3FC1X

Crystal structure of p38 kinase bound to pyrimido-pyridazinone inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELIWEVPERYQNLSPVSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Evaluating the molecular mechanics poisson-boltzmann surface area free energy method using a congeneric series of ligands to p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fc1X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fc1X01
3GQLA 2W1FA 3GU4A 3FI4A 2PE2A 3HLLA 3PJCA 2YDIA 3SXSA 3E8CA 4JAIA 2Y6OA 1Z5MA 2I0YA 4DH1A 4UMUA 4I93A 4LGHA 3T9TA 3DZOA 3FLYA 3VBWA 4BDGA 2HZNA 4O27B 3PIZA 2GHMA 2BR1A 2BZJA 5HIDA 3ZBFA 2VGPA 2VTHA 3C4EA 3VQHA 4EOOA 4QT1A 4FI1A 3WIKA 5A46A 2Q0BA 2QKRA 4UZHA 3LCDA 4BCFA 2W4JA 4LV5A 5J79A 4YZNA 4GIIA 4CYJA 2XIXA 3PVUA 2OXYA 4C38A 4CG8A 2IVUA 3BYVA 3LFBA 4MH7A 5C01A 1R0PA 2JKOA 2YWPA 3QKLA 4U80A 2P4IA 2VN9A 2UZNA 4JR7A 2W96B 2E2BA 4ANNA 4BIEA 5CQUA 3FSFA 2B9JA 2OJ9A 4FT0A 3VRYA 4E6CA 5IQCA 5CAVA 4CKJA 3DJ6A 2BZHB 4S32A 3RPVA 2J90A 2QR8A 3ZLXA 1IASA 5E8YA 4WNKA 3IS5A 4HNFA 4N0SA 3FC2A 2G2FA 2GDOA 2BROA 5M09A 1YVJA 4IWOA 3EKKA 4OTDA 4X2KA 4A4OA 2W1GA 5GZAA 1U46A 1O6YA 2ZB0A 2XNGA 5KUPA 3ORLA 3E62A 5CU2A 4QO9A 3BV3A 5AUTA 3IGOA 5CI6A 1HOWA 2WTCA 4UXQA 3ZEWA 5D7AA 5E8XA 2QHNA 3FXXA 5CEQA 4QMWA 2IJMA 5CSPA 4J8NA 4BC6A 2W5AA 2JITA 4C34A 2VD5A 2Z02A 2YLFA 2QO9A 4EH9A 3AMAA 5KBRA 2PULA 5E8WA 2LAVA 5LXMA 4NFMA 4PNKA 1OVEA 1E1VA 4S33A 3NLBA 3UO5A 2VWVA 3EQDA 4E4NA 1PY5A 4RIXA 1YDSE 3TZ7A 3E7OA 4QD6A 4HGTA 4ASDA 5DIAA 4PQNA 2QNJA 3P5KA 2Z7RA 4W4WA 2G1TA 2C6DA 4A06A 3KA0A 5BUEA 3QWJA 4DA5A 2NO3A 2VO6A 3QFVA 4RA5A 4BRXA 5C26A 5BX0A 4FT9A 4LRJA 5IUHA 4X3FB 1L8TA 4FV0A 3ETAA 3PXYA 4NL0A 3Q32A 3CLYA 3R73A 3FLNC 3NZ0A 3GC7A 1UNLA 4JG6A 5HNBA 4MWHA 5JT2A 2JKKA 3HP2A 4P7EA 3U4WA 5EHLA 4YPSA 5IQGA 3GEQA 5HD4A 1RDQE 2OW3A 3EQGA 5AP5A 1M14A 2Y4PA 1IAJA 4NKSA 5IQAA 4WNOA 3E88A 5CQWA 4FGRA 4DCAA 3VNTA 3OTVA 4RVMA 3QRKA 2BTRA 4EK5A 5D41A 5KX8A 4LOOA 5HORA 3FMKA 2W0JA 5M53A 3LXKA 3LQ3A 2I40A 2UVYA 3ZS5A 5CASA 4XBRA 4WUNA 4QQJA 4Q5HA 5HIBA 2R3GA 5DEWA 4CT1A 3V01A 4E1ZA 1ZRZA 4P4CA 4XH6A 3VVHA 5CEKA 2XBAA 4UEUA 3W8LA 5HKMA 4RJ8A 2W9ZB 4IANA 5IA0A 3GI3A 1OIQA 5EK7A 3VULA 2JDVA 3U6IA 3TL8A 4J99A 4CFUA 2XP2A 4I6HA 4RJ3A 4L45A 3PPKA 4JBVA 3TKHA 4DFZE 4QP2A 1Q24A 3UNKA 2E9NA 5BYLA 3U8WA 2C3JA 4CTCA 3KK9A 5HNGA 3FZPA 4BI2A 2W5HA 3R8VA 4HGEA 3CPBA 3DFAA 2EU9A 4I92A 4TKSA 2QOLA 3O71A 3OG7A 4NM0A 4WG4A 2O63A 2R4BA 4BBMA 3R9OA 3ULIA 2NNWB 1PMUA 1R3CA 3F6XA 3WYYA 4AQCA 2C3IB 3EFWA 4NW6A 4EH4A 4MTAA 4D0XA 4NM3A 2W4OA 4E5BA 1QPCA 3PP1A 4EQCA 3DTCA 3FQHA 3SQQA 3O8PA 4PPBA 2VU3A 3ZZWA 4XS2A 4CT2A 3BHHA 3OFMA 1KV2A 2CGVA 4KBAA 4RQKA 5B0XA 3DAEA 4R77A 4OAVB 3ENMA 3SAYA 2Y6MA 5L2IA 4I4FA 4QMSA 4I0TA 1Q8UA 4D4YA 4E6QA 4JIAA 4C3PA 1B38A 2WU6A 5CZHA 3MTFA 1ZYJA 4NSTA 1ZOHA 3DXNA 3W2SA 4E93A 4UY9A 3MDYA 4JDIA 4LOPA 3JY0A 3TNQB 4KRCA 4FF8A 3M11A 5CS6A 3W2OA 3VS1A 4AE9A 3ZRKA 3EN6A 3LFQA 4I5PA 5AR8A 5J1WA 4S34A 2YDKA 2YAAA 2NRUA 4RX5A 3F2RA 2GQRA 3POZA 3QC4A 5L6OA 3O8TA 5IDPA 3FY0A 3HECA 3KC3A 2X81A 4IVBA 3R9RA 3FE3A 3ZUUA 2OJJA 3I6WA 2BDFA 3CKWA 2R5TA 4PWNA 4EH8A 4YR8A 3C50A 4JDHA 4QRCA 3D5VA 3TWJA 3NYNA 4RJ5A 3F82A 5FBNC 4E6AA 5A4CA 5ITAA 3RJCA 5C27A 4HVHA 4D4SA 5C4LA 4D5HA 5KMKA 4Q9ZA 4BF2A 4TN6A 5M4CA 2W4KA 4FL3A 1YXUA 4FKWA 2UZVA 3CD8A 1APME 4DLIA 5HD7A 3KVXA 3QD0A 2CGUA 4GS6A 1U5QA 4NT4A 1E9HA 1G3NA 1JSVA 5L2TA 3VF8A 1SVGA 3E87A 5EDQA 2Z2WA 3G90X 4NTTA 2BAQA 4R8QA 4O86A 4UB7A 1BL6A 3QTSA 2X7GA 4BL1A 3S0OA 3TT0A 5CF8A 3FZ1A 1ZMWA 4PDSA 2BRMA 3QBNA 1GAGA 5GJDA 3KL8A 5M56A 5AP4A 3GENA 5IA3A 4IVDA 4YBKA 4FTUA 2B52A 3SRVA 3MBLA 5HG7A 3KMWA 4DG0E 3TIZA 5JRQA 3MH0A 4FL2A 2Y9QA 5LWNA 3GC8A 3A4PA 3GC0A 3CIKA 2VZ6A 5H9BA 2R0UA 4OBPA 4PL4A 3VHEA 3MVJA 3R8PA 3PJ2A 3R2BA 3MFUA 4AOTA 5A54A 4BWPA 1F5QA 4MNEA 1FVTA 3MFTA 5LOHA 5E91A 4DAWA 1PXOA 2BTSA 3UOKA 4BZNA 4HPUE 4MHAA 4CFMA 3D7ZA 4F0GA 2VTOA 5HE2A 5BYZA 4EH2A 4GVJA 2VX1A 1GZOA 4BTMA 5CU4A 5DYJA 2JAVA 4YJQA 3VF9A 3TNIA 2EXEA 4EKKA 3IDBA 4FTIA 5FP5A 1MRUA 4RT7A 3W2PA 1RJBA 4FKJA 5CVGA 4JG7A 4MXXA 4FT7A 4QP1A 4GT5A 5B2KA 2JFLA 3PPJA 4BDBA 3ZTXA 4GKHA 3BQRA 2XB7A 4K8AA 2YHVA 2JKQA 4E4LA 4YJNA 5A9UA 2J50A 4DF3A 3Q60A 4QMVA 2QLQA 5LVPA 5LVOA 1J1BA 1XJDA 4ACCA 4L3PA 2ITOA 3OBJA 3JS2A 3ZDUA 3E7VA 4XRLA 3W2RA 5ACBC 4AFJA 3NIEA 4R1YA 3ZM9A 2V62A 2ZVAA 3HDMA 5AUVA 3FXWA 3W18A 3ATTA 2ETKA 4X2NA 2OH0E 3LXNA 4EYJA 2DS1A 3QC9A 5AAEA 1OUYA 2ZAZA 2EVAA 3L8SA 4BHZA 5GJFA 3QL8A 4NIFB 4BR3A 3BYSA 3QAME 4C36A 3MH1A 2EWAA 3R04A 1PYEA 3F61A 3VS0A 2PVKA 2VNWA 3TTJA 5IMXA 4EHEA 5DWRA 4NM7A 5DI1A 4D1XA 3FMNA 4C4IA 4PTEA 5JEBA 4A4LA 3F9NA 3CQWA 3KGAA 1WMKA 3LM5A 3JXWA 5BVNA 5BVDA 2BIKB 2ZM1A 4YSJA 2H6DA 3LCOA 4R7HA 1SYKA 2HWPA 1WBSA 3DT1A 3B2WA 2JDRA 4JBPA 4N6YA 2B9IA 5CENA 3RCDA 2J5EA 2OJFE 5HESA 5EW8A 3ROCA 1Q8WA 5L8KA 3C4XA 2QCSA 3UMWA 3EHAA 4F6SA 4XV9A 4B0GA 3KFAA 3BE9A 3C0IA 3FJQE 3NYVA 2PTKA 3VJOA 5I3RA 4KIKB 5KNJA 5HCZA 1PW2A 1WBTA 1JVPP 1NA7A 3RK5A 2ITNA 5EW9A 3TNHA 3O96A 2X4FA 4FSMA 1H01A 5D7VA 5I4NA 4BTJA 5AR4A 4UZDA 2DUVA 4IEBA 1HCLA 3DLSA 4PP9A 3IW8A 4I41A 4AGUA 2WPAA 4B9DA 4FIGA 4PPCA 3KXZA 3FUPA 1YOMA 4ZTHA 5ETCA 1WBWA 3IDCA 4MXZA 4BN1A 4A9TA 2VTSA 4ZLOA 5GINE 2J4ZA 1IG1A 5IQBA 4USEA 5KMOA 2PZYA 3U51A 3AT2A 3A7GA 3GNIB 2EB3A 5IEVA 3MFSA 2P3GX 3PG3A 4HNIA 5EFQA 3R1QA 4AUAA 4WBOA 5EI6A 2PUIA 4BDCA 4APCA 4O0XA 3BHYA 2XJ2A 4W9XA 3R1YA 4IC7A 4BKZA 4DTAA 4FUXA 4O22A 4R6VA 3PE1A 4D2WA 2ZM3A 2XK9A 3LFNA 5HNIX 4I5HA 2VV9A 3BV2A 2WTKC 1P14A 3DTWA 3S4QA 4MXOA 4K9YA 1OKYA 4AZEA 3MPTA 3ZO3A 5H2UA 2VWYA 3A7JA 4PMPA 4QNYA 1KE5A 2F9GA 4DH7A 3CJFA 4FTKA 4E6DA 3F88A 3CY2A 4MBLA 3UP7A 3WYXA 1J91A 3R63A 3Q52A 3TG1A 5IU2A 2QR7A 2YM4A 5AFVA 5EOLA 5T3QA 5CU0A 4LI5A 4IQ6A 4ZJIA 2YM7A 3KREA 3D5UA 3NYOA 4NW5A 4D1ZA 2BFYA 2Q0NA 3ODYX 4QPSA 4MXAA 5HCYA 2Y4IC 3OXZA 4FYOA 2QOHA 2VGOA 4PMTA 1PYXA 2JGZA 4W4YA 2VWUA 4MKCA 4U41A 2HY0A 4FKUA 2XIZA 1GY3A 3OCSA 3FSKA 3IW5A 4FSNA 4FZDB 4JAJA 2A4LA 4HCVA 4IW0A 4DEBA 2XK3A 4X2FA 5EHYA 2JIIA 2YCFA 1QPDA 1QMZA 4EUUA 3EN4A 5HBJA 5J8IA 3VN9A 4HVSA 2ITQA 4J53A 4W8EA 3L8PA 2W17A 2XM9A 4Q5EA 4EK3A 4ENXA 2H34A 3EB0A 3OOMA 4JQ7A 4I23A 1M2QA 4IX4A 3RAWA 2VTLA 4OGRA 4MQ2A 2UW9A 3H3CA 5FXRA 4YJPA 2OKRA 3QTZA 3MWUA 1PXKA 2W1CA 3QQKA 2UW0A 2XIKA 3HNGA 4BDIA 2CN5A 1WBNA 3ORKA 4XV1A 2HY81 5AWMA 3LFFA 4HJOA 3R83A 3UC4A 2BAKA 4I20A 1T46A 3QQJA 3ORMA 1ZLTA 3I7BA 4KWPA 3FZOA 5DN3A 4DGNA 3KXHA 3BYUA 3LJ0A 4EH5A 4ORKA 2WFYA 1ZXEA 1OIUA 2WQNA 4H3BA 3FPMA 3VC4A 2YM8A 4G31A 4E3CA 1CTPE 4FIEA 4N6ZA 5FLFA 4NTSA 3ZSGA 4FZ7A 4QYYA 2FSMX 4XUFA 3ZDIA 4GG7A 4DC2A 5E8ZA 2IW6A 3FKNA 3Q4CA 3COHA 3LFEA 1XH6A 4AZVA 3COKA 5AP2A 3C4CA 1A06A 1TQMA 1P2AA 3AD5A 3BU6A 4TNBA 3EOCA 4OW8A 5ANEA 2PSQA 5F20A 1UKHA 5DGZA 1ZYLA 5CF4A 3ERKA 4EEVA 3GU7A 4DLJA 2ITPA 1KOBA 1OZ1A 3R02A 4GCJA 1GZKA 4KKHA 4Y8DA 4O7NA 3SKCA 3I1AA 3S1HA 1ZZLA 3FL5A 2XEYA 3PVGA 4CKIA 5KMNA 3SW7A 4HVGA 1ZYSA 4MNFA 3L9NA 1Q99A 4I22A 4M0YA 1JKSA 4QMOA 1OKZA 2R3PA 4TXCA 3RWQA 4YURA 1GNGA 1VJYA 3CPCA 2C30A 3MSSA 4FICA 1ZARA 4YZMA 5AMNA 4MEDA 4HCUA 2UVXA 4RFYA 1H08A 4FV3A 1PXPA 5AA8A 3EMGA 4MQ1A 4ALVA 2UW4A 4ZSGA 1JKLA 2JBPA 2ETRA 2YERA 2Y0AA 2W1EA 2WMSA 5BUIA 3CS9A 4TYJA 4V0GB 3RINA 4G3DA 1H1PA 1J7UA 2GSFA 5I9WA 3RAKA 4FZFB 4AW1A 4MXCA 4ZY5A 2I6LA 3ZM4A 4BB4A 5LVNA 3G15A 4QTEA 3OCGA 5ANOA 1WBOA 4DFNA 3GCPA 3VUHA 3AC8A 4WG3A 3CTHA 4KRDA 4O7ZA 4MWIA 2RFNA 1T45A 3BIZA 4M69A 3NW5A 2ITUA 2CSNA 4TWCA 4ANOA 4IWPA 4BFMA 1KWPA 5HVYA 4ZIMA 5IH5A 5LVLA 3KY2A 1NT2A 5BVOA 5G1XA 2HZIA 2XNNA 2WTWA 2VWBA 5JMSA 4R3RA 3ZZEA 2P2IA 3KRWA 1CKJA 1Z57A 3ZH8A 3BYOA 1RW8A 3ELJA 5ETFA 5CYIA 4E8AA 2PVMA 2CNQA 4PL3A 3K3IA 2HENA 3FKOA 4P5QA 3DAJA 4XG3A 5M44A 3OWPA 1FINA 4AT3A 4QMUA 2FB8A 1BI8A 4WNMA 4DE4A 1OL1A 3VUMA 2BHHA 3BHUA 1AD5A 4LQMA 1Q41A 5CU3A 3QA0A 2W06A 4YO6A 4O7YA 2WOUA 4O84A 1WVWA 2PVNA 3WI6A 2R0IA 5E1SA 2BZIB 3OZ6A 5LARA 4ACDA 2BHEA 2VUWA 3KRJA 3DQXA 5IH6A 3JUHA 4TRLA 4C8BA 4IWDA 4QQ5A 3R7UA 5CSXA 4CMUA 1Q61A 1W8CA 4OT6A 3BEGA 3DKFA 1KE7A 4DYMA 4M14A 4IJ9A 4OTFA 3LJ2A 5A4LA 5AR3A 4XNEA 5G6VA 3NX8A 4FKIA 5EKOA 3L9PA 3DPKA 3TI1A 1JAMA 4YTIA 5HHWA 4GIHA 3BPRA 3M2WA 3QKMA 4J96A 4IZAA 4A9UA 3ID6C 2GNIA 4EOQA 3R00A 3BRBA 3DAKA 3ZXZA 3DCVA 3QZGA 4QPAA 4LG4A 4EUTA 4YJVA 3PY3A 4Z16A 2XMYA 4D5KA 4IVAA 3QD2B 1WVYA 4RX8A 1OKVA 5IMEA 4DEGA 3BLHA 3C5UA 4D2SA 3C4ZA 3NW7A 4FKSA 2UVZA 2PVHA 3AGLA 3Q6UA 4LL5A 4RVKA 2R3JA 1STCE 4X0MA 5L6WL 1ND4A 3AD6A 3I4BA 2RG6A 2WMUA 3RPOA 4F9WA 1G8SA 2KULA 4IZYA 1UNGA 2Z7LA 3FYKX 2H8HA 3BHTA 5LMBA 1PHKA 1YHVA 4FTLA 4G34A 5AM7A 4M3QA 3CGOA 3PWDA 2XA4A 4IDTA 4YHFA 5F9EA 2VTJA 1W98A 2EB2A 4XP3A 5AX3A 3MY0A 4L52A 3FL4A 5IUGA 3LKMA 4CQGA 3N4TA 5DH3A 4K11A 4L43A 4ERWA 4CRLA 4K2RA 4ACMA 3GCSA 3QCXA 4U43A 5DVRA 2QC6A 1XH9A 3UNZA 1E1XA 3UVQA 4CVAA 1CMKE 2V7OA 3LMGA 5LWMA 5HGIA 3ORXA 3E8EA 3SXFA 3NS9A 3NWWA 3OY3A 5CALA 2QLUA 2RFEA 4HYUA 4BDJA 3LLAA 3QYZA 4DN5A 4BTKA 5M57A 4M13A 4RLLA 2AC3A 4J52A 4M97A 5FBOA 3VUTA 4L7SA 4CCBA 3D4QA 2R3NA 2B53A 3KCKA 4BDDA 4FV8A 2DWBA 3LCSA 4JNWA 1H24A 2PY3A 1TVOA 4S30A 5CY3A 1GIHA 4O83A 3DBEA 3FAAA 4EOLA 1KE9A 1R39A 4O96A 4RIWB 3D2KA 4O6LA 5HO7A 5DRBA 3H0ZA 4TPTA 5HX8A 2R2PA 3G9NA 4DEEA 4I3ZA 2QOCA 5JK3A 5DA3A 2Y7JA 2V22A 3QCQA 4F09A 3MA3A 3WE4A 4FNYA 5CSWA 3F69A 2YCSA 4DFBA 3FHRA 3AMYA 4PF4A 4YHTA 3FHIA 4WBBB 2JAMA 4AA4A 5BMSA 2WTJA 4OTGA 3CQEA 2BRHA 1LEWA 4YTHA 2PPQA 5ETAA 5HO6A 5LCKA 2J0KA 3FQEA 2A19B 3CY3A 2VTNA 2YN8A 1A9UA 4FTMA 4DTBA 4GH2A 4BCIA 2VX3A 5I9VA 5EQEA 1KSWA 4YJUA 4HYSA 1ZYDA 2CHLA 3ET7A 2A2AA 4BYIA 3BGQA 1HCKA 3D15A 1H00A 5HG5A 3Q9XA 1ZAOA 3TTIA 4GK2A 3QYWA 4WIHA 2J0JA 3IOKA 3LHJA 4G2FA 5DRDA 5AP1A 4DEHA 2C5VA 4UALA 2P33A 3K54A 4XG7A 4WUAA 4C37A 3L9MA 4D28A 4A9YA 3PJ3A 4MBJA 4XLIA 3OOGA 2Q83A 4PTGA 3GC9A 4IX5A 5EYMA 2BRGA 3CSVA 4Q9SA 4ARKA 2GS2A 1GZ8A 1M7NA 3ZCLA 2YA9A 5EM7A 4YZBA 1REKA 2IZRA 3NUUA 4P5ZA 4F9BA 2YIYA 4YUQA 3UQCA 2C1BA 3KQ7A 4X2GA 4RWKA 5A4EA 5EQYA 1YI6A 4IM2A 3EFJA 1CKIA 2YJRA 4N70A 4C57A 3UOJA 2QOKA 3RGFA 4WKQA 5JFSA 1V0BA 4D2PA 5E8TA 3T8OA 3OXTA 3QCSA 3R8LA 4GYGA 3BZ3A 4F7SA 4YC8A 4ZSEA 4AA5A 4APPA 2WEIA 2I1MA 5EM5A 3QX2A 2QURA 3FZRA 5IPJA 4U40A 4YO4A 3H0YA 4CD0A 3FMDA 4KIQA 5EYKA 5LQFA 4ID7A 4G3FA 3JPVA 2P0CA 1WCCA 5D10A 3ENHA 2PZIA 2VTAA 3RTPA 4LYNA 3EIDA 3OTUA 5FTQA 4EJ7A 3F2NA 4OR5A 4FEWA 4AW0A 2CNUA 4IM3A 5KHWA 5FDXA 4J97A 3Q2MA 5AV2A 5AV4A 1SNXA 3QTRA 4FTOA 4BCGA 2WIPA 5BQ0A 3RHKA 1NVQA 3F3TA 3QZIA 2OZAB 5K0KA 3FWQA 3IKAA 2JC6A 5H3QA 1GJOA 2QOIA 3PRFA 2XEZA 4J95A 4ASXA 1GOLA 1A48A 3V6RA 3EN7A 3F5GA 4W4VA 5A6NA 5TO8A 4AW5A 4FEQA 3OHTA 5DFPA 4F0FA 4FKVA 2QOBA 3EJ1A 4CFNA 2YIRA 4F1TA 3ZU7A 5JFWA 4L8MA 4C35A 2BZKB 3QALE 4XG8A 2WO6A 3GCUA 3MH3A 4RFMA 5C8NA 4ACHA 4NU1A 2NPQA 2B0QA 3P08A 5KBQA 4M84A 4Y73A 3V51A 4EI4A 4KUJA 5EQPA 3L8VA 3UO4A 4JL9A 3MIYA 5TF9A 4DGOA 3IQ7A 3S95A 2HYYA 1K3AA 3AQVA 4O2ZA 3RK9A 3PUPA 3ZYAA 5CAOA 3D94A 1KUTA 2WMVA 1V0OA 3OCTA 2WQBA 2OSCA 2VX0A 2YISA 2J0LA 3IG7A 3BQCA 3KXNA 3NYXA 4QMTA 3OY1A 3V5PA 4K1BA 2HZ0A 3AG9A 2X6EA 3PYYA 4G6NA 4C4JA 2BDJA 4IX3A 3AXWA 2GNHA 3IW7A 5CX9A 3CEKA 5H8BA 2GS6A 3QZHA 3QTUA 4FSZA 4PDPA 3LLTA 2GMXA 3P78A 4ZTRA 3MYGA 4H1MA 3NRMA 5JGDA 3U6HA 3V04A 2IVVA 2C6EA 4P2KA 4RWJA 3UQGA 4DH3A 1XH7A 2A1AB 5LMKA 2ITYA 2YZAA 2ZMCA 4KKGA 3BWFA 2QU6A 5KKRC 1OM1A 4CKRA 4XBUA 4QOXA 3C9WA 3LXPA 3KN5A 2FUMA 5K4IA 3DK6A 2BKZA 4QMZA 5AUUA 3G33A 4ZS0A 1FGIA 4QP4A 4MD8E 3OVVA 1UU3A 5B7VA 3P7BA 4ENYA 3VRZA 3KF4A 4H39A 3H30A 2XF0A 3HUBA 3QRUA 3V8SA 3EL8A 2XYNA 3MN3A 1WVXA 1P5EA 2ZMDA 4BCOA 2ZDUA 2FA2A 4AGCA 2C6OA 1ZY4A 2B9HA 1UA2A 5JN2A 4KINA 4PX6A 4LUEA 4YTCA 3TDWA 2YZLA 2WTKB 5L6PA 2BPMA 4NCTA 4TYEA 1ZYCA 4U6RA 3R71A 4UBAA 5EYDA 3U54A 5JGAA 5AX9A 1BKXA 4YC3A 4ANQA 2JDSA 3ANRA 3UC3A 2YFXA 3KXXA 3DBQA 5HE0A 1FMOE 3PFQA 4U3YA 5HTIA 4I0RA 4F65A 4GYIA 3HL7A 5HLWA 4FIIA 4G3GA 3UIMA 4E26A 2JD5A 2CKQA 5AR7A 3FLSA 4FGBA 1OPJA 1JOWB 3PA3A 3LE6A 3O7LB 2OXXA 3UZPA 3LCTA 4BCQA 2W1DA 4Y5QA 4UX9A 1J1CA 2EXMA 2Y4IB 4LRKA 2E9UA 2ONLA 1O6LA 5M55A 1H0WA 3FXZA 3C0HA 1F0QA 4QTBA 3GB2A 3VIDA 3WZEA 4QP6A 4D55A 2J7TA 2X7OA 4IB3A 4FIJA 4TT7A 4U7ZA 4Z9LA 2PMOX 3DGKA 4XRJA 3TEIA 3PG1A 4YNOA 4FTRA 4ZJVA 4L00A 2C0TA 3IOPA 4J8MA 3DNDA 4XJ0A 2OJGA 4GL9A 4I94A 5HOAA 1M52A 3NDMA 4K77A 1OECA 3RALA 4U3ZA 2RKUA 3MJ1A 3HV4A 3UP2A 3VS2A 4EBWA 4E73A 1W82A 3TZMA 2XIYA 2UZEA 4NYEA 2GTNA 3MY5A 4H3PA 3UG1A 1XQZA 3ZO2A 4DFYA 5KE0A 3NVKI 1H07A 5JSMA 3Q6WA 1H4LA 4CYIA 5IQDA 4JOAA 3EYHA 2OJIA 5EDPA 2CPKE 3EQBA 3EZRA 4EOKA 3DJ7A 3R2YA 2FSOX 4XX9A 5HLPA 1M7QA 3MS9A 4O82A 1Q8ZA 3LW0A 4RJ4A 4IAYA 5EM8A 5FXSA 2IPXA 1XKKA 3R7YA 3SHEA 5DPVA 1AGWA 4CGAA 3CTJA 4AN2A 1BUHA 4O7RA 2ACXA 3K2LA 4G3EA 4MXYA 5K4JA 4EOMA 5BVEA 5EI2A 4K6ZA 3SW4A 3VS5A 3IW4A 1SNUA 5DEYA 3SG9A 2PVYA 4RLKA 5AADA 3HMMA 3OD6X 4I6FA 2J6MA 4IWQA 1J3HA 1ZZ2A 1PXJA 2WQOA 1YWVA 3GOPA 1IA8A 4TYHB 4GSBA 4XHKB 4QYHA 3PSCA 4GVAA 4X3FA 3IW6A 1REJA 3UIBA 2VTPA 4WD5A 5FM3A 4O38A 5J87A 1J7IA 2HAKA 3O51A 3OEFX 3HKOA 5CAPA 3WILA 4ZAUA 3FLZA 3FZSA 2PMNX 4FSRA 4KBCA 3K5UA 3I0QA 3GOKA 4R3CA 2X8DA 1QL6A 4KD1A 5KMIA 5E1EA 2EXCX 4Y83A 3GBZA 3N9XA 1NVSA 4O21A 3BELA 3RM7A 4LGDA 4V01A 3BBTB 5K5XA 3CD3A 5CEPA 2CNVA 4AP7A 1L3RE 3R7EA 4HYHA 4FSYA 5HO8A 3U6JA 4E4XA 3KKVA 4A4XA 1UWHA 3ZRMA 3Q04A 3UE4A 2HW7A 2WTDA 4HVIA 2O0UA 2A27A 3MW1A 4ZZOA 3V5LA 3QU0A 4UXLA 1OUKA 4ASEA 4I4EA 1XBAA 3CC6A 4I0SA 4YJRA 4Z7HA 3I79A 4M67A 5IQFA 4WOVA 4AOIA 2PL0A 1M2RA 4JI9A 5DT3A 4AACA 2FH9A 4C2WA 2EUFB 5GIPE 4KSQA 4QPMA 2C68A 1OPLA 5JRSA 2UZOA 4IFGA 3R9DA 2WMTA 3GCQA 4IE9A 4C61A 3QZFA 5BVFA 4O0RA 3C5IA 4NKAA 4IFCA 3DB8A 1U59A 4UYAA 4WRSA 2CMWA 3C1XA 4FZAB 4HW7A 3HMIA 3TV6A 4FEVA 5I0BA 3HDNA 4S2ZA 3UPXA 5ICPA 3T3VA 4AG8A 3DXPA 4DH5A 3EQFA 4B6LA 4D9UA 4PTCA 3VAPA 4E5AX 4O7VA 3LFAA 3EWHA 4V04A 3A99A 1JSTA 3KULB 4FTJA 3L9LA 4GMYA 3VS6A 2WTVA 3I0OA 4GJ3A 4D2TA 2F49A 3PLAE 2C3LA 5DR9A 1BMKA 2VAGA 3P23A 4NWMA 3OW4A 4M69B 1M2PA 4EBVA 2PZPA 3C0GA 4AW2A 2ITZA 2WKMA 5TOZA 4QMYA 3VW8A 4AGDA 4F63A 2OZOA 3WARA 4BDHA 2PUUA 3OT3A 3D5XA 4Y46A 3DKGA 4YLJA 3RBWA 3TKIA 4AS0A 4ZSLA 5CI7A 2R7BA 3BX5A 4QYFA 4D2VA 4M68A 4H36A 1FGKA 2BFXA 3ZUVA 3PXZA 2B4SB 3RZBA 4ZK5A 3V5QA 4FTAA 2C6LA 1Y8YA 4NM5A 3UNJA 5BNJA 3PIXA 1ZOGA 3GU8A 3QQGA 4WG5A 5L2QA 4DT8A 1ZWSA 4BGGA 5M51A 4BTFA 4K33A 2XK8A 2UW6A 2QKWB 4L7FA 4D1SA 2WMWA 4RWIA 4DGGA 4ZJJA 1KV1A 3DK3A 3Q9YA 3N4VA 2WD1A 4D0WA 3RZFA 4RWLA 1QPEA 3D7TB 3VJNA 1VEBA 5C03A 2G9XA 3KB7A 3JYAA 5EKNA 5FWKK 4IAAA 1PMNA 1SM2A 4WSYA 1UV5A 4YSMA 3ZHPC 3RPYA 4EJNA 2G2HA 3THBA 3WZJA 3V8TA 3RM6A 3UIUA 4C4HA 3PA5A 2LGCA 4O81A 5ANIA 2O8YA 1R78A 4JXFA 4FZ6A 4USDA 1OGUA 4CFWA 5L8JA 3IO7A 4L67A 2F7EE 5TT7A 1H1QA 4ANSA 4BDEA 4CFXA 5FXQA 3U9CA 2NRYA 3AC1A 3DU8A 4LM5A 3PJ8A 4U42A 4CSVA 3A7IA 4IZ7A 4YGAA 2FO0A 2PZRA 4AOJA 2PUNA 3DA6A 4ACGA 2QOQA 3AGMA 3CXWA 4Y5HA 3R21A 4U79A 3L8XA 3PY0A 5ANKA 4RA4A 4FSWA 5HZNA 5HLNA 3GUBA 4KA3A 3VWAA 2WU7A 3UVRA 4QTCA 3F5XA 4FIHA 3RWPA 3KRLA 5DHJA 3C7QA 3FI2A 4KSPA 5AA9A 4KIOA 5AP0A 2X2MA 3ZFYA 2GHGA 3N51A 2J51A 4FKRA 4F7JA 4GKIA 4F9AA 3HVCA 3QQLA 2CCIA 4RSSA 1UU8A 4L46A 4UV0A 3W32A 5DT0A 3QX4A 1Q97A 4FV9A 4YZ9A 3SVVA 5IDNA 2WMAA 4GU6A 1FVRA 3PE2A 4JT3A 5GHVA 3FKLA 4RC3A 5BVWA 3FMHA 3RNYA 4CZUA 3PZEA 2PMLX 4EH7A 4EK8A 2KTYA 4QMMA 4ZTNA 2X8EA 5AJQA 2ZV8A 4BWXA 3KK8A 2OXDA 4Y72A 3NEWA 4CRSA 3DXQA 1BLXA 4J71A 3R8ZA 4LOQA 3GCVA 5HTCA 1B6CB 3TCPA 4IACA 3RMFA 3PDTA 2PVJA 4HVDA 2VTRA 1OKWA 1Y6BA 2V0DA 1TKIA 3OP5A 4FIFA 2YCQA 1GIIA 1Q8YA 2OWBA 3WF8A 1O6KA 2R3RA 3EH9A 3RPSA 5HX6A 2JIUA 4JIKA 4DGLC 4YLKA 4EL9A 2CKEA 4IDVA 5BUJA 1H1RA 3WZUA 5D1JA 4ZMEA 1O9UA 3FYJX 5I5ZA 2E9VA 3VW6A 3ZO4A 4DBXA 4XOYA 4O1PA 5C8MA 3GU6A 2W5BA 2UV2A 3C13A 4LUDA 3BE2A 4X7QA 2CLQA 4JLCA 3R1SA 3TNWA 4ANLA 3NMUF 4D2RA 3HA8A 3JVSA 3NNUA 3OC1A 4Z7GA 1URWA 3F7ZA 3OWJA 3G0FA 4NIFA 5A6OA 3QKKA 2XKFA 2HOGA 5CU6A 4FR4A 4LFIA 3OXIA 1ZMVA 3UDBA 4DH8A 2HWOA 2CDZA 3QD4A 4WO5A 3A61A 3QHWA 3R7VA 4BYJA 3DZQA 4IADA 4AZSA 3E63A 3HV3A 2FGIA 3CP9A 3TUBA 5J9ZA 4XLVA 2PUPA 3AOXA 5EHOA 2XJ0A 5CANA 1NW1A 1RE8A 2HCKA 4EOSA 1UNHA 1DI8A 2WHBA 3PA4A 3GU5A 2J5FA 4KAOA 5LJJA 2BKKA 5JFVA 5GJGA 2GU8A 4A9SA 4UWCA 3HRCA 2Z7SA 2VWIA 2X6DA 2C0OA 4KIKA 2CKOA 2PYWA 2UZDA 3D2IA 3TJCA 3DK7A 3NUNA 4I24A 3VBTA 5CAUA 2QG7A 4IMYA 4ZMFA 4JDJA 4F70A 3WIGA 2NP8A 3HA6A 4XOZA 4ZTQA 4EHVA 4G9CA 2IG7A 2WB8A 2GNLA 4M7IA 3C51A 2WMXA 4GRBA 4JQ8A 4YZCA 3MH2A 3UO6A 4Z55A 4ZS4A 2C1AA 3FMMA 4GG5A 2HZ4A 2ITTA 2CGXA 4GFMA 3UOHA 4BY9E 2CLXA 5JZNA 5CT0A 2YEXA 4YJSA 3P4KA 2XS0A 5A14A 2P2HA 4G3CA 3IPHA 4GW8A 1J7LA 4C62A 4X21A 3LIJA 3FMJA 5IQIA 4G5JA 1U5RA 4R5YA 4RIXB 1ERKA 1PKGA 3PP0A 3BLQA 1G5SA 3A4OX 4BCNA 2C69A 5C1QB 3BU3A 5J9YA 4PDYA 5GIOE 1OI9A 5KMMA 5JKGA 3Q5ZA 4TW9A 4AX8A 4R5SA 1QPJA 1MRVA 2F4JA 4QYGA 2VTIA 3V5JA 4KKEA 2BVAA 4AZFA 1UVRA 3E8DA 3QA8A 4RX9A 2XNOA 3UIXA 4BI1A 4LV8A 2XJ1A 3OT8A 4GFOA 4RJ7A 5AV1A 1K9AA 2WZJA 4F0IA 3E93A 2XNEA 2PU8A 3E5AA 1WBVA 5HE3A 3W2CA 3G0EA 3PIYA 5F4NA 1BX6A 1PXNA 1YOJA 3QCYA 4EQMA 3TM0A 4RFZA 5C4KA 4GFGA 4IM0A 5I9XA 3POOA 4RIOA 3HX4A 4ZEGA 4AWIA 2JBOA 1PRYA 3DNEA 3H9RA 3C4FA 3W8QA 2R3KA 3RP9A 3RVGA 1YXVA 5M4IA 4OTIA 3RCJA 2BILB 3FDNA 4KIPA 5F1ZA 4QMQA 3ACJA 2FYSA 4YC6A 3ORNA 3OWLA 3QQUA 1VYZA 5I9UA 5EI8A 1UU7A 2XNPA 4BDAA 1U4DA 2WXVA 4FMQA 2XUUA 4LL0A 1VZOA 2ERKA 3FPQA 2YDJA 5IISA 3TNPC 4K0YA 2YIQA 5ACKA 3T9IA 3G51A 4DT9A 2QQ7A 3KRRA 3WZKA 4BCJA 2C6IA 2V5QA 4G16A 4IBMA 4JBQA 5M06A 3UYSA 1OPKA 5FRIA 3TACA 3KRXA 4H1JA 5KKRB 3EFKA 3GVUA 5K9IA 1H1SA 2VRXA 3AD4A 3DJ5A 3WF5A 3OUNB 3RK7A 4HGSA 5DNRA 2ZDTA 3PVWA 1VYWA 3QQHA 4KNBA 3LQ5A 3Q4TA 5TR6A 4CLIA 3PWYA 4O0VA 3RI1A 5AAGA 1JSUA 2B54A 4FOBA 4GUEA 4JDKA 3BLRA 2OK1A 2HXQA 3U87A 5KO1A 3PXKA 1IAHA 5EH0A 4FTTA 1KE6A 3NAXA 4NZWB 1V1KA 3MVLA 4PPAA 3CE3A 4ITJA 4R7BA 4YJTA 3NUSA 5CT7A 5HVKA 1OBDA 4CXAA 2J9MA 3MPAA 2O64A 5FDPA 1TQIA 4IB1A 4EQUA 3W16A 2ZB1A 5L8LA 4UYNA 3DKOA 4CV9A 3LMHA 4JRNA 4L68A 4UMTA 2QO2A 3UG2A 1DAWA 3U55A 4RPVA 4J98A 4P90A 5IKWA 3SX9A 3EKNA 3ORPA 4XEYA 5CTPA 1ZOEA 2PE1A 1YRPA 2W7XA 3HGKA 4FK3A 1H1WA 4IAKA 3SG8A 5C8KA 2RIOA 4D4VA 2JEDA 1YQJA 4MX9A 1Q3WA 5D9HA 4I6QA 3I81A 5HG9A 4RVTA 4DTKA 2R3FA 3H10A 4O6EA 3Q5IA 2OG8A 2VWWA 3QWKA 4O1OA 4I5MA 4BGQA 2YITA 1DM2A 3GP0A 2GQSA 2RL5A 5M07A 2Z60A 4C33A 1PMVA 3PPZA 4FKOA 3VHKA 3ZFXA 2QG5A 5CXZA 2CGWA 3LAUA 3FLQA 2OF2A 1YI3A 5AP6A 1XH8A 3R22A 3R8UA 5LCJA 1Y57A 4PMSA 3QTQA 3IK3A 4BCPA 1LR4A 2YABA 1MUOA 5KMLA 4B8MA 4S31A 2PVFA 2X9EA 1XBBA 4FVRA 1Q4LA 4E4MA 5M4UA 3F2AA 1H25A 2W9FB 3ZLWA 5CEOA 1LEZA 2PE0A 5IUIA 4CZTA 1YW2A 3AT3A 3VUDA 2UZTA 4IIRA 4FVQA 4ZOGA 4V0GA 3W33A 1WBPA 3V3VA 5J5TA 3ZUTA 5J7BA 5KCVA 4J1RA 4O2PA 2XNBA 3LFCA 2C4GA 3G6HA 4YMJA 2X2KA 4EH6A 3KCFA 3HAVA 3CR0A 4OTHA 2R9SA 3M42A 2R3QA 3TZ9A 3ZC5A 2UZLA 3QLGA 1OBGA 4II5A 4G5PA 3MFRA 3QXOA 4DGMA 4F99A 5AP3A 1P4FA 2XM8A 3IECA 4OTRA 3UBDA 4UMRA 4PL5A 4BBFA 4CFVA 5AM6A 3SRVB 1MQBA 3EZVA 3SC1A 1URCA 4W9WA 5AR2A 5AAFA 4BIDA 2C47A 3REPA 3TZ8A 3ZRLA 2GNFA 1DI9A 2PVRA 2WMQA 4U5JA 3GT8A 3BCEA 4RX7A 4ZSAA 5L3AA 3OMVA 4QNAA 3IGGA 4AE6A 4WA9A 3VQUA 1IR3A 2RFDA 2X0GA 1YXSA 3FI3A 3A62A 4MNEB 4X3JA 3R0TA 3S2PA 4H3QA 2R64A 4BBEA 4YZDA 2RG5A 2HW6A 2XK4A 4QP8A 4L6QA 4BCHA 4UWBA 4M15A 5BPYA 4RGJA 3AC3A 5HBHA 3OBGA 3NUYA 4MYGA 3BWJA 2WEVA 3RKBA 4L3LA 3EN5A 5J9LA 2DYLA 3JVRA 1NY3A 2IO6A 5ANGA 2ESMA 3UMXA 4ONAA 2ERZE 2YCRA 2B9FA 3H9OA 2C6TA 4CTBA 5IEYA 1G8AA 2X2LA 3VBXA 4KB8A 3V8WA 4OTPA 3TN8A 2VTQA 1P4OA 1UU9A 5L4QA 3EYGA 4FTNA 4FNZA 4BHNA 4DG3E 5CVFA 5FQDC 3VUKA 5B2LA 2OGVA 3D14A 4GEOA 4HOKA 4HYIA 4FG9A 4IAIA 4ZXTA 3TV7A 1TQPA 3OROA 1JNKA 3UVPA 4AZWA 1YDRE 3O17A 1PXIA 3A8WA 4FV7A 3FEGA 1W0XC 5LMAA 4QMNA 1YWRA 4OLIA 5A4TA 1R1WA 5HVJA 2W05A 1OL5A 4PP7A 1U54A 4FBXA 4CEGA 1LPUA 4RZWA 3F7WA 3PXFA 2X1NA 4EH3A 4EC8A 2J2IB 2QOFA 3AMBA 3CTQA 2BDWA 3DB6A 3EQCA 3ACKA 3RNIA 5T68A 3F66A 3BBWA 4GUBA 4IJPA 4A07A 1F3MC 2UUEA 5FTOA 3JR1A 3KMUA 4ZLZA 1Q8TA 4IB0A 1XR1A 3RPRA 4I5CA 3BGZA 1V0PA 3HUCA 2JFMA 3G6GA 2F2UA 3QGYA 5BVKA 4DG2E 3HRFA 4JQEA 5AV0A 2PMIA 1FVVA 5DBXA 5E90A 3U9NA 4JX7A 5AIKA 2YAKA 3DV3A 4QQCA 4F64A 4DINA 2I0HA 3IDPA 4ITHA 3LXLA 2B7AA 4QMLA 1LUFA 5EW3A 5HI2A 2F7XE 2C0IA 1JPAA 2QODA 1SVEA 5E8SA 3GQIA 2UW7A 2RF9A 2F7ZE 2IVSA 3NGAA 4R7IA 4EZ5A 3TUCA 4H05A 4IAFA 5AUZA 2JIVA 3Q9WA 3SLSA 4AZTA 2IW9A 4FKLA 4F4PA 4JBOA 2WIHA 5AP7A 2I7QA 4ZP5A 3DKCA 4MBIA 3SGCA 5FGKA 4U0IA 2UZUE 2X9FA 1B39A 3BKBA 3NNVA 4FL1A 2REIA 4RIYA 4F08A 3CBLA 2G01A 4LGGA 1JQHA 3FLWA 4BKJA 3M1SA 4C3FA 2GFCA 4U9AA 5LMKC 2CKPA 4HZRA 4MD7E 3WF7A 2OBJA 3ITZA 2UW5A 4FEUA 2JLDA 1BL7A 2BALA 1FMKA 4WSQA 2GHLA 3WF6A 5IQHA 2AC5A 3V6SA 5IA4A 3G5DA 1CKPA 2RSVA 3FI8A 4ZTSA 4C4EA 4CMTA 4U97A 5HU9A 4PRJA 4NJ3A 4CLJA 1YHSA 4OT5A 3ZBXA 4RIWA 4IB5A 3EQPA 2XH5A 4FOCA 3GXLA 3NNWA 3A7FA 5AUYA 4TYGA 3WBLA 4B7TA 4RC4A 4BKYA 3DQWA 5CAQA 5CF6A 2YM5A 4OUCA 1ZY5A 5CVHA 4RJ6A 4E20A 1XBCA 3NNXA 3FQSA 4FVPA 3PRIA 4QYEA 3VBVA 3II5A 3NUXA 5J7HA 5F94A 1PKDA 1OL7A 2XBJA 3BI6A 4PV0A 4TWNA 4WT6A 5ANJA 4EK4A 5GNKA 4FG8A 5IG1A 5FTGA 2BCJA 4FV6A 4PNIA 1YKRA 1GZNA 4NCTC 4F6WA 5CXHA 4BCKA 3BHVA 4ANBA 5JFXA 3SD0A 5DLSA 5IQEA 4OTQA 4R78A 2O2UA 4EONA 4LMNA 4UMPA 5DE2A 5L2WA 4F9YA 3RAHA 2ITVA 3MB6A 3QRJA 5JH6A 5HICA 1OL2A 3PTGA 4FNXA 2F2CB 2VWZA 5CZIA 2ZJWA 1W7HA 3QRIA 3UODA 4MD9E 2XZSA 1GIJA 5GZ8A 3NUPA 4DITA 1YOLA 3D0EA 3ZLSA 3NW6A 3P9JA 2ONLC 4O91A 4C4GA 3VS7A 3PJ1A 4L01A 3W55A 4BGHA 3MGYA 2G2IA 3R9HA 3H9FA 3CGFA 4DCEA 2CJMA 3HMPA 4O7WA 4FYNA 2JDOA 4NH1A 4E7WA 5LVMA 3F5UA 2HIWA 3ORIA 3D5WA 3I60A 4EC9A 1ATPE 5HIEA 2J0IA 4BDFA 1WZYA 3BGPA 2XKEA 3DDQA 5DMZA 3UTOA 4QMXA 3NIZA 4A9RA 3QF9A 4ZZNA 4Y95A 2B55A 5CNOA 3E3PA 2FSLX 5DT4A 4GV1A 2XVDA 4YTFA 3UQFA 2X8IA 2OIBA 3COIA 3ZC6A 2QI8A 1OMWA 2P55A 3MY1A 2W1HA 4EORA 1WFCA 4MVFA 3K5VA 1PXMA 4FKGA 2YWVA 1Q62A 1X8BA 4ZLYA 3MVMA 5GZ9A 3QLFA 3HV5A 3Q53A 4FC0A 5I3OA 1W84A 1ZMUA 5HCXA 4M66A 1VR2A 5E9EA 5E7RA 3O23A 5JQ5A 4RG0A 4F7LA 1PMEA 2JKMA 3HMOA 4JJRA 3UOLA 1BI7A 2B1PA 3HYHA 5F95A 3LJ1A 3FMEA 4PMMA 1PXLA 2XKDA 5D12A 2PK9A 3U4UA 2SRCA 3NUAA 2GCDA 3QUPA 3ATSA 2OO8X 4YLLA 4XMOA 4YJOA 5HG8A 3FBVA 4FK6A 4HZSA 3F3WA 3P86A 4CCUA 4FX3A 2OZAA 3KMMA 2BIYA 2GNJA 2OH4A 3KU2A 2YLEA 5CWZA 5A3XA 3T3UA 3RAIA 1JBPE 3E8NA 4AXAA 1Z9XA 4I6BA 2ZOQA 4X3FC 3K3JA 4MAOA 3TJDA 4BIBA 3F5PA 3QD3A 3DLZA 3V5TA 3Q9ZA 3HZTA 4IH8A 5DR2A 4DEIA 2BRNA 3GFEA 3QXPA 4FT3A 4F6UA 4RMZA 3UZRA 4IHPA 3EFLA 4DHFA 2PVLA 4N57A 4XP2A 5HQ0A 3OW3A 5FG8A 4NJDA 1W83A 4KS8A 1Y8GA 4I21A 4CFFA 4ZTMA 5HU3A 3LM0A 4X2JA 5HBEA 3VBYA 2C5NA 1H8FA 2QU5A 4C0TA 4FSUA 2OU7A 2A0CX 4BZDA 3Q3BA 1IRKA 2V7AA 3ODZX 3DBDA 4ITIA 5EOBA 4ALWA 4FT5A 3R28A 3A7HA 3P1AA 1XH4A 4CQEA 1XH5A 2UW8A 1K2PA 3QTXA 2PZ5A 2WNTA 3C4WA 4XV3A 2IZSA 1CDKA 4AT5A 5IEXA 3ZONA 2R3IA 1XHAA 5CSVA 4FV5A 4OAUC 2O5KA 3MJ2A 3LMIA 4JVGA 4U44A 4YPDA 2O3PA 3TV4A 3TDVA 2F57A 1UKIA 1Y6AA 5E8VA 3DFCB 5M08A 3BU5A 2VO7A 4RZVA 5AIRA 2R3LA 4UMQA 3R9NA 3COMA 3DS6A 1KE8A 5IA5A 2IVTA 3UGCA 3NCZA 4FE2A 3HP5A 4OTWA 4W4XA 4D4RA 2BMCA 5BYYA 3PSDA 2XKCA 4AF3A 3HAMA 1I09A 2OF4A 3ZLYA 2OLCA 2OICA 2H96A 4O0YA 2JDTA 3O7LD 2XCHA 2WMBA 3SOAA 2ZV7A 2DQ7X 4NEUA 4F7NA 3CKXA 4ZY4A 3L1SA 5E8UA 3R8MA 4AA0A 3D9VA 2XYUA 1OITA 3LFSA 4FSQA 4Y85A 4L53A 3S00A 4CG9A 3MV5A 4RVLA 3G9LX 2YM6A 2WTIA 3HMNA 2ETMA 3MTLA 2I0EA 3KEXA 3MVHA 5TKDA 3MI9A 3DDPA 3ZEPA 3FZTA 2GQGA 1XO2B 2H9VA 2C3KA 2I0VA 3QRTA 3FC1X 4O0TA 1IEPA 5EM6A 3UYTA 4C7TA 5IH4A 4MCVA 4OBQA 4B4LA 2QONA 2XK6A 4XG4A 2HXLA 2WOTA 3ALNA 3KVWA 3OCBA 4QMPA 3VO3A 4PUZA 5HEZA 1PJKA 3NCGA 4G6OA 5L2SA 3LOKA 4QP3A 3SOCA 4DEDA 3LQ8A 2GNGA 4HPTE 4TWOA 4TNDA 4RRVA 2OI4X 4DBNA 4QP7A 2IZUA 2YACA 4DEAA 1EH4A 2QOOA 3LPBA 2CCHA 3LFDA 5EG3A 3H4JA 4QQTA 3JY9A 2OIDA 5E92A 5CLPA 3R7IA 5IA2A 4NK9A 4B8LA 1OIYA 3ANQA 2IW8A 5KHXA 1MQ4A 2YM3A 4O7LA 5E4HA 3I7CA 4TWPA 4FNWA 4EZ7A 3R6XA 1BYGA 1I44A 4YHJA 2XIRA 3ROYA 4ZTLA 2W99B 1NVRA 4KABA 3CQUA 1XWSA 2IZTA 3IONA 3R30A 4RQVA 3GGFA 3SDJA 2R3OA 3DBFA 3OWKA 4FTQA 3E3BX 5CNNA 4MF0A 2ZM4A 5FD2A 5AV3A 2IWIA 3PXQA 2V55A 3SA0A 2W1ZA 3ZFMA 3PY1A 5T6KA 2XK7A 4EHGA 5H8GA 3QHRA 4TL0A 3HEGA 5DR6A 5CEMA 5DOSA 2X39A 3LZBA 5AEPA 3O50A 3VUIA 4JRVA 4AAAA 2ZV9A 4IXPA 1YDTE 4FTCA 4X6QC 4AFEA 2HELA 4BICA 4EKLA 3WZDA 3QGWA 4QTAA 3KF7A 4Z3VA 4BVUA 4DFXE 3B8QA 2ITWA 3BYMA 4CMOA 4G17A 3KXGA 3HRBA 1SZMA 4FV2A 5FP6A 4C58A 3EQHA 3EQRA 5FEQA 3F3VA 3I6UA 5K5NA 4O7SA 2Z8CA 2ZV2A 5CF5A 2CN8A 3NVMB 1IA9A 1DAYA 5IA1A 1RQQA 1YHWA 1OL6A 4G1WA 2PWLA 3I5ZA 4TYHA 4UWYA 4ASZA 5M4FA 2GTMA 3F3UA 3P7AA 1CSNA 2FSTX 4EWHA 1YXTA 5EYCA 4N4SA 3TIYA 1M17A 3B8RA 3MIAA 3V5WA 4WHZA 4FA2A 1H26A 3VBQA 3A60A 3BEAA 4XG9A 3NR9A 3W2QA 3W1FA 1Q3DA 3S3IA 1AQ1A 3FV8A 3TUDA 3WOWA 2R3MA 4M8TA 3ORTA 3WE8A 3WF9A 2WQEA 4C2VA 4YU2A 4W8DA 4KBKA 2XRWA 4KS7A 3QTIA 1H27A 3ZO1A 4U8ZA 5KMJA 5FEDA 3VS4A 2GS7A 4ZZMA 3CCNA 4LMUA 4EHZA 4AT4A 2QVSE 1KOAA 3CJGA 4FKTA 2BAJA 4FUYA 2XCKA 2O65A 4HCTA 4IX6A 3ZSHA 4ERKA 4EOPA 3OEZA 1MP8A 4IC8A 3PXRA 4AU8A 5J5SA 3A8XA 1FOTA 4XG2A 5C9CA 2C6KA 4FODA 5EDRA 4YBJA 2QHMA 4I1ZA 4J7BA 2WQMA 4L9IA 5HTBA 3N4UA 2OFVA 3NSZA 3PLSA 5BMMA 3VUGA 3P79A 1QCFA 1UWJA 3ZMMA 2WMRA 1JLUE 4BDKA 2X4ZA 3MESA 3FMLA 4XYFA 4G9RA 4TTHB 5AUWA 4C02A 2FVDA 5JZJA 3ZXTA 2BRBA 4USFA 4QP9A 3Q96A 3OF0A 2WGJA 4FV4A 5ETIA 1H0VA 4UN0C 5ANDA 4AN3A 4YNEA 4L44A 3TXOA 4GK4A 3O2MA 4WRGA 3DOGA 3O8UA 5D11A 3LCKA 5FEEA 3OS3A 3F3ZA 3PVBA 5CEIA 4WNPA 3KULA 4JG8A 2HK5A 1YWNA 1FQ1B 1SMHA 2VO3A 2WELA 4XG6A 4YP8A 5A4QA 5TE0A 4GT4A 1R0EA 1NXKA 2QD9A 4IAZA 3E92A 1JKTA 3QUDA 5B2MA 4D9TA 5I9ZA 4QTDA 4L42A 5DG5A 4E5WA 4BWKA 4GT3A 4PY1A 5KZIA 4EYMA 3OUKA 1Y91A 2IN6A 2ZYBA 2RFSA 3I5NA 1OB3A 3HV7A 3O0GA 4IZ5A 4BCMA 4C59A 2AYPA 2BUJA 3LVPA 3NAYA 3QQFA 5IZFA 3R1NA 2C5YA 1JKKA 3P0MA 3FY2A 3R7OA 4FKPA 4U81A 3UJGA 4V05A 4AGWA 2C5OA 1LP4A 2XRUA 5AUXA 4GK3A 4FSTA 3SV0A 2OFUA 4G6LA 3ZOSA 3ALOA 3QTWA 1JWHA 3TKUA 3UPZA 4C4FA 4RC2A 1YI4A 2YIWA 1WAKA 4Q2AA 4GU9A 4R3PA 3NPCA 4CV8A 4FV1A 2GFSA 4EK6A 4ZSJA 1FBNA 2E9OA 2J0MB 4L3JA 4F9CA 3UZTA 2UZWE 3D7TA 1SVHA 3PSBA 4JS8A 4IVCA 2VTTA 4R1VA 1S9JA 1YXXA 4C3RA 4U45A 2WAJA 1CM8A 4OBOA 4A7CA 1FPUA 3DY7A 2R3HA 5CSHA 4ZY6A 4MF1A 1MRYA 4F1MA 1S9IA 1Q5KA 3G2FA 2R7IA 4CNHA 1OIRA 3P7CA 3B2TA 3SXRA 3Q4UA 4ANMA 1U54B 2YJSA 4JR3A 3R01A 2C6MA 4LRMA 2ITXA 3KN6A 2Y8OA 4H58A 2UZBA 3DBCA 3MPMA 4JX3A 4O0WA 5HE1A 3EL7A 3EN9A 4XV2A 4DFLA 3PZHA 3ZSIA 2GPHA 3Q2JA 1H28A 3AT4A 2G15A 4EWQA 5I9YA 3MA6A 4XP0A 2RGPA 4NFNA 4ALUA 5K0XA 4TZRA 1DS5A 3MB7A 4X6RA 4O0UA 4EZ3A 4O7TA 3AC4A 5H8EA 3AC2A 4TYIA 2PHKA 2VO0A 4FEXA 4GJ2A 5KZ0A 5FUTA 2VTMA 2X7FA 2XNMA 4BI0A 2YIXA 4FKQA 3Q4ZA 4NUSA 3GFWA 4M12A 2VWXA 3W10A 3KXMA 4XCUA 4EOIA 3R7GA 5JGBA 3D83A 2E9PA 1PF8A 4M0ZA 2Z7QA 5AR5A 5J95A 3VS3A 2OIQA 3AC5A 4RBLA 5IF1A 3ORZA 3RHXA 5JQ8A 5J1VA 2VNYA 3HV6A 5K3YA 4PDOA 5FM2A 4B99A 3EQIA 4FG7A 2QO7A 2W1IA 4AN9A 3A2CA 4D58A 3E64A 4TY1A 4BZOA 3ULZA 2AUHA 3QUEA 2C5XA 4HGLA 4K18A 4F1OA 4DFUA 2UW3A 4O0SA 4RIYB 4CZYB 4MK0A 4EOJA
chains in the Genus database with same CATH superfamily
3GQLA 2W1FA 3GU4A 3FI4A 2PE2A 3HLLA 3PJCA 2YDIA 3SXSA 3E8CA 4JAIA 2Y6OA 1Z5MA 2I0YA 4DH1A 4UMUA 4I93A 4LGHA 3T9TA 3TYKA 3DZOA 3FLYA 3VBWA 4BDGA 2HZNA 4O27B 3PIZA 2GHMA 2BR1A 2BZJA 2X0QA 5HIDA 2VGPA 2VTHA 3C4EA 3VQHA 3ZBFA 4QT1A 4EOOA 4FI1A 3WIKA 5A46A 2Q0BA 2QKRA 4UZHA 3LCDA 4BCFA 2W4JA 4LV5A 5J79A 4YZNA 4GIIA 4CYJA 2XIXA 3PVUA 2OXYA 4C38A 4CG8A 2IVUA 1W2FA 3BYVA 3LFBA 4MH7A 5C01A 1R0PA 2JKOA 2YWPA 3QKLA 4U80A 2P4IA 2VN9A 2UZNA 4JR7A 2W96B 2E2BA 4ANNA 4BIEA 5CQUA 3FSFA 2B9JA 2OJ9A 4FT0A 3VRYA 4E6CA 5IQCA 5CAVA 4CKJA 3DJ6A 2BZHB 4S32A 3RPVA 2J90A 2QR8A 3ZLXA 1IASA 5E8YA 4WNKA 3IS5A 4HNFA 4N0SA 3FC2A 2G2FA 2GDOA 2BROA 5M09A 1YVJA 4IWOA 3EKKA 4OTDA 4X2KA 4A4OA 2W1GA 5GZAA 1U46A 1O6YA 2ZB0A 2XNGA 5KUPA 3ORLA 3E62A 5CU2A 4QO9A 3BV3A 5AUTA 3W0RA 3IGOA 5CI6A 1HOWA 2WTCA 4UXQA 3ZEWA 5D7AA 5E8XA 2QHNA 3FXXA 5CEQA 4QMWA 2IJMA 5CSPA 4J8NA 4BC6A 2W5AA 2JITA 4C34A 2VD5A 2Z02A 2YLFA 2QO9A 4EH9A 3AMAA 5KBRA 2PULA 5E8WA 2LAVA 5LXMA 4NFMA 4PNKA 1OVEA 1E1VA 4S33A 3NLBA 3UO5A 2VWVA 3EQDA 4E4NA 1PY5A 4RIXA 1YDSE 4O4FA 3E7OA 4QD6A 4HGTA 3TZ7A 5DIAA 4PQNA 2QNJA 3P5KA 2Z7RA 4W4WA 2G1TA 2C6DA 4A06A 3KA0A 5BUEA 3QWJA 4DA5A 2NO3A 2VO6A 3QFVA 4RA5A 4BRXA 5C26A 5BX0A 4FT9A 4LRJA 5IUHA 4X3FB 1L8TA 4FV0A 3ETAA 3PXYA 4NL0A 3Q32A 3CLYA 3R73A 3FLNC 3NZ0A 3GC7A 1UNLA 4JG6A 5HNBA 4MWHA 5JT2A 2JKKA 3HP2A 4P7EA 3U4WA 5EHLA 4YPSA 5IQGA 3GEQA 5HD4A 1RDQE 2OW3A 3EQGA 5AP5A 1M14A 2Y4PA 1IAJA 4NKSA 5IQAA 4WNOA 3E88A 5CQWA 4JMQA 4FGRA 4DCAA 3VNTA 3OTVA 4RVMA 3QRKA 2BTRA 4EK5A 5D41A 5KX8A 4LOOA 5HORA 3FMKA 2W0JA 5M53A 3LXKA 3LQ3A 2I40A 2UVYA 3ZS5A 5CASA 4XBRA 4WUNA 4QQJA 4Q5HA 5HIBA 4O4CA 2R3GA 5DEWA 4CT1A 3V01A 4E1ZA 1ZRZA 4P4CA 4XH6A 3VVHA 5CEKA 2XBAA 4UEUA 3W8LA 5HKMA 4RJ8A 2W9ZB 4IANA 5IA0A 3GI3A 1OIQA 5EK7A 3VULA 2JDVA 3U6IA 3TL8A 4J99A 4CFUA 2XP2A 4I6HA 4RJ3A 4L45A 3PPKA 4JBVA 3TKHA 4DFZE 4QP2A 1Q24A 3UNKA 2E9NA 5BYLA 3U8WA 2C3JA 4CTCA 3KK9A 5HNGA 3FZPA 4BI2A 2W5HA 3R8VA 4HGEA 3CPBA 3DFAA 2EU9A 4I92A 4TKSA 2QOLA 3O71A 3OG7A 4NM0A 4WG4A 2O63A 2R4BA 4BBMA 3R9OA 3ULIA 2NNWB 1PMUA 1R3CA 3F6XA 3WYYA 4AQCA 2C3IB 3EFWA 4NW6A 4EH4A 4MTAA 4D0XA 4NM3A 2W4OA 4E5BA 1QPCA 3PP1A 4EQCA 3DTCA 3FQHA 3SQQA 2XAMA 3O8PA 4PPBA 2VU3A 3ZZWA 4XS2A 4CT2A 3BHHA 3OFMA 1KV2A 2CGVA 4KBAA 4RQKA 5B0XA 3DAEA 4R77A 4OAVB 3ENMA 3SAYA 2Y6MA 5L2IA 4I4FA 2AQXA 4QMSA 4I0TA 1Q8UA 3BL9A 4D4YA 4E6QA 4JIAA 4C3PA 1B38A 2WU6A 5CZHA 3MTFA 1ZYJA 4NSTA 1ZOHA 3DXNA 3W2SA 4E93A 4UY9A 3MDYA 4JDIA 2IF8A 3JY0A 4LOPA 3TNQB 4KRCA 4FF8A 3M11A 5CS6A 3W2OA 3VS1A 4AE9A 3ZRKA 3EN6A 3LFQA 4I5PA 5AR8A 5J1WA 4S34A 2YDKA 2YAAA 2NRUA 4ASDA 4RX5A 3F2RA 2GQRA 3POZA 3QC4A 5L6OA 3O8TA 5IDPA 3FY0A 3HECA 3KC3A 2X81A 4IVBA 3R9RA 3FE3A 3ZUUA 2OJJA 3I6WA 2BDFA 3CKWA 2R5TA 4PWNA 4EH8A 4YR8A 4AXFA 3C50A 4JDHA 4QRCA 3D5VA 3TWJA 3NYNA 4RJ5A 3F82A 5FBNC 4E6AA 5A4CA 5ITAA 3TMOA 3RJCA 5C27A 4HVHA 4D4SA 5C4LA 4D5HA 5KMKA 4Q9ZA 4BF2A 4TN6A 5M4CA 2W4KA 4FL3A 1YXUA 4FKWA 2UZVA 3CD8A 1APME 4DLIA 5HD7A 3KVXA 3QD0A 2CGUA 4GS6A 1U5QA 2ZFYA 4NT4A 1E9HA 1G3NA 1JSVA 5L2TA 3VF8A 1SVGA 3E87A 5EDQA 2Z2WA 3G90X 4NTTA 2BAQA 4R8QA 4O86A 4UB7A 1BL6A 3QTSA 2X7GA 4BL1A 3S0OA 3TT0A 5CF8A 3FZ1A 1ZMWA 4PDSA 2BRMA 3QBNA 1GAGA 5GJDA 3KL8A 5M56A 5AP4A 3GENA 5IA3A 4IVDA 4YBKA 4FTUA 2B52A 3SRVA 3MBLA 5HG7A 3KMWA 4DG0E 3TIZA 5JRQA 3MH0A 4FL2A 2Y9QA 5LWNA 3GC8A 3A4PA 3GC0A 3CIKA 2VZ6A 5H9BA 2R0UA 4OBPA 4PL4A 3VHEA 1G8KA 3MVJA 3R8PA 3PJ2A 3R2BA 3MFUA 4AOTA 5A54A 4BWPA 1F5QA 4MNEA 1FVTA 3MFTA 5LOHA 5E91A 4DAWA 1PXOA 2BTSA 3UOKA 4BZNA 4HPUE 4MHAA 4CFMA 3D7ZA 4F0GA 2VTOA 5HE2A 5BYZA 4EH2A 4GVJA 2XALA 2VX1A 1GZOA 4BTMA 5CU4A 5DYJA 2JAVA 4YJQA 3VF9A 3TNIA 2EXEA 4EKKA 3IDBA 4FTIA 5FP5A 1MRUA 4RT7A 3W2PA 1RJBA 4FKJA 5CVGA 4JG7A 4MXXA 4FT7A 4QP1A 4GT5A 5B2KA 2JFLA 3PPJA 4BDBA 3ZTXA 4GKHA 3BQRA 2XB7A 4K8AA 2YHVA 2JKQA 4E4LA 4YJNA 5A9UA 2J50A 4DF3A 3Q60A 4QMVA 2QLQA 5LVPA 5LVOA 1J1BA 1XJDA 4ACCA 4L3PA 2ITOA 3OBJA 3JS2A 3ZDUA 3E7VA 4XRLA 3W2RA 5ACBC 4AFJA 3NIEA 4R1YA 3ZM9A 2V62A 2ZVAA 3HDMA 5AUVA 3FXWA 3W18A 3ATTA 2ETKA 4X2NA 2OH0E 3LXNA 4EYJA 2DS1A 3QC9A 5AAEA 1OUYA 2ZAZA 2EVAA 3L8SA 4BHZA 5GJFA 3QL8A 4NIFB 4BR3A 3BYSA 3QAME 4C36A 3MH1A 2EWAA 3R04A 1PYEA 3F61A 3VS0A 2PVKA 2VNWA 3TTJA 5IMXA 4EHEA 5DWRA 4NM7A 5DI1A 4D1XA 3FMNA 4C4IA 4PTEA 5JEBA 4A4LA 3F9NA 3CQWA 3KGAA 1WMKA 3LM5A 3JXWA 5BVNA 5BVDA 2BIKB 2ZM1A 4YSJA 2H6DA 3LCOA 4R7HA 1SYKA 2HWPA 1WBSA 3DT1A 3B2WA 2JDRA 4JBPA 4N6YA 2B9IA 5CENA 3RCDA 2J5EA 2OJFE 5HESA 5EW8A 3ROCA 1Q8WA 5L8KA 3C4XA 2QCSA 3UMWA 3EHAA 4F6SA 4XV9A 4B0GA 3KFAA 3BE9A 3C0IA 3FJQE 3NYVA 2PTKA 3VJOA 5I3RA 4KIKB 5KNJA 5HCZA 1PW2A 1WBTA 1JVPP 3P5JC 1NA7A 3RK5A 2ITNA 5EW9A 3TNHA 3O96A 2X4FA 4FSMA 1H01A 5D7VA 5I4NA 4BTJA 5AR4A 4UZDA 2DUVA 4IEBA 1HCLA 3DLSA 4PP9A 3IW8A 4I41A 4AGUA 2WPAA 4B9DA 4FIGA 4PPCA 3KXZA 3FUPA 1YOMA 4ZTHA 5ETCA 1WBWA 3IDCA 4MXZA 4BN1A 4A9TA 3W0SA 2VTSA 4ZLOA 5GINE 2J4ZA 1IG1A 5IQBA 4USEA 5KMOA 2PZYA 3U51A 3AT2A 3A7GA 3GNIB 2EB3A 5IEVA 3MFSA 2P3GX 3PG3A 4HNIA 5EFQA 3R1QA 4AUAA 4WBOA 5EI6A 2PUIA 4BDCA 4APCA 4O0XA 3BHYA 2XJ2A 4W9XA 3R1YA 4IC7A 4BKZA 4DTAA 4FUXA 4O22A 4R6VA 3PE1A 4D2WA 2ZM3A 2XK9A 3LFNA 5HNIX 4I5HA 2VV9A 3BV2A 2WTKC 1P14A 3DTWA 3S4QA 4MXOA 4K9YA 1OKYA 4AZEA 3MPTA 3ZO3A 5H2UA 2VWYA 3A7JA 4PMPA 4QNYA 1KE5A 2F9GA 4DH7A 3CJFA 4FTKA 4E6DA 3F88A 3CY2A 4MBLA 3UP7A 3WYXA 1J91A 3R63A 3Q52A 3TG1A 5IU2A 2QR7A 2YM4A 5AFVA 5EOLA 5T3QA 5CU0A 4LI5A 4IQ6A 4ZJIA 2YM7A 3KREA 3AKLA 3D5UA 3NYOA 4NW5A 4D1ZA 2BFYA 2Q0NA 3ODYX 4QPSA 4MXAA 5HCYA 2Y4IC 3OXZA 4FYOA 2QOHA 2VGOA 4PMTA 1PYXA 2JGZA 4W4YA 2VWUA 4MKCA 4U41A 2HY0A 4FKUA 2XIZA 1GY3A 3OCSA 3FSKA 3IW5A 4FSNA 4FZDB 4JAJA 2A4LA 4HCVA 4IW0A 4DEBA 2XK3A 4X2FA 5EHYA 2JIIA 2YCFA 1QPDA 1QMZA 4EUUA 3EN4A 5HBJA 5J8IA 3VN9A 4HVSA 2ITQA 4J53A 4W8EA 3L8PA 2W17A 2A98A 2XM9A 4Q5EA 4EK3A 4ENXA 2H34A 3EB0A 3OOMA 4JQ7A 4I23A 1M2QA 4IX4A 3RAWA 2VTLA 4OGRA 4MQ2A 2UW9A 3H3CA 5FXRA 4YJPA 2OKRA 3QTZA 3MWUA 1PXKA 2W1CA 3QQKA 2UW0A 2XIKA 3HNGA 4BDIA 2CN5A 1WBNA 3ORKA 4XV1A 2HY81 5AWMA 3LFFA 4HJOA 3R83A 3UC4A 2BAKA 4I20A 1T46A 3QQJA 3ORMA 1ZLTA 3I7BA 4KWPA 3FZOA 5DN3A 4DGNA 3KXHA 3BYUA 3LJ0A 4EH5A 4ORKA 2WFYA 1ZXEA 1OIUA 2WQNA 4H3BA 3FPMA 3VC4A 2YM8A 4G31A 4E3CA 1CTPE 4FIEA 4N6ZA 5FLFA 4NTSA 3ZSGA 4FZ7A 4QYYA 2FSMX 4XUFA 3ZDIA 4GG7A 4DC2A 5E8ZA 2IW6A 3FKNA 3Q4CA 3COHA 3LFEA 1XH6A 4AZVA 3COKA 5AP2A 3C4CA 3KIOC 1A06A 1TQMA 1P2AA 3AD5A 3BU6A 4TNBA 3EOCA 4OW8A 5ANEA 2PSQA 5F20A 1UKHA 5DGZA 1ZYLA 5CF4A 3ERKA 3BLAA 4EEVA 3GU7A 4DLJA 2ITPA 1KOBA 1OZ1A 3R02A 4GCJA 1GZKA 4KKHA 4Y8DA 4O7NA 3SKCA 3I1AA 3S1HA 1ZZLA 3FL5A 2XEYA 3PVGA 4CKIA 5KMNA 3SW7A 4HVGA 1ZYSA 4MNFA 3L9NA 1Q99A 4I22A 4M0YA 1JKSA 4QMOA 1OKZA 2R3PA 2X0PA 4TXCA 3RWQA 4YURA 1GNGA 1VJYA 3CPCA 2C30A 3MSSA 4FICA 1ZARA 4YZMA 5AMNA 4MEDA 4HCUA 2UVXA 4RFYA 1H08A 4FV3A 1PXPA 5AA8A 3EMGA 4MQ1A 4ALVA 2UW4A 4ZSGA 1JKLA 2JBPA 2ETRA 2YERA 2Y0AA 2W1EA 2WMSA 5BUIA 3CS9A 4TYJA 4V0GB 3PUFC 3RINA 4G3DA 1H1PA 1J7UA 2GSFA 5I9WA 3RAKA 4FZFB 4AW1A 4MXCA 4ZY5A 2I6LA 3ZM4A 4BB4A 5LVNA 3G15A 4QTEA 3OCGA 5ANOA 1WBOA 4DFNA 3GCPA 3VUHA 3AC8A 4WG3A 3CTHA 4KRDA 4O7ZA 4MWIA 2RFNA 1T45A 3BIZA 4M69A 3NW5A 2ITUA 2CSNA 4TWCA 4ANOA 4IWPA 4BFMA 1KWPA 5HVYA 4ZIMA 5IH5A 5LVLA 3KY2A 1NT2A 5BVOA 5G1XA 2HZIA 2XNNA 2WTWA 2VWBA 5JMSA 4R3RA 3ZZEA 2P2IA 3KRWA 1CKJA 1Z57A 3ZH8A 3BYOA 1RW8A 3ELJA 5ETFA 5CYIA 4E8AA 2PVMA 2CNQA 4PL3A 3K3IA 2HENA 3FKOA 4P5QA 3DAJA 4XG3A 5M44A 3OWPA 1FINA 4AT3A 4QMUA 2FB8A 1BI8A 4WNMA 4DE4A 1OL1A 3VUMA 2BHHA 3BHUA 1AD5A 4LQMA 1Q41A 5CU3A 3QA0A 2W06A 4YO6A 4O7YA 2WOUA 4O84A 1WVWA 2PVNA 4LDTA 3WI6A 2R0IA 5E1SA 2BZIB 3OZ6A 5LARA 4ACDA 2BHEA 2VUWA 3KRJA 3DQXA 5IH6A 3JUHA 4TRLA 4C8BA 4IWDA 4QQ5A 3R7UA 5CSXA 4CMUA 1Q61A 1W8CA 4OT6A 3BEGA 3DKFA 1KE7A 4DYMA 4M14A 4IJ9A 4OTFA 3LJ2A 5A4LA 5AR3A 4XNEA 5G6VA 3NX8A 4FKIA 5EKOA 3L9PA 3DPKA 3TI1A 1JAMA 4YTIA 5HHWA 4GIHA 3BPRA 3M2WA 3QKMA 4J96A 4IZAA 4A9UA 3ID6C 2GNIA 4EOQA 3R00A 3BRBA 3DAKA 3ZXZA 3DCVA 3QZGA 4QPAA 4LG4A 4EUTA 4YJVA 3PY3A 4Z16A 2XMYA 4D5KA 4IVAA 3QD2B 1WVYA 4RX8A 1OKVA 5IMEA 4DEGA 3BLHA 3C5UA 4D2SA 3C4ZA 3NW7A 4FKSA 2UVZA 2PVHA 3AGLA 3Q6UA 4LL5A 4RVKA 2R3JA 1STCE 4X0MA 5L6WL 1ND4A 3AD6A 3I4BA 2RG6A 2WMUA 3RPOA 4F9WA 1G8SA 2KULA 4IZYA 1UNGA 2Z7LA 3FYKX 2H8HA 3BHTA 5LMBA 1PHKA 1YHVA 4FTLA 4G34A 5AM7A 4M3QA 3CGOA 3PWDA 2XA4A 4IDTA 4YHFA 5F9EA 2VTJA 1W98A 2EB2A 4XP3A 5AX3A 3MY0A 4L52A 3FL4A 5IUGA 3LKMA 4CQGA 3N4TA 5DH3A 4K11A 4L43A 4ERWA 4CRLA 4K2RA 4ACMA 3GCSA 3QCXA 4U43A 5DVRA 2QC6A 1XH9A 3UNZA 1E1XA 3UVQA 4CVAA 4AAYA 1CMKE 2V7OA 3LMGA 5LWMA 5HGIA 3ORXA 3E8EA 3SXFA 3NS9A 3NWWA 3OY3A 5CALA 2QLUA 2RFEA 4HYUA 4BDJA 3LLAA 3QYZA 4DN5A 4BTKA 5M57A 3AKKA 4M13A 4RLLA 2AC3A 4J52A 4M97A 5FBOA 3VUTA 4L7SA 4CCBA 3D4QA 3ML1A 1G8JA 2R3NA 2B53A 3KCKA 4BDDA 4FV8A 2DWBA 3LCSA 4JNWA 1H24A 2PY3A 1TVOA 4S30A 5CY3A 1GIHA 4O83A 3DBEA 3FAAA 4EOLA 1KE9A 1R39A 4O96A 4RIWB 3D2KA 4O6LA 5HO7A 5DRBA 3H0ZA 4TPTA 5HX8A 2R2PA 3G9NA 4DEEA 4I3ZA 2QOCA 5JK3A 5DA3A 2Y7JA 1W2DA 2V22A 3QCQA 4F09A 3MA3A 3WE4A 4FNYA 5CSWA 3F69A 2YCSA 4DFBA 3FHRA 3AMYA 4PF4A 4YHTA 3FHIA 4WBBB 2JAMA 4AA4A 5BMSA 2WTJA 4OTGA 3CQEA 2BRHA 1LEWA 4YTHA 2PPQA 5ETAA 5HO6A 5LCKA 2J0KA 3FQEA 2A19B 3CY3A 2VTNA 2YN8A 1A9UA 4FTMA 4DTBA 4GH2A 4BCIA 2VX3A 5I9VA 5EQEA 1KSWA 4YJUA 4HYSA 1ZYDA 2CHLA 3ET7A 2A2AA 4BYIA 3BGQA 1HCKA 3D15A 1H00A 5HG5A 3Q9XA 1ZAOA 3TTIA 4GK2A 3QYWA 4WIHA 2J0JA 3IOKA 3LHJA 4G2FA 5DRDA 5AP1A 4DEHA 2C5VA 4UALA 2P33A 3K54A 4XG7A 4WUAA 4C37A 3L9MA 4D28A 4A9YA 3UDTA 3PJ3A 4MBJA 4XLIA 3OOGA 2Q83A 4PTGA 3GC9A 4IX5A 5EYMA 2BRGA 3CSVA 4Q9SA 4ARKA 2GS2A 1GZ8A 1M7NA 3ZCLA 2YA9A 5EM7A 4YZBA 1REKA 2IZRA 3NUUA 4P5ZA 4F9BA 2YIYA 4YUQA 3UQCA 2C1BA 3KQ7A 4X2GA 4RWKA 5A4EA 5EQYA 1YI6A 4IM2A 3EFJA 1CKIA 2YJRA 4N70A 4C57A 3UOJA 1XMMA 2QOKA 3RGFA 4WKQA 5JFSA 1V0BA 4D2PA 5E8TA 3T8OA 3OXTA 3QCSA 3R8LA 4GYGA 3BZ3A 4F7SA 4YC8A 4ZSEA 4AA5A 4APPA 2WEIA 2I1MA 5EM5A 3QX2A 2QURA 3FZRA 5IPJA 4U40A 4YO4A 3H0YA 4CD0A 3FMDA 4KIQA 5EYKA 5LQFA 4ID7A 4G3FA 3JPVA 2P0CA 1WCCA 4AXEA 5D10A 3ENHA 2PZIA 2VTAA 3RTPA 4LYNA 4DHIB 3EIDA 3OTUA 5FTQA 4EJ7A 3F2NA 4OR5A 4FEWA 4AW0A 2CNUA 4IM3A 5KHWA 5FDXA 4J97A 2X0OA 3Q2MA 5AV2A 5AV4A 1SNXA 3QTRA 4FTOA 4BCGA 2WIPA 5BQ0A 3RHKA 1NVQA 3F3TA 3QZIA 2OZAB 5K0KA 3FWQA 3IKAA 2JC6A 5H3QA 1GJOA 2QOIA 3PRFA 2XEZA 4J95A 4ASXA 1GOLA 1A48A 3V6RA 3EN7A 3F5GA 4W4VA 5A6NA 5TO8A 4AW5A 4FEQA 3OHTA 5DFPA 4F0FA 4FKVA 2QOBA 3EJ1A 4CFNA 2YIRA 4F1TA 3ZU7A 5JFWA 4L8MA 4C35A 4MUQA 2BZKB 3QALE 4XG8A 2WO6A 3GCUA 3MH3A 4RFMA 5C8NA 4ACHA 4NU1A 2NPQA 2B0QA 3P08A 5KBQA 4M84A 4Y73A 3V51A 4EI4A 4KUJA 5EQPA 3L8VA 3UO4A 4JL9A 3MIYA 5TF9A 4DGOA 3IQ7A 3S95A 2HYYA 1K3AA 3AQVA 4O2ZA 3RK9A 3PUPA 3ZYAA 5CAOA 3D94A 1KUTA 3PFYA 2WMVA 1V0OA 3OCTA 2WQBA 2OSCA 2VX0A 2YISA 2J0LA 3IG7A 3BQCA 3KXNA 3NYXA 4QMTA 3OY1A 3V5PA 4K1BA 2HZ0A 3AG9A 2X6EA 3PYYA 4G6NA 4C4JA 2BDJA 4IX3A 3AXWA 2GNHA 3IW7A 5CX9A 3CEKA 5H8BA 2GS6A 3QZHA 3QTUA 4FSZA 4PDPA 3LLTA 2GMXA 2XARA 3P78A 4ZTRA 3MYGA 4H1MA 3NRMA 5JGDA 3U6HA 3V04A 2IVVA 2C6EA 4P2KA 4RWJA 3UQGA 4DH3A 1XH7A 2A1AB 5LMKA 2ITYA 2YZAA 2ZMCA 4KKGA 3BWFA 2QU6A 5KKRC 1OM1A 4CKRA 4XBUA 4QOXA 3C9WA 3LXPA 3KN5A 2FUMA 5K4IA 3DK6A 2BKZA 4QMZA 2NYAA 5AUUA 3G33A 4ZS0A 1FGIA 4QP4A 4MD8E 3OVVA 1UU3A 5B7VA 3P7BA 4ENYA 3VRZA 3KF4A 4H39A 3H30A 2XF0A 3HUBA 3QRUA 3V8SA 3EL8A 2XYNA 3MN3A 1WVXA 1P5EA 2ZMDA 4BCOA 2ZDUA 2FA2A 2XANA 4AGCA 2C6OA 1ZY4A 2B9HA 1UA2A 5JN2A 4KINA 4PX6A 4LUEA 4YTCA 3TDWA 2YZLA 2WTKB 5L6PA 2BPMA 4NCTA 4TYEA 1ZYCA 4U6RA 3R71A 4UBAA 5EYDA 3U54A 5JGAA 5AX9A 1BKXA 4YC3A 4ANQA 4FJVA 2JDSA 3ANRA 3UC3A 2YFXA 3KXXA 3DBQA 5HE0A 1FMOE 3PFQA 4U3YA 5HTIA 3O5AA 4I0RA 4F65A 4GYIA 3HL7A 5HLWA 4FIIA 4G3GA 3UIMA 4E26A 2JD5A 2CKQA 5AR7A 3FLSA 4FGBA 1OPJA 1JOWB 3PA3A 3LE6A 3O7LB 2OXXA 3UZPA 3LCTA 4BCQA 2W1DA 4Y5QA 4UX9A 1J1CA 2EXMA 2Y4IB 4LRKA 2E9UA 2ONLA 1O6LA 5M55A 1H0WA 3FXZA 3C0HA 1F0QA 4QTBA 3GB2A 3VIDA 3WZEA 4QP6A 4D55A 2J7TA 2X7OA 4IB3A 4FIJA 4TT7A 4U7ZA 4Z9LA 2PMOX 3DGKA 4XRJA 3TEIA 3PG1A 4YNOA 4FTRA 4ZJVA 4L00A 2C0TA 3IOPA 4J8MA 3DNDA 4XJ0A 2OJGA 4GL9A 4I94A 5HOAA 1M52A 3NDMA 4K77A 1OECA 3RALA 4U3ZA 2RKUA 3MJ1A 3HV4A 3UP2A 3VS2A 4EBWA 4E73A 1W82A 3TZMA 2XIYA 3W0MA 2UZEA 4NYEA 2GTNA 3MY5A 4H3PA 3UG1A 1XQZA 3ZO2A 4DFYA 5KE0A 3NVKI 1H07A 5JSMA 3Q6WA 1H4LA 4CYIA 5IQDA 4JOAA 3EYHA 2OJIA 5EDPA 2CPKE 3EQBA 3EZRA 4EOKA 3DJ7A 3R2YA 2FSOX 4XX9A 5HLPA 1M7QA 3MS9A 4O82A 1Q8ZA 3LW0A 4RJ4A 4IAYA 5EM8A 5FXSA 2IPXA 1XKKA 3R7YA 3SHEA 5DPVA 1AGWA 4CGAA 3CTJA 4AN2A 1BUHA 4O7RA 2ACXA 3K2LA 4G3EA 4MXYA 4O4EA 4EOMA 5K4JA 5BVEA 5EI2A 4K6ZA 3BL7A 3SW4A 3VS5A 3IW4A 1SNUA 5DEYA 3SG9A 2PVYA 4RLKA 5AADA 3HMMA 3OD6X 4I6FA 2J6MA 4IWQA 1J3HA 1ZZ2A 1PXJA 2WQOA 1YWVA 3GOPA 1IA8A 4TYHB 4GSBA 4XHKB 4QYHA 3PSCA 4GVAA 4X3FA 3IW6A 1REJA 3UIBA 2VTPA 4WD5A 5FM3A 4O38A 5J87A 1J7IA 2HAKA 3O51A 3OEFX 3HKOA 5CAPA 3WILA 4ZAUA 3FLZA 3FZSA 2PMNX 4FSRA 4KBCA 3K5UA 3I0QA 3GOKA 4R3CA 2X8DA 1QL6A 4KD1A 5KMIA 5E1EA 2EXCX 4Y83A 3GBZA 3N9XA 1NVSA 4O21A 4QDVA 4QDEA 3BELA 3RM7A 4LGDA 4V01A 3BBTB 5K5XA 3CD3A 5CEPA 2CNVA 4AP7A 1L3RE 3R7EA 4HYHA 4FSYA 5HO8A 3U6JA 4E4XA 3KKVA 4A4XA 1UWHA 3ZRMA 3Q04A 3UE4A 2HW7A 2WTDA 4HVIA 2O0UA 2A27A 3MW1A 4ZZOA 3V5LA 3QU0A 4UXLA 1OUKA 4ASEA 4I4EA 1XBAA 3CC6A 4I0SA 4YJRA 4Z7HA 3I79A 4M67A 5IQFA 4WOVA 4AOIA 2PL0A 1M2RA 4JI9A 5DT3A 4AACA 2FH9A 4C2WA 2EUFB 5GIPE 4KSQA 4QPMA 2C68A 1OPLA 5JRSA 2UZOA 4IFGA 3R9DA 2WMTA 3GCQA 4IE9A 4C61A 3QZFA 5BVFA 4O0RA 3C5IA 4NKAA 4IFCA 3DB8A 1U59A 4UYAA 4WRSA 2CMWA 3C1XA 4FZAB 4HW7A 3HMIA 3TV6A 4FEVA 5I0BA 3HDNA 4S2ZA 3UPXA 5ICPA 3T3VA 4AG8A 3DXPA 4DH5A 3EQFA 4B6LA 4D9UA 4PTCA 3VAPA 4E5AX 4O7VA 3LFAA 3EWHA 4V04A 3A99A 1JSTA 3KULB 4FTJA 3L9LA 4GMYA 3VS6A 2WTVA 3I0OA 4GJ3A 4D2TA 2F49A