 1WVYA 3R71A 3WYXA 2QOHA 1H4LA 2OF2A 4GW8A 3VS2A 5IDPA 4GUEA 4DGOA 2W1CA 4LRKA 4C02A 3TUBA 2W5HA 1UU7A 1OPKA 3E5AA 1QPDA 3QZFA 3ENHA 3TV6A 2YIWA 5DEYA 5FD2A 3KMUA 5K5XA 4FTNA 4PDPA 3CGFA 5DBXA 4EJNA 5GINE 3GUBA 4EZ5A 5J1WA 2PMOX 4FV9A 4GG7A 4QYYA 4F9CA 4FMQA 3VF9A 3O8TA 2HY81 4OTWA 3HA6A 3O96A 4UWCA 3QUDA 4ZY6A 3WIGA 5DT4A 1BKXA 3G9NA 2OJ9A 5FXRA 2IW8A 4CNHA 4GRBA 5C27A 1ZYJA 5KO1A 4YHJA 3EFLA 4CXAA 3UO5A 3FMDA 4N4SA 5JRQA 5CWZA 4TYEA 5EYCA 3R8PA 5D11A 2ITXA 3OWLA 1URCA 1CTPE 3HVCA 4DEAA 5EM7A 5C01A 5L3AA 2J0IA 4IAYA 1H00A 4BF2A 4YGAA 4NM0A 1YHVA 3RWQA 4AE9A 3U8WA 2R0UA 4ZJJA 4CYJA 3HAVA 4V01A 3ZDUA 3O8UA 1YXUA 3I0OA 3HRCA 4ZAUA 3AC5A 4IZYA 3DQXA 3H0ZA 4FF8A 4KINA 2WTVA 4QPMA 5HIEA 4UYNA 4BDJA 2WEVA 4CMUA 2X7GA 4MBIA 4R7HA 4DC2A 4KB8A 3KEXA 4WBOA 1Q8YA 4K6ZA 5LCKA 4DFYA 2W0JA 4ZZNA 3AD4A 2YHVA 1YHWA 5HCZA 2WMVA 4DCEA 5BUJA 1PYEA 3HKOA 4HCTA 4RFYA 3HRFA 2NYAA 1I44A 1OM1A 3RHXA 3DY7A 3F66A 4RIYA 2VU3A 3Q2JA 2W1ZA 5BVNA 5AV1A 1WVXA 1ATPE 3OMVA 5E8WA 3TMOA 4XG8A 1H8FA 4Y95A 4FTIA 2XYNA 3PWYA 3W2OA 3ZSGA 5CEPA 4USFA 1V0PA 1KWPA 3EKNA 3FMNA 1XBAA 5M4FA 3QXPA 2X0QA 4C8BA 2BIKB 5B7VA 3ZUVA 5K4JA 4L3PA 3ZS5A 3COMA 5DEWA 4FG7A 5M4CA 3R7IA 4PX6A 4QP9A 4P2KA 4YMJA 3C51A 3FMEA 4JAIA 5AP2A 5E92A 5HG8A 3AC8A 3PPKA 2HZ4A 4WNKA 2XNPA 3KMMA 1H26A 1KE5A 2Y9QA 3GC8A 3UJGA 3CD8A 3BIZA 3DBFA 1WBNA 4DTBA 4FEUA 3SOCA 2B53A 3IK3A 1NXKA 3AKJA 1APME 2VNYA 5AP0A 3UDZA 3DBCA 4YZBA 3A8XA 3GCUA 4QMUA 2CJMA 4WUNA 3W8LA 3P4KA 2UZBA 4R1YA 4ITHA 2QODA 4H3QA 2XJ2A 5A4LA 3E8CA 3LM5A 4XG4A 2CNQA 3POOA 2J5EA 3Q04A 3OY3A 3LIJA 4M0YA 4U6RA 2ZM1A 4X2KA 4DAWA 5IQFA 3OC1A 3KXGA 4BB4A 4WA9A 3E63A 2WZJA 2OXDA 4A07A 5HQ0A 3BELA 4NYEA 4RFMA 3ORPA 2YCQA 2XM8A 5BYLA 3I60A 3QX2A 2A27A 3RJCA 5EHOA 3BL9A 4JOAA 4Z55A 5LVOA 2ZV2A 4YUQA 5FP6A 3CPCA 3TV4A 4FOCA 2VWXA 4KWPA 1XQZA 4S33A 2IPXA 5DRDA 4YR8A 4WUAA 3GEQA 4C4HA 3D7ZA 2DS1A 2F2UA 4FSRA 5IUHA 5A46A 2GQSA 4D1ZA 3N4VA 4UBAA 1KE7A 4OTPA 2F7EE 2J9MA 4Q5HA 4AUAA 3A4OX 3EZVA 2ITWA 3BYSA 3F2NA 4FKRA 3BQCA 4G34A 4IX4A 4GT5A 4PY1A 1Q24A 5C26A 4BBFA 4Y46A 4YSMA 3I6WA 5CSHA 4AGWA 4BDFA 2WD1A 3QA0A 4W4WA 1W2DA 5AM6A 4LMUA 2PPQA 4FKIA 4LL0A 5HORA 3IS5A 4LG4A 3LCSA 4AW0A 5FM2A 4DFNA 2Z7QA 2GPHA 4E7WA 5CQWA 4AGCA 5HX8A 4GFMA 3LXLA 2Y4IC 4YJNA 3KN5A 3W0NA 3MVLA 2WXVA 3SW7A 2F57A 2YM6A 4FUYA 5JEBA 3D94A 1OECA 2O0UA 1Y6BA 5K3YA 3REPA 4O7LA 3TNHA 3TNPC 4CKIA 2P2HA 1SVEA 2HYYA 2IO6A 3FV8A 5HG5A 3HX4A 5BVKA 3NR9A 5HU3A 2GHMA 1OGUA 3PPZA 3OTUA 4J7BA 4TT7A 3V8SA 3VF8A 3F6XA 3SRVB 2VO3A 3M11A 4TYGA 4QT1A 4XG7A 3UE4A 5BVDA 5GIPE 3L8VA 1XH6A 4II5A 2HY0A 4JMQA 4HGEA 4B6LA 2RFSA 3C9WA 3VS7A 4I5HA 4X6QC 4J96A 4CTCA 5AAFA 3O71A 3DJ6A 3QD0A 2X2LA 3UOHA 3CQUA 3KXZA 3SX9A 5BNJA 4ALVA 3ZO3A 2PL0A 3I0QA 2C6DA 3L9MA 1CDKA 2O5KA 3BYOA 4UMPA 5D9HA 3KY2A 3LPBA 2IZTA 2OJFE 3D14A 5IEYA 5KHWA 4FNYA 3R8LA 3GC9A 5K0KA 1ZOGA 3LFSA 5JMSA 1WBSA 4BCOA 3SXRA 3W55A 3ZFYA 5AEPA 1OGYA 1M7QA 3N4UA 3H9RA 3Q4TA 4GCJA 4I1ZA 4EEVA 4EHVA 4IMYA 2ETRA 4OTIA 1OUYA 2XUUA 3PZEA 3TL8A 3R8VA 2QKRA 4FTAA 1XMLA 5JRSA 4C36A 2VO6A 2RFEA 1JKTA 2JFLA 2YDJA 3P7AA 2PZIA 4CKJA 5LCJA 2WMXA 2CMWA 4TYJA 4ANSA 3OY1A 2R3OA 3N51A 4FKVA 2WKMA 3IQ7A 2GSFA 4BIEA 4EH9A 4HCUA 4JR7A 4CFWA 5DR6A 5FTOA 3DB8A 2ESMA 2R4BA 4EC9A 4WRGA 3ROYA 3RTPA 4MQ1A 1UV5A 2I40A 2JDTA 3PIYA 3PPJA 4XLIA 3HECA 5D10A 3TNWA 4IX6A 4X3FB 4ZIMA 4ARKA 3FUPA 4IWQA 4E6QA 3L9NA 2ERZE 1QL6A 3PJ1A 4G3CA 3UG2A 2QD9A 4FKQA 3TKUA 5KMOA 2X2MA 5BUEA 1G8AA 4YC6A 3RWPA 3UOJA 3OROA 5E8UA 3FLZA 4M3QA 5DLSA 3A60A 4XG9A 2LGCA 2CN5A 3U9CA 5JFXA 4FKPA 1XBCA 5AP3A 5HE3A 4LDTA 4RQVA 3SV0A 3G2FA 2JKQA 5LVNA 1EH4A 1WFCA 3PDTA 5AUTA 4ORKA 4W9XA 5AP5A 3F82A 3CPBA 3D5UA 5KZ0A 5I9YA 4FSZA 1YOLA 4NW5A 5AUYA 2CDZA 1M17A 3NYNA 4XG3A 3R9OA 3EFJA 1WCCA 3E7VA 3DK7A 5AUXA 1V1KA 4DE4A 2C0IA 3DXNA 4F65A 5FEDA 5IH6A 4FV7A 4IVBA 3QHWA 1Q61A 1KV2A 4OAUC 4FT7A 3VUTA 3ZZWA 5IA5A 1L8TA 3U54A 5J7BA 5CX9A 3MBLA 3ORZA 3QYZA 1PMNA 4FZ6A 1BMKA 1Q41A 3BV3A 5CENA 2CSNA 3OCBA 5FP5A 4E3CA 3Q6UA 4O4CA 3EN7A 1MRUA 4GK3A 3MW1A 1M2QA 4PP7A 2BKKA 4EJ7A 3R1QA 5CVGA 1KUTA 3VS1A 3R1YA 4FTCA 2NRUA 2QONA 5HVJA 4IWOA 3U6JA 1WMKA 4H05A 3VNTA 1PF8A 2Z7LA 5CAUA 2C6IA 2GNJA 2ZVAA 4JDJA 3ANRA 4NT4A 4F7LA 2YIRA 5IU2A 2ONLA