2BIYA

Structure of pdk1-s241a mutant kinase domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANAFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Role of T-loop phosphorylation in PDK1 activation, stability, and substrate binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 287
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2biyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2biyA01
3P78A 4WUAA 2XK7A 4BBFA 5DLSA 4EZ3A 4IXPA 5CEOA 4GFMA 5K3YA 2ZV2A 1FVTA 3ZLWA 3MESA 2UW8A 2F7EE 3HAMA 1Q62A 1UNHA 1VYWA 3ZFYA 2V7OA 3GB2A 5J1WA 1SNXA 4C62A 2WTIA 2XK3A 3EQFA 4G31A 4I41A 4P5ZA 3ZM4A 1O6KA 5A6OA 5I9VA 2PZRA 5E8YA 3RK7A 3F3ZA 5E8TA 4AU8A 1IG1A 2HY0A 2OKRA 5B0XA 3NUUA 3SDJA 3S0OA 1E9HA 4MNEA 3G2FA 4FT5A 4FZDB 3WOWA 5KMIA 1URCA 4HVGA 3E7OA 2GS6A 3E5AA 3NUNA 3DK7A 4M97A 5DT4A 2R0UA 3GC9A 3OF0A 3KXNA 4IAKA 5HIDA 3ZMMA 4CVAA 4YU2A 4O0SA 3ATTA 4DT9A 4FI1A 3VBVA 3WIKA 4P4CA 5CF5A 1BLXA 3DXPA 3E8NA 2BIKB 4O84A 4F70A 5ETIA 3ZLSA 4IWDA 2XK8A 4J99A 3P7BA 4EK5A 3QQKA 1H1PA 3NUXA 4B9DA 5KO1A 3D0EA 4AXAA 3G6GA 3UIMA 5IEVA 4O0YA 4KKGA 4AZFA 5FP5A 3L9LA 3ZXTA 3VO3A 4GS6A 1TVOA 4XX9A 5HG7A 4EHZA 3LLAA 3RWPA 1OKYA 4OTHA 3FMMA 3U6JA 4WKQA 3C4CA 4L67A 4U5JA 2WMUA 5CENA 3QUPA 4AZWA 4V01A 4DEBA 1DAWA 3UVQA 3ZC5A 1XH7A 2C69A 2YABA 1YHVA 5T68A 2BAJA 5IQDA 2OXDA 5TKDA 3HVCA 2PUUA 3ORKA 3H4JA 4PL4A 4BZDA 3A7IA 3CEKA 4EH2A 5I5ZA 4EHEA 3NW7A 4RX7A 5CVGA 5IA1A 2YITA 4ZJIA 3SW4A 3D7ZA 4FL3A 4G2FA 1QPCA 4F6SA 3BQCA 4R1VA 4MQ1A 4O21A 5HBHA 1E1VA 3RK5A 3JPVA 4ANMA 1P4FA 3QTIA 4FG9A 3FLWA 5CANA 2YM8A 3NUPA 4DGOA 4HW7A 5CF8A 2BZHB 5EI8A 4OTIA 4ZSLA 3NYNA 3OTUA 5HE2A 2AC5A 2QNJA 4UZHA 3ZRMA 5BPYA 2PK9A 3AD6A 1Y8GA 2WAJA 3QWKA 4JL9A 3QQJA 1FPUA 3QX2A 4MX9A 4O1PA 4AT5A 1M2QA 4AP7A 3E93A 3D2KA 2YCQA 4FKIA 3U8WA 3JY9A 3O0GA 2W7XA 4FA2A 2VUWA 2W1HA 3IKAA 4CFVA 3R1QA 4TNBA 4EOQA 4GUBA 5IUIA 4HZRA 2ITZA 1OECA 2JGZA 2V55A 4FTMA 4RLLA 1FOTA 1ZWSA 5CXHA 4RLKA 5D11A 4HCVA 5EM6A 2B53A 4E6DA 2GHMA 3FZ1A 2WMBA 3Q9YA 4QYYA 5HLWA 3O23A 4OTGA 3I79A 3LCOA 2XRUA 3NS9A 2GS2A 5IEXA 5I9XA 5M4IA 2XZSA 4NT4A 4BCNA 3IW5A 4D0WA 2JDSA 4EH3A 4AE9A 3R1SA 1ZMVA 2XVDA 4ALUA 4MBLA 4QP3A 3GC8A 5L8LA 3DPKA 3E62A 3UPZA 5AAGA 3FMNA 3ET7A 5GINE 3FI2A 4H39A 4OT6A 1PY5A 5HG5A 1ZOGA 5HU3A 5EQEA 5JFXA 3ZXZA 4FTUA 1P14A 4D2TA 4EH7A 3FMLA 4O22A 2X8DA 4MHAA 4AZEA 3PYYA 3HNGA 2GFCA 3M2WA 3OW3A 3WYYA 4HNIA 2W06A 5K5NA 3NUAA 1M2PA 3FQEA 2OJ9A 1SVHA 3EN7A 5JFSA 4G3GA 2J5FA 4O81A 2CHLA 3E8EA 4GYIA 4RIYB 2YZAA 1CDKA 4R3PA 2Z02A 5CI6A 1URWA 5E9EA 1U54A 5CS6A 4TW9A 3KL8A 1ZYDA 3JY0A 4MF1A 4DE4A 2R3QA 2WTWA 4TYJA 4LYNA 3MY5A 5AR5A 3KREA 1PKDA 5GNKA 3PVBA 5EQYA 3HMIA 4L7SA 3JXWA 1YWRA 4QMOA 3H3CA 3DFAA 4AZTA 5M57A 2VTQA 2ZM1A 4I5CA 4R6VA 3TZ9A 5IUGA 4PNIA 4KS7A 4DTKA 3BU5A 2JKOA 3FMDA 2C0OA 2PZPA 4ZTRA 1UVRA 5CLPA 4WT6A 4BWXA 3TCPA 2BZIB 2IVUA 4M13A 3QQFA 4N0SA 4BGHA 4DFYA 2I40A 4DH3A 4C36A 3EN4A 3KFAA 5CEQA 5HOAA 1H26A 3HA8A 4R5YA 1XBAA 2XP2A 4F99A 2P33A 2VWZA 5E92A 1FQ1B 3UJGA 1F3MC 3V6SA 3UDBA 3EN9A 5C9CA 2ITVA 3BGQA 1BKXA 4CSVA 2G01A 2RFDA 5IDNA 4ZY5A 4PY1A 4R8QA 3KVXA 2ETKA 3WBLA 4AG8A 5EM5A 3ETAA 4ZOGA 4AW5A 4E5AX 5C4LA 4QRCA 3QRIA 2YAKA 4JI9A 5HTCA 5EK7A 4X6QC 5CEKA 4IAYA 4O7SA 4DGLC 4BWKA 1V0BA 4Y83A 2JDOA 3UPXA 4AGDA 4CZUA 3BI6A 3BU6A 2ERKA 4FNWA 4GIIA 1NXKA 2BPMA 4IZ5A 4QMWA 2BDFA 4L53A 4AN3A 5JFVA 2OIQA 4BDBA 3BKBA 4PPAA 4IJ9A 3MTFA 4ANOA 2ITYA 5E8SA 4EJ7A 3LVPA 4IVBA 4XG6A 4AOTA 4KSPA 4BDAA 3HMOA 3KULB 4WBBB 5EDRA 3CR0A 3QC9A 2QO7A 4ZJVA 2YFXA 4UYAA 3BIZA 2QOHA 3VS2A 5T3QA 3GU5A 3VUKA 2OZOA 3D15A 1K9AA 3AT3A 3PIXA 3ZYAA 4X21A 2HIWA 4IIRA 3GUBA 3ORZA 4KBKA 2GMXA 2QD9A 3OD6X 2YERA 2PE2A 2QCSA 3A4PA 4QYGA 3DBFA 4UWBA 3LIJA 5EHLA 1ZOEA 3BYUA 3Q4CA 4MYGA 2CLQA 4OBOA 5BVKA 4C57A 2CKQA 3GU7A 4O96A 3ENHA 1SMHA 3P79A 3P86A 4JR7A 4O0UA 2XIXA 1CKPA 2YIRA 4EOLA 1XJDA 4TL0A 2X1NA 3PY1A 4PP7A 4FKGA 3PZEA 3TM0A 2RFNA 3P1AA 3BYSA 3R0TA 5HNBA 3QCXA 4WNMA 4YLJA 3LLTA 3COHA 4JG6A 2QQ7A 3P23A 4RX8A 5C01A 2OH4A 3S1HA 4FICA 2P2IA 3PXRA 2BFXA 2YCFA 3BWJA 5L6WL 3FKOA 3HV4A 1S9JA 4CD0A 4BHNA 3HUBA 4E4XA 1Q97A 2QO9A 2R3FA 3HL7A 4GJ2A 4FV2A 4BF2A 4HVDA 4CQGA 3FC1X 4BN1A 4IE9A 3F5PA 3FLQA 4WNKA 4M69A 3QFVA 3LAUA 4S31A 5K5XA 3BLQA 2IVSA 3DBQA 2CJMA 3RAIA 4DG2E 1FBNA 3VAPA 4QTEA 4D9UA 2NRUA 3QGWA 1QPDA 4ITJA 4K33A 3OW4A 4R7IA 1FMOE 3H9OA 2OWBA 4KIKB 2VTIA 4A4XA 4WIHA 4DEDA 2J0KA 2YDIA 5CQUA 1GIHA 5DR6A 1OVEA 3BHTA 2OSCA 4AS0A 5L2SA 1BYGA 5HD7A 2VWIA 2IZUA 3GVUA 4YHJA 4APPA 5AEPA 3KA0A 1TQMA 4LL0A 1K2PA 3DLSA 1KE5A 3SRVB 3VJNA 2VWVA 4YSMA 3FXXA 3EQIA 4BR3A 3AGMA 4UX9A 3EL7A 3IO7A 4H36A 4HNFA 1KOAA 3PLSA 2VTPA 5J5TA 4DEAA 4PMPA 4UMPA 5CAQA 3W16A 2HZNA 4P2KA 1ZZ2A 2HYYA 5D7VA 4I22A 1LR4A 4FTQA 3R1YA 5LVNA 3DNEA 4CMTA 4YJOA 4WG4A 5JGAA 4IB0A 2BKKA 2RG5A 4IADA 3EN6A 4F08A 1FGIA 5AUVA 2W05A 2C6EA 4O38A 3LZBA 5GJGA 1J3HA 2W1CA 3FLSA 3VS5A 4XG4A 4BCQA 3PFQA 4AW0A 4AGCA 2UZNA 4UXLA 1IEPA 4QTAA 4YZMA 2W1IA 3EZVA 1XKKA 3DB8A 4FIIA 5LMKC 3ZHPC 1REKA 4FZAB 1YI6A 4O6LA 4AFEA 5KMLA 3U6IA 3HECA 2VTTA 5A4EA 4F63A 1KE9A 2W1GA 5C27A 3DAEA 3F5UA 4Y5QA 5M07A 1JSVA 3OOMA 3TZ8A 4DEIA 5M55A 3TKHA 4ZTLA 3KN5A 5LVPA 2XEZA 3L8PA 1IR3A 4UEUA 5HZNA 2PUNA 3UYSA 5JSMA 2XF0A 3MH2A 5C4KA 2IZTA 3EWHA 4KAOA 3BHHA 1RE8A 1A06A 2B4SB 3HLLA 3KXMA 3OCSA 3LW0A 4ACMA 3G90X 3N51A 5GZ8A 3KQ7A 2ZV7A 1AGWA 3MH1A 4KS8A 3EH9A 5E8WA 2GCDA 3O96A 3ODZX 5L3AA 3SA0A 3UMWA 5IEYA 4Y73A 5CVHA 5HO6A 4G9CA 3UIXA 4NCTC 4FTKA 1SYKA 3EQPA 4KIOA 3PRFA 2XBJA 4C35A 3WZDA 4RMZA 4YPSA 3OOGA 3QWJA 4EKKA 5C1QB 4RIOA 2C6TA 2R9SA 4AX8A 3PVGA 3DB6A 3WE8A 4FGRA 3BHVA 5DR2A 3V51A 3FQSA 4LRMA 2HZ4A 5HKMA 5IH4A 4E93A 3GCUA 3MTLA 2XKDA 4UZDA 1Q8UA 5DYJA 4PUZA 3FQHA 4YJUA 4XG2A 2OGVA 2UVXA 1PF8A 4CKJA 5D10A 4G6OA 2J0LA 4USFA 3D4QA 2OXYA 5KMOA 5CQWA 3OFMA 4IDTA 4CYIA 5F20A 5IA2A 4L00A 2FO0A 3HDMA 2YZLA 3JUHA 4JIKA 4PL5A 3ZFXA 4DEGA 4IVAA 4U6RA 4EEVA 3V8SA 2VWWA 3EQCA 4YC6A 3BU3A 3KF4A 2F7XE 5CZHA 3U4WA 3C4ZA 3C1XA 3KC3A 4CMUA 1OITA 3R73A 4QP8A 2FH9A 3UNJA 4AE6A 3SVVA 2R3MA 2UZTA 3U9CA 3D94A 3UG2A 4L9IA 1Y6BA 4JXFA 4JX7A 5J9LA 1A48A 4RVTA 3FKNA 3NWWA 5CU0A 1DAYA 1R78A 4WBOA 4O7LA 2WMQA 2VO6A 3B2TA 2J0MB 2UZLA 5KHWA 4QP9A 4FVPA 4L3JA 4XH6A 4TPTA 2O0UA 3LPBA 2H9VA 1HCKA 1XQZA 5ACBC 4C7TA 4DH7A 2X6DA 3CD3A 4AW1A 3F6XA 4D4SA 1BMKA 4FYNA 5BUJA 3ZEWA 3FMJA 3A60A 2JLDA 3UNZA 1STCE 2PVFA 5J7BA 3F2AA 4NM3A 4OTPA 2BKZA 4BI0A 3G0FA 2YM4A 3ZTXA 5K0XA 3G15A 5KX8A 2OJGA 4Z7HA 4IX6A 4K9YA 4NFMA 4Y72A 3VRZA 5C8NA 4QP2A 3OUNB 4K0YA 5FTOA 4U97A 2QOBA 3DAJA 3FSKA 4A4OA 4NKAA 2XCHA 3RHXA 3A8XA 3LKMA 3CQWA 3CD8A 2W17A 4KRDA 4TTHB 4ZTSA 3PXYA 3VULA 2XNBA 3FDNA 4ASZA 5FTQA 4EHGA 4YURA 3TKUA 5BVOA 3QTUA 4O0XA 4MTAA 5L6OA 3KN6A 3F3TA 4QPSA 2QHMA 1ZYCA 5I9UA 4GVAA 2ZVAA 2QHNA 1OM1A 4FTCA 5ETFA 4L3PA 4EK4A 2BZJA 2RSVA 1ZMWA 3NW6A 2CMWA 1GJOA 3POOA 4J8NA 2FA2A 4K2RA 3COMA 4I20A 4WD5A 4XG7A 3UC4A 1UNLA 3I0OA 3UVRA 2VTLA 1UWHA 2R3NA 5JT2A 4I1ZA 4FVQA 5DA3A 2WQOA 3QTXA 2BILB 3HGKA 4CFNA 3SV0A 3MWUA 3OXZA 5IUHA 5FD2A 4IACA 3SG8A 4CG8A 3Q6WA 3QQLA 2UW0A 3IW4A 4NTSA 3V5TA 2O65A 5ANIA 4RFZA 5JN2A 3W2PA 3W8QA 3OEFX 1Q3WA 3LFCA 3GC7A 3GXLA 3DTWA 4MKCA 4NIFB 5DEWA 1JSUA 5EI2A 4AQCA 5GZ9A 3RZFA 5AM7A 1KE7A 1DM2A 1XHAA 3Q32A 4JS8A 4R3RA 3AT2A 2B1PA 4YLKA 4BWPA 4R3CA 4MD8E 2BALA 3F69A 2UW3A 4FMQA 4DTAA 1YHSA 4C0TA 4M68A 3W55A 5BVWA 4FOCA 3R21A 4F09A 4ID7A 4JQ7A 3VBXA 5M08A 3Q2JA 5DBXA 2OIBA 3MJ2A 3BQRA 5L2QA 3KRJA 5AWMA 4EJNA 4I0TA 1CMKE 5HTIA 3U6HA 2FYSA 2BDWA 3M42A 3FPMA 2EU9A 5I9WA 4NM0A 3MW1A 1KOBA 4H3BA 1LP4A 1AD5A 5CAPA 2ESMA 4RT7A 2BROA 4JX3A 2ZB1A 4YP8A 4RC2A 3FI3A 4XV2A 3VHKA 2YCSA 5J79A 1IRKA 3K5VA 4KNBA 2ZMDA 4ZTMA 3DKCA 5AJQA 3O8PA 4BGGA 4ZZOA 3RWQA 2GSFA 3QXOA 3UOKA 4FC0A 3RGFA 3FMEA 4PPCA 2X39A 3Q2MA 3QTZA 3KXZA 4U3ZA 4FKVA 4BY9E 4C4JA 4IWPA 1YHWA 5FXQA 2R4BA 5CYIA 3RVGA 1BX6A 2Q0NA 3RPRA 3FEGA 1WBOA 3EQBA 5A4LA 3TV4A 4EQCA 1W98A 2VN9A 3FC2A 4KB8A 1WBPA 4B8LA 4UMRA 3IW6A 2BTRA 1WCCA 3SG9A 3PJ2A 4QMLA 4S2ZA 5AV2A 3O8UA 2X2MA 4YJPA 4B6LA 3ZFMA 1UU3A 5DHJA 4E5WA 1TQIA 5LWMA 4FEUA 4WUNA 5ETAA 4PX6A 2JD5A 2WMWA 4U45A 4LGHA 4BCOA 4GU9A 4NW5A 2OK1A 4RIWA 2XRWA 3PSDA 3V04A 3VBYA 4X3FA 4AGUA 1MRVA 3W33A 1XH9A 5AP7A 4KRCA 2WNTA 3R02A 4GKHA 5BYLA 2QOQA 3NZ0A 2E9NA 3GU8A 2C1BA 3ZSIA 2DWBA 4L42A 4RWKA 4OAUC 1H1SA 2R3LA 2J50A 3T8OA 4DG3E 4FEXA 5ANOA 1M17A 1OIRA 2XYNA 3AC1A 3BLHA 1PMUA 2C30A 3AC2A 3AMBA 3OMVA 2YISA 4QYEA 4DLIA 5I9YA 5J87A 4M14A 3CQUA 4FKUA 4D0XA 3P4KA 2E9UA 4MK0A 4GVJA 2WMRA 4N6ZA 3C0IA 2JC6A 4UXQA 3ZDIA 3GGFA 1XO2B 2UZWE 4OTWA 1Q24A 3IOPA 3MPMA 3ERKA 3PE2A 4BCPA 2GPHA 4NL0A 4BCHA 1OMWA 4H3QA 1XBCA 3BBTB 5A4QA 4DF3A 2PZIA 4ZIMA 5HBJA 4L44A 2RGPA 2XJ0A 4MH7A 4U40A 1W84A 5CAVA 3CJGA 3TI1A 4WOVA 1H4LA 2PUPA 3HMPA 4CGAA 2W5AA 5IA4A 4FT7A 3E88A 4GT3A 2QLUA 3HAVA 4EK3A 1ZYLA 4WA9A 3VUHA 5ANGA 5AUWA 4RFYA 4FV8A 2PVNA 4EYMA 3TUBA 4LV8A 2HZ0A 3KEXA 5KCVA 4FZ6A 3Q52A 3VF9A 5HU9A 2R64A 2X2KA 3OVVA 4XG3A 4KUJA 5AR7A 4B4LA 4C61A 2OXXA 2YM7A 4PL3A 5AP3A 3QCYA 4Q9ZA 3QKMA 3OTVA 1PYXA 3FSFA 3R1NA 2G15A 1H25A 2PVHA 4QP6A 5HG9A 3K5UA 3ZUVA 3O51A 4II5A 4ACDA 5AUZA 4EUTA 3HV3A 2KTYA 2ZB0A 5HBEA 4RGJA 4MQ2A 2O3PA 4X3JA 3GCVA 5HCZA 2WZJA 1P2AA 3PJ1A 1YI4A 2W9ZB 3KRRA 1YXVA 2XK4A 2Z7RA 3QLFA 2WQNA 3TACA 5IQEA 2UV2A 3NIEA 3PVUA 4O0WA 5AR4A 2YCRA 3FZTA 3FLNC 1YXSA 3PXKA 3PIZA 4EZ7A 3CS9A 3R22A 3R9HA 1NY3A 4XJ0A 3ZU7A 3ANRA 4MXZA 5E8VA 4EQMA 5LARA 3LCTA 3W2QA 3A4OX 3DJ6A 1LEZA 3CY3A 4I0RA 4PMTA 4F6WA 4AUAA 2J5EA 3BV3A 4N57A 3R9DA 4MXXA 3GCQA 4EI4A 2XH5A 3PPJA 3C50A 4ZLZA 2CGVA 2JBOA 2YIXA 1OPJA 1IA9A 4K8AA 3QQUA 1UNGA 3LJ1A 3Q60A 1BI7A 3R7EA 3VC4A 3W2SA 2JKKA 2W1EA 5BUEA 1JPAA 4ZY4A 3SGCA 3H9FA 3R9RA 1RQQA 2XKFA 3BHYA 4MXOA 4TYGA 3F3WA 3KMUA 4EH6A 2HOGA 3QF9A 2PMIA 4ENYA 2PL0A 4H3PA 1MUOA 3FJQE 4X2JA 3ZO2A 2RIOA 4UMQA 4AW2A 1ZOHA 4EONA 1Y91A 4CFWA 4BL1A 4G17A 3R8UA 3SLSA 3R28A 2YHVA 2FSMX 1G3NA 3Q9XA 4AOIA 1KE8A 3HP2A 4GT5A 4EOIA 4FTRA 4EK8A 1CSNA 3OY3A 3MPTA 5C03A 5HICA 1SVGA 3C0HA 4UMTA 3AD5A 5ANEA 4ARKA 5I4NA 4FL1A 2EB2A 5KBRA 3PP0A 3NYXA 2WOUA 4KBAA 1F0QA 3DS6A 3OCTA 1GNGA 4AT4A 1LEWA 5LWNA 3Q4TA 3ORIA 3R2YA 4YO6A 5FUTA 3JVRA 5H9BA 4FKSA 3OC1A 5DI1A 2IG7A 3QYWA 4FSQA 4GH2A 4E6AA 2C5NA 4Z9LA 4IZAA 3DK6A 4OBPA 4BGQA 4W4VA 3R8ZA 3MPAA 1APME 3AXWA 4D4VA 4LOOA 3ZO4A 5K4IA 3F2NA 4FV6A 3QXPA 1WBWA 5CEIA 2Z7QA 3BE2A 4YC8A 3CLYA 5DH3A 5AIKA 2OH0E 1BL6A 4KD1A 3RPYA 2O63A 3QD0A 4U41A 4BCJA 4OTDA 4B8MA 2BHHA 2HW6A 3LM0A 4RA5A 5T6KA 3ELJA 3NYOA 4BC6A 5L8KA 2GS7A 3LXKA 2Y9QA 3QU0A 4JBVA 1YVJA 4RWJA 5AA9A 1FVRA 3FZOA 3I0QA 4FSRA 1JVPP 5H8BA 4ZZNA 4I6FA 5B7VA 4J96A 4DCEA 2AC3A 2QO2A 4LG4A 3T9IA 5CU2A 2BRBA 4FKRA 3BWFA 4RVLA 2B9IA 5ITAA 4PTEA 4RZVA 2OJIA 4QO9A 3D5UA 5HNGA 5DVRA 4AT3A 4ZSAA 1HOWA 2F9GA 3D7TB 3HUCA 2C4GA 4FTLA 2VAGA 3PUPA 2Y4PA 1OL2A 3RM7A 4XOYA 3L9MA 4BDKA 3OWJA 4X2GA 3TKIA 4USDA 4D1XA 4PWNA 4ZXTA 2E9PA 4LGDA 3PA3A 4BCGA 2QODA 1H1RA 3OCGA 4MWIA 2VTOA 3MB7A 2R7IA 2VX0A 3ZO3A 4EH9A 4IAZA 4R7BA 1XWSA 3CGFA 2ZM3A 2UZBA 2ITOA 2R3OA 3BYVA 3VS3A 5E1SA 2OZAB 3KCKA 2IO6A 2WMSA 5HG8A 1XH5A 3E3PA 3GQIA 2ZYBA 3GCPA 4G3DA 2PU8A 3Q5ZA 4EC9A 3G9NA 4GFGA 5FXRA 3VVHA 3MFRA 4GRBA 2QONA 1O6YA 2WTKC 3P9JA 4GJ3A 3CKWA 4BFMA 4WNPA 4XYFA 3ZM9A 3LCSA 4FIHA 5AUYA 4BDJA 3DKFA 5GJDA 4C4HA 1KV1A 5DR9A 4CCUA 2OI4X 4A4LA 1YXUA 4EOOA 3ID6C 3CSVA 2X81A 4FNYA 3L8SA 3MGYA 5EYKA 3QZGA 3AC3A 5LMKA 4O7YA 1JNKA 2JFLA 2WMXA 1VR2A 3A99A 4L52A 3V6RA 3W10A 4XCUA 4FSUA 3HV6A 5AAEA 1XH8A 4XV3A 3NNUA 5CNOA 2QC6A 3H30A 3EJ1A 4FR4A 5CEMA 3DY7A 4FKOA 4CLJA 2X9EA 3UZTA 3COIA 4IB3A 3R9OA 3U4UA 2EXMA 3I6UA 2WTVA 4PRJA 4ANNA 4DAWA 4E3CA 4UV0A 3TXOA 4JDIA 5DN3A 3VW6A 1R39A 5AAFA 3O7LB 4ASEA 5DPVA 3S3IA 4DLJA 4FSZA 2BR1A 5L8JA 3NNVA 4D28A 4GK2A 3H9RA 4WG5A 3QRJA 4C38A 2I7QA 1WBNA 3NRMA 4XRLA 4ZTNA 4C3FA 4QTBA 5AP5A 3CTJA 3KVWA 4BDHA 2UVYA 3H0ZA 3PXQA 4C58A 5J5SA 4ZMEA 3IDBA 3QD4A 5TO8A 3A8WA 4O1OA 3VS4A 4I5PA 4QQCA 4DHFA 3CQEA 3QAME 1GAGA 2UZEA 4J8MA 4ANSA 4NK9A 2F2CB 4NSTA 4CTBA 4RG0A 4FSWA 4CEGA 4EOPA 2EWAA 1PHKA 1XR1A 2XM9A 3BYMA 3WF8A 1Q3DA 3WI6A 5I3OA 3TUDA 3RBWA 2C5XA 1GOLA 3R7OA 3V01A 4FG7A 4IM0A 3HMMA 4RIXA 2A2AA 5LXMA 1ZY5A 2CCHA 4FTOA 4IH8A 2HXLA 4M84A 4RX9A 1VEBA 3GFEA 2IW9A 3BGZA 3WILA 4I92A 1K3AA 4ZTQA 4XOZA 4LUDA 4D2RA 4YBKA 4L01A 3MJ1A 2W0JA 1TKIA 4CMOA 4R1YA 2REIA 5B2KA 2IJMA 1GZKA 4GIHA 4QPAA 3EFWA 3K54A 3UBDA 2YIWA 1R0EA 2BFYA 2ITWA 3AGLA 3ZCLA 4MWHA 4J7BA 3LCKA 3LQ8A 3NNWA 4CG9A 3NUYA 2YM3A 4FZ7A 4MXYA 1Q8TA 4WHZA 3OY1A 2XUUA 5AX9A 3UP2A 4DCAA 4QOXA 4MD9E 2X7GA 3QTQA 4YJVA 4EH4A 5HEZA 3DK3A 3O7LD 3A7HA 2P3GX 3BCEA 4RJ7A 5JK3A 4F7LA 5AUTA 2E9VA 3AC5A 3ZOSA 3TNPC 3UIUA 4M67A 3EYGA 4DGGA 5HNIX 2ACXA 2CLXA 3LFAA 3FL5A 3C5UA 3RAKA 2VNWA 4E7WA 3QC4A 4QMVA 2XIYA 1PXIA 3WIGA 3LXPA 4FKQA 4Z7GA 2R3RA 3LM5A 3POZA 2QOOA 5H8GA 3W2CA 1UU8A 3QTWA 3N4UA 5HQ0A 4KBCA 3HDNA 2ETMA 3NYVA 2JIVA 1NT2A 4CV8A 2BUJA 3FHRA 4I94A 2XNNA 3NAXA 4OTRA 5IKWA 3OHTA 4F1TA 2PY3A 5ANKA 3MVMA 2RFSA 3GEQA 3FMHA 5KHXA 4YJSA 2Y4IB 3E8CA 3GFWA 4DH1A 4JDJA 4FEWA 5K0KA 1YWNA 1MQ4A 3MV5A 4Y5HA 3MFTA 4QPMA 1REJA 4F65A 1NVQA 3TG1A 3NGAA 1NA7A 3I1AA 4I24A 5TOZA 2CGWA 2B52A 5CI7A 2ONLA 2P4IA 4HYIA 4ITIA 4A9TA 4O7NA 2WFYA 5HHWA 3ZBFA 2Y6OA 2WQMA 3QKKA 2XM8A 1I09A 2YIYA 2PZ5A 4BDFA 2YDJA 1JKKA 3LOKA 3QL8A 2WGJA 4QMMA 3B2WA 3CY2A 3TTIA 3ULIA 5FXSA 3MA6A 4QMQA 1MQBA 5E90A 1Y57A 1W83A 1X8BA 2EXEA 3WE4A 1M7NA 3QBNA 3FZRA 4FK3A 4XUFA 2XB7A 4FKJA 3HV7A 5C8KA 1U5QA 2B9HA 2YIQA 1W0XC 2WQBA 5J9ZA 5HGIA 2V22A 4O82A 1OI9A 3RM6A 2C3KA 3ORLA 3F66A 4AAAA 2XYUA 1WBSA 4ACHA 4BKZA 4D2WA 3FKLA 1PMNA 1M7QA 4JAJA 1KWPA 4AOJA 4QMPA 1OUYA 2JIIA 1R3CA 5B2MA 4IWQA 4NU1A 4NW6A 4FV4A 4IM2A 2CKOA 4RIWB 2HZIA 2XNMA 2VTMA 3IDPA 5AX3A 4YHFA 4RWIA 3VUMA 4D5KA 1ERKA 3HEGA 2JIUA 4XBUA 5A6NA 3DA6A 2XEYA 4RRVA 1JBPE 4YJNA 1J91A 2CCIA 2ITPA 5HVJA 2PMOX 2DS1A 3IGGA 4DFXE 4BKYA 5IH5A 4FIGA 1RDQE 2B0QA 3ACJA 1J1BA 1J1CA 3MA3A 4F1MA 2UW9A 3Q5IA 2QKWB 2R5TA 4AN9A 4ANBA 5M51A 3I6WA 2B9FA 2V7AA 4FL2A 1CKJA 5DT0A 4G6LA 2X9FA 4TT7A 4XHKB 4DH5A 3JS2A 1RW8A 1GZOA 4RPVA 5J8IA 4D5HA 3DQWA 4OR5A 1V0OA 3MYGA 4G6NA 4F9CA 4DBNA 1NVRA 4EK6A 2IWIA 4U44A 1WVWA 5KMMA 3ZUUA 1T46A 2BVAA 2XMYA 5FM2A 3TNIA 2GNHA 3BEGA 1V1KA 3VNTA 3V5WA 5DWRA 2R3JA 3LFQA 4G16A 5M06A 3ZRLA 2VO7A 3EQDA 2BRNA 4C4EA 1FMKA 1P5EA 3RI1A 4LOPA 3QX4A 2XNPA 4HYUA 4K11A 5KE0A 5KBQA 2WO6A 4M66A 1YOLA 2FSLX 3U87A 2J9MA 4LFIA 2VWXA 5TT7A 4TXCA 5FDPA 3OT8A 4L3LA 4F1OA 3I5NA 5JGDA 4M7IA 3PVWA 3FUPA 2XK6A 4E4NA 2X8EA 1UKIA 3TV7A 3MVJA 4Q2AA 3OXTA 3RAWA 1G5SA 2W5BA 3VBQA 3WYXA 5LQFA 4C4IA 5IPJA 3NX8A 2UW5A 2QOLA 3HRBA 4BDCA 5EW9A 3MSSA 4FT0A 1OGUA 2H6DA 3HV5A 1QMZA 2ITTA 2J90A 2NP8A 3BHUA 3R00A 4IFGA 4MCVA 4V05A 5CZIA 5CF4A 4ENXA 3FE3A 4G34A 2BRGA 2PVYA 2I0EA 4MBIA 5I9ZA 5IF1A 1SVEA 4IAAA 4YZ9A 4S34A 4OUCA 2VTSA 2CNUA 3BZ3A 5FGKA 4HJOA 2ITXA 5EQPA 2JFMA 2VTAA 4WRGA 3R63A 3RPOA 2BDJA 4A9RA 2VTJA 4E6QA 3UNKA 3PXZA 4JVGA 2QLQA 4W4XA 2C3JA 4DG0E 2ZV8A 4ZAUA 4GL9A 5EYDA 5H3QA 4E4LA 5DNRA 2CDZA 5K4JA 3I5ZA 4KINA 1JWHA 3FHIA 5CSHA 4OTFA 1L8TA 4Z16A 4M15A 3LQ3A 5DRDA 3QHWA 3SAYA 4AA0A 4JQEA 3FXZA 3QA0A 2BHEA 1JKLA 3GENA 4QP1A 1ATPE 4W4YA 4XP0A 3OP5A 4U79A 3L8VA 3V5LA 4D4YA 4C02A 5GZAA 5D41A 5A4CA 3EFLA 4XP3A 4MNEB 4BCKA 2EVAA 3HA6A 3RAHA 3FY2A 4RFMA 3I4BA 4X6RA 3R8PA 3MDYA 4XG9A 3M1SA 3UYTA 3GCSA 2FUMA 4IZ7A 4JBOA 3ORTA 3QQGA 4RJ3A 4L8MA 3B8RA 4RQVA 1WVYA 3AT4A 4L43A 3Q3BA 1CM8A 3QRTA 4K18A 4FKTA 2JAMA 4PP9A 3R01A 5A14A 5D1JA 2J2IB 2G2IA 2WTKB 3ODYX 5G1XA 3FZPA 3SOCA 1F5QA 2HENA 3IGOA 5M44A 3ZZWA 3AC4A 5IA0A 3BV2A 1O6LA 3IS5A 3M11A 2XKCA 3VW8A 4PMSA 1WBVA 3VUTA 4AA5A 2X4ZA 3OUKA 5IQAA 4K1BA 2CPKE 3UVPA 4PF4A 5CSVA 5CY3A 4S33A 2BCJA 2QG7A 3KULA 5DG5A 2R3GA 2UZVA 3EHAA 4AZVA 3VJOA 5HE1A 4QNYA 5JQ8A 4ZEGA 5IG1A 4IM3A 4FKPA 5AIRA 4BBMA 1CKIA 4F0IA 3WZUA 3F2RA 1YDTE 4F0GA 4HVIA 2HWPA 4O0RA 3UIBA 3W2RA 4FV0A 3NPCA 3OWKA 4NJDA 5BNJA 1Q41A 3NLBA 2F49A 3G5DA 4ZJJA 3SQQA 1ZAOA 2X0GA 4J97A 4HZSA 5DOSA 5EHOA 5KMJA 3LMGA 3O8TA 3ALOA 3P0MA 5E7RA 3GQLA 5BX0A 4QQTA 3IK3A 3UODA 4ZP5A 2OW3A 1W7HA 4OW8A 2EUFB 4ZSGA 1FINA 4U0IA 4AN2A 4HVHA 3SXRA 1Q8ZA 1QCFA 4BICA 2W99B 2J7TA 2V5QA 2YJRA 3B8QA 3DV3A 3PPZA 3QGYA 3TNWA 3ZDUA 3ZLYA 4CXAA 1MP8A 3FI8A 4BB4A 4F9AA 4CZTA 4IMYA 4O2PA 2X7OA 1RJBA 1YOMA 2X6EA 2ETRA 3F3UA 5G6VA 2VX3A 2CGUA 3DXQA 5IQFA 2WXVA 3RALA 4CCBA 1NVSA 1PXPA 3CP9A 5K9IA 2BIYA 4TN6A 4BIBA 3Q04A 4I6QA 3H10A 1O9UA 2YA9A 3TDVA 2ZJWA 2GU8A 3I81A 1XH6A 4U3YA 3EQHA 4QD6A 4FTNA 3W1FA 4ZLYA 4R7HA 3CGOA 1PXLA 4BIEA 4W9WA 4JG7A 4FSMA 4IAIA 2HELA 4J1RA 4GUEA 3SRVA 5AP1A 5EYCA 3F7WA 3PY3A 1GZNA 1QL6A 2HWOA 4ONAA 3ZSHA 4CNHA 3DDQA 3T3UA 2ZM4A 3WF5A 3AC8A 2QKRA 3MS9A 4RJ6A 5IDPA 5TE0A 3CXWA 2C6KA 4FK6A 4KKHA 5JZJA 1SM2A 3RMFA 2GTNA 3A7FA 3MFSA 3QA8A 4QP4A 3C4EA 3N4TA 1GIIA 3QCQA 4GV1A 3TWJA 1B6CB 1W8CA 2ITNA 4YO4A 5BVNA 1AQ1A 4LRJA 3ZEPA 3ZSGA 3DBCA 2C6LA 4R5SA 5ANDA 5HCXA 4APCA 1LPUA 3E3BX 3T9TA 4B99A 4BIDA 4YJQA 5CF6A 3N9XA 5AUUA 4I6BA 3DQXA 3RINA 3DDPA 4Y95A 4W9XA 3Q9ZA 3ITZA 2W1FA 3I7BA 4O6EA 4BI2A 3R8VA 4DFNA 2ZV9A 2UUEA 4LOQA 4FTIA 3FWQA 5CVFA 5IQBA 2C6OA 2GNGA 2HAKA 3AOXA 3NDMA 2JDTA 4IZYA 4TYEA 5D9HA 1PYEA 1U54B 5A3XA 4EOKA 5AFVA 1H1WA 1ZXEA 4G3CA 2G1TA 3O50A 4RVMA 3UQGA 4HGLA 3MY0A 4AFJA 4NFNA 4E73A 1EH4A 2WOTA 2VZ6A 2Y4IC 4BTMA 3FYKX 4E26A 2AYPA 2Z7LA 2IW6A 5JFWA 4HYSA 3HX4A 5L2IA 2DUVA 4DFBA 2PZYA 3TL8A 4FODA 4P5QA 4B0GA 3VS0A 1CTPE 2JAVA 5LCJA 2F2UA 1J7LA 2DYLA 3G33A 3GT8A 3EKKA 5FQDC 4MF0A 4UMUA 5AP6A 4GEOA 4OLIA 3IW7A 3UGCA 2ZOQA 5A54A 3FZSA 4YJTA 3HMNA 4YC3A 4YHTA 3R04A 3EFKA 3UMXA 5E8UA 3VHEA 3VUGA 4PV0A 2ITQA 4BTKA 4TWPA 4EBVA 2QOFA 3LHJA 3GI3A 4NWMA 2BAKA 1KE6A 4RJ5A 3G9LX 4FF8A 4N6YA 2G9XA 3MN3A 3DBEA 3C4WA 3NUSA 4PDSA 1UWJA 3OCBA 4C3RA 2YM5A 3MH3A 1VJYA 3VWAA 4AACA 4JNWA 4YMJA 3ZH8A 3ORPA 5DGZA 4EL9A 4P90A 5CASA 3NVKI 2J0IA 4FGBA 3QZIA 4IEBA 5LMBA 4DBXA 3R8MA 3KRXA 5BQ0A 3R30A 5GIPE 2UZOA 4UWYA 1OKZA 2W9FB 3OS3A 4TNDA 2UVZA 1Q99A 4EOMA 1H28A 2B54A 2BMCA 3PSBA 4TY1A 5HVKA 1IAJA 3EIDA 2PULA 4BDGA 2H96A 4JIAA 4V04A 3GP0A 3VS7A 4U42A 3BE9A 3TNHA 3LFNA 2WB8A 3P7AA 3TN8A 4RZWA 4X7QA 3TV6A 5AP2A 4F7SA 4PTGA 5JQ5A 3KY2A 3LJ2A 4X3FC 4P7EA 3IDCA 2O2UA 2RL5A 1JQHA 1PXMA 2QG5A 5IQGA 5CU4A 1OL7A 2OICA 1WFCA 1PXKA 4FKWA 4EKLA 1ZYJA 4O7WA 3G0EA 3EQGA 1UA2A 3ZUTA 3VRYA 3DLZA 2GQGA 4Q9SA 4LL5A 5GIOE 3NW5A 5HI2A 4ANLA 3NVMB 4O83A 1HCLA 1U59A 1WZYA 3MVLA 1OIUA 2ZDUA 4X0MA 3VF8A 5A9UA 3F88A 4FNXA 4BKJA 3SOAA 4G5JA 2BAQA 4WSYA 2BRHA 4AA4A 2XIKA 4FT3A 4TYHA 3UOLA 3JR1A 4D1SA 3G6HA 3SW7A 3IOKA 4YUQA 2PVLA 5ETCA 4DT8A 2OJFE 4L7FA 4TZRA 2OF4A 3HKOA 3L8XA 2QR8A 4TRLA 3TZ7A 2UZUE 3QLGA 4XG8A 3F5XA 4G3FA 4OGRA 1H8FA 4KWPA 4F9BA 1E1XA 4M69B 3I60A 2IW8A 2VV9A 2BTSA 2Y6MA 4RVKA 1J7IA 3F3VA 5L6PA 1Q5KA 2GHGA 3MH0A 4UALA 4DN5A 3LE6A 4O7ZA 4HCTA 4N70A 4I4FA 4J98A 4ZS0A 2RFEA 5M09A 2W5HA 5C8MA 3PJCA 3KK8A 5HO7A 4ORKA 4WRSA 4FTAA 4LQMA 3MBLA 4DFZE 2GQSA 4ZSJA 1NW1A 5KKRB 2J6MA 3QD2B 2DQ7X 4ZZMA 3D9VA 4FE2A 4D4RA 3WF9A 1ND4A 4QMYA 4YTFA 2PMLX 5EKNA 2GNIA 4EORA 3BLRA 4NYEA 2CN8A 2QOCA 3W18A 5I3RA 1JLUE 4BCMA 3TTJA 2B9JA 3DTCA 4MEDA 4RQKA 4UWCA 4YLLA 4YZBA 3R7UA 3VS6A 2VO0A 4QMUA 5IZFA 5CT7A 4CKIA 1JKTA 2V62A 4NIFA 4BDIA 4S30A 3PA5A 4C33A 5LVMA 2VWYA 3OBJA 3H0YA 3OEZA 2SRCA 3O71A 4EBWA 2QOIA 4F7JA 1H00A 2BZKB 4HGSA 2H34A 5J95A 1UU9A 1BL7A 4A7CA 3QZFA 2WIPA 4O0VA 3C4FA 2CKPA 4QYHA 4FSTA 3DT1A 4EUUA 5AUXA 1DI9A 3MB6A 4XP2A 3W2OA 3D14A 2KULA 3IQ7A 3VBTA 2FVDA 2PWLA 2C0TA 5JMSA 2PVJA 5EH0A 2HCKA 3DBDA 4LUEA 5DT3A 4ZTHA 3SXFA 4C59A 4O7RA 4M0ZA 5E8XA 4JDKA 4JOAA 4C2WA 4CRSA 2CGXA 4JQ8A 3QTRA 1OB3A 2G2HA 4C4FA 2J0JA 4IB5A 4A9SA 2PUIA 1J7UA 3ZO1A 2BRMA 5EW3A 4HVSA 5M4CA 3CE3A 3C7QA 3TIZA 1H1QA 4BCFA 2OG8A 3FPQA 3FY0A 5DIAA 2XNEA 2C68A 4L68A 4RC4A 4F0FA 1SNUA 4FV7A 3GOPA 5BMMA 4A9UA 3WZJA 2XKEA 1G8AA 3DOGA 4D55A 4V0GA 3PPKA 4E20A 4KIQA 4QTDA 4F7NA 2XIZA 3I7CA 3EN5A 3KKVA 4DC2A 3K3IA 2O8YA 5LOHA 2VGOA 2QU6A 5I0BA 3LXNA 2WIHA 3W32A 3RPVA 2VO3A 2I6LA 1BI8A 2XNOA 1VYZA 4BI1A 2ITUA 4CFXA 1LUFA 5EDPA 3VQHA 4DFLA 5EM8A 5FEDA 3NAYA 3W8LA 2C3IB 4U43A 3ORMA 3S95A 3CPCA 3DCVA 5M4FA 5IA3A 5HX6A 3F61A 3ROCA 4JT3A 2GNJA 1ZZLA 3D5VA 1L3RE 2JITA 3S00A 4ZS4A 2X2LA 4PPBA 3ZS5A 5CSPA 4G9RA 3P08A 4ERKA 2F7ZE 2O5KA 3R7YA 3TZMA 2PHKA 2WEVA 3Q4UA 4QYFA 3RNYA 2XCKA 2QR7A 5EFQA 2WU6A 5BVFA 3WZKA 4YZCA 4O0TA 2LGCA 2W4JA 3C9WA 4FOBA 4O27B 4BZNA 1UV5A 2VTHA 3QALE 4QMZA 3QKLA 4EC8A 3R71A 1T45A 2XIRA 3C5IA 2H8HA 2FB8A 3G51A 3V8WA 3K2LA 3VN9A 3QTSA 2ZDTA 3LFBA 4KSQA 4Y85A 3UZPA 4C8BA 2I0HA 2XS0A 4XMOA 3KRWA 3D83A 5L4QA 3MVHA 3NSZA 3FXWA 3CTQA 2VNYA 5IQHA 4BRXA 4OTQA 2WKMA 4QQ5A 4HPUE 3OWPA 4O7VA 4CV9A 2IPXA 2EB3A 4MBJA 4I5MA 4NZWB 3CTHA 3S2PA 1H01A 4UY9A 2WTDA 4NKSA 3DNDA 5ICPA 4LM5A 4G3EA 4PDOA 4LRKA 4ZK5A 2I0VA 3V5QA 4N4SA 4U81A 4FX3A 2HW7A 5EKOA 4IANA 3QQHA 4FBXA 2JEDA 3JVSA 4YTHA 3ANQA 3D5XA 3Q6UA 3TEIA 4HGTA 3IW8A 1Z57A 2IN6A 2AUHA 3RZBA 3VUIA 5EW8A 2OLCA 5AP0A 4O86A 4ERWA 1YI3A 5H8EA 3UOHA 4JJRA 4K6ZA 4EWQA 4PDPA 3CC6A 4MNFA 4IJPA 2NO3A 1ZARA 2NRYA 2W1DA 2VTRA 2WHBA 2Z60A 2QI8A 4C37A 5IQIA 4ALVA 1YOJA 3MY1A 3ZRKA 2UW7A 4IB1A 2WEIA 2F57A 2C47A 4NTTA 5CU3A 5CWZA 4CYJA 4DGNA 3C4XA 4PDYA 2UZDA 5DFPA 2XNGA 3KMWA 3R8LA 1IAHA 3PXFA 5A4TA 2R3HA 4UB7A 4FYOA 3QRKA 4TWNA 3P5KA 4MVFA 3RCJA 2UW6A 4QMXA 1H08A 3OZ6A 3LMHA 4UBAA 4I4EA 5FP6A 4ALWA 1YWVA 2R0IA 3UO4A 3OXIA 1OUKA 3L1SA 2J51A 4JR3A 5KZIA 3TUCA 4ZSEA 5AADA 3ALNA 3D2IA 3BELA 4DEHA 3TDWA 1WAKA 4AWIA 1YRPA 3SX9A 4ZY6A 3EQRA 4IC8A 4X2NA 4IC7A 5AMNA 2PE1A 5BYYA 3V3VA 5FLFA 4QMNA 4FV1A 1PXNA 5TF9A 4CTCA 1U46A 2Z7SA 2A0CX 4AZSA 4MXAA 4GK3A 3O17A 1OL1A 1PKGA 2I1MA 3E64A 3KXHA 3PWDA 5L2TA 3DZQA 5JRSA 1H24A 4E5BA 4TYIA 2HK5A 5GHVA 2HXQA 3QYZA 2NNWB 3K3JA 3QRUA 1KV2A 3UQFA 4KA3A 2Y0AA 4Z3VA 1UU7A 3LFEA 2VX1A 3SKCA 5LCKA 1YW2A 3F5GA 4AGWA 3AG9A 1B39A 3NR9A 3RK9A 3CCNA 3IECA 4G5PA 5EYMA 4USEA 5KZ0A 1IASA 1JSTA 2C5YA 3O2MA 4KIPA 4U80A 5AV4A 3COKA 3TNQB 4U8ZA 3DJ5A 3ORXA 3FV8A 1OL5A 3LCDA 4FT9A 4GG7A 4QP7A 4S32A 4C4GA 3DKOA 5FTGA 2GDOA 5CEPA 5AR8A 2PYWA 3QCSA 4NCTA 4OT5A 4BDDA 2YN8A 2UW4A 1YKRA 3D5WA 3R7IA 4A07A 4CFFA 3PDTA 4NUSA 4XBRA 2A27A 3Q96A 1KSWA 5E1EA 4YTIA 2WMVA 1TQPA 3ENMA 5ANJA 5IMEA 2WTJA 3KU2A 4IWOA 2EXCX 3VIDA 1PJKA 1OIYA 4UYNA 2O64A 4QMTA 5IA5A 2E9OA 1VZOA 3TIYA 4BYIA 4EYJA 2PSQA 3R2BA 5BVEA 3LFFA 2A4LA 3ROYA 4E1ZA 4RWLA 3OBGA 5AV1A 3FL4A 4EOSA 3FAAA 4U7ZA 5HX8A 3KRLA 3IPHA 4KABA 2JDVA 2C6IA 3F82A 3UOJA 4X3FB 1PRYA 4DFUA 2CKEA 3BGPA 2X8IA 1M52A 5LJJA 1I44A 5CSWA 5AV0A 4IX5A 2B7AA 3AQVA 5A46A 2JDRA 4OAVB 4YGAA 2YWVA 1U4DA 2C0IA 5CAOA 3DKGA 1SZMA 2IZSA 2WD1A 3BRBA 2W4OA 3D7TA 3F9NA 3SC1A 3UP7A 2Q0BA 2FGIA 4LI5A 2GHLA 4KKEA 5DEYA 4DINA 4UN0C 4GMYA 2GNLA 3RJCA 1JAMA 4M0YA 3V5PA 4GU6A 2YACA 4U9AA 3BEAA 4BVUA 3BBWA 3AD4A 4L6QA 2G2FA 1WBTA 4F64A 3KGAA 4I5HA 4NEUA 2C6MA 4FVRA 1Y8YA 2GFSA 5E91A 2OZAA 5EDQA 2Z8CA 4J95A 3Q53A 3QD3A 4I6HA 1W82A 4YJRA 4GT4A 3E87A 3PSCA 2CNQA 4ZMFA 5DE2A 3ATSA 4D2PA 3A7JA 4GFOA 3ACKA 4X2KA 2YLEA 5F1ZA 2ONLC 4FSYA 1U5RA 4E8AA 4TWCA 4CFMA 3NCZA 5KKRC 3MIYA 4NM5A 4PMMA 5HCYA 3T3VA 1OKWA 2IVVA 4XLVA 5CU6A 4ZLOA 1YXTA 4H1JA 4QQJA 4QT1A 2PVMA 3SD0A 4M3QA 3VUDA 2FSTX 3Q9WA 3RTPA 4FTTA 5HIBA 3E7VA 3S4QA 1R0PA 1ZY4A 3GU4A 3ZZEA 5FM3A 5AA8A 4RIYA 3UTOA 4ASXA 5FRIA 5C26A 5AP4A 3LXLA 3CJFA 4RBLA 1UKHA 3PRIA 2WQEA 3R6XA 3RPSA 4FUYA 2I0YA 2FSOX 4FEQA 3P7CA 2VRXA 3KK9A 3TT0A 2R3IA 2W1ZA 4JG8A 4NH1A 4FIJA 5EI6A 3BX5A 3C0GA 1OBDA 3VS1A 2YJSA 4FKLA 3KXGA 5D12A 4JLCA 2R7BA 4MAOA 5AM6A 4HGEA 5F9EA 4YR8A 4YTCA 5FWKK 1Q8WA 1Z5MA 2GNFA 3A2CA 3FLZA 4I23A 4ACGA 4LMUA 4CT2A 2XJ2A 3LMIA 4RC3A 2PPQA 3A61A 4K77A 1ZLTA 3OROA 2JKMA 3C13A 2R3KA 3HP5A 4FTJA 1GZ8A 4GSBA 3WZEA 1DI8A 4IDVA 5HORA 2P55A 2PVRA 3R9NA 3II5A 3U54A 3PG3A 3BYOA 2VWBA 3PA4A 5KMKA 4B7TA 3E92A 4YPDA 3LJ0A 4E6CA 3KB7A 3L9PA 1FVVA 4BTFA 4D9TA 4BTJA 4IBMA 3FMKA 3EFJA 4CT1A 1YDRE 3DFCB 4IW0A 4YNEA 4F6UA 3EYHA 2OFVA 2W4KA 4FV5A 2WTCA 5AR3A 3REPA 2A1AB 2C6DA 1MRUA 3UE4A 5JEBA 4Y46A 2VWUA 4R77A 3NMUF 4CLIA 2WELA 2YWPA 4WSQA 2PE0A 3EOCA 3RNIA 5HTBA 5KMNA 4JRNA 4IX4A 4TYHB 2E2BA 4Q5EA 1A9UA 4C34A 4I21A 5DMZA 3UO6A 3VBWA 5DRBA 4M8TA 5M4UA 4RX5A 2B55A 1V0PA 2C1AA 2JBPA 2PVKA 4I3ZA 3EL8A 2F4JA 4HYHA 4IHPA 4NM7A 4RA4A 2JKQA 3THBA 5CTPA 5EM7A 3Q4ZA 1OL6A 1ZMUA 3GBZA 5CSXA 5KNJA 3U51A 4BHZA 2QOKA 2XK9A 1XBBA 4JAIA 5J7HA 5IH6A 3IONA 2OIDA 2LAVA 4MXCA 1ZYSA 5EOBA 2C5VA 2ERZE 3SHEA 2YAAA 5FEEA 1H0WA 1PMEA 4J52A 2A19B 3CBLA 4XEYA 4XV9A 4EQUA 3NEWA 3OT3A 4R78A 1YQJA 2IVTA 2OFUA 3DZOA 3KXXA 4IVCA 4I93A 3GOKA 1PXOA 2GQRA 3KF7A 4H05A 5AV3A 1Z9XA 1H07A 2WPAA 2ZAZA 3PWYA 4Y8DA 4YZNA 4RJ8A 5CT0A 5B2LA 5IISA 3QUEA 2PMNX 4Q5HA 5FEQA 4D2VA 4QTCA 4DYMA 4PQNA 5FBOA 1OKVA 2X4FA 4JBQA 5FBNC 4PNKA 5L2WA 5LVOA 4XV1A 3DGKA 1GIJA 4YZDA 3AMAA 5CNNA 5CAUA 5M56A 3MFUA 4GCJA 4HCUA 5H2UA 4YSJA 4AF3A 3ORNA 3TJCA 4W8DA 5HESA 3A62A 4GYGA 5JRQA 1M2RA 4ITHA 5BUIA 2Y8OA 2VU3A 4RJ4A 2Y7JA 2J4ZA 4CZYB 4H1MA 3R7VA 3WF7A 5F95A 1Y6AA 4A06A 4FEVA 2VGPA 4FNZA 4XRJA 3R7GA 4YBJA 2WU7A 2YDKA 4HOKA 4IQ6A 3E8DA 4FSNA 3UC3A 3V5JA 1YXXA 4EH5A 5JZNA 1G8SA 1XH4A 3WF6A 3OG7A 3ZC6A 1JOWB 4KIKA 4O91A 5M53A 3RHKA 4D2SA 3ZONA 3A7GA 4F9YA 5HE0A 4W4WA 3EB0A 3UZRA 4BYJA 3RKBA 4GK4A 1IA8A 3NNXA 3PG1A 3PLAE 3LFDA 5HIEA 1OBGA 4M12A 2YEXA 1GY3A 1OPKA 4IAFA 1Q4LA 4GW8A 4W8EA 4ASDA 2P0CA 4FIEA 4DITA 5CXZA 3R83A 1S9IA 1ZRZA 2Z2WA 3RCDA 1YDSE 3GC0A 5KUPA 4EZ5A 3KCFA 5HD4A 3HZTA 4IX3A 1M14A 5GJFA 4YNOA 4C2VA 3MIAA 3CIKA 4XLIA 3PP1A 3PZHA 4EHVA 2GTMA 4EH8A 4H58A 3KMMA 4F4PA 3FYJX 5HE3A 3EMGA 2HY81 5EHYA 5EOLA 2XA4A 5JH6A 4CFUA 2CNVA 3N4VA 4J53A 3U55A 4BBEA 5D7AA 5HO8A 4DH8A 4DA5A 5BYZA 4V0GB 2CN5A 3NIZA 1Q8YA 5F94A 3UG1A 5IMXA 5CX9A 1JKSA 4DTBA 3SXSA 3QHRA 4OBQA 3WARA 4A9YA 4D58A 1R1WA 1PMVA 4JBPA 4JDHA 4TWOA 1QPJA 3FI4A 2W96B 4E4MA 4NJ3A 4L46A 4TKSA 3UO5A 1BUHA 3PY0A 3NCGA 3E63A 4O7TA 3GNIB 4FG8A 3FBVA 3IG7A 3OWLA 2C3LA 3EZRA 4BDEA 5BVDA 4FZFB 2Q83A 4DGMA 5FDXA 5F4NA 1PXJA 2P2HA 3ZLXA 4I0SA 4LGGA 5AR2A 3DAKA 3QZHA 4JRVA 3VQUA 3PJ8A 4O2ZA 2OJJA 2YLFA 2X7FA 2CSNA 3RP9A 3JYAA 2PTKA 3DJ7A 2XJ1A 3F7ZA 4WO5A 3PIYA 5ACKA 2C5OA 4BCIA 3EKNA 3L9NA 4IFCA 3ZBXA 3CKXA 3GU6A 4EWHA 5CALA 2IZRA 4CQEA 1FGKA 1OPLA 3DU8A 5HVYA 3DXNA 3ULZA 4WNOA 2V0DA 2ZMCA 1OIQA 4RSSA 2VTNA 1MRYA 2R3PA 1B38A 4FUXA 2WMTA 4ANQA 5IQCA 1H27A 3LFSA 4MD7E 4RIXB 2WMAA 4WG3A 4DEEA 3PJ3A 5HLPA 5JGBA 4EOJA 5IU2A 2QURA 2R2PA 2NPQA 4GG5A 5J1VA 4HPTE 3UQCA 4Z55A 4XS2A 1DS5A 5EG3A 3PE1A 2OO8X 3U9NA 3AMYA 4L45A 3V8TA 2QU5A 3MI9A 4F9WA 2OF2A 5TR6A 2RG6A 3HYHA 1WMKA 4LMNA 3TJDA 4D1ZA 3QUDA 5E4HA 2YM6A 5FG8A 2QVSE 2RF9A 4C3PA 5BMSA 4GKIA 4ACCA 5HLNA 2OBJA 4FV9A 4QMSA 4X2FA 2OU7A 2VD5A 1H0VA 5J9YA 4LV5A 4J71A 4CKRA 3HRCA 3C51A 1Q61A 1WVXA 4G1WA 5LVLA 4PTCA 4QNAA 5E8ZA 4BZOA 3BPRA 1QPEA 4FIFA 4IVDA 5LMAA 5JKGA 1OZ1A 3HRFA 4XNEA 4CRLA 1KUTA 3CPBA 4FV3A 3LQ5A 1PW2A 1P4OA 2XBAA 3FLYA 2RKUA 3PTGA
chains in the Genus database with same CATH superfamily
3P78A 4WUAA 2XK7A 4BBFA 5DLSA 4EZ3A 4IXPA 5CEOA 4GFMA 5K3YA 2ZV2A 1FVTA 3ZLWA 3MESA 2UW8A 2F7EE 3HAMA 1Q62A 1UNHA 1VYWA 3ZFYA 2XANA 2V7OA 3GB2A 5J1WA 1SNXA 4C62A 2WTIA 2XK3A 3EQFA 4G31A 4I41A 4P5ZA 3ZM4A 1O6KA 5A6OA 5I9VA 2PZRA 5E8YA 3RK7A 3F3ZA 5E8TA 4AU8A 1IG1A 2HY0A 2OKRA 5B0XA 3NUUA 3SDJA 3S0OA 1E9HA 4MNEA 3G2FA 4FT5A 4FZDB 3WOWA 5KMIA 4QDEA 1URCA 4HVGA 3E7OA 2GS6A 3E5AA 3NUNA 3DK7A 4M97A 5DT4A 2R0UA 3GC9A 3OF0A 3KXNA 4IAKA 5HIDA 3ZMMA 4CVAA 4YU2A 4O0SA 3ATTA 4DT9A 4FI1A 3VBVA 3WIKA 4P4CA 5CF5A 1BLXA 3DXPA 3E8NA 2BIKB 4O84A 4F70A 5ETIA 3ZLSA 4IWDA 2XK8A 4J99A 3P7BA 4EK5A 3QQKA 1H1PA 3NUXA 4B9DA 5KO1A 3D0EA 4AXAA 3G6GA 3UIMA 5IEVA 4O0YA 4KKGA 4AZFA 5FP5A 3L9LA 3ZXTA 3VO3A 4GS6A 1TVOA 4XX9A 5HG7A 4EHZA 3LLAA 3RWPA 1OKYA 4OTHA 3FMMA 3U6JA 4WKQA 3C4CA 4L67A 4U5JA 2WMUA 5CENA 3QUPA 4AZWA 4V01A 4DEBA 1DAWA 3UVQA 3ZC5A 1XH7A 2C69A 2YABA 1YHVA 5T68A 2BAJA 5IQDA 2OXDA 5TKDA 3HVCA 2PUUA 3ORKA 3H4JA 4PL4A 4BZDA 3A7IA 3CEKA 4EH2A 5I5ZA 4EHEA 3NW7A 4RX7A 5CVGA 5IA1A 4QDVA 2YITA 4ZJIA 3SW4A 3D7ZA 4FL3A 4G2FA 1QPCA 1G8KA 4F6SA 3BQCA 4R1VA 4MQ1A 4O21A 5HBHA 1E1VA 3RK5A 3JPVA 4ANMA 1P4FA 3QTIA 4FG9A 3FLWA 5CANA 2YM8A 3NUPA 4DGOA 4HW7A 5CF8A 2BZHB 5EI8A 4OTIA 4ZSLA 3NYNA 3OTUA 5HE2A 2AC5A 2QNJA 4UZHA 3ZRMA 5BPYA 5BV3A 2PK9A 3AD6A 1Y8GA 2WAJA 3QWKA 4JL9A 3QQJA 1FPUA 3QX2A 4MX9A 4O1PA 4AT5A 1M2QA 4AP7A 3E93A 2AEGA 3D2KA 2YCQA 4FKIA 3U8WA 3JY9A 3O0GA 2W7XA 4FA2A 2VUWA 2W1HA 3IKAA 4CFVA 3R1QA 4TNBA 4EOQA 4GUBA 5IUIA 4HZRA 2ITZA 1OECA 2JGZA 2V55A 4FTMA 4RLLA 1FOTA 1ZWSA 5CXHA 4RLKA 5D11A 4HCVA 5EM6A 2B53A 4E6DA 2GHMA 3FZ1A 2WMBA 3Q9YA 4QYYA 5HLWA 3O23A 4OTGA 3I79A 3LCOA 2XRUA 3NS9A 2GS2A 5IEXA 5I9XA 5M4IA 2XZSA 4NT4A 4BCNA 3IW5A 4D0WA 2JDSA 4EH3A 4AE9A 3R1SA 1ZMVA 2XVDA 4ALUA 4MBLA 4QP3A 3GC8A 5L8LA 3DPKA 3E62A 3UPZA 5AAGA 3FMNA 3ET7A 5GINE 3FI2A 4H39A 4OT6A 1PY5A 5HG5A 1ZOGA 5HU3A 5EQEA 5JFXA 3ZXZA 4FTUA 1P14A 4D2TA 4EH7A 3FMLA 4O22A 2X8DA 4MHAA 4AZEA 3PYYA 3HNGA 2GFCA 3M2WA 3OW3A 3WYYA 4HNIA 2W06A 5K5NA 3NUAA 1M2PA 3FQEA 2OJ9A 1SVHA 3EN7A 3W0OA 5JFSA 4G3GA 2J5FA 4O81A 2CHLA 3E8EA 4GYIA 4RIYB 2YZAA 1CDKA 4R3PA 2Z02A 5CI6A 1URWA 5E9EA 1U54A 5CS6A 4TW9A 3KL8A 1ZYDA 3JY0A 4MF1A 4DE4A 2R3QA 2WTWA 4TYJA 4LYNA 3MY5A 5AR5A 3KREA 1PKDA 5GNKA 3PVBA 5EQYA 3HMIA 4L7SA 3JXWA 1YWRA 4QMOA 3H3CA 3DFAA 4AZTA 5M57A 2VTQA 2ZM1A 4I5CA 4R6VA 3TZ9A 5IUGA 4PNIA 4KS7A 4DTKA 3BU5A 2JKOA 3FMDA 2C0OA 2PZPA 4ZTRA 1UVRA 5CLPA 4WT6A 4BWXA 3TCPA 2IVUA 2BZIB 4M13A 3QQFA 2IF8A 4N0SA 4BGHA 2I40A 4DFYA 4C36A 3EN4A 4DH3A 3KFAA 5CEQA 5HOAA 1H26A 3HA8A 4R5YA 1XBAA 2XP2A 4F99A 4AXEA 2P33A 2VWZA 5E92A 1FQ1B 3UJGA 1F3MC 3V6SA 3UDBA 3EN9A 5C9CA 3PFYA 2ITVA 3BGQA 1BKXA 4CSVA 2G01A 2RFDA 5IDNA 4ZY5A 4PY1A 4R8QA 3KVXA 2ETKA 3WBLA 4AG8A 5EM5A 3ETAA 4ZOGA 4AW5A 4E5AX 3TYKA 5C4LA 4QRCA 3QRIA 2YAKA 4JI9A 5HTCA 5EK7A 4FRFA 4X6QC 5CEKA 4IAYA 4O7SA 4DGLC 4BWKA 1V0BA 4Y83A 2JDOA 3UPXA 4AGDA 4CZUA 3BI6A 3BU6A 2ERKA 4FNWA 4GIIA 1NXKA 2BPMA 4IZ5A 4QMWA 2BDFA 4L53A 4AN3A 5JFVA 2OIQA 4BDBA 3BKBA 4PPAA 4IJ9A 3MTFA 4ANOA 2ITYA 5E8SA 4EJ7A 3LVPA 4IVBA 4XG6A 4AOTA 4KSPA 4BDAA 3HMOA 3KULB 4WBBB 5EDRA 3CR0A 3QC9A 2QO7A 4ZJVA 2YFXA 4UYAA 3BIZA 2QOHA 3VS2A 5T3QA 3GU5A 3VUKA 2OZOA 3D15A 1K9AA 3AT3A 3PIXA 3ZYAA 4X21A 2HIWA 4IIRA 3GUBA 3ORZA 4KBKA 2GMXA 2QD9A 3OD6X 2YERA 2PE2A 2QCSA 3A4PA 4QYGA 3DBFA 4UWBA 3LIJA 5EHLA 1ZOEA 3BYUA 3Q4CA 4MYGA 2CLQA 4OBOA 5BVKA 4C57A 2CKQA 3GU7A 4O96A 3ENHA 1SMHA 3P79A 3P86A 4JR7A 4O0UA 2XIXA 1CKPA 2YIRA 4EOLA 1XJDA 4TL0A 2X1NA 3PY1A 4PP7A 4FKGA 3PZEA 3TM0A 2RFNA 3P1AA 3BYSA 3R0TA 5HNBA 3QCXA 4WNMA 4YLJA 3LLTA 3COHA 4JG6A 2QQ7A 3P23A 4RX8A 5C01A 2OH4A 3S1HA 4FICA 2P2IA 3PXRA 2BFXA 2YCFA 3BWJA 5L6WL 3FKOA 3HV4A 1S9JA 4CD0A 4BHNA 3HUBA 4E4XA 1Q97A 2QO9A 2R3FA 3HL7A 4GJ2A 4FV2A 4BF2A 4HVDA 4CQGA 3FC1X 4BN1A 4IE9A 3F5PA 3FLQA 4WNKA 4AQKA 4M69A 3QFVA 3LAUA 4S31A 5K5XA 3BLQA 2IVSA 3DBQA 2CJMA 3RAIA 4DG2E 1FBNA 3VAPA 4QTEA 4D9UA 2NRUA 3QGWA 2XAOA 1QPDA 4ITJA 4K33A 3OW4A 4R7IA 1FMOE 3H9OA 2OWBA 4KIKB 2VTIA 4A4XA 4WIHA 4FJVA 4DEDA 2J0KA 2YDIA 5CQUA 1GIHA 5DR6A 1OVEA 3BHTA 2OSCA 4AS0A 5L2SA 1BYGA 5HD7A 2VWIA 2IZUA 3GVUA 4YHJA 4APPA 5AEPA 3KA0A 1TQMA 4LL0A 1K2PA 3DLSA 1KE5A 3SRVB 3VJNA 2VWVA 4YSMA 3FXXA 3EQIA 4BR3A 3AGMA 4UX9A 3EL7A 3IO7A 4H36A 4HNFA 1KOAA 3PLSA 2VTPA 5J5TA 4DEAA 4PMPA 4UMPA 5CAQA 3W16A 2HZNA 4P2KA 1ZZ2A 2HYYA 5D7VA 4I22A 1LR4A 4FTQA 3R1YA 5LVNA 3DNEA 4CMTA 4YJOA 4WG4A 5JGAA 4IB0A 2BKKA 2RG5A 4IADA 3EN6A 4F08A 1FGIA 5AUVA 2W05A 2C6EA 4O38A 3LZBA 5GJGA 1J3HA 2W1CA 3FLSA 3VS5A 4XG4A 4BCQA 3PFQA 4AW0A 4AGCA 2UZNA 4UXLA 1IEPA 4QTAA 4YZMA 2W1IA 3EZVA 1XKKA 3DB8A 4FIIA 5LMKC 3ZHPC 1REKA 4FZAB 1YI6A 4O6LA 4AFEA 5KMLA 3U6IA 3HECA 2VTTA 5A4EA 4F63A 1KE9A 2W1GA 5C27A 3DAEA 3F5UA 4Y5QA 5M07A 1JSVA 3OOMA 3TZ8A 4DEIA 5M55A 3TKHA 4ZTLA 3KN5A 5LVPA 2XEZA 3L8PA 1IR3A 4UEUA 5HZNA 2PUNA 3UYSA 5JSMA 2XF0A 3MH2A 5C4KA 2IZTA 3EWHA 4KAOA 3BHHA 1RE8A 1A06A 2B4SB 3HLLA 3KXMA 3OCSA 3LW0A 4ACMA 3G90X 3N51A 5GZ8A 3KQ7A 2ZV7A 1AGWA 3MH1A 4KS8A 3EH9A 5E8WA 2GCDA 3O96A 3ODZX 5L3AA 3SA0A 3UMWA 4QEBA 5IEYA 4Y73A 5CVHA 5HO6A 4G9CA 3UIXA 4NCTC 4FTKA 1SYKA 3EQPA 4KIOA 3PRFA 2XBJA 4C35A 3WZDA 4RMZA 4YPSA 4O4BB 3OOGA 3QWJA 4EKKA 5C1QB 4RIOA 2C6TA 2R9SA 4AX8A 3PVGA 3DB6A 3WE8A 4FGRA 3BHVA 5DR2A 3V51A 3FQSA 4LRMA 2HZ4A 5HKMA 5IH4A 4E93A 3GCUA 3MTLA 2XKDA 4UZDA 1Q8UA 5DYJA 4PUZA 3FQHA 4YJUA 4XG2A 2OGVA 2UVXA 1PF8A 4CKJA 5D10A 4G6OA 2J0LA 4USFA 3D4QA 2OXYA 5KMOA 5CQWA 3OFMA 3W0RA 4IDTA 4CYIA 5F20A 5IA2A 4L00A 2FO0A 3HDMA 2YZLA 3JUHA 4JIKA 4PL5A 3ZFXA 4DEGA 4IVAA 4U6RA 4EEVA 3V8SA 2VWWA 3EQCA 4YC6A 3BU3A 3KF4A 2F7XE 5CZHA 3U4WA 3C4ZA 3C1XA 3KC3A 4CMUA 1OITA 3R73A 4QP8A 2FH9A 3UNJA 4AE6A 3SVVA 2R3MA 2UZTA 3U9CA 3D94A 3UG2A 4L9IA 1Y6BA 4JXFA 4JX7A 5J9LA 1A48A 4RVTA 3FKNA 3NWWA 5CU0A 1DAYA 1R78A 4WBOA 4O7LA 2WMQA 2VO6A 3B2TA 2J0MB 2UZLA 5KHWA 4QP9A 4FVPA 4L3JA 4XH6A 4TPTA 2O0UA 3LPBA 2H9VA 1HCKA 1XQZA 5ACBC 4C7TA 4DH7A 2X6DA 3CD3A 4AW1A 3F6XA 4D4SA 1BMKA 4FYNA 5BUJA 3ZEWA 3NFGB 3FMJA 3A60A 2JLDA 3UNZA 1STCE 2PVFA 5J7BA 3F2AA 4NM3A 4OTPA 2BKZA 4BI0A 3G0FA 2YM4A 3ZTXA 5K0XA 3G15A 5KX8A 2OJGA 4Z7HA 4IX6A 4K9YA 4NFMA 4Y72A 3VRZA 5C8NA 4QP2A 3OUNB 4K0YA 5FTOA 4U97A 2QOBA 3DAJA 3FSKA 4A4OA 4NKAA 2XCHA 3RHXA 3A8XA 3LKMA 3CQWA 3CD8A 2W17A 4KRDA 4TTHB 4ZTSA 3PXYA 3VULA 2XNBA 3FDNA 4ASZA 5FTQA 4EHGA 4YURA 3TKUA 5BVOA 3QTUA 4O0XA 4MTAA 5L6OA 3KN6A 3F3TA 4QPSA 2QHMA 1ZYCA 5I9UA 4GVAA 2ZVAA 2QHNA 1OM1A 4FTCA 5ETFA 4L3PA 4EK4A 2BZJA 2RSVA 1ZMWA 3NW6A 2CMWA 1GJOA 3POOA 4J8NA 2FA2A 4K2RA 3COMA 4I20A 4WD5A 4XG7A 3UC4A 1UNLA 3I0OA 3UVRA 2VTLA 1UWHA 2R3NA 5JT2A 4I1ZA 4FVQA 5DA3A 2WQOA 3QTXA 2BILB 3HGKA 4CFNA 3SV0A 3MWUA 3OXZA 5IUHA 5FD2A 4IACA 3SG8A 4CG8A 3Q6WA 3QQLA 2UW0A 3IW4A 4NTSA 3V5TA 2O65A 5ANIA 4RFZA 5JN2A 3W2PA 3W8QA 3OEFX 1Q3WA 3LFCA 3GC7A 3GXLA 3DTWA 4MKCA 4NIFB 5DEWA 1JSUA 5EI2A 4AQCA 5GZ9A 3RZFA 5AM7A 1KE7A 2XARA 1DM2A 1XHAA 3Q32A 4JS8A 4R3RA 3AT2A 2B1PA 4YLKA 4BWPA 4R3CA 4MD8E 2BALA 3F69A 2UW3A 4FMQA 4DTAA 1YHSA 2NYAA 4C0TA 4M68A 3W55A 5BVWA 4FOCA 3R21A 4F09A 4ID7A 4JQ7A 3VBXA 5M08A 3Q2JA 5DBXA 2OIBA 3MJ2A 3BQRA 5L2QA 3KRJA 5AWMA 4EJNA 4I0TA 1CMKE 5HTIA 3U6HA 2FYSA 2BDWA 3M42A 3FPMA 2EU9A 5I9WA 4NM0A 3MW1A 1KOBA 4H3BA 1LP4A 1AD5A 5CAPA 2ESMA 4RT7A 2BROA 4JX3A 2ZB1A 4YP8A 4RC2A 3FI3A 4XV2A 3VHKA 2YCSA 5J79A 1IRKA 3K5VA 4KNBA 2ZMDA 4ZTMA 3DKCA 5AJQA 3O8PA 4BGGA 4ZZOA 3RWQA 2GSFA 3QXOA 3UOKA 4FC0A 3RGFA 3FMEA 4PPCA 2X39A 3Q2MA 3QTZA 3KXZA 4U3ZA 4FKVA 4BY9E 4C4JA 4IWPA 1YHWA 5FXQA 2R4BA 5CYIA 3RVGA 1BX6A 2Q0NA 3RPRA 3FEGA 1WBOA 3EQBA 5A4LA 3TV4A 4EQCA 1W98A 2VN9A 3FC2A 4KB8A 1WBPA 4B8LA 4UMRA 3IW6A 2BTRA 1WCCA 3SG9A 3PJ2A 4QMLA 4S2ZA 5AV2A 3O8UA 2X2MA 4YJPA 4B6LA 3ZFMA 1UU3A 5DHJA 4E5WA 1TQIA 5LWMA 4FEUA 2AQXA 4WUNA 4PX6A 5ETAA 2JD5A 2WMWA 4U45A 4LGHA 4BCOA 4GU9A 4NW5A 2OK1A 4RIWA 2XRWA 3PSDA 3V04A 3VBYA 4X3FA 4AGUA 4BJJA 1MRVA 3W33A 1XH9A 5AP7A 4KRCA 2WNTA 3R02A 4GKHA 5BYLA 2QOQA 2X0QA 3NZ0A 2E9NA 3GU8A 2ZFYA 2C1BA 3ZSIA 2DWBA 4L42A 4RWKA 4OAUC 1H1SA 2R3LA 2J50A 3T8OA 4DG3E 4FEXA 5ANOA 1M17A 1OIRA 2XYNA 3AC1A 3BLHA 1PMUA 2C30A 3AC2A 3AMBA 3OMVA 2YISA 4QYEA 4DLIA 5I9YA 5J87A 4M14A 3CQUA 4FKUA 4D0XA 3P4KA 2E9UA 4MK0A 4GVJA 2WMRA 4N6ZA 3C0IA 2JC6A 4UXQA 3ZDIA 3GGFA 1XO2B 2UZWE 4OTWA 1Q24A 3IOPA 3MPMA 3ERKA 3PE2A 4BCPA 2GPHA 4NL0A 4BCHA 1OMWA 4H3QA 1XBCA 3BBTB 5A4QA 4DF3A 2PZIA 4ZIMA 5HBJA 4MUQA 4L44A 2RGPA 2XJ0A 4MH7A 4U40A 1W84A 5CAVA 3CJGA 3TI1A 4WOVA 1H4LA 2PUPA 3HMPA 4CGAA 2W5AA 5IA4A 4FT7A 3E88A 4GT3A 2QLUA 3HAVA 4EK3A 1ZYLA 4WA9A 3VUHA 5ANGA 5AUWA 4RFYA 4FV8A 2PVNA 3W0PA 4EYMA 3TUBA 4LV8A 2HZ0A 3KEXA 5KCVA 4FZ6A 3Q52A 3VF9A 5HU9A 2R64A 2X2KA 3OVVA 4XG3A 4KUJA 5AR7A 4B4LA 4C61A 2OXXA 2YM7A 4PL3A 5AP3A 3QCYA 4Q9ZA 3QKMA 3OTVA 1PYXA 3FSFA 3R1NA 2G15A 1H25A 2PVHA 4QP6A 5HG9A 3K5UA 3ZUVA 3O51A 4II5A 4ACDA 5AUZA 4EUTA 3HV3A 2KTYA 2ZB0A 5HBEA 4RGJA 4MQ2A 3W0NA 2O3PA 4X3JA 3GCVA 5HCZA 2WZJA 1P2AA 3PJ1A 1YI4A 2W9ZB 3KRRA 1YXVA 2XK4A 2Z7RA 3QLFA 2WQNA 3TACA 5IQEA 2UV2A 3NIEA 3PVUA 4O0WA 5AR4A 2YCRA 3FZTA 3FLNC 1YXSA 3PXKA 3PIZA 4EZ7A 3CS9A 3R22A 3R9HA 1NY3A 4XJ0A 3ZU7A 3ANRA 4MXZA 5E8VA 4EQMA 5LARA 1W2CA 3LCTA 3W2QA 3A4OX 3DJ6A 4DHJA 1LEZA 3CY3A 4I0RA 4PMTA 4F6WA 4AUAA 2J5EA 3BV3A 4N57A 3R9DA 4MXXA 3GCQA 4EI4A 2XH5A 3PPJA 3C50A 4ZLZA 2CGVA 2JBOA 2YIXA 1OPJA 1IA9A 4K8AA 3QQUA 1UNGA 3LJ1A 3Q60A 1BI7A 3R7EA 3VC4A 3W2SA 2JKKA 2W1EA 5BUEA 1JPAA 4ZY4A 3SGCA 3H9FA 3R9RA 1RQQA 2XKFA 3BHYA 4MXOA 4TYGA 3F3WA 3KMUA 4EH6A 2HOGA 3QF9A 2PMIA 4ENYA 2PL0A 4H3PA 1MUOA 3FJQE 4X2JA 3ZO2A 2RIOA 4UMQA 4AW2A 1ZOHA 4EONA 1Y91A 4CFWA 4BL1A 4G17A 3R8UA 3SLSA 3R28A 2YHVA 2FSMX 1G3NA 3Q9XA 4AOIA 1KE8A 3HP2A 4GT5A 4EOIA 4FTRA 4EK8A 1CSNA 3OY3A 3MPTA 5C03A 5HICA 1SVGA 3C0HA 4UMTA 3AD5A 5ANEA 4ARKA 5I4NA 4FL1A 2EB2A 5KBRA 3PP0A 3NYXA 2WOUA 4KBAA 1F0QA 3DS6A 3OCTA 1GNGA 4AT4A 1LEWA 5LWNA 3Q4TA 3ORIA 3R2YA 4YO6A 5FUTA 3JVRA 5H9BA 4FKSA 3OC1A 5DI1A 2IG7A 3QYWA 4FSQA 4GH2A 4E6AA 2C5NA 4Z9LA 4IZAA 3DK6A 4OBPA 4BGQA 3P5JC 4AAYA 4W4VA 3R8ZA 3MPAA 1APME 3AXWA 4D4VA 4LOOA 3ZO4A 5K4IA 3F2NA 4FV6A 3QXPA 1WBWA 5CEIA 3AKJA 2Z7QA 3BE2A 4YC8A 3CLYA 5DH3A 5AIKA 2OH0E 1BL6A 4KD1A 3RPYA 2O63A 1G8JA 3QD0A 4U41A 4BCJA 4OTDA 4B8MA 2BHHA 2HW6A 3LM0A 4RA5A 5T6KA 3ELJA 3NYOA 4BC6A 5L8KA 2GS7A 3LXKA 2Y9QA 3QU0A 4JBVA 1YVJA 4RWJA 5AA9A 1FVRA 3FZOA 3I0QA 4FSRA 1JVPP 5H8BA 4O4EA 4I6FA 4ZZNA 5B7VA 4J96A 4DCEA 2AC3A 2QO2A 4LG4A 3T9IA 5CU2A 2BRBA 4FKRA 3BWFA 4RVLA 2B9IA 5ITAA 4PTEA 4RZVA 2OJIA 4QO9A 3D5UA 5HNGA 5DVRA 4AT3A 4ZSAA 1HOWA 2F9GA 3D7TB 3ML1A 3HUCA 2C4GA 4FTLA 2VAGA 4AXFA 3PUPA 2Y4PA 1OL2A 3RM7A 4XOYA 3L9MA 4BDKA 3OWJA 4X2GA 3TKIA 4USDA 4D1XA 4PWNA 4ZXTA 2E9PA 4LGDA 3PA3A 4BCGA 2QODA 1H1RA 3OCGA 4MWIA 2VTOA 3MB7A 2R7IA 2VX0A 3ZO3A 4EH9A 4IAZA 4R7BA 1XWSA 3CGFA 2ZM3A 2UZBA 2ITOA 2R3OA 3BYVA 3VS3A 5E1SA 2OZAB 4LDTA 3KCKA 2IO6A 2WMSA 5HG8A 1XH5A 3E3PA 3GQIA 2ZYBA 3GCPA 4G3DA 2PU8A 3Q5ZA 4EC9A 3G9NA 4GFGA 5FXRA 3VVHA 3MFRA 4GRBA 2QONA 1O6YA 2WTKC 3P9JA 4GJ3A 3CKWA 4BFMA 4WNPA 4XYFA 3ZM9A 3LCSA 4FIHA 5AUYA 4BDJA 3DKFA 5GJDA 4C4HA 1KV1A 5DR9A 4CCUA 1TFFA 2OI4X 4A4LA 1YXUA 4EOOA 3ID6C 3CSVA 2X81A 4FNYA 3L8SA 3MGYA 5EYKA 3QZGA 3AC3A 5LMKA 3AKKA 4O7YA 1JNKA 2JFLA 2WMXA 1VR2A 3A99A 4L52A 3V6RA 3W10A 4XCUA 4FSUA 3HV6A 5AAEA 1XH8A 4XV3A 3NNUA 5CNOA 2QC6A 3H30A 3EJ1A 4FR4A 4F78A 5CEMA 3DY7A 4FKOA 4CLJA 2X9EA 3UZTA 1ST0A 3COIA 4IB3A 3R9OA 3U4UA 2EXMA 3I6UA 2WTVA 4PRJA 4ANNA 4DAWA 4E3CA 4UV0A 3TXOA 4JDIA 5DN3A 3VW6A 1R39A 5AAFA 3O7LB 4ASEA 5DPVA 3S3IA 4DLJA 4FSZA 2BR1A 5L8JA 3NNVA 4D28A 4GK2A 3H9RA 4WG5A 3QRJA 4C38A 2I7QA 1WBNA 3NRMA 4XRLA 4ZTNA 4C3FA 4QTBA 5AP5A 3CTJA 3KVWA 4BDHA 2UVYA 3H0ZA 3PXQA 4C58A 5J5SA 4ZMEA 3IDBA 3QD4A 5TO8A 3A8WA 4O1OA 3VS4A 4I5PA 4QQCA 4DHFA 3CQEA 3QAME 1GAGA 2UZEA 4J8MA 2XAMA 4ANSA 4NK9A 2F2CB 4NSTA 4CTBA 4RG0A 4FSWA 4CEGA 4EOPA 2EWAA 1PHKA 1XR1A 2XM9A 3BYMA 3WF8A 1Q3DA 3WI6A 5I3OA 3TUDA 3RBWA 2C5XA 1GOLA 3R7OA 3V01A 4FG7A 4IM0A 3HMMA 4RIXA 2A2AA 5LXMA 1ZY5A 2CCHA 4FTOA 4IH8A 2HXLA 4M84A 4RX9A 1VEBA 3GFEA 2IW9A 3BGZA 3WILA 4I92A 1K3AA 4ZTQA 4XOZA 4LUDA 4D2RA 4YBKA 4L01A 3MJ1A 2W0JA 1TKIA 4CMOA 4R1YA 2REIA 5B2KA 2IJMA 1GZKA 4GIHA 4QPAA 3EFWA 3K54A 3UBDA 2YIWA 1R0EA 2BFYA 2ITWA 3AGLA 3ZCLA 4MWHA 4J7BA 3LCKA 3LQ8A 3NNWA 4CG9A 3NUYA 2YM3A 4FZ7A 4MXYA 1Q8TA 4WHZA 3OY1A 2XUUA 5AX9A 3UP2A 4DCAA 4QOXA 4MD9E 2X7GA 3QTQA 4YJVA 4EH4A 5HEZA 3DK3A 3O7LD 3A7HA 2P3GX 3BCEA 4RJ7A 5JK3A 4F7LA 5AUTA 2E9VA 3AC5A 3ZOSA 3TNPC 3UIUA 4M67A 3EYGA 4DGGA 5HNIX 2ACXA 2CLXA 3LFAA 3FL5A 3C5UA 3RAKA 2VNWA 4E7WA 3QC4A 4QMVA 2XIYA 1PXIA 3WIGA 3LXPA 4FKQA 4Z7GA 2R3RA 3LM5A 3POZA 2QOOA 5H8GA 3W2CA 1UU8A 3QTWA 3N4UA 5HQ0A 4KBCA 3HDNA 2ETMA 3NYVA 2JIVA 1NT2A 4CV8A 2BUJA 3FHRA 4I94A 2XNNA 3NAXA 4OTRA 5IKWA 3OHTA 4F1TA 2PY3A 5ANKA 3MVMA 2X0OA 2RFSA 3GEQA 3FMHA 5KHXA 4YJSA 2Y4IB 3E8CA 3GFWA 4DH1A 4JDJA 4FEWA 5K0KA 1YWNA 1MQ4A 3MV5A 4Y5HA 3MFTA 4QPMA 1REJA 4F65A 1NVQA 3TG1A 3NGAA 1NA7A 3I1AA 4I24A 5TOZA 2CGWA 2B52A 5CI7A 2ONLA 2P4IA 4HYIA 4ITIA 4A9TA 4O7NA 4O4FA 2WFYA 5HHWA 3ZBFA 2Y6OA 2WQMA 3QKKA 2XM8A 1I09A 2YIYA 2PZ5A 4BDFA 2YDJA 1JKKA 3LOKA 3QL8A 2WGJA 4QMMA 3B2WA 3CY2A 3TTIA 3ULIA 5FXSA 3MA6A 4QMQA 1MQBA 5E90A 1Y57A 1W83A 1X8BA 2EXEA 3WE4A 1M7NA 3QBNA 3FZRA 4FK3A 4XUFA 2XB7A 4FKJA 3HV7A 5C8KA 1U5QA 2B9HA 2YIQA 1W0XC 2WQBA 5J9ZA 5HGIA 2V22A 4O82A 1OI9A 3RM6A 2C3KA 3ORLA 3F66A 4AAAA 3UDSA 2XYUA 1WBSA 4ACHA 4BKZA 4D2WA 3FKLA 3AKLA 2IEWA 1PMNA 1M7QA 4JAJA 1KWPA 4AOJA 4QMPA 1OUYA 2JIIA 1R3CA 5B2MA 4IWQA 4NU1A 4NW6A 4FV4A 4IM2A 2CKOA 4RIWB 2HZIA 2XNMA 2VTMA 3IDPA 5AX3A 4YHFA 4RWIA 3VUMA 4D5KA 1ERKA 3HEGA 2JIUA 4XBUA 5A6NA 3DA6A 2XEYA 4RRVA 1JBPE 4YJNA 1J91A 2CCIA 2ITPA 5HVJA 2PMOX 2DS1A 3IGGA