3FC1X

Crystal structure of p38 kinase bound to pyrimido-pyridazinone inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELIWEVPERYQNLSPVSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluating the molecular mechanics poisson-boltzmann surface area free energy method using a congeneric series of ligands to p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 104
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fc1X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fc1X01
2WTKC 4TPTA 4W9XA 2YA9A 5IDNA 4FOBA 2YIRA 2YISA 3HV3A 5AUUA 5KNJA 3QA0A 2XKFA 4FNYA 2HW7A 3GC8A 3QTIA 1NVSA 2OGVA 5DH3A 3ZU7A 2P0CA 4W4VA 1O9UA 2WMWA 3L9PA 3M42A 5EW8A 4AGWA 4ANBA 4ZSLA 2X6DA 3OXTA 3UZPA 4G6LA 5EQYA 4AZWA 1UWJA 3Q60A 1UU9A 2R3HA 4DG2E 2GNLA 3AT3A 5LXMA 4PMMA 4MXZA 4L3LA 3GCUA 5KE0A 3HAMA 1A48A 4O7VA 2CDZA 3R1YA 5T3QA 1OBGA 4GG5A 5F4NA 3ZUUA 2HIWA 4IB1A 4FGRA 3OY3A 3MW1A 4NFMA 3P7CA 4A7CA 4UXQA 4RGJA 4YUQA 2CN8A 5GJGA 2RFSA 4OAUC 4IIRA 5DT3A 4BWKA 2VX0A 4BDHA 4X2GA 2G2FA 3PWYA 5EKNA 5LMBA 4LRMA 2WMXA 4RJ4A 3RAWA 3K5UA 4ZTSA 2XNBA 4O0RA 4FG8A 4AOJA 4EH4A 4O7WA 4JQ7A 2PMLX 2OH4A 2VWVA 5HLNA 4PTCA 4OTWA 4XS2A 3ZZEA 4IZ5A 5IISA 1QPJA 1KV1A 2P55A 4QTCA 4UMQA 4D4YA 2ZB0A 3LQ8A 3W33A 1JKKA 3ZBFA 4BHZA 5H8GA 4A4LA 4ZJVA 2OZAB 4ALUA 4LUDA 2WU6A 3PSBA 3QFVA 4PDPA 4XCUA 2DYLA 5AP6A 3PJ2A 4L67A 4ZEGA 4LMUA 4D2WA 4QP4A 1YQJA 2W4OA 3KCFA 1F3MC 5HTBA 1ZYLA 1KV2A 5HNGA 4I5HA 4HZRA 3U54A 4ZY4A 4QMMA 2ITNA 2VD5A 4NSTA 4YLJA 3ZCLA 1FBNA 1JKSA 2YFXA 5IA4A 3B8QA 3AMYA 5HO8A 1PY5A 3FE3A 3AC2A 3POZA 5EHOA 1YHWA 2W5AA 4FI1A 4E5AX 3HNGA 3BHUA 4FVPA 4F7NA 1J7IA 5AV2A 5GJFA 3VS7A 3PZEA 3WARA 3BYOA 5I9XA 5BVDA 3R9RA 1JVPP 1P2AA 2KTYA 5H9BA 5DA3A 2IWIA 2PU8A 4FTOA 2WMSA 3BYUA 1Y91A 2C6TA 3PJ3A 4IAAA 5AP0A 3VUTA 2PZRA 1QPEA 2BRHA 2UW6A 3Q4TA 4IEBA 2J5FA 4LOPA 4UWCA 3G90X 4O91A 4OTFA 5LMAA 3Q3BA 5GIOE 4MNEA 2BPMA 1URCA 4RIYB 3L8PA 4YJRA 4FTCA 2O3PA 4USDA 5DRBA 1VYZA 4FK6A 3ZC6A 4TYIA 4MXOA 4FEQA 4GSBA 2PVLA 4W4XA 4CXAA 3LMIA 5DE2A 3JPVA 3PVGA 2YCFA 4XNEA 2VWBA 3UE4A 4AZVA 4R7BA 1F5QA 4JBPA 4U79A 1BI8A 3EQRA 3V5PA 3F7ZA 3EHAA 4CEGA 3COMA 4LL0A 4QNAA 3N4TA 3V5TA 4XV2A 2C5OA 5B7VA 5C8NA 2WQBA 4IMYA 4F65A 2J4ZA 3NGAA 3KN5A 4ZSEA 3ACKA 4TZRA 4TY1A 4UV0A 3Q5IA 4A9TA 3IG7A 4FV7A 1U5RA 4JG8A 4LMNA 4O6LA 1G3NA 4YZCA 2CNVA 3FSFA 1YVJA 4HNIA 4QOXA 2OZAA 4D1ZA 4HPTE 4AN9A 5AV4A 4Z9LA 5EM5A 3VNTA 4FIEA 4RJ5A 1Y6BA 1FOTA 4EH9A 4HJOA 4KKGA 5BVOA 2ZOQA 4DYMA 1Q8UA 4CYIA 4ANNA 3AG9A 4UWBA 3UOJA 5DEWA 4R5SA 1GJOA 3ENHA 4JG7A 2OF2A 3CY2A 5KZ0A 3LFQA 3TG1A 1OI9A 1Q24A 4E4LA 4F9AA 1M17A 1BMKA 2GFSA 3KCKA 1HCKA 3WZDA 3E8CA 2XIXA 4XP2A 5KHXA 3BU3A 5CQUA 1BYGA 1MP8A 4MBIA 3T3UA 5DG5A 1JAMA 4BY9E 4LM5A 2JLDA 4FTTA 1DAYA 4J95A 4YJTA 4OGRA 5ACBC 3QYZA 4ANQA 1OL7A 4ASEA 4BDAA 1L3RE 4NK9A 1DAWA 2C1BA 2O64A 2R3NA 2W1HA 2X39A 3DZOA 3FV8A 4RA5A 3JVRA 2PHKA 5IQBA 2X7FA 4HCVA 4E3CA 2Q0BA 3FY0A 5DLSA 3MTFA 4O0SA 4MYGA 4ZZMA 3TIYA 4BDEA 4RZVA 1Y57A 3PA3A 4U43A 3D9VA 3QBNA 2OF4A 2ZVAA 4EH6A 2C6MA 4M14A 3BLRA 4TYEA 3E62A 3FYKX 4RWLA 5CSXA 3JR1A 1VR2A 2OSCA 4YO6A 3NS9A 2YCRA 2BILB 4ACCA 4O7RA 5ETAA 4RX5A 5ANJA 5EI2A 5AUZA 1WMKA 2PZPA 2QOLA 2UZLA 2IG7A 4EH2A 4JLCA 4P90A 4DGGA 4RLKA 5DGZA 4F7JA 3W10A 2PSQA 5FUTA 2XIZA 2OJ9A 2VRXA 5EW3A 1KOBA 2VO3A 3RVGA 5JFVA 4BKZA 2RFNA 1NT2A 2GTMA 4CFUA 4GIHA 4USEA 1NY3A 2NO3A 3CKXA 5ANDA 4NKAA 4RVKA 5IA5A 3F5UA 3SGCA 2WNTA 3LJ0A 2BZIB 2OKRA 2PE1A 4IXPA 4QMUA 5LVPA 3DOGA 2YERA 3Q4CA 3HA6A 3ZSIA 3PLSA 3DCVA 1BL6A 4U81A 2JDRA 1H07A 2HZ4A 2XKDA 4LGHA 4TNBA 2O63A 3C51A 4UX9A 3U51A 2BFYA 2W05A 4FKRA 4FV5A 4FV4A 3C4CA 3OBJA 5HX6A 2IN6A 2FSOX 4JBQA 4YZMA 2R3MA 3A2CA 4F4PA 3U87A 3PFQA 4EOKA 2OIDA 4JRNA 4X6RA 4UMUA 5M09A 1JLUE 1XR1A 2VTLA 3BU5A 5E4HA 4JR3A 3CR0A 1OUYA 4IBMA 4ZSGA 2PZ5A 3CTJA 3EFLA 3CC6A 3I60A 3DPKA 3OVVA 3BGQA 3KK9A 4V05A 4Y85A 1NVQA 5JFWA 2VV9A 3S2PA 2WKMA 3L8VA 3SKCA 4D4VA 2BRGA 3D83A 4RWJA 3UC3A 3TV7A 1ZYSA 2VO0A 4QPMA 5DR6A 4MEDA 4I0SA 4KIKA 4KNBA 3NUSA 4EOIA 2QR8A 2QOKA 1NXKA 2C3JA 2R3KA 1BKXA 3R71A 3V8TA 4EKKA 3QLFA 2R5TA 2ZB1A 3FHIA 2UZVA 4LOQA 2CJMA 2CLXA 4DCEA 4YJNA 4EZ5A 4FA2A 2XBJA 2B53A 3DU8A 3G0FA 3IGGA 3Q5ZA 4GH2A 3LOKA 3U8WA 3WZJA 4CZUA 5L6PA 2GQRA 4AOIA 4BVUA 3DKGA 3DBFA 4U97A 3RCJA 3VS2A 3Q9YA 3WF8A 3WBLA 4BTKA 4PTGA 5CALA 2WMVA 3EJ1A 4FV9A 1TQPA 3NSZA 4O6EA 4UN0C 3SW7A 4FSYA 1ZOGA 3D0EA 1V1KA 2Y4IC 3TI1A 4ZP5A 4B0GA 4BF2A 5EFQA 4HCTA 3EZVA 5BPYA 4YC8A 5EDRA 3QD3A 4HVDA 2UZOA 2Z60A 4DEIA 5HCXA 3OTUA 1XH7A 4R6VA 2O5KA 4FTRA 3MFTA 5BVEA 3N9XA 3UGCA 5A14A 3QRTA 2XH5A 2JGZA 3K3JA 3P7AA 4FZ7A 4TWPA 2QOIA 4A4XA 5HTIA 3ATTA 4DBXA 2YZAA 2PE2A 1GIIA 2WPAA 3H10A 3QHRA 5GIPE 4G3FA 5D41A 3RINA 3HMPA 3NIEA 1Z9XA 5FEDA 2BKZA 5FRIA 1OECA 1WBPA 2C0TA 2YCQA 3C7QA 4X3FC 4AGUA 3RWQA 3V51A 5J5TA 3FZRA 4FK3A 2B1PA 3UNZA 1ND4A 4TXCA 4M7IA 3PXRA 4R7HA 4A07A 2QG7A 4YJQA 3D94A 2A27A 2J90A 3OUKA 5GZ8A 3I0OA 4OR5A 1Q4LA 3PXKA 3CBLA 5ACKA 3SA0A 4HNFA 2F4JA 3HAVA 4G9CA 4X3JA 2YM6A 3BHTA 5H8EA 4BFMA 3MY1A 5K4IA 3ZFMA 4O82A 3FC1X 4PRJA 5HBHA 5BVFA 2O65A 2ZV8A 3TUBA 3CGFA 4IE9A 5CY3A 4OTDA 4CRSA 4BICA 3PY1A 3UO4A 1VYWA 4C8BA 2ETKA 2QU5A 3ORPA 1P4OA 4LUEA 4F9CA 2RG6A 4BBFA 3NW6A 2VTSA 3R1SA 5DR9A 1MRUA 3BYMA 3WILA 4ZLZA 3OCGA 4FYNA 4I23A 3HP5A 5E8UA 2XK6A 2HENA 3OCTA 3E92A 3LXPA 3PTGA 3QD2B 5TO8A 3PIYA 4K2RA 4PDOA 4DFUA 3P0MA 3BV2A 4DITA 4BIDA 3BZ3A 3KXNA 4FBXA 3BLQA 1OIRA 4WIHA 5AV0A 3ETAA 4E4NA 4C4FA 3OWKA 1GZ8A 4YJSA 2WQMA 4JAJA 2HAKA 2DQ7X 3HVCA 4GVAA 5J1VA 3VW8A 3ZMMA 2ZAZA 3V6RA 3Q04A 5A4CA 1FVVA 3OROA 3EQFA 4FKVA 2HELA 2Y7JA 5IQIA 3FLSA 5IA3A 4EC9A 2QQ7A 2Z7QA 3BLHA 1SVHA 4FKTA 3FQHA 3ID6C 4J71A 4GCJA 3CEKA 1UNLA 1GNGA 3CQUA 2PVYA 4QQ5A 4AFJA 5HU9A 4WNPA 3QF9A 2XKCA 3KREA 4CG8A 5GNKA 1E1VA 2RFEA 2BMCA 4JXFA 4Q5HA 5AUVA 3T8OA 5KMMA 4F1MA 4M97A 2FSTX 3G6HA 4Q2AA 2I0YA 4QMSA 2CMWA 5IU2A 4XX9A 4JIKA 3KN6A 3WI6A 1SVEA 3LMGA 4KWPA 3TZ8A 4C57A 2Y6OA 4AOTA 3RM6A 3VUHA 1MQBA 1EH4A 2JD5A 3R2YA 3C5IA 4DT9A 3UNKA 4B7TA 3V6SA 5IQHA 2W06A 4DHFA 3A7GA 4GKHA 5KBQA 4X2FA 3EN5A 4O7NA 2VTQA 4RQVA 3SW4A 5HU3A 2REIA 4KRCA 1LEWA 4IX5A 3RPVA 4CCUA 3VHEA 3UP2A 2CCIA 4GV1A 3T9IA 4BDJA 3IS5A 4AN3A 5GZAA 2JAMA 4FKIA 1XO2B 3RNYA 2YZLA 5I4NA 3LCKA 2Z02A 4ORKA 5KMIA 3DJ6A 5IDPA 2GSFA 5IQDA 3Q32A 4BTMA 4F1TA 2C5NA 4UXLA 4APPA 4C59A 3G15A 2GPHA 2QU6A 2B9JA 2OW3A 3QUEA 3R28A 4ANOA 4DLJA 1FGIA 4IB0A 3BBTB 3BIZA 3FLYA 5D10A 3FI2A 5E8VA 3AGMA 4I1ZA 4DINA 2WXVA 3FXXA 4WA9A 2CSNA 3ZZWA 5CNNA 4ZTHA 5EM7A 5JSMA 3NIZA 3RKBA 3VJOA 3BEGA 3QUDA 4CFXA 4HYSA 2ITOA 5HVYA 3TNWA 2PULA 5AA8A 3GI3A 4YTHA 4M0ZA 5JQ5A 4LV5A 1G8SA 4YNOA 1KWPA 4NW5A 4S2ZA 5BX0A 3JS2A 2JBOA 1ZOHA 3NCGA 4G16A 2XIRA 4L43A 1WBNA 4Z16A 3TN8A 4AG8A 3WOWA 4MD9E 4U41A 3CSVA 2HXLA 4PWNA 5CI6A 2HY81 1YW2A 2YDIA 2OI4X 2XMYA 3HRCA 4GYIA 3GC9A 3D5XA 2QLQA 5EQEA 5KKRB 4ASZA 3R8MA 5H8BA 1J1BA 1Q5KA 4DTKA 3V3VA 1PJKA 4CV9A 1JQHA 1M2PA 4EH3A 4EZ7A 4JOAA 1OKWA 4V0GB 3U4WA 3NVKI 4D5KA 3RCDA 1LP4A 4QP3A 5I9VA 4L3JA 2WMQA 5L2SA 3QC4A 1BL7A 3NEWA 3QA8A 1ZY4A 4Y83A 2XEYA 2YIXA 4BCOA 3ZO4A 3QZIA 2VTJA 3F61A 3HGKA 2VTTA 4QTBA 3UODA 4BI1A 4FSUA 3HA8A 4Z7GA 4KKHA 4UYNA 4CV8A 5DYJA 5AV1A 2QNJA 2YJRA 1O6KA 2F49A 3HMOA 4DN5A 3I5ZA 4DGOA 4ZZNA 2W1GA 3ORLA 3FQEA 4JDKA 2QURA 3V5JA 5KMLA 4ZS0A 3ORIA 3LM0A 3LFCA 4X6QC 4FKOA 1W8CA 2P4IA 2QO2A 3FPQA 4IWDA 2X2LA 4XRLA 3FI4A 3UYTA 4F09A 5EM6A 4QPSA 4KS7A 4HW7A 4NFNA 4X2KA 5EHLA 4XOYA 3ZTXA 4IC7A 1PHKA 4LFIA 2V7AA 4C38A 4FV1A 1E9HA 5EK7A 4HGSA 4FSQA 1XH5A 4U3ZA 4BI2A 4C35A 5F9EA 3COKA 5K0KA 1K2PA 2ITXA 3QD4A 4J52A 5IQGA 1GAGA 3C50A 3GU8A 5M06A 3MH2A 3VAPA 2FVDA 4CNHA 2GTNA 3W2CA 2EXMA 2V5QA 3MJ2A 3RAKA 2EVAA 4BGGA 4O7LA 2CKEA 2UZNA 3G9LX 1KE5A 3O7LD 4IDVA 4NM5A 3SXSA 1YDRE 3VS5A 4NKSA 2R3GA 1J91A 2PVHA 2YIQA 3DBCA 3VBTA 3IDPA 4ZK5A 1WZYA 3ZFXA 4GT5A 4H39A 3CTHA 4YR8A 4AT5A 4JNWA 5KZIA 2C0IA 3PVBA 5J7HA 4AZEA 4KUJA 3NUYA 4XHKB 3SAYA 1SNUA 2OU7A 1FINA 5CU2A 3GENA 4NTSA 2VWZA 1Q97A 3HDNA 4FZ6A 4D1XA 4YJPA 2I0HA 2JKQA 2EXCX 3NNWA 4GUEA 3E8DA 3UIUA 3SG9A 4CFMA 5JGDA 3NUNA 3PXZA 3P1AA 2HYYA 4QMQA 4MHAA 4V0GA 2EU9A 2AYPA 2BZJA 3UIBA 4EH7A 1U59A 5L8LA 2W1EA 3II5A 5M57A 3VRZA 4DFZE 1M7QA 2VO7A 4FG7A 1IEPA 4YZ9A 4CFWA 1ZMVA 5AIKA 3U6JA 4G34A 2Q83A 3KXGA 4IFCA 4H3QA 2XM8A 3AMBA 4M8TA 5EG3A 4E93A 5BUIA 3M2WA 3A8WA 5CVGA 5ITAA 5DNRA 4EUTA 1P4FA 2OBJA 4E20A 2XNOA 3KEXA 3NR9A 5CU6A 3W16A 3VN9A 4FSRA 4NU1A 3QTXA 4O2ZA 2IZTA 4YJUA 5KX8A 5LVOA 4RWKA 2J7TA 4OUCA 3R9HA 3MB6A 3DNEA 1B38A 1NA7A 3A7JA 1R78A 4I6HA 3CKWA 3SOAA 3GUBA 3RJCA 4CLIA 4FEUA 2ITQA 1IAJA 3G9NA 5M08A 4ZIMA 2BROA 3EYHA 4R1VA 1XHAA 4NT4A 1OGUA 2RFDA 4JDHA 3UPXA 5DT4A 2WMBA 1PW2A 3QRKA 1ZYDA 4XJ0A 2XNPA 3CD3A 5EOBA 3ORNA 5DFPA 5FM2A 5TT7A 3ZLSA 4F7SA 4JJRA 5HE3A 4NIFB 3NUPA 4U42A 4WT6A 5FXSA 3ORZA 4GRBA 3ACJA 5AP2A 4KS8A 2OZOA 3Q4UA 1X8BA 3RHKA 4ZLYA 3TV4A 5A6NA 2VGOA 3MGYA 3QQJA 3I6UA 3WYYA 4ZZOA 3CQWA 1T45A 3ET7A 4UALA 3RNIA 4C0TA 5HEZA 1A06A 2VU3A 3GFWA 4WUNA 3I0QA 5G6VA 1LR4A 4BDKA 4Q5EA 5AIRA 3O8UA 3MH0A 5DI1A 3SG8A 1V0OA 1YHVA 2CGVA 4YJOA 5LCKA 5J79A 5J9LA 4DBNA 4BIBA 4GJ3A 1R0EA 2B55A 4XLIA 5D9HA 4C58A 4U80A 4FVRA 4EOLA 2Z2WA 2F9GA 3LLTA 3UP7A 1YI3A 3QQKA 5FTQA 2C6EA 4IM0A 2E9NA 3DA6A 3DT1A 4CZTA 3LE6A 1H28A 3CJGA 4HGLA 4MTAA 4W4YA 5FBOA 5FXQA 4CLJA 4LV8A 4NUSA 3BU6A 5AP7A 4BCNA 4QMTA 1XJDA 2GQGA 4W4WA 5DT0A 4RC3A 5M44A 2B0QA 4BZOA 4C2VA 3NYVA 4FV8A 3O7LB 3OCSA 4FKSA 2BALA 2X9EA 3RGFA 4GU9A 3OW4A 4N6YA 2YWPA 1B6CB 2GCDA 1LEZA 2J9MA 2QD9A 3HMMA 4U0IA 4S31A 2XEZA 3M1SA 2JITA 3DK7A 4CKRA 3G0EA 4FTNA 2J0KA 4RLLA 4RIYA 5IG1A 2XK4A 3QRUA 5CX9A 2RL5A 4OTRA 2F2UA 1RW8A 4TWNA 3TKHA 3VS3A 3KFAA 3MPAA 4QP7A 4UBAA 4EWQA 2YAAA 4XG8A 1OKYA 2XUUA 2XJ2A 2J5EA 4RMZA 4GJ2A 3W1FA 3GC7A 3KRRA 5A54A 5I9WA 2G1TA 3BQRA 3R7OA 3ZC5A 2J0MB 1JWHA 3FQSA 5DRDA 4IAYA 5IQFA 1XH8A 2FA2A 4DA5A 3DV3A 3QCYA 3DDPA 2WMUA 3NNXA 3QQUA 5E1EA 4RIXB 5CQWA 4FT3A 2WELA 2I0EA 4I6BA 5AWMA 4MK0A 3QXOA 5C4LA 4AA4A 4YO4A 5CSPA 2NPQA 2GU8A 5ANOA 4BCPA 3RPSA 2Y4PA 4H3PA 5IUHA 3JXWA 2GS7A 4XMOA 4AZFA 3EIDA 2W1ZA 3QHWA 4IJPA 4PDSA 3WZUA 2GNJA 4BCQA 1XQZA 1H01A 4CVAA 2HWOA 4M3QA 4AE6A 4IAKA 3HECA 5K3YA 5JRSA 2IO6A 3H9FA 1UV5A 3ZM9A 4E6DA 4B9DA 4WRGA 5HBJA 4XV1A 4CTCA 2C4GA 3IOKA 5EI8A 3QX2A 4XG2A 3V04A 3ZDIA 4C02A 3BE2A 2Z8CA 4PDYA 3EOCA 3FAAA 5CT7A 5EYCA 2IW8A 3W32A 4Y95A 4B8MA 4MQ1A 4EK5A 4WOVA 3RPYA 3PSDA 4XBRA 2BRBA 4RSSA 4A9YA 2A2AA 1XH4A 3IO7A 4PQNA 3VF8A 4BWPA 3GQIA 4JDIA 4OTPA 4R7IA 3F69A 5IH4A 4X0MA 5KKRC 3PXYA 1YXXA 4S34A 2BZHB 5HCZA 3S4QA 2Z7LA 3FLZA 4EI4A 2PVKA 5EHYA 4EHZA 2HY0A 4X7QA 5C1QB 4TYHB 4B6LA 4IWOA 3F7WA 3V01A 3GVUA 3PIZA 4KSQA 2YM7A 3LCTA 5L8JA 2AUHA 3EKNA 2JIUA 4RBLA 2FYSA 5BVWA 5M55A 1GOLA 2EUFB 4GFOA 5IQAA 3EN4A 2BVAA 3R22A 4FZDB 3TCPA 3ULIA 4ACDA 1O6LA 1WBWA 4QP6A 4MX9A 1YHSA 2BAQA 2J50A 3SX9A 3DFAA 1H1RA 4K8AA 3W2SA 3CLYA 1Q3DA 3ORTA 4RFMA 1SVGA 4TNDA 5HCYA 4EORA 3NVMB 4A9UA 3MTLA 4KIKB 2IZSA 4BDCA 3PSCA 5CVHA 2HZ0A 3OW3A 4QMZA 4CMTA 2W1CA 3SXFA 3FZTA 4AW5A 3TTIA 4D2TA 3LLAA 3GBZA 4QP9A 1JKLA 4FTIA 1KOAA 4KAOA 3TWJA 4PMPA 3ANQA 5CT0A 3QTZA 3BE9A 2JDTA 2W4JA 3KMUA 4OBPA 3VJNA 4TWCA 3DKCA 2YIWA 5IPJA 2R3JA 2YDKA 1CM8A 3G5DA 2ZM3A 3QZFA 3TNQB 4J8MA 2UW0A 2YEXA 4C4HA 2WTCA 3KRWA 5DHJA 3HEGA 4IAIA 4PPAA 4RX9A 4XG7A 5K5XA 2YABA 2X1NA 2C6DA 3OCBA 4GS6A 1B39A 4NZWB 4U40A 2VTIA 3UOKA 4JVGA 4FTLA 4F1OA 4JS8A 3VS1A 4IVCA 2GNIA 3O0GA 4RJ8A 3QTSA 3HRFA 5CEMA 5C01A 4HPUE 1PXLA 1YDSE 4OT6A 3DAKA 4ZTLA 4Z55A 3AMAA 4DGMA 1GY3A 2YM3A 4D0WA 4L53A 3NRMA 2C0OA 2YN8A 2CN5A 4YZBA 3TKIA 4XG6A 4Q9ZA 3LPBA 5BVKA 2BHHA 4G2FA 3DLZA 3MV5A 2BRNA 4FNZA 2PYWA 4EYMA 2X7GA 3W2PA 2OH0E 3BHYA 3IW6A 3KMWA 4F6UA 2WEIA 4QMYA 5EH0A 4HCUA 3G33A 4H58A 5AM7A 3FUPA 3BQCA 2XBAA 4U45A 4FSMA 5AR3A 5AA9A 2IPXA 3NLBA 5M07A 4TKSA 3FMJA 5CAUA 3KL8A 1H1SA 3IW7A 3FBVA 3R04A 4L7SA 4IVDA 1KSWA 3AQVA 2R0IA 1V0BA 4LRJA 3ELJA 3VHKA 5DMZA 5JH6A 3LCDA 2E9OA 2VZ6A 5AP5A 3TV6A 3ZDUA 1R3CA 2BDJA 4AZSA 3C9WA 4J1RA 4RVTA 4FT0A 3ODYX 3D5VA 4RFYA 3AT2A 3UZTA 3A7FA 3EQIA 3DXPA 1KE7A 4RWIA 3C5UA 4BDBA 2ZJWA 3ZSGA 4R77A 4EQMA 4E73A 2PVRA 4FEXA 3EL8A 5GZ9A 3QALE 3EB0A 4NCTA 4AN2A 4UWYA 2JBPA 5HIDA 3VIDA 4H1JA 4L44A 1UNGA 3GCPA 4EOQA 4EOMA 4F70A 4FOCA 2CGWA 5E8ZA 5AUYA 4QMLA 1L8TA 3PRFA 1P5EA 3FXWA 3D15A 4R3PA 3MY5A 5J95A 5F20A 5L2TA 2VTAA 4F08A 3IW4A 4BHNA 3FYJX 3R83A 4D4SA 5IZFA 4TWOA 4O83A 3GCVA 3CS9A 1ZYJA 1DM2A 2FH9A 3IW5A 3SXRA 1UKHA 4G5JA 4R3CA 3M11A 4G6OA 1REKA 4BWXA 4I0TA 2BKKA 4MAOA 4FT9A 3PVUA 1STCE 4C7TA 4AZTA 3CXWA 3REPA 2VTPA 5I9ZA 2VNYA 2FSMX 3GU7A 2ITVA 4QYEA 3EYGA 4J97A 4KB8A 5K9IA 4O21A 3HV7A 2XNNA 2LGCA 2NRYA 4GMYA 3FLQA 3UVPA 4AAAA 5JEBA 4WBOA 3R7GA 2C47A 4USFA 5CEOA 1BI7A 2B9FA 3DFCB 3R2BA 3UC4A 1I44A 5FXRA 4QPAA 4B8LA 3PJCA 4IC8A 3HV5A 3BPRA 3SRVA 4IQ6A 4BCIA 1T46A 5KMJA 4K6ZA 4KBCA 5HLPA 2JIIA 1KE9A 5G1XA 5HICA 4FR4A 3Q9XA 4CQEA 3PWDA 1OL1A 2VTNA 3OS3A 3VBYA 4RVLA 3KXHA 4M66A 2RF9A 4H3BA 3F2RA 4G1WA 1REJA 1ZMUA 4FNXA 4O1PA 4L45A 5HLWA 2GS6A 3ALOA 3QAME 3GXLA 4O27B 3COIA 3GEQA 4BCHA 4CQGA 4ZJJA 3CTQA 3I1AA 3Q2MA 2Q0NA 4RIWA 4MVFA 5L2IA 3EQDA 1WBOA 3O8TA 3T9TA 2JKKA 4IM3A 3LJ1A 4IVAA 1H24A 4CT2A 4FSNA 5B2LA 2C5VA 3CJFA 2P2HA 4M69B 4JRVA 1RJBA 1UKIA 4M12A 4G31A 5E92A 3CGOA 3EQCA 1OIYA 3AOXA 3O50A 3ZH8A 3UQCA 4YC3A 4A9SA 3SHEA 4S33A 4FV3A 3S95A 4EK4A 2X0GA 3MDYA 3OHTA 4ZMFA 3VBVA 4PMTA 4Y8DA 3QKMA 4WUAA 2VTOA 3DY7A 1U4DA 2XNEA 4GT3A 1OZ1A 3D7TB 4NTTA 3P79A 2GFCA 4C3RA 2OJJA 4MKCA 3UYSA 3KMMA 2QI8A 5FTGA 2E9UA 3L9MA 5I9UA 2BRMA 3ZLXA 4YZDA 3NNUA 2GHGA 5DN3A 5E8TA 2VUWA 1JPAA 2XCHA 4S32A 5CZHA 3OT3A 5IEXA 2V7OA 5EI6A 2ZM4A 4K9YA 3HP2A 2IVTA 4BCFA 4PX6A 4GK3A 3UO5A 2GHLA 4XLVA 4QQTA 1FPUA 1Z57A 3DTWA 3L9NA 2OICA 4DFYA 5JGAA 2C30A 2YLFA 4YTCA 4D2SA 3WE4A 5CF5A 3QKLA 4FUYA 3GGFA 3FWQA 2PK9A 4D28A 3DAJA 1BLXA 1OM1A 4E6CA 3GQLA 1R39A 4JIAA 5LMKC 3BHVA 4PPCA 5HGIA 5TR6A 5A9UA 5IMXA 3KRXA 3NYXA 2GMXA 2GHMA 4LGDA 3GP0A 4RC4A 5BYLA 2UZDA 5LARA 3ZONA 1PYEA 3NZ0A 5AADA 2J0IA 4IX3A 5M4FA 5ANGA 2F7ZE 3VO3A 2Y8OA 4YSMA 4EOSA 1ZZ2A 3C13A 3TKUA 3TZ7A 3LCOA 3LQ5A 2BFXA 2PL0A 4RRVA 2W7XA 1Q8ZA 5FTOA 2JDVA 1YRPA 3TNPC 1S9IA 3NUUA 3W8LA 4EQUA 5JKGA 4HYIA 3FXZA 3LXKA 3TIZA 4CFVA 3LQ3A 3QQLA 3V8WA 4UYAA 4E6QA 3G2FA 4O1OA 3FMDA 2WMAA 1PKDA 4RJ7A 4F9WA 3I81A 2C3LA 3BWJA 2XNGA 5B2KA 3MVLA 3RPRA 3VQUA 4EJNA 3W2QA 5CYIA 1OMWA 4P4CA 4Y5QA 3R7YA 3ENMA 2H8HA 3G51A 4C4GA 3RZBA 3C4XA 4CYJA 3ORXA 5LCJA 3ZLYA 3B2TA 5E7RA 5HTCA 4J7BA 4ALWA 3MVMA 5A4QA 4IACA 3OTVA 3F5XA 3ZFYA 3VUDA 5LJJA 3R7IA 3UMWA 2WQOA 4RX7A 4L68A 1XWSA 5KHWA 3H0YA 5CENA 5HORA 4O7SA 5CXHA 4F6WA 4Y72A 3LJ2A 2W1DA 1FVTA 4QO9A 4YTIA 1PMVA 3LFAA 4QTEA 2GDOA 4DH1A 3KULB 3R21A 3EQBA 4JBVA 3UVQA 4JBOA 3A4PA 1ZRZA 4FIFA 2C6OA 4BBEA 3W55A 4CFFA 2WTDA 1W82A 1JSUA 3E7OA 2P3GX 3RAIA 1CSNA 5HO6A 5HKMA 4E5BA 3QCXA 2HK5A 3QGYA 4IDTA 2W9FB 4LQMA 4FX3A 1K9AA 2JEDA 2CKPA 3QWJA 3O2MA 4RJ6A 5GJDA 2HCKA 3EN6A 3Q6UA 5LMKA 2WO6A 3DAEA 3KRJA 4I4EA 3EWHA 2X9FA 2FUMA 3VBQA 3E93A 4BZDA 5CXZA 3OY1A 1UNHA 1OBDA 4LL5A 2RG5A 2WMTA 3QGWA 2FO0A 3S00A 3GNIB 4M84A 4ERKA 4YP8A 4CSVA 3MFRA 3LXNA 3IW8A 4NL0A 2W5BA 4G17A 5IQCA 3UG1A 4D2VA 5HD7A 1VJYA 4ONAA 3SRVB 2OK1A 4O0VA 3H30A 2NP8A 3E63A 4FIHA 1FMKA 2ITYA 4ZXTA 5BYZA 5JZJA 3NAYA 5E1SA 3WYXA 4CZYB 4Z3VA 1R1WA 4DCAA 3Q4ZA 4FEWA 4ACMA 5D7VA 4MWIA 2ERKA 2QONA 3UOLA 2PMOX 4CKJA 4OTIA 1WVXA 3K5VA 4YPSA 3V5WA 3VS4A 3CY3A 3RMFA 2I7QA 1OITA 1W84A 5E8XA 3PY0A 1LPUA 5DEYA 5J9YA 2GQSA 2Y9QA 3MSSA 1H08A 4U6RA 3VVHA 4FL1A 4ACHA 3WIGA 3A7HA 4MF1A 5M56A 2JKMA 4AFEA 2BAJA 2PVFA 5HG9A 3KULA 4I5CA 1UU8A 3KVXA 2F7EE 1H0VA 4IZYA 5JFXA 5C8MA 3PG1A 5M51A 2XIYA 2G9XA 5HBEA 3QQGA 4TYGA 2QOHA 4TTHB 4I22A 1DI8A 3LFBA 3KF4A 1M2RA 3F3UA 4H1MA 2WIHA 3Q2JA 1XH9A 4FV2A 1JSTA 3NAXA 2F2CB 4MXCA 4IZ7A 1ZXEA 4GT4A 4AA5A 4II5A 4AXAA 3PP0A 1R0PA 3MBLA 5AP3A 2ESMA 4G9RA 2KULA 3G6GA 3IKAA 4UZDA 3RWPA 4Q9SA 4O7YA 3QUPA 4GIIA 3RK7A 4D4RA 5CEKA 4O81A 4JX3A 5AX9A 4YHTA 3A99A 3D7ZA 5CSHA 3UQGA 3CE3A 4FKLA 4A9RA 5CEPA 2JFLA 1W0XC 2ITTA 3MPTA 4P7EA 4UEUA 4EONA 5M53A 3DB8A 3PG3A 3PVWA 5AUXA 3H9OA 2ITWA 4QTDA 3UIXA 3Q9WA 3PYYA 4EK8A 4IZAA 2WIPA 1Q8WA 3WIKA 3QLGA 4ZTRA 1NVRA 3VUGA 4AA0A 4E8AA 3I6WA 3WF6A 3OZ6A 5HHWA 2OFVA 2RSVA 1MQ4A 2X6EA 3CPCA 1FVRA 4XUFA 2R3RA 5L8KA 2C1AA 3IONA 1G8AA 4FSWA 3OBGA 3MFUA 1PMNA 3WE8A 3R1NA 2OLCA 3MH3A 4AGDA 4GU6A 1ZARA 2BZKB 3RI1A 2ZV2A 3UG2A 3EFKA 4OBOA 4X21A 5I5ZA 2ITUA 3H4JA 4QD6A 3FZPA 3QQHA 3RAHA 5HE0A 4BCJA 3DK3A 4ZY5A 3R8VA 3BGPA 5F1ZA 2XA4A 3JY0A 5E91A 5FLFA 2C6IA 4XG4A 3EN9A 1DI9A 1YOJA 1ZY5A 2QODA 5DR2A 3IECA 4DE4A 5EM8A 1YWRA 2H34A 1JOWB 2UW4A 3H0ZA 4IADA 3RZFA 2XK3A 2XNMA 5AUTA 4UMTA 3MH1A 5HE1A 3OT8A 4MNFA 1ZWSA 3NMUF 2DWBA 3ROCA 4DGNA 4MXAA 2OWBA 5DBXA 4ZS4A 1SM2A 4FTJA 3UJGA 4DEBA 4AE9A 1AGWA 3RK5A 2X81A 4KIPA 5E8YA 4DFNA 1A9UA 4BDDA 5BNJA 1XBBA 2OJFE 4ITHA 2IW9A 2UV2A 4U9AA 4ZMEA 4WO5A 4NJ3A 4R1YA 3OWLA 3TZ9A 5I3OA 4PL4A 4DFXE 3QL8A 2HWPA 5CS6A 5JK3A 2QO7A 1IA8A 2A0CX 1QCFA 2UZTA 2WTJA 5J87A 3LCSA 4JX7A 1S9JA 2WAJA 3ZRKA 4I93A 2R3IA 3MIAA 3HYHA 4L8MA 4EOPA 4M69A 4QT1A 4KSPA 3R00A 3SOCA 2R3PA 2YM4A 4PPBA 3MVJA 4NM3A 1Q41A 4K77A 1WAKA 4EYJA 2RKUA 4J53A 4J96A 3ZBXA 2NRUA 3THBA 2C3KA 4DEEA 2QCSA 4TYHA 4IANA 5BUJA 4FE2A 4G3EA 2WTVA 4L01A 1SZMA 1XBAA 2WOUA 2XM9A 4AW0A 5AM6A 4OTQA 3IQ7A 3L1SA 4L6QA 4YLLA 3ZRLA 4QNYA 2BIYA 4BB4A 3DS6A 4U44A 5A4EA 3HV4A 3R8UA 2CCHA 1QPCA 3I7CA 2YDJA 3F82A 4APCA 4N57A 4RQKA 2YAKA 2G2IA 4O0WA 5H3QA 4L00A 4CFNA 4D1SA 4EBVA 3HUCA 3KB7A 4R8QA 2C68A 3QTUA 4CT1A 1WBTA 4YTFA 5IQEA 2GS2A 3ZEPA 4AUAA 5F95A 2J51A 4DEAA 4I92A 1GZOA 2C3IB 3IGOA 4HYHA 3KU2A 3H3CA 4F7LA 5IUIA 1J1CA 3U55A 2R2PA 4K11A 2UW5A 1PXKA 3NCZA 3HV6A 1OIUA 5L6WL 3EL7A 3KQ7A 5KO1A 1GIHA 3MFSA 4B4LA 2BUJA 2PTKA 3LM5A 4C36A 3U6IA 2XK9A 2QHMA 3A60A 2QVSE 5KMOA 5JQ8A 1H4LA 2WTIA 3MPMA 4Z7HA 1PXMA 1PMEA 5CSVA 2ZV7A 2W99B 3F2AA 5AR7A 3SDJA 3FKNA 4K18A 2QR7A 2ETRA 4R3RA 5HG7A 3LZBA 1PXNA 5LOHA 3QCQA 1OL6A 2P33A 3GC0A 3HLLA 4FKJA 5K4JA 3C0GA 4FMQA 2PUUA 4M67A 3RM7A 3QYWA 4FIIA 4Y46A 5DVRA 2QOFA 5AR2A 3WZKA 4D58A 4DH7A 5CAQA 3OEFX 3O51A 4ARKA 5J5SA 3AC1A 4C4IA 4C2WA 4OAVB 2V0DA 5LVMA 3OP5A 2VWWA 3DZQA 4HVSA 4A06A 3S1HA 3C0HA 3HMNA 4P5ZA 2XJ0A 4IFGA 3VRYA 3T3VA 4I5MA 4BYIA 2W96B 5JZNA 3DXQA 4MBLA 5CU4A 4FIJA 5M4UA 4YJVA 3FMMA 4IAZA 2I0VA 5ICPA 3P9JA 4KIQA 3LFNA 3D2KA 3DB6A 4XP0A 3ROYA 2VWYA 5E8SA 1H0WA 2ZMDA 4NJDA 5HIEA 3LMHA 1NW1A 1P14A 2WMRA 4XG9A 2W5HA 5FG8A 3GU5A 4ZY6A 5IEVA 2FSLX 1IA9A 3LFFA 2XYNA 4BCMA 4MXXA 3EFWA 3QX4A 3R7EA 4ZAUA 1VZOA 4O0YA 3KVWA 3TACA 3ODZX 2UVZA 3ZEWA 4O0UA 3P08A 3PZHA 1JSVA 2CGUA 4F0IA 3MI9A 3TTJA 4BC6A 4FKGA 2VTRA 4FVQA 4M15A 4D0XA 3BX5A 3NYNA 3PE2A 4KBKA 4X2JA 3W2OA 5IA1A 3PDTA 3TNIA 2AC5A 3QXPA 4ACGA 3DQXA 4DG3E 1H1PA 3RBWA 3QCSA 3RHXA 4H05A 3LVPA 5C8KA 2HXQA 1U54B 1O6YA 5FDXA 5CF6A 4WD5A 3BYVA 4DTAA 1KUTA 3ZXZA 3B8RA 3TUCA 2W1FA 3GU4A 3ANRA 4N6ZA 3PJ8A 2YACA 5EQPA 5E8WA 5HG8A 5D7AA 3GOKA 4BGHA 3FC2A 3S0OA 4L42A 4LYNA 1QL6A 1WBVA 5HO7A 2C5XA 2C69A 5C03A 5HX8A 3MVHA 5CTPA 4KBAA 2OXDA 3VBWA 5CI7A 4KKEA 3R9DA 5FM3A 1J7UA 2WQEA 3CQEA 4MH7A 1FQ1B 3K3IA 4XRJA 2CNUA 3PJ1A 3UDBA 2JKOA 5B2MA 4RVMA 3SV0A 1Z5MA 3F88A 3KC3A 3QQFA 3R73A 1YXSA 3IDBA 2PZYA 3PA5A 5E90A 5DOSA 4FODA 3N4UA 3VC4A 1V0PA 5AP1A 1RDQE 4WBBB 2XK8A 2F7XE 2QOOA 3UTOA 2B7AA 1CMKE 3R9OA 4OTGA 3TXOA 3POOA 1OVEA 4J8NA 3ZLWA 3UQFA 5FGKA 3KXMA 4TRLA 4GUBA 4IB3A 4WNMA 3ZUVA 1K3AA 1PXOA 1Q3WA 3KA0A 4RA4A 4WSYA 3K2LA 3FMLA 5IKWA 2PWLA 4U7ZA 5J1WA 3UZRA 3NNVA 4KA3A 5BYYA 3A7IA 3I4BA 4XOZA 4EK3A 3IOPA 4R78A 4BYJA 3LFEA 3ZO3A 5HQ0A 3Q9ZA 3IDCA 3ITZA 3SLSA 5FWKK 2UZUE 4FNWA 4AU8A 3O23A 1RE8A 4F9YA 5CU0A 1E1XA 4CG9A 2CLQA 4YPDA 4ZTNA 2WQNA 5LWMA 2ERZE 4EZ3A 3IPHA 4PL5A 4F6SA 2B9IA 3VUMA 4B99A 1H27A 1U54A 3WZEA 4EH5A 4O7TA 3C4FA 2ETMA 5A4TA 2W0JA 3C4WA 4RIWB 5AP4A 3H9RA 2GNFA 2VX3A 3DTCA 1WVYA 3AT4A 5JGBA 2EXEA 5CVFA 4QMVA 4WG4A 3U4UA 2VTHA 2WB8A 4CCBA 4TW9A 3OWPA 2XK7A 3VUIA 3LFSA 4EL9A 1JKTA 1H1WA 1H1QA 1SNXA 5I9YA 3NW7A 5J9ZA 3AC5A 3PE1A 3TZMA 5A4LA 5K5NA 4BDFA 3EMGA 4FIGA 4FICA 1M14A 1ERKA 2VWXA 2F57A 4I5PA 3BEAA 2RIOA 4QQJA 5D11A 5JN2A 1GIJA 4P5QA 3VS6A 4K0YA 3ZUTA 3P78A 4XV3A 3LW0A 2WTKB 1Q99A 4ANSA 3FHRA 2O2UA 4FZAB 3R1QA 4YC6A 3LKMA 4G3GA 1WCCA 1YI4A 4HGEA 4WKQA 4OLIA 5B0XA 3GFEA 3RK9A 3QTRA 4QYGA 4L52A 4RFZA 4WHZA 3VWAA 4C33A 4E7WA 2UW7A 1PKGA 4LGGA 5CLPA 3JYAA 3O71A 3ZYAA 2IVVA 4FSTA 1UA2A 4EKLA 5GINE 4XV9A 2H6DA 3FPMA 2LAVA 3E88A 4ZTMA 1ZLTA 2ONLA 1TKIA 3BV3A 4UB7A 1QMZA 4GEOA 2BCJA 1CKPA 2ZYBA 3HRBA 4FSZA 1IRKA 4AGCA 4PP7A 1TQIA 3CCNA 4PP9A 4DG0E 4E4MA 4C37A 5IH6A 2B54A 3ALNA 1IR3A 3ZSHA 3PY3A 5GHVA 3U6HA 3VUKA 3E8NA 3NW5A 2VNWA 4OTHA 3EQPA 4XP3A 3PUPA 4QTAA 4XBUA 1TQMA 4BTJA 4NW6A 3F6XA 5AJQA 3HL7A 5KCVA 5CF4A 4HVGA 2RGPA 5L2QA 1OKZA 1SMHA 3EQHA 3NDMA 5BVNA 3QKKA 5AR5A 3VBXA 4C3PA 3O17A 2G15A 3D4QA 4GKIA 3P23A 3VQHA 2JAVA 2XZSA 3QZHA 4AX8A 5D12A 4CKIA 3F9NA 2OXXA 5AAEA 4GG7A 1Y6AA 4O96A 4G6NA 2EWAA 4YSJA 1PXIA 4D2RA 2Y0AA 4EHGA 3GOPA 2ZV9A 3R0TA 4W8DA 4IWPA 4YBKA 4ASDA 2OIQA 3AC3A 1UU3A 2ITPA 2W1IA 5T6KA 1Q8TA 2IJMA 3ZOSA 4DTBA 2X4FA 3KXZA 4LOOA 3BYSA 3UIMA 4EHEA 3BI6A 5IEYA 5IMEA 4MD8E 4NYEA 3R02A 3QRJA 4GVJA 4MD7E 1KE6A 3N51A 4L3PA 4FG9A 1F0QA 4IWQA 3JVSA 4U5JA 3TJCA 4H36A 4AW1A 3DLSA 2OFUA 3FZSA 4FT7A 3PRIA 4JT3A 2VGPA 4JQ8A 2A4LA 4FL3A 3P4KA 5L6OA 5BMSA 2E2BA 4JAIA 4EQCA 5LVNA 1YWVA 1Q8YA 2XYUA 4HZSA 2R64A 3FLWA 4U8ZA 3R6XA 1BX6A 4N0SA 3W18A 3BCEA 4DH3A 3CD8A 4ERWA 4IB5A 4JL9A 4F99A 3DKOA 1PXPA 3OG7A 3W2RA 2YITA 3MYGA 4QP8A 4XH6A 4C34A 2X2KA 4KIOA 3NPCA 2BDWA 3JY9A 5H2UA 4NH1A 1IASA 3GU6A 4FTKA 1APME 4N70A 2OXYA 3UOHA 4NWMA 5BQ0A 2UZWE 3KKVA 4ITJA 4PMSA 4RIXA 4ENXA 3MY0A 4PTEA 2YHVA 4EOOA 2PZIA 2QKWB 3NYOA 1Q62A 4I20A 3AC4A 5AUWA 5TF9A 4DGLC 2IZUA 4IH8A 3GT8A 3DJ5A 4AT4A 3EH9A 5L2WA 4MWHA 2B4SB 3ZS5A 4C3FA 2VWUA 5A6OA 2C5YA 3R8LA 4RZWA 4RJ3A 3Q96A 2JFMA 4EEVA 1I09A 1UU7A 4EC8A 4YURA 4ID7A 3ORMA 4FL2A 5A46A 3ORKA 4I94A 5JT2A 3DBDA 3BGZA 2OJGA 2XP2A 2Y6MA 1UVRA 2OIBA 4IX6A 3I79A 4ZSJA 2BAKA 2X8IA 3EKKA 4IX4A 2UW9A 1RQQA 5HNIX 3DXNA 3C4EA 4HGTA 5TE0A 3D7TA 4FKWA 2ZDTA 3OWJA 4RPVA 4XEYA 2WTWA 4C4JA 4X3FA 1BUHA 3E3BX 2A1AB 2I6LA 2XS0A 3FKOA 1ZYCA 3PPZA 3QRIA 4WG5A 3BWFA 4ENYA 4I6QA 3EQGA 3NUXA 3I5NA 4GW8A 3EN7A 4ASXA 3PPJA 2FGIA 5EW9A 4FUXA 4FKQA 4FZFB 3R8PA 3P7BA 4EH8A 5ANIA 3RP9A 4AW2A 4NCTC 3DNDA 4AQCA 3FZ1A 5AX3A 4UMRA 3FEGA 4BL1A 1M7NA 4L7FA 5HG5A 5FDPA 4HOKA 3CP9A 2QC6A 3MN3A 4QMPA 2AC3A 2Z7RA 3F66A 2R3QA 4O2PA 2I1MA 2PMNX 4FYOA 2HZNA 4FGBA 4J99A 4O84A 4WNKA 5FP5A 3A4OX 4K33A 1ZMWA 2QOBA 4MF0A 4PF4A 3PPKA 4QMOA 4EWHA 3ZRMA 3FY2A 4FKUA 5TOZA 4BZNA 4M13A 4U3YA 3GCQA 3WF9A 3D14A 2CPKE 3BBWA 4N4SA 4D9TA 3BELA 3R7VA 4BIEA 3Q53A 4GK2A 3S3IA 5ANEA 1OB3A 5IA0A 3I7BA 1TVOA 3MA6A 3F5GA 4V04A 3AXWA 4BDIA 5LQFA 1GZKA 2H96A 4DEGA 2W4KA 3RPOA 3SC1A 2VWIA 2WZJA 2UZEA 2Z7SA 2ZDUA 1YXUA 1W98A 3DQWA 4MBJA 4NIFA 4BDGA 1WVWA 2VO6A 2B52A 4YBJA 4DLIA 5HZNA 4FTAA 4I0RA 5BUEA 1OPKA 2QOQA 2E9PA 1OPJA 4FTMA 1Y8GA 3Q52A 4LRKA 4DAWA 5CAVA 2GNGA 3VS0A 2XJ1A 2WHBA 3O8PA 5CAPA 5FD2A 2UZBA 2UUEA 3FKLA 2G01A 4W8EA 2O8YA 4O22A 3FL4A 5AR8A 2BDFA 2C6KA 1U5QA 5EYDA 1PF8A 1JBPE 3FMNA 4J98A 3EFJA 4C61A 4JQEA 5KUPA 4F64A 4LG4A 5I3RA 3DK6A 4L9IA 3TJDA 4YLKA 5L3AA 2VAGA 5K0XA 1FGKA 1QPDA 2PPQA 3EZRA 2OJIA 2CHLA 1YI6A 4OW8A 1XH6A 5AV3A 4FF8A 2ITZA 3CIKA 5CNOA 1OPLA 5F94A 1AD5A 1H26A 3BRBA 5ETCA 4E5WA 2WOTA 5IH5A 2IVSA 4CD0A 3UO6A 3UMXA 4C4EA 4D55A 2ZM1A 3FJQE 4HYUA 5E9EA 2DUVA 2C6LA 5FBNC 4UZHA 5CU3A 5FP6A 2PE0A 1YOLA 4RG0A 5BMMA 3ZO1A 5DIAA 1Y8YA 1VEBA 4GFMA 1FMOE 5HD4A 4O38A 2CKOA 4ANLA 2NNWB 4IW0A 2XCKA 3V5QA 4G5PA 5IA2A 3TDWA 3IK3A 4NM7A 5EDPA 2BTSA 4YNEA 2R9SA 3LAUA 2UW3A 3N4VA 5JRQA 4M0YA 5AR4A 4GL9A 3R9NA 4KRDA 5CEIA 3DBQA 5AAFA 4HVHA 1YXVA 3HMIA 1OL2A 3P86A 2PVNA 2ZMCA 3DGKA 5CAOA 2W17A 1HOWA 5EDQA 3QC9A 4BN1A 3F3WA 4BR3A 3UNJA 3D5UA 4D5HA 3OXZA 3OOMA 5CZIA 4EBWA 2HW6A 4BGQA 2QKRA 3OD6X 2H9VA 3TUDA 5HI2A 5FEEA 5M4CA 2JDSA 4O86A 1CKIA 3LFDA 3OEZA 5ETFA 5LWNA 2B9HA 2X8EA 3L9LA 4CMOA 1OIQA 5C27A 1PYXA 1LUFA 3TL8A 1IAHA 3QU0A 4NM0A 1OUKA 2X2MA 2BR1A 3MWUA 4YHFA 4UMPA 4QYFA 4ZTQA 4ZSAA 3LIJA 4YMJA 1CTPE 2QG5A 3Q6WA 3HZTA 3TNHA 3V8SA 4I4FA 4I41A 5HE2A 3TT0A 4ALVA 1YWNA 5EYMA 2PMIA 4Y73A 4RT7A 2X8DA 4ZOGA 5FEQA 2BHEA 5D1JA 2Y4IB 2OO8X 4KD1A 3OFMA 3A62A 5AAGA 4O7ZA 4CRLA 2QO9A 4YGAA 4FTUA 3AD5A 4F63A 3PXFA 4CMUA 4GK4A 2JC6A 3GCSA 4S30A 3SQQA 5CSWA 1ZAOA 4OBQA 2ACXA 3A8XA 1AQ1A 3F5PA 4KINA 2JDOA 4TT7A 4YU2A 5DPVA 3QD0A 3WF7A 4BTFA 4M68A 2FB8A 3HUBA 4OT5A 5HNBA 2CKQA 4FTQA 2WD1A 4IM2A 2YCSA 4PNKA 3U9NA 2O0UA 4GFGA 1MRVA 1M52A 4DC2A 5KMNA 4EK6A 2QHNA 3JUHA 3OF0A 4X3FB 4QYHA 4WG3A 4E6AA 3MESA 3A61A 4PUZA 3MJ1A 3W8QA 1H25A 2UW8A 4IAFA 4XYFA 3AGLA 4UY9A 4AP7A 3HX4A 3R30A 4FKPA 4I3ZA 3D2IA 4YZNA 5HOAA 3U9CA 3R01A 2PVMA 4DEDA 3OC1A 3WF5A 2A19B 2X4ZA 4XG3A 3NX8A 1ATPE 2IZRA 4AF3A 4W9WA 4DFBA 2EB3A 4BKYA 3BHHA 4YHJA 1XBCA 1YKRA 3BKBA 4LI5A 1JNKA 1PXJA 3PA4A 1PRYA 3E64A 4TYJA 4V01A 5C4KA 5J8IA 3B2WA 3TEIA 4O0TA 3CPBA 3DBEA 2XVDA 5I0BA 1URWA 4DF3A 3KXXA 2V62A 3KGAA 5JFSA 3TDVA 4R5YA 4E26A 5KBRA 3E3PA 2PUPA 3MS9A 2R3OA 4DT8A 4FT5A 4E4XA 4KABA 5CWZA 2YJSA 3FSKA 1HCLA 3FI3A 3HDMA 5AEPA 3F3TA 2VX1A 5ANKA 2WEVA 3R7UA 2XKEA 3PP1A 5DWRA 2J0JA 4I6FA 5L4QA 4BCKA 3KY2A 4I21A 1IG1A 2R0UA 4X2NA 3PXQA 3R8ZA 4D9UA 5J7BA 4JR7A 2QLUA 3AC8A 5KMKA 3NUAA 2J6MA 2UVYA 4GYGA 3VULA 1YXTA 4QYYA 4BKJA 3NWWA 3GB2A 4JDJA 2VTMA 5EKOA 3DDQA 5EOLA 4CGAA 2IW6A 2J0LA 2XIKA 2W9ZB 4L46A 4F0GA 2XB7A 1GZNA 4BI0A 3COHA 1J7LA 3UVRA 4ZLOA 2XRUA 3VF9A 4G3DA 2YIYA 3ATSA 4BCGA 4PL3A 4RC2A 1W7HA 4FV6A 1H00A 3MA3A 3UPZA 4JG6A 4RX8A 3FDNA 4FC0A 3DJ7A 3C1XA 3VW6A 4EOJA 3LHJA 3UBDA 4O0XA 4P2KA 4FV0A 4QMNA 3PLAE 2R3FA 4QP2A 1G5SA 2G2HA 5ETIA 5IUGA 4F9BA 4NEUA 2R7BA 4PV0A 2BIKB 4BBMA 2YWVA 2J2IB 3K54A 1UWHA 4EUUA 2R3LA 3AD4A 4K1BA 4MNEB 4TN6A 5HVKA 1YOMA 3RTPA 2IVUA 3E5AA 5CF8A 4FEVA 4DEHA 5LVLA 5EYKA 4ANMA 3FLNC 4QMXA 3R63A 4TL0A 4MQ2A 1WBSA 4PNIA 5HESA 3FMHA 4QQCA 3KRLA 4WNOA 2SRCA 2UVXA 2X7OA 2I40A 2WFYA 3HKOA 1H8FA 4QMWA 3C4ZA 3E87A 3QWKA 5CEQA 4G3CA 1ZZLA 2QOCA 2BTRA 4AT3A 4MCVA 3F3ZA 4IVBA 3PIXA 3RALA 2HZIA 3ULZA 5T68A 5AFVA 5C9CA 3LXLA 2WU7A 3KF7A 3FMKA 4IHPA 5C26A 2DS1A 5HIBA 1PMUA 3F3VA 1OL5A 3QZGA 4RIOA 3QTQA 5HVJA 3ZXTA 3ZHPC 4DFLA 4WSQA 1XKKA 2PY3A 1W83A 4DH5A 3FMEA 4E1ZA 4F0FA 1SYKA 1Q61A 2R4BA 1OKVA 2VN9A 3FL5A 2WGJA 3AD6A 4I24A 3ZO2A 2YM8A 2YLEA 1CDKA 3MIYA 4IJ9A 3E8EA 3OOGA 3ZM4A 4DH8A 3QTWA 1YDTE 2XRWA 3OUNB 5CANA 3C0IA 2YM5A 1J3HA 2R7IA 3L8XA 5M4IA 4Y5HA 1DS5A 4ZJIA 1U46A 4AWIA 4BRXA 3P5KA 3SVVA 2CNQA 5JMSA 3TM0A 1MRYA 4AACA 2E9VA 3L8SA 2ONLC 4EHVA 1MUOA 4HVIA 2XF0A 1ZOEA 4CTBA 4MXYA 5A3XA 2V55A 3OMVA 2PUIA 4JI9A 3SD0A 3MB7A 3ERKA 4D2PA 2GNHA 4AS0A 3FI8A 4EJ7A 5FQDC 4WRSA 1KE8A 2HOGA 3KK8A 1WFCA 4PY1A 3DKFA 4QRCA 1CKJA 3D5WA 5IF1A 5CASA 4ITIA 2V22A 2P2IA 4A4OA 3O96A 3V5LA 2CGXA 3E7VA 4QP1A 2PUNA 2JIVA 2OG8A 5TKDA 1M2QA 5AMNA 3F2NA 2PVJA 4C62A 2EB2A 3FZOA 3OXIA
chains in the Genus database with same CATH superfamily
2WTKC 4TPTA 4W9XA 2YA9A 5IDNA 4FOBA 2YIRA 2YISA 3HV3A 5AUUA 5KNJA 3QA0A 2XKFA 4FNYA 2HW7A 3GC8A 3QTIA 1NVSA 2OGVA 5DH3A 3ZU7A 2P0CA 4W4VA 1O9UA 2WMWA 3L9PA 3M42A 5EW8A 4AGWA 4ANBA 4ZSLA 2X6DA 3OXTA 3UZPA 4G6LA 5EQYA 4AZWA 1UWJA 3Q60A 1UU9A 2R3HA 4DG2E 2GNLA 3AT3A 5LXMA 4PMMA 4MXZA 4L3LA 3GCUA 5KE0A 3HAMA 1A48A 4O7VA 2CDZA 3R1YA 5T3QA 1OBGA 4GG5A 5F4NA 3ZUUA 2HIWA 4IB1A 4FGRA 3OY3A 3MW1A 4NFMA 3P7CA 4A7CA 4UXQA 4RGJA 4YUQA 2CN8A 5GJGA 2RFSA 4OAUC 4IIRA 5DT3A 4BWKA 2VX0A 4BDHA 4X2GA 2G2FA 3PWYA 5EKNA 5LMBA 4LRMA 2WMXA 4RJ4A 3RAWA 3K5UA 4ZTSA 2XNBA 4O0RA 4FG8A 4AOJA 4EH4A 4O7WA 4JQ7A 2PMLX 2OH4A 2VWVA 5HLNA 4PTCA 4OTWA 4XS2A 3ZZEA 4IZ5A 5IISA 1QPJA 1KV1A 2P55A 4QTCA 4UMQA 4D4YA 2ZB0A 3LQ8A 3W33A 1JKKA 3ZBFA 4BHZA 5H8GA 4A4LA 4ZJVA 2OZAB 4ALUA 4LUDA 2WU6A 3PSBA 3QFVA 4PDPA 4XCUA 2DYLA 5AP6A 3PJ2A 4L67A 4ZEGA 4LMUA 4D2WA 4QP4A 1YQJA 2W4OA 3KCFA 1F3MC 5HTBA 1ZYLA 1KV2A 5HNGA 4I5HA 4HZRA 3U54A 4ZY4A 4QMMA 2ITNA 2VD5A 4NSTA 4YLJA 3ZCLA 1FBNA 1JKSA 2YFXA 5IA4A 3B8QA 3AMYA 5HO8A 1PY5A 3FE3A 3AC2A 3POZA 5EHOA 1YHWA 2W5AA 4FI1A 4E5AX 3HNGA 3BHUA 4FVPA 4F7NA 1J7IA 5AV2A 5GJFA 3VS7A 3PZEA 3WARA 3BYOA 5I9XA 5BVDA 3R9RA 1JVPP 1P2AA 2KTYA 5H9BA 5DA3A 2IWIA 2PU8A 4FTOA 2WMSA 3BYUA 1Y91A 2C6TA 3PJ3A 4IAAA 5AP0A 3TYKA 3VUTA 2PZRA 1QPEA 2BRHA 2UW6A 3Q4TA 4IEBA 2J5FA 4LOPA 4UWCA 3G90X 4O91A 4OTFA 5LMAA 3Q3BA 5GIOE 4MNEA 2BPMA 1URCA 4RIYB 3L8PA 4YJRA 4FTCA 2O3PA 4USDA 5DRBA 1VYZA 4FK6A 3ZC6A 4TYIA 4MXOA 4FEQA 4GSBA 2PVLA 4W4XA 4CXAA 3LMIA 5DE2A 3JPVA 3PVGA 2YCFA 4XNEA 2VWBA 3UE4A 4AZVA 4R7BA 1F5QA 4JBPA 4U79A 1BI8A 3EQRA 3V5PA 3F7ZA 3EHAA 4CEGA 3COMA 4LL0A 4QNAA 3N4TA 3V5TA 4XV2A 2C5OA 5B7VA 5C8NA 2WQBA 4IMYA 4F65A 2J4ZA 3NGAA 3KN5A 4ZSEA 3ACKA 4TZRA 4TY1A 4UV0A 3Q5IA 4A9TA 3IG7A 4FV7A 1U5RA 4JG8A 4LMNA 4O6LA 1G3NA 4YZCA 2CNVA 3FSFA 1YVJA 4HNIA 4QOXA 2OZAA 4D1ZA 4HPTE 4AN9A 5AV4A 4Z9LA 5EM5A 3VNTA 4FIEA 4RJ5A 1Y6BA 1FOTA 2X0PA 4HJOA 4KKGA 5BVOA 2ZOQA 4DYMA 1Q8UA 4CYIA 4ANNA 3AG9A 4UWBA 3UOJA 5DEWA 4R5SA 1GJOA 3ENHA 4JG7A 2OF2A 3CY2A 5KZ0A 3LFQA 3TG1A 1OI9A 1Q24A 2IF8A 4E4LA 1M17A 1BMKA 2GFSA 3KCKA 4F9AA 1HCKA 3WZDA 3E8CA 2XIXA 4XP2A 5KHXA 3BU3A 5CQUA 1BYGA 1MP8A 4MBIA 3T3UA 5DG5A 1JAMA 4BY9E 4LM5A 2JLDA 4FTTA 1DAYA 4J95A 4YJTA 4OGRA 5ACBC 3QYZA 4ANQA 1OL7A 4ASEA 4BDAA 1L3RE 4NK9A 1DAWA 2C1BA 2O64A 2R3NA 2W1HA 2X39A 3DZOA 3FV8A 4RA5A 3JVRA 2PHKA 5IQBA 2X7FA 4HCVA 4E3CA 2Q0BA 3FY0A 5DLSA 3MTFA 4O0SA 4MYGA 4ZZMA 3TIYA 4BDEA 4RZVA 1Y57A 3PA3A 4U43A 3D9VA 3QBNA 2OF4A 2ZVAA 4EH6A 2C6MA 4M14A 3BLRA 4TYEA 3E62A 3FYKX 4RWLA 5CSXA 3JR1A 1VR2A 2OSCA 4YO6A 3NS9A 2YCRA 2BILB 4ACCA 4O7RA 5ETAA 4RX5A 5ANJA 5EI2A 5AUZA 1WMKA 2PZPA 2QOLA 2UZLA 2IG7A 4EH2A 4JLCA 4P90A 4DGGA 4RLKA 5DGZA 4F7JA 3W10A 2PSQA 5FUTA 2XIZA 2OJ9A 2VRXA 5EW3A 1KOBA 2VO3A 3RVGA 5JFVA 4BKZA 1ST0A 2RFNA 1NT2A 2GTMA 4CFUA 4GIHA 4USEA 4LDTA 1NY3A 2NO3A 3CKXA 5ANDA 4NKAA 4RVKA 5IA5A 3F5UA 3SGCA 2WNTA 3LJ0A 2BZIB 2OKRA 2PE1A 4IXPA 4QMUA 5LVPA 3DOGA 2YERA 3Q4CA 3W0SA 3HA6A 3ZSIA 3PLSA 3DCVA 1BL6A 4U81A 2JDRA 1H07A 2HZ4A 2XKDA 4LGHA 4TNBA 2O63A 3C51A 4UX9A 3U51A 2BFYA 2W05A 4FKRA 4FV5A 4FV4A 3C4CA 3OBJA 5HX6A 2IN6A 2FSOX 4JBQA 4YZMA 2R3MA 3A2CA 4F4PA 3U87A 3PFQA 4EOKA 2OIDA 4JRNA 4X6RA 4UMUA 5M09A 1JLUE 1XR1A 2VTLA 3BU5A 5E4HA 4JR3A 3CR0A 1OUYA 4IBMA 4ZSGA 2PZ5A 3CTJA 3EFLA 3CC6A 3I60A 3DPKA 3OVVA 3BGQA 3KK9A 4V05A 4Y85A 1NVQA 5JFWA 2VV9A 3S2PA 2WKMA 3L8VA 3SKCA 4D4VA 2BRGA 3D83A 4RWJA 3UC3A 3TV7A 1ZYSA 2VO0A 4QPMA 5DR6A 4MEDA 4I0SA 4KIKA 4KNBA 3NUSA 4EOIA 2QR8A 2QOKA 1NXKA 2C3JA 2R3KA 1BKXA 3R71A 3V8TA 4EKKA 3QLFA 2R5TA 2ZB1A 3FHIA 2UZVA 4LOQA 2CJMA 2CLXA 4DCEA 4YJNA 4EZ5A 4FA2A 2XBJA 2B53A 3DU8A 3G0FA 3IGGA 3Q5ZA 4GH2A 3LOKA 3U8WA 3WZJA 4CZUA 5L6PA 2GQRA 4AOIA 4BVUA 3DKGA 3DBFA 4U97A 3RCJA 3VS2A 3Q9YA 3WF8A 3WBLA 4BTKA 4PTGA 5CALA 2WMVA 3EJ1A 4FV9A 1TQPA 3NSZA 4O6EA 4UN0C 3SW7A 4FSYA 1ZOGA 3D0EA 1V1KA 2Y4IC 3TI1A 4ZP5A 4B0GA 4BF2A 5EFQA 4HCTA 3EZVA 5BPYA 4YC8A 5EDRA 3QD3A 4HVDA 2UZOA 2Z60A 4O4DA 5HCXA 4DEIA 3OTUA 1XH7A 4R6VA 2O5KA 4FTRA 3MFTA 5BVEA 3N9XA 3UGCA 5A14A 3QRTA 2XH5A 2JGZA 3K3JA 3P7AA 4FZ7A 4TWPA 2QOIA 4A4XA 5HTIA 3ATTA 4DBXA 2YZAA 2PE2A 1GIIA 2WPAA 3H10A 3QHRA 5GIPE 4G3FA 5D41A 3RINA 3HMPA 3NIEA 1Z9XA 5FEDA 2BKZA 5FRIA 1OECA 1WBPA 2C0TA 2YCQA 3C7QA 4X3FC 4AGUA 3RWQA 3V51A 5J5TA 3FZRA 4FK3A 2B1PA 3UNZA 1ND4A 4TXCA 4M7IA 3PXRA 4R7HA 4A07A 2QG7A 4YJQA 3D94A 2A27A 2J90A 3OUKA 5GZ8A 3I0OA 4OR5A 1Q4LA 3PXKA 3CBLA 5ACKA 3SA0A 4HNFA 2F4JA 3HAVA 4G9CA 4X3JA 2YM6A 3BHTA 5H8EA 4BFMA 3MY1A 5K4IA 3ZFMA 4O82A 3FC1X 4PRJA 5HBHA 5BVFA 2O65A 2ZV8A 3TUBA 3CGFA 4IE9A 5CY3A 4OTDA 4CRSA 4BICA 3PY1A 3UO4A 1VYWA 4C8BA 2ETKA 2QU5A 3ORPA 1P4OA 4LUEA 4F9CA 2RG6A 4BBFA 3NW6A 2VTSA 3R1SA 5DR9A 1MRUA 3BYMA 3WILA 4ZLZA 3OCGA 4FYNA 4I23A 3HP5A 5E8UA 2XK6A 2HENA 3OCTA 3E92A 3LXPA 3PTGA 3QD2B 5TO8A 3PIYA 4K2RA 4PDOA 4DFUA 3P0MA 3BV2A 4DITA 4BIDA 3BZ3A 3KXNA 4FBXA 3BLQA 1OIRA 4WIHA 5AV0A 3ETAA 4E4NA 4C4FA 3OWKA 1GZ8A 4YJSA 2WQMA 4JAJA 2HAKA 2DQ7X 3HVCA 4GVAA 5J1VA 3VW8A 3ZMMA 2ZAZA 3V6RA 3Q04A 5A4CA 1FVVA 3OROA 3EQFA 2XARA 4FKVA 2HELA 2Y7JA 4QEBA 3FLSA 5IQIA 5IA3A 4EC9A 2QQ7A 2Z7QA 3BLHA 1SVHA 4FKTA 3FQHA 3ID6C 4J71A 4GCJA 3CEKA 1UNLA 1GNGA 3CQUA 2PVYA 4QQ5A 4AFJA 5HU9A 4WNPA 3QF9A 2XKCA 3KREA 4CG8A 4DDIA 5GNKA 1E1VA 2RFEA 2BMCA 4JXFA 4Q5HA 5AUVA 3T8OA 5KMMA 4F1MA 4M97A 2FSTX 3G6HA 4Q2AA 2I0YA 4QMSA 2CMWA 5IU2A 4XX9A 3VONA 4JIKA 3KN6A 3WI6A 1SVEA 3LMGA 4KWPA 3TZ8A 4C57A 2Y6OA 4AOTA 3RM6A 3VUHA 1MQBA 1EH4A 2JD5A 3R2YA 3C5IA 4DT9A 3UNKA 4B7TA 3V6SA 5IQHA 2W06A 4DHFA 3A7GA 4GKHA 5KBQA 4X2FA 3EN5A 4O7NA 2VTQA 4RQVA 3SW4A 5HU3A 2REIA 4KRCA 1LEWA 4IX5A 3RPVA 4CCUA 3VHEA 3UP2A 2CCIA 4GV1A 3T9IA 4BDJA 3IS5A 4AN3A 5GZAA 2JAMA 4FKIA 1XO2B 3RNYA 4EH9A 5I4NA 2YZLA 3LCKA 2Z02A 4ORKA 5KMIA 3DJ6A 5IDPA 2GSFA 5IQDA 3Q32A 4BTMA 4F1TA 2C5NA 4UXLA 4APPA 4C59A 3G15A 2GPHA 2QU6A 2B9JA 2OW3A 3QUEA 3R28A 4ANOA 4DLJA 1FGIA 4IB0A 3BBTB 3BIZA 3FLYA 5D10A 3FI2A 5E8VA 3AGMA 4I1ZA 4DINA 2WXVA 3FXXA 4WA9A 2CSNA 3ZZWA 5CNNA 4ZTHA 5EM7A 5JSMA 3NIZA 4AXDA 3RKBA 3VJOA 3BEGA 3QUDA 4CFXA 4HYSA 2ITOA 5HVYA 3TNWA 2PULA 5AA8A 3GI3A 4YTHA 4M0ZA 5JQ5A 4LV5A 1G8SA 4YNOA 1KWPA 4NW5A 4S2ZA 5BX0A 3JS2A 2JBOA 1ZOHA 3NCGA 4G16A 2XIRA 4L43A 1WBNA 4Z16A 3TN8A 4AG8A 3WOWA 4MD9E 4U41A 3CSVA 2HXLA 4PWNA 5CI6A 4BJJB 2HY81 1YW2A 2YDIA 2OI4X 2XMYA 3HRCA 4GYIA 3GC9A 3D5XA 2QLQA 5EQEA 5KKRB 4ASZA 3R8MA 5H8BA 1W2DA 1J1BA 1Q5KA 4DTKA 3V3VA 1PJKA 4CV9A 1JQHA 1M2PA 4EH3A 4EZ7A 4JOAA 1OKWA 4V0GB 3U4WA 3NVKI 4D5KA 3RCDA 1LP4A 4QP3A 5I9VA 4L3JA 2WMQA 5L2SA 3QC4A 1BL7A 3NEWA 3QA8A 1ZY4A 4Y83A 2XEYA 2YIXA 4BCOA 3ZO4A 3QZIA 2VTJA 3F61A 3HGKA 2VTTA 4QTBA 3UODA 4BI1A 1W2CA 4FSUA 3HA8A 4Z7GA 4KKHA 4UYNA 4CV8A 5DYJA 5AV1A 2QNJA 2YJRA 1O6KA 2F49A 3HMOA 4DN5A 3I5ZA 4DGOA 4ZZNA 2W1GA 3ORLA 3FQEA 4JDKA 2QURA 3V5JA 5KMLA 4ZS0A 3ORIA 3LM0A 3LFCA 4X6QC 4FKOA 1W8CA 2P4IA 2QO2A 3FPQA 2X0QA 2X2LA 4IWDA 3FI4A 4XRLA 3UYTA 5EM6A 4QPSA 4KS7A 4F09A 4HW7A 4NFNA 4X2KA 5EHLA 4XOYA 3ZTXA 4IC7A 1PHKA 4LFIA 2V7AA 4C38A 4FV1A 1E9HA 5EK7A 4HGSA 4FSQA 1XH5A 4U3ZA 4BI2A 4C35A 5F9EA 3COKA 5K0KA 1K2PA 2ITXA 3QD4A 4J52A 5IQGA 1GAGA 3C50A 3GU8A 5M06A 3MH2A 3VAPA 2FVDA 4CNHA 2GTNA 3W2CA 2EXMA 2V5QA 3MJ2A 3RAKA 2EVAA 4BGGA 4O7LA 2CKEA 2UZNA 3G9LX 1KE5A 3O7LD 4IDVA 4NM5A 3SXSA 1YDRE 3VS5A 4NKSA 2R3GA 1J91A 2PVHA 2YIQA 3DBCA 3VBTA 3IDPA 4ZK5A 1WZYA 3ZFXA 4GT5A 4H39A 3CTHA 4YR8A 4AT5A 4JNWA 5KZIA 2C0IA 3PVBA 5J7HA 4AZEA 4KUJA 3NUYA 4XHKB 3SAYA 1SNUA 2OU7A 1FINA 5CU2A 3GENA 4NTSA 2VWZA 1Q97A 3HDNA 3AKKA 3O5AA 4FZ6A 4D1XA 4YJPA 2I0HA 2JKQA 2EXCX 3NNWA 4GUEA 3E8DA 3UIUA 3SG9A 4CFMA 4DHJA 5JGDA 3NUNA 3PXZA 3P1AA 2HYYA 4QMQA 4MHAA 4V0GA 2EU9A 2AYPA 2BZJA 3UIBA 4EH7A 1U59A 5L8LA 2W1EA 3II5A 5M57A 3VRZA 4DFZE 1M7QA 2VO7A 4FG7A 1IEPA 4YZ9A 4CFWA 1ZMVA 5AIKA 3U6JA 4G34A 2Q83A 3KXGA 4IFCA 4H3QA 2XM8A 3AMBA 4M8TA 5EG3A 4E93A 5BUIA 3M2WA 3A8WA 5CVGA 5ITAA 5DNRA 4EUTA 1P4FA 2OBJA 4E20A 2XNOA 3KEXA 3NR9A 5CU6A 3W16A 3VN9A 4FSRA 4NU1A 3QTXA 4O2ZA 3PUFC 2IZTA 4YJUA 5KX8A 5LVOA 4RWKA 2J7TA 4OUCA 3R9HA 3MB6A 3DNEA 1B38A 1NA7A 3A7JA 1R78A 4I6HA 3CKWA 3SOAA 3GUBA 3RJCA 4CLIA 4FEUA 2ITQA 1IAJA 3G9NA 4O4CA 5M08A 4ZIMA 2BROA 3EYHA 4R1VA 1XHAA 4NT4A 1OGUA 2RFDA 4JDHA 3UPXA 5DT4A 2WMBA 1PW2A 3QRKA 1ZYDA 4XJ0A 2XNPA 3CD3A 5EOBA 3ORNA 5DFPA 5FM2A 5TT7A 3ZLSA 4F7SA 4JJRA 5HE3A 4NIFB 3NUPA 4U42A 4WT6A 5FXSA 3ORZA 4GRBA 3ACJA 5AP2A 4KS8A 2OZOA 3Q4UA 1X8BA 3RHKA 4ZLYA 3TV4A 5A6NA 2VGOA 3MGYA 3QQJA 3I6UA 3WYYA 4ZZOA 3CQWA 1T45A 3ET7A 4UALA 3RNIA 4C0TA 5HEZA 1A06A 2VU3A 3GFWA 4WUNA 3I0QA 5G6VA 1LR4A 4BDKA 4Q5EA 5AIRA 3O8UA 3MH0A 5DI1A 3SG8A 1V0OA 1YHVA 2CGVA 4YJOA 5LCKA 5J79A 5J9LA 4DBNA 4BIBA 4GJ3A 1R0EA 2B55A 4XLIA 5D9HA 4C58A 4U80A 4FVRA 1W2FA 4EOLA 2Z2WA 2F9GA 3LLTA 3UP7A 1YI3A 3QQKA 5FTQA 2C6EA 4IM0A 2E9NA 3DA6A 3DT1A 4CZTA 3LE6A 1H28A 3CJGA 4HGLA 4MTAA 4W4YA 5FBOA 5FXQA 4CLJA 4LV8A 4NUSA 3BU6A 5AP7A 4BCNA 4QMTA 1XJDA 2XALA 2GQGA 4W4WA 5DT0A 4RC3A 5M44A 2B0QA 4BZOA 4C2VA 3NYVA 4FV8A 3O7LB 3OCSA 4FKSA 2BALA 2X9EA 3RGFA 4GU9A 3OW4A 4N6YA 2YWPA 1B6CB 2GCDA 2QD9A 1LEZA 2J9MA 3HMMA 4U0IA 4S31A 2XEZA 3M1SA 2JITA 3DK7A 3UDTA 4CKRA 3G0EA 4FTNA 2J0KA 4RLLA 4RIYA 5IG1A 2XK4A 3QRUA 5CX9A 2RL5A 4OTRA 2F2UA 1RW8A 4TWNA 3TKHA 3VS3A 3KFAA 3MPAA 4QP7A 4UBAA 4EWQA 2YAAA 4XG8A 1OKYA 2XUUA 2XJ2A 2J5EA 4RMZA 4GJ2A 3W1FA 3GC7A 3KRRA 5A54A 5I9WA 2G1TA 3BQRA 3R7OA 3ZC5A 2J0MB 1JWHA 3FQSA 5DRDA 1XMMA 3W0RA 4IAYA 5IQFA 1XH8A 2FA2A 4DA5A 3DV3A 3QCYA 3DDPA 2WMUA 3NNXA 3QQUA 5E1EA 4RIXB 5CQWA 3BL9A 4FT3A 2WELA 4AQKA 2I0EA 4I6BA 5AWMA 4MK0A 3QXOA 5C4LA 4AA4A 4YO4A 5CSPA 2NPQA 2GU8A 5ANOA 4BCPA 3RPSA 2Y4PA 4H3PA 5IUHA 3JXWA 2GS7A 4XMOA 4AZFA 3EIDA 2W1ZA 3QHWA 4IJPA 4PDSA 3WZUA 2GNJA 4BCQA 1XQZA 1H01A 4CVAA 3ML1A 2HWOA 4M3QA 4AE6A 4IAKA 3HECA 5K3YA 5JRSA 2IO6A 3H9FA 1UV5A 3ZM9A 4E6DA 4B9DA 4WRGA 5HBJA 4XV1A 4CTCA 2C4GA 3IOKA 5EI8A 3QX2A 4XG2A 3V04A 3ZDIA 4C02A 3BE2A 2Z8CA 4PDYA 3EOCA 3FAAA 5CT7A 5EYCA 2IW8A 3W32A 4Y95A 4B8MA 4MQ1A 4EK5A 4WOVA 3RPYA 3PSDA 4XBRA 2BRBA 4RSSA 4A9YA 2A2AA 1XH4A 3IO7A 4PQNA 3VF8A 4BWPA 3GQIA 4JDIA 4OTPA 4R7IA 3F69A 5IH4A 4X0MA 5KKRC 3PXYA 1YXXA 4S34A 2BZHB 5HCZA 3S4QA 2Z7LA 3FLZA 4EI4A 2PVKA 5EHYA 4EHZA 2HY0A 4X7QA 5C1QB 4TYHB 4B6LA 4IWOA 3F7WA 3V01A 3GVUA 3PIZA 4KSQA 2YM7A 3LCTA 5L8JA 2AUHA 3EKNA 2JIUA 4RBLA 1OGYA 2FYSA 5BVWA 5M55A 1GOLA 2EUFB 4GFOA 5IQAA 3EN4A 2BVAA 3R22A 4FZDB 3TCPA 3ULIA 4ACDA 1O6LA 1WBWA 4QP6A 4MX9A 1YHSA 2BAQA 2J50A 3SX9A 3DFAA 1H1RA 4K8AA 3W2SA 3CLYA 1Q3DA 3ORTA 4RFMA 1SVGA 4TNDA 5HCYA 4EORA 3NVMB 4A9UA 3MTLA 4KIKB 2IZSA 4BDCA 3PSCA 5CVHA 2HZ0A 3OW3A 4QMZA 4CMTA 2W1CA 3SXFA 3FZTA 4AW5A 3TTIA 4D2TA 3LLAA 3GBZA 4QP9A 1JKLA 4FTIA 1KOAA 4KAOA 3TWJA 4PMPA 3ANQA 5CT0A 3QTZA 3BE9A 2JDTA 2W4JA 3KMUA 4OBPA 3VJNA 4TWCA 3DKCA 2YIWA 5IPJA 2R3JA 2YDKA 1CM8A 3G5DA 2ZM3A 3QZFA 3TNQB 4J8MA 2UW0A 2YEXA 4C4HA 2WTCA 3KRWA 5DHJA 3HEGA 4IAIA 4PPAA 4RX9A 4XG7A 5K5XA 2YABA 2X1NA 2C6DA 3OCBA 4GS6A 1B39A 4NZWB 4U40A 2VTIA 3UOKA 4JVGA 4FTLA 4F1OA 4JS8A 3VS1A 4IVCA 2GNIA 3O0GA 4RJ8A 3QTSA 3HRFA 5CEMA 5C01A 4HPUE 1PXLA 1YDSE 4OT6A 3DAKA 4ZTLA 4Z55A 3AMAA 4DGMA 1GY3A 2YM3A 4D0WA 4L53A 3NRMA 2C0OA 2YN8A 2CN5A 4YZBA 3TKIA 4XG6A 4Q9ZA 3LPBA 5BVKA 2BHHA 4G2FA 3DLZA 3MV5A 2BRNA 4FNZA 2PYWA 4EYMA 2X7GA 3W2PA 2OH0E 3BHYA 3IW6A 3KMWA 4F6UA 2WEIA 4QMYA 5EH0A 4HCUA 3G33A 4H58A 5AM7A 3FUPA 3BQCA 2XBAA 4U45A 4FSMA 5AR3A 5AA9A 2IPXA 3NLBA 5M07A 4TKSA 3FMJA 5CAUA 3KL8A 1H1SA 3IW7A 3FBVA 3R04A 4L7SA 4IVDA 1KSWA 3AQVA 2R0IA 1V0BA 4LRJA 4DDGA 3ELJA 3VHKA 5DMZA 5JH6A 3LCDA 2E9OA 2VZ6A 5AP5A 3TV6A 3ZDUA 1R3CA 2BDJA 4AZSA 3C9WA 4J1RA 4RVTA 4FT0A 3ODYX 3D5VA 4RFYA 3AT2A 3UZTA 3A7FA 3EQIA 3DXPA 1KE7A 4RWIA 3C5UA 4BDBA 2ZJWA 3ZSGA 4R77A 4EQMA 4E73A 2PVRA 4FEXA 3EL8A 5GZ9A 3QALE 3EB0A 4NCTA 4AN2A 4UWYA 2JBPA 5HIDA 3VIDA 4H1JA 4L44A 1UNGA 3GCPA 4EOQA 4EOMA 4F70A 4FOCA 2CGWA 5E8ZA 5AUYA 4QMLA 1L8TA 3PRFA 1P5EA 3FXWA 3D15A 4R3PA 3MY5A 5J95A 3P5JC 5F20A 4O4BB 5L2TA 2VTAA 4F08A 3IW4A 4BHNA 3FYJX 3R83A 4D4SA 5IZFA 4TWOA 4O83A 3GCVA 3CS9A 1ZYJA 1DM2A 2FH9A 3IW5A 3SXRA 1UKHA 4G5JA 4R3CA 3M11A 4G6OA 1REKA 4BWXA 4I0TA 2BKKA 4MAOA 4FT9A 3PVUA 1STCE 4C7TA 4AZTA 3CXWA 3REPA 2VTPA 5I9ZA 2VNYA 2FSMX 3GU7A 3NFGB 2ITVA 4QYEA 3EYGA 4J97A 4KB8A 5K9IA 4O21A 3HV7A 2XNNA 2LGCA 2NRYA 4GMYA 3FLQA 3UVPA 4AAAA 5JEBA 4WBOA 3R7GA 2C47A 4USFA 5CEOA 1BI7A 2B9FA 3DFCB 3R2BA 3UC4A 1I44A 5FXRA 4QPAA 4B8LA 3PJCA 4IC8A 3HV5A 3BPRA 3SRVA 4IQ6A 4BCIA 1T46A 5KMJA 4K6ZA 4KBCA 5HLPA 2JIIA 1KE9A 5G1XA 5HICA 4FR4A 3Q9XA 4CQEA 3PWDA 1OL1A 2VTNA 3OS3A 4O4FA 3VBYA 4RVLA 3KXHA 4M66A 2RF9A 4H3BA 3F2RA 4G1WA 1REJA 1ZMUA 4FNXA 4O1PA 4L45A 5HLWA 2GS6A 3ALOA 3QAME 3GXLA 4O27B 3COIA 3GEQA 4BCHA 4CQGA 4ZJJA 3CTQA 3I1AA 3Q2MA 2Q0NA 4RIWA 4MVFA 5L2IA 3EQDA 1WBOA 3O8TA 3T9TA 2JKKA 4IM3A 3LJ1A 4IVAA 2XANA 1H24A 4CT2A 4FSNA 5B2LA 2C5VA 4LV7A 3CJFA 2P2HA 4M69B 4JRVA 1RJBA 1UKIA 4M12A 4G31A 5E92A 3CGOA 3EQCA 1OIYA 3AOXA 3O50A 3ZH8A 3UQCA 3PFYA 4YC3A 4A9SA 3SHEA 4S33A 2IEWA 4FV3A 3S95A 4EK4A 2X0GA 3MDYA 3OHTA 4ZMFA 3VBVA 4PMTA 4Y8DA 3QKMA 4WUAA 2VTOA 3DY7A 1U4DA 2XNEA 4GT3A 1OZ1A 3D7TB 4NTTA 3P79A 2GFCA 4C3RA 2OJJA 4MKCA 3UYSA 3KMMA 2QI8A 5FTGA 2E9UA 3L9MA 5I9UA 2BRMA 3ZLXA 4YZDA 3NNUA 2GHGA 5DN3A 5E8TA 2VUWA 1JPAA 2XCHA 4S32A 2AEGA 5CZHA 3OT3A 5IEXA 2V7OA 5EI6A 2ZM4A 4K9YA 3HP2A 2IVTA 4BCFA 4PX6A 4GK3A 3UO5A 2GHLA 4XLVA 4QQTA 1FPUA 1Z57A 3DTWA 3L9NA 2OICA 4DFYA 5JGAA 2C30A 2YLFA 4YTCA 4D2SA 3WE4A 5CF5A 3QKLA 4FUYA 3GGFA 3FWQA 2PK9A 4D28A 3DAJA 1BLXA 1OM1A 4O4EA 4E6CA 3GQLA 1R39A 4JIAA 5LMKC 3BHVA 4PPCA 5HGIA 5TR6A 5A9UA 4MUQA 5IMXA 3KRXA 3NYXA 2GMXA 2GHMA 4LGDA 3GP0A 4RC4A 5BYLA 2UZDA 5LARA 3ZONA 1PYEA 3NZ0A 5AADA 2J0IA