2QO7A

Human epha3 kinase and juxtamembrane region, dephosphorylated, amp-pnp bound
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
278
Chain Sequence
TYVDPHTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 278
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo7A01
1S9IA 3FC2A 3I6WA 5HGIA 4DG2E 4H05A 4B4LA 2BIKB 4FK6A 3TG1A 3R01A 5CSXA 2J90A 5JRSA 2PULA 3VQUA 3VHKA 2HZ0A 4FV4A 3EQRA 5CNNA 2NRUA 4OBOA 1H0WA 3DT1A 3OOMA 1H1RA 5HNBA 1H01A 4DFXE 3KF7A 4C0TA 4BBEA 2BZJA 2UZUE 5H9BA 4RFZA 1LEZA 2B52A 2OIBA 4NSTA 4HCVA 3VC4A 2WXVA 4C4EA 2XRUA 5KHWA 4QP8A 4GUEA 1B6CB 4G3EA 3VF8A 4G6NA 4C33A 4AW1A 5IA2A 3B2TA 4MXCA 4DGNA 2UZBA 4I6HA 4OTHA 2GPHA 2FUMA 2QOCA 4XP2A 3JVRA 2J5FA 4HVDA 3R1SA 4BCNA 1BKXA 4KAOA 4ORKA 5M4FA 5FD2A 4BDHA 3R7EA 4HOKA 2YJSA 4RC3A 1IRKA 2EXCX 4F1TA 5ICPA 3NUYA 1ZRZA 2W96B 3NNUA 1B39A 5FWKK 3R9NA 4GH2A 3NUXA 3OCBA 2YDJA 3P4KA 2B53A 1Q8ZA 1ZMWA 2WTKC 3ALNA 3OCTA 3E5AA 2VWWA 5E8VA 3AC1A 3R1QA 4L45A 1WAKA 3QKKA 2OBJA 5JFXA 2PMNX 1SNUA 4LV5A 1FQ1B 3QTRA 4IANA 1F0QA 4I0TA 4OTPA 4R3PA 4BDBA 5C4KA 1WBOA 4M69A 1ZXEA 4YJNA 4UYAA 3VRYA 3OHTA 5KE0A 5HBJA 4XBRA 3QD4A 2UZLA 4KKEA 2Z2WA 3COMA 4HCUA 4ONAA 4NUSA 4AT3A 1M2RA 3EN6A 5A6OA 3VS4A 1IAHA 5CF6A 3NVKI 3BBTB 5HI2A 4J71A 1JLUE 5AUVA 4IVCA 3KY2A 5LARA 4GU9A 3ZLWA 4O96A 2BDFA 2QR7A 3NUNA 4XNEA 2XKEA 3LCDA 4D28A 4DTKA 3DZQA 4EYJA 5ETAA 2X6EA 3O7LD 4OTGA 4CCUA 4EK4A 4O84A 3NW5A 3NUSA 4N4SA 1SMHA 3I5NA 3QCQA 3EKNA 3QQJA 5IDNA 5IUIA 3UOLA 2PVLA 4FEQA 5JH6A 3NLBA 4QOXA 4AFEA 4PF4A 2VX3A 3IONA 4O0YA 4Y73A 1V1KA 2CSNA 4FNXA 1Q3DA 3FL4A 2VGPA 4IMYA 2W05A 4IZYA 3GOPA 4P5ZA 4QMWA 1R39A 2REIA 4AN9A 4QP6A 3RPRA 2VWYA 3WZDA 3LFBA 4FV6A 2W5BA 2BTRA 4F0GA 3R63A 3CQEA 1WVXA 2YWPA 3GXLA 3PXZA 4RJ5A 5F1ZA 3QGWA 2GNHA 1KE5A 2RFEA 3TIYA 4IVAA 3BLHA 3QRTA 1H4LA 3GQIA 3QTSA 2WQOA 3R8MA 4FR4A 3MY0A 4JI9A 3DBQA 3NUUA 2HCKA 4W4YA 2W1ZA 5HG7A 4ZIMA 2IZSA 5HCYA 4FYOA 3W1FA 4BFMA 3BGPA 2UZVA 2OF2A 3ZXTA 5J87A 4CD0A 5L2QA 3FUPA 4FKGA 4EJNA 5A4LA 4CTCA 4L68A 3CJFA 2X39A 4O7YA 3GNIB 2WELA 1H27A 2XKDA 3MS9A 4QYYA 5A6NA 2VTAA 2W1IA 2ONLC 4W8EA 3JXWA 4I5PA 2I7QA 2R0UA 1LUFA 3HAMA 5CY3A 5J1VA 2WKMA 1PXLA 4U40A 3LCSA 4EYMA 5I0BA 5LCKA 3OTUA 5LMKC 3ZXZA 4YLLA 2JDVA 2R3MA 5KBQA 1K3AA 2Z7LA 3ORZA 5J9ZA 2YM5A 1MUOA 2IW8A 1REJA 2WU7A 3RPSA 2BKKA 2P0CA 5DH3A 1PXJA 2GNGA 3DFAA 5GIPE 4QMMA 2BZIB 1CMKE 3CLYA 2JIIA 4U41A 4GVAA 2PY3A 3DKFA 4GW8A 4BZOA 3TUCA 2QNJA 4R8QA 4BI1A 4EKLA 1QPCA 1XO2B 1STCE 4MTAA 3DGKA 3DK7A 2C1BA 3IECA 3ORPA 5FDXA 4RIWA 3U4WA 4AX8A 4USFA 4ERWA 3PDTA 2WEIA 5E8UA 4TW9A 4JDHA 3ZRMA 4APCA 2JEDA 3LVPA 3ZC6A 2Y4IB 4O0TA 4FZFB 4DBXA 4L7FA 4G16A 5BQ0A 4FSZA 4XG6A 1UA2A 4IAZA 3PZHA 2W1HA 2X7GA 4CNHA 4DBNA 5IQHA 1VR2A 1PY5A 1PXNA 5CWZA 2F2UA 1ZOEA 4WIHA 2ZDTA 4FSWA 3ZM4A 4TWNA 3EQGA 4YBKA 3KVXA 3QUPA 2KTYA 4UYNA 4XG9A 4RFMA 2W9ZB 1IR3A 4M0YA 3Q6UA 4G6LA 4O7WA 4KRDA 3U55A 3AQVA 1XH8A 2IZTA 4C8BA 4DH1A 4IB5A 3BHTA 3UZRA 4M12A 2FH9A 5IMXA 2RG5A 4RVTA 5CEMA 3MTFA 4L46A 5CZHA 2HW7A 4YO6A 3TKHA 3IW6A 2HYYA 3W2RA 5GZ9A 1YI3A 2J50A 4TN6A 3ZH8A 4RJ3A 3KGAA 5BYLA 3QD2B 5ANIA 3ORXA 4MNFA 2CKEA 4DGGA 2C68A 3E3PA 5HHWA 4EOKA 4MXXA 5HG9A 3BRBA 2QU6A 3R9OA 3FYJX 4F63A 3IOPA 3ORNA 3QQKA 2PVKA 2XM8A 1JOWB 1DI9A 4R7BA 5IISA 1Q61A 4DCEA 1P4OA 2ITVA 3LM0A 2X2MA 2XJ1A 3MB6A 2UW0A 2WO6A 3CQUA 3Q96A 4WNPA 3R71A 5DRDA 3CIKA 3UOHA 2ITOA 4O6LA 5CXZA 1NW1A 4NTTA 2P2HA 4LOOA 5FXQA 3CTQA 4S31A 3FZTA 3PP0A 4WHZA 1APME 2V5QA 3Q3BA 5L4QA 4UMTA 2PYWA 4BKJA 1XH6A 5FEQA 5GJFA 3TV6A 4RZVA 3IW4A 4MXAA 4I4FA 5AR3A 3R9HA 5IQFA 2OFVA 4ANMA 4ZJVA 5LVMA 5DLSA 4HZSA 4GMYA 3ET7A 4NWMA 4BL1A 2C47A 4K11A 5JSMA 4W9WA 5AP2A 4CYIA 1VYWA 4QYFA 4EONA 3BU3A 4DLIA 3BELA 3AT2A 2JIUA 5K4JA 1ERKA 5K0KA 3P7BA 2R4BA 2C5OA 3ROCA 3KREA 4P4CA 4IFCA 4PP7A 2WQMA 2QKWB 4HNIA 5JGDA 4M66A 1H0VA 4H1JA 3GU7A 4GG5A 4RVKA 1GNGA 1Y6AA 5TR6A 1Q24A 4M14A 3CSVA 3EN7A 3MFTA 3QQGA 4FYNA 5E8WA 3ZOSA 2VAGA 4LV8A 5AR7A 5AR5A 2IN6A 3TV4A 3VN9A 1YDSE 5E92A 3TN8A 1ZYCA 2QHMA 4Q5EA 5AAFA 1OECA 2O64A 4J8NA 4LRJA 3MW1A 5FEDA 4C7TA 5FUTA 3Q5IA 5BVWA 4QYEA 3FMDA 4RX5A 1BX6A 4ITHA 3HX4A 4YTIA 3ZYAA 3T8OA 3W8QA 3G6HA 2E2BA 3SLSA 4BKZA 2XIXA 4RVMA 4JG7A 2HOGA 4NM0A 2BTSA 2ZYBA 4L3LA 4NKSA 4WKQA 5L2TA 4AT4A 5M57A 1LPUA 2OXYA 1T45A 4F1OA 2BAJA 4RC4A 5JKGA 2J0LA 2Y4IC 2WMUA 3CEKA 5DOSA 3QQFA 3IW5A 3QZHA 3VVHA 4UBAA 1PW2A 4JL9A 2UVZA 4GJ2A 3UG1A 4QTCA 5EI2A 1E1XA 2GNJA 3G0FA 4XJ0A 3VAPA 4IB1A 5CAPA 3CS9A 4O2ZA 2YIWA 4BHNA 4ZMEA 3MFSA 4FG9A 3FAAA 3N9XA 5L8KA 4ZSAA 4DN5A 1SYKA 4HYIA 3WZKA 3F3ZA 1JWHA 2PHKA 2VTIA 5ANEA 2J2IB 4BIDA 4GIIA 4R3CA 3PJ3A 4F0IA 3HVCA 1PYEA 1GAGA 3FMEA 1UNHA 4O38A 3D5VA 4NU1A 3O96A 2JAMA 4MD9E 5A46A 3CXWA 3SQQA 2J6MA 3V6SA 5K0XA 2YLFA 3RZFA 3UNKA 5BNJA 4I24A 5TOZA 4MXOA 4EOMA 3PY1A 3GUBA 3QC9A 3U51A 2BIYA 4XLVA 4BF2A 3R7YA 4BDGA 5AA8A 2BCJA 2QURA 3ERKA 1YVJA 2XNBA 3JY0A 4E6AA 4Y8DA 3FI8A 1YI6A 4CFMA 4IVBA 2W1GA 3K2LA 4TKSA 4BDAA 3HLLA 4CFXA 3PLSA 5BMMA 4D4RA 1O6LA 4EOLA 3FPMA 3ACJA 4EHEA 3VUTA 1IA8A 5AV1A 4Z3VA 2B0QA 3ZCLA 4IFGA 1RW8A 4XG2A 3VJOA 4CYJA 5HIEA 3LLAA 5JQ8A 3C4EA 4JR3A 5AWMA 2P3GX 3F61A 2XKFA 3BEGA 4CCBA 3C5UA 5K5XA 2ITYA 3OEZA 2R3OA 5J8IA 3SD0A 3FKLA 1QL6A 2J0IA 4R3RA 4EH5A 4A7CA 3A7FA 4WSQA 3U87A 4QP4A 2CLQA 3ZM9A 2WTJA 4FL2A 4I0SA 3G90X 5EDRA 4D1SA 3DY7A 3EQDA 3L8VA 4ZY5A 3C0IA 2IW6A 4LOQA 3W16A 2YN8A 1G8AA 2V7OA 5CVFA 4OGRA 3VBVA 3I0OA 4EZ3A 4YURA 5E4HA 1U5QA 2W5HA 3O8TA 3PE1A 3RVGA 5B2MA 4JX7A 3B8RA 1PXIA 5IPJA 4IVDA 3RNIA 3F2AA 1PXMA 5KMJA 2EB2A 3O23A 4FI1A 5IA0A 4RWJA 5E8SA 5CSVA 4X3JA 4IWQA 4FTIA 4NZWB 3VBYA 4EI4A 3UOJA 4D2WA 5AFVA 5HO6A 4KKGA 1BLXA 4L53A 3W18A 4XYFA 3SHEA 4A9YA 3TUDA 1YXXA 3HMMA 1Q97A 4GT5A 3UYSA 2C3IB 2EVAA 1OZ1A 4QMVA 4PMPA 1TQPA 2C6MA 3AGMA 3JS2A 1W84A 2YDKA 3D5XA 4FUXA 4WD5A 1ZYSA 4UWBA 5EQPA 3BU6A 3MH1A 5D7AA 5L8JA 5AJQA 3ZLYA 3W8LA 1UNLA 2EB3A 3FHIA 3AT3A 3GI3A 4F9BA 4D4VA 2XJ0A 1OGUA 5E7RA 4E1ZA 5CU6A 3AC5A 2OXDA 4H39A 4S2ZA 3DKOA 4FV7A 3Q9YA 3CP9A 4I5MA 4NCTC 5EI6A 3TIZA 2G9XA 2HELA 3D83A 2VRXA 3R30A 4YJVA 3E8NA 3QTWA 2WGJA 5T68A 1Q5KA 3G6GA 3A99A 4BWKA 4DEIA 5C27A 3DKCA 3QZGA 4BDCA 5AP1A 5GZAA 3LXKA 5DGZA 4BWXA 3HECA 5GJDA 3FEGA 1PKDA 4FT7A 4TTHB 5L2IA 2O2UA 4RSSA 3RJCA 4C58A 5LQFA 5M56A 1FGIA 2I1MA 4IIRA 4R1VA 1X8BA 3QQHA 4E6CA 2HXLA 3R8VA 5IUHA 2CGWA 2WMVA 4W4VA 5EOBA 5CVGA 5IDPA 1U54B 1WFCA 2FA2A 4HVGA 4CV9A 2DWBA 3MGYA 3UZPA 4DEGA 3TZ8A 2XA4A 3RI1A 5M4UA 4ZLOA 2WTVA 4IX3A 2OWBA 2FSMX 3HRFA 5LXMA 3KXXA 3C4WA 3M2WA 4G3DA 4YTHA 1H1QA 5KMMA 4FOBA 1JKSA 4FTTA 4LMUA 4A07A 3QTUA 5I9VA 5J95A 4NIFA 4O21A 1PMNA 5EH0A 3LOKA 2XYNA 4EQUA 3MI9A 4IE9A 2GHLA 4BI2A 4YJTA 1OI9A 3DAEA 4RQKA 4QTBA 5DNRA 3ELJA 3L1SA 3PPJA 4XMOA 5JQ5A 4B99A 3E64A 2ERZE 3MBLA 2W06A 5DT4A 3TTIA 3TV7A 2OJIA 2C6EA 4F6SA 1Y8YA 5FTQA 5EM6A 3FMMA 2PZIA 3TNHA 5CU2A 3L8PA 2EXEA 2XVDA 1B38A 4LOPA 5EM7A 3PG3A 5CLPA 5ANKA 3BCEA 3QYZA 3VW6A 4OTWA 2BVAA 3PXFA 3NYVA 4QMTA 4YJUA 4O81A 3CGOA 4ZTMA 1XBAA 3AC8A 3P7CA 4I0RA 4RIOA 2C6IA 3WIKA 5EYCA 5DG5A 4EORA 3HKOA 3V8TA 3OEFX 3OY3A 1YKRA 2YM4A 3KN5A 4K18A 4M67A 3TNPC 5FGKA 3VS0A 4ZZOA 3MESA 4FE2A 3FMLA 3DQWA 3VQHA 3BYSA 3NAXA 1J3HA 4KBAA 3R7UA 3HNGA 1CM8A 4ALVA 4F7SA 5GIOE 3KRLA 4D5HA 3WOWA 4YGAA 2JDOA 1ZLTA 2PVFA 1URWA 4JXFA 4YLKA 3V5WA 4AE9A 3EFJA 2YM8A 3A60A 3OTVA 3G0EA 4FKJA 2VTPA 4NEUA 3I7CA 4TYHB 4DFZE 1JSTA 1O6YA 4OT6A 2Y6OA 3TI1A 3UOKA 4BCIA 4DLJA 3GENA 3LFFA 3QHWA 3ZMMA 2JBPA 4X3FB 2CGVA 3IGOA 4HZRA 4OTFA 3WF9A 5HG8A 4CZYB 2YIRA 2ITQA 1E9HA 4QMLA 3VBWA 3DLSA 3G9LX 3WILA 1Z5MA 3NS9A 3OWKA 4KS8A 3AG9A 4G5JA 4I23A 2C0TA 5M44A 4PV0A 3KULB 5F94A 4UMUA 5CU0A 2IO6A 4CFVA 4NM3A 2X9EA 2ONLA 3P7AA 4RRVA 4XP3A 3RM7A 3UPXA 3G5DA 3O71A 2XK6A 5I9UA 3A7JA 2VNWA 4V05A 4G34A 4DH7A 1HCLA 3BIZA 5M06A 5M09A 2I40A 2QU5A 3M11A 4O6EA 1PHKA 3EKKA 3ZO2A 4UN0C 3RAKA 1J1BA 3KXHA 4W4WA 5EFQA 2F7EE 2VTJA 5LMKA 5ANGA 5ACKA 4GS6A 3QLGA 3UODA 3IDPA 4ITJA 4IX6A 4JDIA 3VBXA 3GU6A 5DR6A 2VTLA 3UO4A 3LXLA 4D0XA 3C13A 1OVEA 2FSTX 3HV5A 4JS8A 4RIXA 5AR8A 3QXOA 3TTJA 3TDWA 3W2QA 1CKIA 5EQEA 3ENHA 5E90A 2Z60A 5J79A 2QOOA 1FBNA 4G2FA 4LGHA 4RJ6A 1GJOA 5FG8A 2CN8A 5DEYA 3KMWA 2ZV8A 3LXNA 3QXPA 4R7IA 1VJYA 4FZ7A 4P2KA 1MRYA 5EHOA 2PUNA 5DI1A 2JIVA 4YNOA 3PVUA 3HZTA 5HQ0A 4O7RA 4DCAA 3DTCA 3EFWA 2GFSA 3QKMA 4BCQA 3Q2JA 1H1PA 2ZOQA 4FSMA 4IAKA 2WQNA 4JLCA 5CQUA 1H08A 4ZSEA 3NIEA 5FTGA 2R3IA 3PWYA 5J9LA 1GY3A 2B9IA 5IF1A 3D4QA 3ORMA 3IDBA 2CMWA 2Y8OA 1UU7A 2W5AA 4GCJA 4FV0A 4FKSA 5HKMA 5ANOA 5JZJA 3PFQA 3ZUVA 5FP5A 3V5TA 5CAOA 2OFUA 2YWVA 3QA8A 1M7QA 2V7AA 3BYVA 3ANRA 2C5XA 3GC7A 3S2PA 4C62A 2YAKA 4AFJA 4FX3A 3ZFYA 4XHKB 2OG8A 3R7VA 3Q52A 1OIUA 2XNGA 2O65A 3OOGA 4XG4A 3VBQA 3EHAA 2QR8A 3AC2A 3I1AA 4P7EA 3UMXA 5A4TA 5EDPA 2XCKA 5HIBA 1KE9A 1TKIA 4KIPA 2WAJA 2E9NA 5AP4A 5KZ0A 2VO3A 3U8WA 3DCVA 4EK6A 4EOIA 5L2SA 3GBZA 4MK0A 3OFMA 1BI8A 3FLYA 4JAJA 5AP0A 3VBTA 1DI8A 1FMKA 5KHXA 5EKNA 5A4EA 5H8BA 3NYOA 4FTKA 4KIKB 4EEVA 3DXNA 4QTAA 2IJMA 4FIFA 4PDPA 2WTDA 4ANLA 5LMAA 2X9FA 3PPKA 4D9TA 5IH5A 2ITUA 3P79A 4TYIA 2QO7A 4C38A 4OT5A 3KMUA 4CKJA 4U45A 4E6DA 2QO2A 3OUNB 4IM2A 4RG0A 1GIJA 1O9UA 4ARKA 2R7BA 3I79A 3MJ2A 5T3QA 4QQCA 3GC0A 2Q0BA 4GU6A 4R5SA 3EQPA 5K9IA 3FZ1A 4KD1A 4OTQA 1ZAOA 2CCIA 2ZM4A 3L9MA 3R7IA 3SA0A 5HX6A 4ZS4A 4FSUA 1H26A 2OJJA 4BCPA 4P5QA 4PX6A 5LJJA 2PZRA 1TVOA 1ZYJA 3KXMA 3DAKA 4NJ3A 5ETCA 3UQCA 3RMFA 2CKPA 1JPAA 1J7UA 4O27B 3EYGA 3QHRA 4XRJA 4CV8A 2PZPA 4ZOGA 3OWJA 2O3PA 4RX8A 5GNKA 5DT3A 4JRVA 3QCYA 3D7TB 3E92A 1XH9A 5E8ZA 1V0PA 3THBA 3I7BA 5FLFA 1H07A 4FIJA 4NK9A 4WA9A 3CBLA 2HW6A 1M7NA 1M14A 3EN5A 3PIXA 2JDTA 2JC6A 5AV3A 5DWRA 4V0GA 2R3KA 2VZ6A 4EH2A 4D58A 4Q5HA 3U6JA 3QA0A 3R04A 3ZO3A 2ZV9A 3QRUA 4ACGA 3CTJA 1Q4LA 3G9NA 5FBNC 3IGGA 4YMJA 2YIYA 3D2IA 3NIZA 3WIGA 1UU3A 3O8UA 1OKYA 3FQSA 2GS7A 3REPA 3MJ1A 4YLJA 2ZMDA 4FIGA 5HLWA 3LCTA 2XS0A 1I09A 3SOAA 2G2HA 3BI6A 5M4CA 3R73A 4D2PA 4EWQA 4BTKA 3L8XA 3H30A 4TWOA 4BDDA 2GNLA 3EL7A 5KKRB 4XG7A 3PUPA 1Q8YA 2R3QA 3TJCA 4FEUA 4CQEA 5KCVA 4FEVA 4Y95A 4F70A 3LJ1A 3OWLA 4GK4A 3UNJA 1K9AA 2VTRA 3LQ5A 4M15A 2UW5A 3PRIA 4TNBA 4H3QA 4E26A 5HIDA 4ANOA 2B54A 4RBLA 3VUIA 4EZ5A 4UWCA 2CNUA 4PDYA 3FV8A 4GK2A 2XK7A 3H0ZA 3IDCA 3MA6A 3OY1A 3POOA 3ZONA 3NGAA 1JSUA 3ZRKA 2YIXA 5IA4A 2OJ9A 3GC8A 4FL3A 3I81A 3BBWA 3KXZA 4PTCA 3V04A 4WUAA 2YHVA 4ZXTA 1XBBA 3CJGA 4GK3A 4IC8A 2F2CB 2ZAZA 4L8MA 2PE2A 5J7HA 3FSFA 4BN1A 4FIHA 1J1CA 2ITWA 1PF8A 3LZBA 5J5SA 4O7NA 2C30A 2WTIA 4F9AA 5AUUA 4DFUA 1BMKA 3PJ8A 1KE8A 4F1MA 5B0XA 2BFYA 3BLRA 4KBKA 4KIQA 4I94A 4OTRA 2PVNA 4QTEA 4E4LA 1W83A 5CEPA 3AMYA 4IBMA 4J53A 5G6VA 3VS3A 4EOOA 3ZS5A 4EK8A 4XG3A 3AD6A 4KRCA 1P4FA 3BHVA 5CX9A 3E3BX 5AP3A 3H0YA 4A4OA 2HY81 4UZDA 2I0EA 5LCJA 3LM5A 4BTJA 3CR0A 3QZIA 1CKJA 3IOKA 4DEAA 5HNIX 4YC8A 4FICA 1URCA 4BYJA 5A14A 2DYLA 2G2IA 4IX5A 4EHZA 2QOLA 2ETKA 4HNFA 4IXPA 5M55A 2C5YA 5HOAA 3F69A 4MX9A 4ZMFA 4CTBA 4EKKA 4BTFA 2PSQA 3AXWA 1NVRA 3FMKA 3FY2A 4FNYA 1OKVA 5HTBA 1J7LA 2Q83A 5CU4A 3EMGA 2PK9A 3MN3A 4AU8A 3D2KA 4ZSGA 1IASA 3MH2A 3DBFA 5EKOA 2GHGA 3VS6A 2GDOA 3KN6A 3NRMA 4G3CA 4MNEA 2P2IA 2UVXA 3POZA 3NX8A 4FZDB 2J4ZA 2OO8X 3RHKA 5IEXA 2VTQA 3CKWA 3RAIA 3DPKA 4KNBA 3F66A 1NT2A 4ANQA 2WMBA 2RKUA 4O0WA 5DR9A 3VO3A 5HEZA 3A7IA 5IQCA 3QU0A 5IA3A 4GT3A 3UQGA 3PVWA 3UTOA 3ENMA 3PA4A 5IU2A 2UW3A 2WMXA 4CQGA 1JKLA 5HU3A 4QQTA 4JIKA 3MH0A 2B55A 4FNWA 1GZOA 1OL1A 2OGVA 2WQBA 4S33A 3R8LA 1CKPA 4A06A 4FODA 5CANA 2B1PA 3S95A 2WU6A 4V0GB 3UIBA 5TO8A 4I6FA 4HPUE 3GGFA 4I6BA 1Y8GA 5IA5A 3VS2A 1JNKA 2XNEA 4YSJA 3NR9A 4ZLYA 3AD5A 1W0XC 2R3PA 3VNTA 1REKA 1WMKA 4IEBA 4A4LA 2FSLX 4GL9A 2BDJA 2C6KA 3MFUA 4M69B 3SRVA 3UIMA 4PDSA 3BPRA 2JLDA 2VTSA 3FZPA 1LP4A 4EH7A 5LVNA 3DK3A 3NAYA 2IVSA 4NCTA 4BGQA 2CPKE 2A4LA 4HGTA 4E3CA 3R21A 4USEA 4NYEA 4XLIA 1VZOA 1Q3WA 2VUWA 5BPYA 4FTRA 4UMPA 3EOCA 4AW5A 4H3PA 2XMYA 5AAEA 3QD0A 2OICA 4EL9A 3HEGA 4ALWA 3UZTA 5E8TA 4NH1A 2HWOA 3IQ7A 4ANSA 4CFNA 5JFSA 3FXZA 4IAYA 4EHVA 2QKRA 3DQXA 2PE1A 2QLUA 4M7IA 4EH9A 4BRXA 5JFWA 4O82A 3DJ5A 5CAQA 4DFBA 4WRSA 3AGLA 4M3QA 5H2UA 2OH0E 4FIIA 4IM0A 2E9OA 4O1PA 4QQJA 2V62A 4L43A 2A2AA 3ZEWA 3W2PA 5HD4A 5AA9A 2HWPA 3UG2A 1ZOHA 4OTDA 2R5TA 3R00A 2WB8A 3R7OA 4PNKA 4J97A 3FI4A 2UW7A 2PL0A 3HA8A 3QWJA 4OLIA 3ZTXA 4CKRA 2IPXA 5JEBA 4CMTA 5AUWA 4ZP5A 1J91A 3N51A 3QRJA 3FBVA 3MYGA 1IG1A 4Z16A 4B0GA 4A9SA 4B9DA 3HYHA 2YZAA 4LUDA 4K1BA 5A3XA 2A19B 5HBHA 3HA6A 3LXPA 4HYHA 3VS7A 3F88A 4EBWA 5IQEA 3DS6A 3AC4A 2B9HA 3MPMA 3NW6A 4E5WA 1M2PA 5CF5A 5JRQA 2W1FA 3GCPA 4DEHA 1M2QA 5AUXA 3AT4A 3R2BA 2C3JA 2XZSA 2ZV7A 4D2TA 3KL8A 3P9JA 4BCJA 4C02A 2WIPA 3RK7A 2XUUA 3VUGA 2GTNA 5C8NA 2YABA 2FO0A 3UP7A 4CRSA 4O7SA 2R3HA 2WMWA 5JZNA 3ZU7A 2QQ7A 3UBDA 2QI8A 2O63A 4MNEB 4UXQA 4UZHA 5EW8A 4G5PA 3QCSA 3FC1X 2JITA 1HOWA 2QCSA 3KK9A 1Q62A 1Y91A 1NXKA 5D12A 1XH5A 2UW4A 3BHYA 3P78A 4FTLA 1U46A 5DT0A 5HTCA 4GKIA 1PKGA 4BDEA 5EHYA 3HV4A 4LGDA 4UX9A 4APPA 2G01A 4RIWB 1IAJA 4CG8A 4EC9A 2EU9A 3WARA 3W2SA 3OT8A 4NKAA 1JVPP 5CALA 3U6HA 3OROA 1Z9XA 3WF6A 4BC6A 3V6RA 3S0OA 2CGXA 4FUYA 1ZY4A 4I41A 4J98A 4FKQA 2I0YA 4J95A 3ZUTA 3OXIA 1R0EA 2PUIA 2H6DA 3HMPA 4PPCA 4JDKA 5FTOA 1PMVA 3R1YA 2BUJA 5AM7A 3ZUUA 4Z9LA 4FGRA 4J99A 4B7TA 2OI4X 4JIAA 3DLZA 3MY5A 4OTIA 3QC4A 2WTCA 4O91A 1CSNA 2QLQA 5F95A 3E88A 3Q9ZA 3UP2A 5A9UA 4C2WA 2XNMA 3UO6A 2F7ZE 2XKCA 2YJRA 3DB8A 4J1RA 4F4PA 3LQ3A 4CG9A 5HZNA 4EZ7A 4FSRA 5L3AA 3FSKA 4EOPA 4UY9A 4XBUA 3MPAA 3OC1A 4YC3A 4I5HA 4YPDA 2YM7A 5DA3A 5TE0A 4EC8A 3Q4ZA 1SVGA 1UVRA 4PTEA 5AX9A 5CAUA 1YXUA 2O8YA 4FSNA 4XG8A 2J0JA 3R22A 3N4VA 3NNVA 4DG3E 3GU4A 3SOCA 3PJ1A 3MA3A 5KMIA 2UVYA 1W7HA 3CGFA 4A9UA 2C0IA 2EWAA 3R02A 3VF9A 3U6IA 2OIDA 3MVJA 4X6QC 2XIRA 4BGGA 4YZCA 1OIRA 3HV7A 3LJ2A 2VTNA 4BIEA 3C1XA 5LVPA 3TT0A 2H9VA 1MQ4A 3PA5A 4HW7A 4O86A 5AUYA 2WOUA 2OIQA 4W8DA 4J7BA 5D1JA 4N6ZA 3COHA 5HX8A 1WBWA 1NVSA 4ACMA 4BCHA 4ENXA 4U44A 1Q8WA 4EJ7A 1DAWA 4FT9A 3DAJA 4TY1A 3F5GA 4FKVA 4H3BA 2P55A 2JGZA 5J1WA 5FDPA 4MEDA 3C4XA 3IO7A 5FP6A 2O0UA 3U4UA 2BZKB 5T6KA 3MIYA 4FTNA 4U9AA 5KMKA 3G51A 4QMYA 1R3CA 2X6DA 4FZ6A 5HE2A 2WIHA 4I6QA 4WO5A 1LR4A 4RA4A 3VUDA 1K2PA 4Y72A 3RP9A 2BPMA 2UZOA 3TL8A 5KMNA 4TXCA 3RNYA 3LHJA 3HMIA 3K54A 4F7JA 1OL2A 4ZSLA 1AGWA 2R3LA 5IQIA 3GEQA 1YHWA 2Q0NA 3ZBXA 4M8TA 2UZNA 5LOHA 5I4NA 2PU8A 3T9IA 4RX7A 3D7ZA 4ASEA 1XHAA 2F49A 3QF9A 4IAIA 4JR7A 5HVYA 2NO3A 1ZYDA 1KV1A 2UZDA 4BR3A 4MKCA 3T3UA 3VIDA 3C50A 1OPKA 3R0TA 4KSQA 4FV5A 4GSBA 5KNJA 5C01A 4BBMA 4DEBA 3S1HA 4O7ZA 3ZLXA 2BFXA 2VWBA 4WRGA 1WVYA 3NVMB 4YU2A 4K9YA 2JBOA 3ID6C 2XNNA 3GFWA 4DFNA 4YTFA 3FZSA 3TZ7A 4AF3A 5CAVA 2CN5A 4OR5A 4O0UA 2IWIA 2YIQA 4FKUA 3EWHA 3NNXA 5HVKA 3R2YA 4IQ6A 3VW8A 2X8DA 3OBJA 4RPVA 3ZFMA 4D4SA 3GP0A 3OG7A 4XS2A 2ZJWA 1ZMUA 5BX0A 1XJDA 1KSWA 3OXZA 4BHZA 3NWWA 3UC4A 5JGAA 4O0RA 4DYMA 1GZ8A 5L6PA 3V5JA 3ZHPC 5AIRA 4RX9A 2J7TA 3Q6WA 2JKKA 3ZSHA 2C0OA 2OW3A 4ENYA 2GQSA 3SDJA 2XB7A 5B2KA 4AT5A 3LW0A 3HP5A 4HYSA 4YJOA 4UMQA 3QTXA 4LMNA 3BQCA 3IK3A 3BX5A 5HVJA 4CT1A 1SVEA 3RALA 1UU9A 3MY1A 3PXQA 4YC6A 1PJKA 3E7OA 2OZAA 5IQGA 5LWMA 2JKOA 4GUBA 3PP1A 3COIA 4YBJA 1OIYA 5CI6A 3QRKA 4BWPA 4PY1A 4QQ5A 4QPMA 5EYMA 4E4MA 2QO9A 2H34A 2J0MB 1XH4A 1H8FA 2W1DA 3ZEPA 5CSPA 1WZYA 3EH9A 4KB8A 4NFMA 4QMNA 4GFMA 2I0VA 3GCUA 4PPAA 3FXXA 5AIKA 4YSMA 2OJFE 5TT7A 2YAAA 3DBEA 1DAYA 5HTIA 1VEBA 5IKWA 2IZRA 3R7GA 4WT6A 3EZRA 3DZOA 2IW9A 5EW3A 5CENA 5E8YA 3W10A 1YRPA 2DS1A 4XV2A 2CKOA 4FV2A 5AV0A 2VTTA 4RIYA 5AAGA 1OMWA 2F7XE 5G1XA 4USDA 3ATTA 4U81A 3II5A 1KUTA 4Q9ZA 3PXKA 3E87A 4BB4A 3L8SA 3CQWA 4S32A 5BUEA 5IUGA 3OCSA 5J7BA 2C1AA 3FZOA 3GCVA 3A62A 2Y9QA 2WFYA 2B9FA 3C4ZA 2RFDA 3MDYA 3TNQB 3RBWA 4R77A 3EQIA 3KXGA 3UQFA 4R78A 4FVRA 4JNWA 5H3QA 5BVEA 5L8LA 2IZUA 4FKRA 1A48A 5ETFA 2ZM1A 4Y83A 1SVHA 4ZZNA 4MF0A 1NY3A 4C4GA 4DHFA 4FKTA 3S4QA 4BBFA 3TJDA 2R0IA 1MP8A 4DGOA 2YISA 3EFKA 1UKHA 3CD3A 4C37A 2FVDA 2LGCA 4DA5A 5AUTA 2W7XA 1ZZ2A 4QMOA 5E1EA 4RWKA 4ASXA 4EOJA 4F9WA 3SV0A 4HGLA 4C2VA 3BLQA 5CYIA 3KKVA 1YHVA 2C6LA 4WG5A 3ODYX 4RC2A 4RJ7A 2E9PA 1TQMA 1H1SA 3PXRA 5F20A 3EQCA 3HAVA 5EQYA 4H58A 4K6ZA 4BVUA 2Z8CA 1OUYA 2VTHA 5DYJA 3LFCA 2EUFB 4U42A 2RL5A 5D10A 5FBOA 3QL8A 5FQDC 5HORA 3CC6A 4C3RA 4FMQA 4IC7A 3RAHA 4E4NA 3QUEA 1YW2A 1FPUA 3DJ7A 4ITIA 3PJ2A 5DRBA 4IDTA 3FJQE 3LMIA 4ZTQA 1Q41A 3GC9A 2PMIA 3LFDA 3D15A 3ZDUA 3N4TA 2CGUA 2IVTA 3LFAA 4AA5A 4JVGA 2BZHB 4U43A 4MYGA 5HBEA 5IEVA 4FC0A 5HG5A 4I21A 2W0JA 3QX2A 2E9VA 2QOIA 5IH4A 2I0HA 2QONA 5C8MA 2WMQA 3P1AA 4FTMA 3E63A 3R1NA 1W8CA 2PWLA 2WPAA 3H10A 4R6VA 5FXSA 3ZLSA 3FMHA 3NEWA 4AAAA 2XBJA 2ITNA 4LFIA 5CEKA 5ACBC 2W17A 2BHHA 5TKDA 2YLEA 2HZ4A 4O0SA 5J5TA 2W1CA 1S9JA 1UKIA 4QNYA 2RSVA 3GOKA 1OPJA 1YWVA 5BYYA 2W1EA 4IADA 3KXNA 2UV2A 3O0GA 3PA3A 4E4XA 3R9DA 3ITZA 2XRWA 4F6UA 4BCFA 3U9CA 1YDRE 2C4GA 4UB7A 4DEEA 4YTCA 4JRNA 4X2KA 1NVQA 2JFMA 4ASDA 4IAAA 5A4CA 2FGIA 2QC6A 3C0GA 1ZZLA 2OKRA 2ZB1A 3Q9WA 4TZRA 4FA2A 1A06A 2PUUA 2WZJA 3EQFA 3O2MA 2V22A 4DFYA 4ZJJA 4ZTHA 2RGPA 4FKWA 4K8AA 4NIFB 5A54A 1ND4A 3PVBA 2WTKB 4JDJA 1GZKA 2BRGA 5AADA 4FL1A 3ZO4A 1W98A 3P86A 2JFLA 3TKUA 3JUHA 2IVUA 3PVGA 3V5LA 4TYJA 1HCKA 3GB2A 1ZMVA 3FLWA 4NFNA 5AM6A 4HVSA 2BDWA 1QPJA 3SG8A 1KOAA 4S30A 5HE3A 4EOQA 2C69A 4N0SA 2CKQA 1P14A 2ZMCA 2LAVA 3MVHA 2WOTA 4X2NA 4QP7A 4C4JA 4MWIA 5EOLA 2V55A 1DM2A 4Z7GA 4OBPA 3KRJA 4RIYB 4YJSA 3V8WA 4M13A 4IWPA 3ATSA 3I4BA 4G9CA 4QPSA 4X2GA 3JY9A 4WNOA 5E9EA 3E7VA 3TXOA 2DQ7X 3RZBA 3KEXA 3NMUF 4DH5A 2BMCA 4JX3A 3PZEA 3OD6X 3IW7A 2PZYA 4O2PA 2WEVA 3RWPA 2PPQA 3BGZA 3D5UA 3QAME 4PL5A 3TDVA 2YM6A 4MHAA 5IH6A 2JKQA 3DFCB 3PY0A 4FV8A 2ZB0A 3B8QA 4F99A 4O83A 4TL0A 5IEYA 3D5WA 4FIEA 2Z7SA 3I5ZA 2HAKA 4U0IA 3QLFA 3R28A 4X3FC 4E7WA 1T46A 4F0FA 4PDOA 2AYPA 3OXTA 4C4FA 5KMOA 3C51A 2XJ2A 5DEWA 3A61A 3NUAA 2G2FA 2BKZA 1PRYA 3LFNA 3CKXA 3VWAA 4L52A 4Y85A 4EK5A 2NNWB 4O7TA 3DNEA 4KUJA 1Q8UA 4O0XA 1OKZA 1F5QA 2VN9A 3Q60A 5JK3A 4U80A 4A4XA 5B2LA 2AC3A 4PWNA 4Y5HA 3F5PA 3TCPA 3RK9A 3F2NA 4PQNA 3HGKA 4MWHA 4QRCA 3OWPA 4IM3A 5CQWA 2VTOA 3WI6A 4TT7A 4AN2A 3JPVA 4PL3A 2XNPA 4X6RA 4RVLA 2GNIA 4G9RA 4RWLA 3DDPA 1WCCA 2XK8A 3Q2MA 2WQEA 1DS5A 4YJRA 3ZFXA 4AGWA 2XP2A 4AZEA 4U79A 1ZARA 4PL4A 4F9YA 3FLZA 2PVHA 3HV3A 5JT2A 3FQHA 4U6RA 3MVMA 2XM9A 4D0WA 3OBGA 2VV9A 3KA0A 4CXAA 5F9EA 2P4IA 5E8XA 5K4IA 3TUBA 4G3FA 2J9MA 4BCOA 2BRBA 4IX4A 3BV2A 4AOJA 5D9HA 4RIXB 2PVYA 4WSYA 2HENA 3ZDIA 4I22A 5CI7A 5CXHA 3OF0A 4C35A 3E8EA 4L44A 3IPHA 2WMSA 4TYGA 2PUPA 3KF4A 4QP3A 3LFQA 4BY9E 3PXYA 5DBXA 2ZM3A 3LCKA 4AZFA 4IAFA 4O22A 4DT9A 4OAVB 2CDZA 3TEIA 4ALUA 4MD7E 2C6OA 3DKGA 3NCGA 1IA9A 1H24A 3KMMA 4KINA 4LYNA 4YZMA 4ZEGA 3DTWA 2GCDA 5CASA 3F7WA 4FKIA 4J8MA 4U97A 3R83A 4MQ1A 4TYEA 3EYHA 5DN3A 4F7NA 2G1TA 2R2PA 3BYMA 3D94A 3FQEA 5M07A 2VWVA 2F9GA 4TWPA 4L3PA 4ANBA 2BALA 4NW6A 4ERKA 3ZZWA 2BILB 5HD7A 4E93A 5AEPA 1XH7A 2QVSE 4AACA 2FB8A 3PYYA 3LQ8A 3VULA 1YOMA 3QTQA 4IWDA 4HGEA 3LAUA 4Z55A 1FVTA 4WBOA 3KK8A 4FEXA 4HVHA 4AP7A 1JBPE 4FSQA 3DU8A 5ANJA 3D0EA 5HO8A 2DUVA 5DR2A 3AC3A 2VWZA 4GG7A 2VO0A 4BTMA 2GFCA 4DTBA 4N70A 4F65A 5KX8A 3C7QA 4AA0A 5AR2A 3I0QA 4Z7HA 2HXQA 3VRZA 4J52A 4QP9A 4BZNA 2BRMA 1G8SA 1JSVA 2RG6A 3G15A 2A0CX 4ZK5A 3ULIA 4ACHA 4EH6A 4EHGA 4G17A 4YP8A 4GKHA 3HUBA 4CLIA 3PSCA 3FXWA 4IZAA 4RJ8A 4NW5A 5AX3A 2W4KA 4YHTA 4BIBA 3TM0A 2B9JA 5BUIA 1BI7A 2R3NA 4QTDA 4B6LA 1GZNA 3UYTA 2VO6A 2KULA 4MBIA 4MQ2A 4ZTSA 4AS0A 3RAWA 5I9ZA 3NW7A 2QOKA 4OAUC 3HP2A 2IG7A 2R64A 3DDQA 4C34A 4CFUA 1GIIA 2PZ5A 3D14A 4KS7A 4QMQA 3QQLA 4M84A 3OP5A 2WD1A 5I9XA 2ZDUA 3KFAA 5C9CA 3EZVA 2ZV2A 3EQBA 2BAKA 2O5KA 5E1SA 2GMXA 4E6QA 4Y5QA 3ZBFA 2SRCA 3B2WA 2OH4A 4FG7A 1YXVA 2F57A 2QD9A 3QTIA 5EDQA 2OSCA 3F9NA 4CGAA 2BAQA 2F4JA 4JQ8A 4AQCA 2G15A 4MBJA 4U8ZA 1RE8A 3V5QA 4ACDA 5EW9A 5K5NA 3MSSA 3LPBA 1QPDA 3KCKA 2HY0A 4AUAA 4LRKA 3VUHA 5KMLA 3KVWA 4XOZA 1FVVA 1PMUA 5GZ8A 3UVPA 3SAYA 2GQRA 3FLNC 4ZSJA 3V8SA 4IJ9A 2C6TA 5I5ZA 5TF9A 2NP8A 3OS3A 4A9RA 3ANQA 3BE2A 3KRWA 4WUNA 5IA1A 2ETRA 4FKLA 2PVJA 1OBGA 3ORTA 5DPVA 2X4ZA 3R6XA 3OUKA 3BQRA 2C5NA 2GSFA 2UUEA 4FTCA 4HVIA 5CU3A 3U54A 4FTOA 4FK3A 4A9TA 3PWDA 3RGFA 4EH8A 4QPAA 2GU8A 2PVMA 2XNOA 3A4OX 3KQ7A 4NL0A 1OB3A 3FI3A 3NPCA 2UW6A 4L6QA 5C8KA 5KKRC 4TRLA 3LKMA 1KOBA 3ROYA 3A4PA 2YACA 4ZTLA 4F6WA 5GJGA 3IW8A 2A1AB 2ITZA 4F7LA 4DF3A 2X1NA 3F5UA 3RM6A 4I93A 1OM1A 1U4DA 4BI0A 2PMLX 3VJNA 3UMWA 4FSYA 4LUEA 3OCGA 4I3ZA 5ANDA 2YCRA 5FRIA 2QODA 2JAVA 4IZ7A 4XCUA 5IQAA 2VWIA 3Q4CA 4L7SA 3NCZA 1FVRA 3QQUA 2VX1A 5HCXA 1UNGA 2ITXA 5CT7A 4C4HA 4UALA 4MXZA 4DAWA 3BWFA 4IWOA 4QNAA 3QKLA 5JFVA 2WHBA 3KRXA 3RINA 1R1WA 4YZDA 4YNEA 2BRHA 5EG3A 5E91A 4FTUA 3C0HA 3CY3A 2W4JA 4FTQA 3W2OA 1H25A 4XX9A 4AXAA 4F64A 2QOBA 3MVLA 1OKWA 2XIZA 4QMZA 3TNIA 4EWHA 4JBVA 3LFEA 4HYUA 4L9IA 4PUZA 1EH4A 4ZLZA 4L67A 1ZWSA 3AMAA 4G1WA 5EK7A 2CHLA 5EI8A 3LFSA 4KABA 4HPTE 5CF4A 2VWXA 2V0DA 3O17A 3F3WA 4HCTA 4NM5A 4PNIA 4ASZA 4BGHA 4AW2A 4PMMA 2BHEA 3FZRA 3KB7A 5HO7A 4NT4A 2AUHA 3FL5A 2J0KA 3F3TA 2H8HA 5BVFA 3W32A 5C4LA 4S34A 3CTHA 2YCFA 5BUJA 3E8DA 1WBSA 3QRIA 5ITAA 4FVQA 3FKNA 4GFGA 3RPYA 4ZY6A 3UIXA 3LJ0A 1NA7A 3H9RA 3T3VA 5HU9A 5FM3A 4ACCA 4RLLA 3FMJA 4X2JA 4AZSA 4DH8A 3SG9A 3TACA 4D5KA 3O7LB 4D2VA 5FEEA 4XP0A 4KWPA 2YEXA 5EYKA 3RCDA 3OVVA 3OW3A 3GCSA 4FKOA 4U7ZA 1SM2A 5HLPA 4MF1A 5D11A 2VX0A 3TKIA 1OL7A 3NSZA 4C36A 2FYSA 4YJQA 5CSHA 5K3YA 4LI5A 4F09A 1ZY5A 1Y57A 3P23A 5IG1A 4QYGA 3TNWA 3Q9XA 4FG8A 4WBBB 3V51A 3QX4A 2YFXA 4D1XA 3EIDA 3EL8A 3G2FA 3KU2A 2R7IA 4EUUA 4JAIA 5AR4A 4L42A 3BEAA 1WBPA 4XOYA 3L9PA 1XWSA 3K3IA 3L9LA 3UNZA 2WMAA 2C3LA 5CEQA 4WOVA 4QYHA 3EB0A 4QP2A 2HZIA 4K2RA 1UWJA 2WMRA 4IB3A 3ZSGA 1VYZA 3CD8A 1BYGA 1YXTA 5I3RA 4YZBA 1UWHA 3I6UA 3PE2A 3TZ9A 5EM5A 4AOTA 1YQJA 4RQVA 4C59A 4KKHA 4YO4A 4IB0A 3HMOA 4RA5A 5GHVA 3WE8A 4M97A 4NM7A 3Q4UA 2VNYA 1M17A 4RGJA 3F2RA 3AMBA 3GCQA 3UE4A 2VTMA 3F5XA 4FT5A 1YXSA 4JBOA 4KA3A 4MVFA 4QMPA 4D2SA 2HIWA 3EN4A 1R0PA 3JYAA 1FINA 5ETIA 4MBLA 4DE4A 3GU8A 4HJOA 3E93A 3DJ6A 4B8MA 4E5AX 1V0OA 3QD3A 5EYDA 3V3VA 4ZJIA 3SRVB 4UXLA 3MV5A 4KBCA 4O0VA 2YZLA 4AGDA 2YM3A 5BVOA 5FXRA 1WBVA 3EQHA 4X0MA 4CT2A 5AP7A 4F08A 4XH6A 3PSBA 4ANNA 5AP6A 5FM2A 4LG4A 3LMGA 3MWUA 3HV6A 2Y0AA 4II5A 2GTMA 5H8GA 3RHXA 2YDIA 4XV1A 5KZIA 4K0YA 3SKCA 1U54A 4EBVA 4JT3A 3P0MA 5HESA 4FV9A 4YHFA 2X8IA 4U3ZA 2QOFA 4AOIA 2CNQA 3BYUA 3WE4A 3QWKA 4AWIA 3CPCA 3TWJA 3H9OA 4LGGA 3BV3A 2W99B 4TPTA 4FT0A 2GHMA 5BVKA 5M53A 1AQ1A 2Z7QA 3NNWA 4L3JA 4BDIA 3NYNA 3MTLA 4XV3A 4AA4A 4CVAA 4TWCA 3VUKA 4WNKA 3EJ1A 2C5VA 4DC2A 3U9NA 3DA6A 3RWQA 3UPZA 2JDRA 3DBDA 1BL6A 4ZS0A 1RDQE 1YOJA 2CJMA 2GNFA 2CCHA 1CDKA 3T9TA 2YERA 1U5RA 2IVVA 3F3UA 4W4XA 3HRBA 4WNMA 5EM8A 4ID7A 3LE6A 2ITPA 3WF7A 4RT7A 5M08A 3R8PA 4DGLC 4MD8E 2R3RA 4OBQA 4R5YA 4D4YA 2ITTA 1SNXA 3BE9A 2PMOX 1PXKA 1XKKA 5DIAA 1O6KA 1XBCA 3SXFA 5C26A 3C9WA 5LVLA 3SC1A 1L3RE 2OJGA 3FPQA 1MRVA 2GS2A 2X7OA 4FOCA 4WG4A 3SW4A 4AZVA 1RJBA 5A4QA 5L2WA 4OUCA 3NYXA 1PXOA 2BR1A 3FMNA 1W82A 1P5EA 2QG7A 3ORIA 1TQIA 5B7VA 3BHUA 4BCGA 2XBAA 3SX9A 3HRCA 3FLSA 1KE7A 3K5VA 3W2CA 3IKAA 2XEZA 4PPBA 4XV9A 2UZTA 3RKBA 1OL5A 2J51A 2B7AA 3ACKA 5AV2A 5JGBA 3F6XA 1YDTE 3Q5ZA 3WF5A 2X0GA 5I3OA 4DITA 4DH3A 4QP1A 4N6YA 4TYHA 3ZRLA 1A9UA 2B4SB 2XYUA 4E20A 5L6WL 3UVRA 4MAOA 5GINE 3ORLA 3NDMA 2X8EA 5KUPA 3PJCA 4X3FA 4E5BA 3PIZA 4AW0A 4DGMA 4DT8A 3UC3A 1ZYLA 2E9UA 2YCQA 3C4CA 4EK3A 3HUCA 2JDSA 4E73A 1JKKA 4FV1A 3AOXA 2JKMA 4C57A 3F7ZA 4MXYA 3PY3A 5LWNA 2XK9A 3KULA 4JBQA 4BDJA 4L01A 4UEUA 5CEOA 3S3IA 2UW9A 4G31A 1MQBA 3VS5A 3OZ6A 4EH4A 2OZOA 4YPSA 2HK5A 4KSPA 1CTPE 2X2KA 4U5JA 1KWPA 3DB6A 4JOAA 2OLCA 2NRYA 1GIHA 2PE0A 3UIUA 3LCOA 1I44A 2CLXA 3K3JA 3BWJA 3CY2A 3M1SA 5AMNA 2Y7JA 3QUDA 4CZTA 5IQBA 1UV5A 4GYIA 4WG3A 4B8LA 3MB7A 3WZJA 4YJPA 2R3FA 4IHPA 3FDNA 3LMHA 3C4FA 3PG1A 4FTAA 5IZFA 4Q9SA 4U3YA 3LLTA 1IEPA 1YOLA 4V01A 1AD5A 1OUKA 4GV1A 3GU5A 2QG5A 3PRFA 4ZTNA 4FBXA 3A8XA 2VD5A 4JBPA 4BICA 4DTAA 3N4UA 3VHEA 1OBDA 4LM5A 1PYXA 3O50A 4UWYA 3JR1A 4M68A 2OF4A 4AZTA 4LQMA 4I4EA 5DE2A 3HMNA 3PSDA 3SW7A 4FNZA 3R8ZA 4D55A 2XIYA 4D1ZA 3FYKX 4CFFA 3HDMA 2A27A 4PP9A 4AZWA 2X81A 3EFLA 5CEIA 4AE6A 1G3NA 4LRMA 5DFPA 2ZVAA 5CS6A 5EHLA 2UW8A 4UV0A 4R7HA 3DBCA 3OMVA 4H36A 5HCZA 5M51A 3ALOA 2VWUA 2XCHA 2PVRA 2ERKA 3PTGA 1WBTA 4FF8A 3Q32A 4R1YA 3UDBA 1J7IA 4IH8A 4N57A 5H8EA 2Z7RA 1XR1A 1Y6BA 2HZNA 2CNVA 5HNGA 3QFVA 5D7VA 3HDNA 3WYXA 3DXPA 2YA9A 4UMRA 4FSTA 2FSOX 4GRBA 2EXMA 3DK6A 4X7QA 4QD6A 3OT3A 3SVVA 4JG8A 1Q99A 4MCVA 4GEOA 4O1OA 4PMTA 3MFRA 3QGYA 3VS1A 4FVPA 4L00A 4DINA 2R3JA 4CMOA 3W55A 5AV4A 4EOSA 4JG6A 4CKIA 3RPOA 2XIKA 4KIKA 4BKYA 1H1WA 5AUZA 2W9FB 4EQMA 4IJPA 4G6OA 4GYGA 4HGSA 3W33A 2C6DA 4RFYA 1ATPE 4MH7A 4EH3A 5L6OA 3DV3A 4O7LA 4V04A 1QMZA 1M52A 5CTPA 1YHSA 4BCMA 3MPTA 4C3PA 3O8PA 3GFEA 2X7FA 1MRUA 1YWNA 3QBNA 3UVQA 1H28A 2C3KA 3ZO1A 4EQCA 3WBLA 4J96A 1R78A 3GT8A 2XF0A 3CE3A 3BGQA 4BDKA 4IZ5A 4PTGA 5C1QB 1L8TA 4ZTRA 4CFWA 4C4IA 4QMUA 3C5IA 5J9YA 4W9XA 4C3FA 1E1VA 3NZ0A 4XRLA 2XK3A 2RF9A 3LIJA 5I9WA 4BZDA 3D9VA 4GFOA 4AN3A 1UU8A 1JQHA 3MH3A 3ZSIA 4QMXA 4RWIA 4OW8A 4GIHA 2YCSA 2JD5A 1QCFA 2H96A 2XEYA 3QCXA 3FWQA 4CZUA 3GVUA 2XK4A 3WYYA 3DXQA 2VU3A 3P08A 3RTPA 5M4IA 5IMEA 3Q4TA 4BCKA 5HE1A 4YZNA 3G33A 5CNOA 3H9FA 4QT1A 5CSWA 3D7TA 5C03A 3R8UA 3RCJA 4FZAB 2Y4PA 5DVRA 4CSVA 2ETMA 4DEDA 3DOGA 1ZOGA 2OK1A 4FTJA 1BL7A 3FKOA 2UZEA 3JVSA 1G5SA 4IDVA 3GQLA 4H1MA 2GQGA 1P2AA 5D41A 5CT0A 3ETAA 5I9YA 4PMSA 4GJ3A 4Q2AA 3ZZEA 2Z02A 3WF8A 4C61A 2WNTA 4FEWA 4DG0E 1OITA 4CMUA 4TNDA 3ZC5A 2Y6MA 2OZAB 1F3MC 3PPZA 4BDFA 4QMSA 4P90A 4CEGA 1GOLA 1OPLA 2WMTA 2X2LA 4LL5A 5BYZA 5LVOA 1JAMA 4ZZMA 3RK5A 3E62A 3ULZA 1FOTA 3UO5A 1Q8TA 2VO7A 3BKBA 5DHJA 4YUQA 5KBRA 4PRJA 4KIOA 2QHNA 5CZIA 4YR8A 4FT3A 2R9SA 3I60A 2ACXA 3QALE 4GVJA 5IQDA 4I92A 2QOQA 2RFNA 4NTSA 4X2FA 4ZAUA 5JMSA 3QTZA 2BROA 4JJRA 3A7HA 3O51A 4CRLA 4DFLA 1FGKA 4YZ9A 2R3GA 3SGCA 3QYWA 2OU7A 3A7GA 3Q53A 5HICA 4RMZA 1PMEA 4O7VA 3A8WA 4D9UA 2RIOA 5BVDA 3H4JA 3FHRA 3QZFA 4AG8A 1PXPA 4AGCA 4ZY4A 4RJ4A 4GT4A 4IW0A 3V5PA 5HLNA 5LMBA 3KCFA 3MIAA 1U59A 3IG7A 5BMSA 5DMZA 1SZMA 4QO9A 5CVHA 4E8AA 2P33A 3IS5A 2NPQA 2OXXA 1KV2A 3AD4A 3F3VA 3A2CA 1H00A 1YI4A 4EUTA 3RPVA 2J5EA 1RQQA 1YWRA 3NUPA 3F82A 3P5KA 4FGBA 3H3CA 3BYOA 5KO1A 3R9RA 5JN2A 2ESMA 4RLKA 5AP5A 1FMOE 1OIQA 3FI2A 2VGOA 4K33A 3HL7A 3SXSA 1OL6A 4Y46A 3UJGA 3FLQA 3KRRA 2X4FA 3ODZX 2WTWA 4FV3A 3K5UA 3M42A 2BRNA 3FY0A 2XH5A 3BU5A 5F4NA 3PLAE 3PIYA 3S00A 2PTKA 3OW4A 2GS6A 2YITA 1WBNA 4I5CA 1JKTA 3DNDA 4F9CA 3CCNA 3BHHA 4JQ7A 4AGUA 2W4OA 3FE3A 4I1ZA 4M0ZA 1Z57A 3WZUA 4D2RA 4FKPA 4YHJA 3KC3A 1XQZA 3BZ3A 4LL0A 4XUFA 3L9NA 4RZWA 4IACA 4BYIA 2UZWE 1QPEA 4NJDA 2QOHA 1BUHA 3Q04A 3EN9A 4I20A 4X21A 4XEYA 2AC5A 1LEWA 2RFSA 3VUMA 3E8CA 2I6LA 3TZMA 3ORKA 3WZEA 3CPBA 4G3GA 1WVWA 5HE0A 1KE6A 3SXRA 4K77A 3UGCA 1V0BA 3COKA 4JQEA 3V01A 5CF8A 4CLJA 5BVNA
chains in the Genus database with same CATH superfamily
1S9IA 3FC2A 3I6WA 5HGIA 4DG2E 4H05A 4B4LA 2BIKB 4FK6A 3TG1A 3R01A 5CSXA 2J90A 5JRSA 2PULA 3VQUA 3VHKA 2HZ0A 4FV4A 3EQRA 5CNNA 2NRUA 4OBOA 1H0WA 3DT1A 3OOMA 1H1RA 5HNBA 1H01A 4DFXE 3KF7A 4C0TA 4BBEA 2BZJA 2UZUE 5H9BA 4RFZA 1LEZA 2B52A 2OIBA 4NSTA 4HCVA 3VC4A 2WXVA 4C4EA 2XRUA 5KHWA 4QP8A 4GUEA 1B6CB 4G3EA 3VF8A 4G6NA 4C33A 4AW1A 5IA2A 3B2TA 4MXCA 4DGNA 2UZBA 4I6HA 4OTHA 2GPHA 2FUMA 2QOCA 4XP2A 3JVRA 2J5FA 4HVDA 3R1SA 4BCNA 1BKXA 4KAOA 4ORKA 5M4FA 5FD2A 4BDHA 3R7EA 4HOKA 2YJSA 4RC3A 1IRKA 2EXCX 4F1TA 5ICPA 3NUYA 1ZRZA 2W96B 3NNUA 1B39A 5FWKK 3R9NA 4GH2A 3NUXA 3OCBA 2YDJA 3P4KA 2B53A 1Q8ZA 1ZMWA 2WTKC 3ALNA 3OCTA 3E5AA 2VWWA 5E8VA 3AC1A 3R1QA 4L45A 1WAKA 3QKKA 2OBJA 5JFXA 2PMNX 1SNUA 4LV5A 1FQ1B 3QTRA 4IANA 1F0QA 4I0TA 4OTPA 4R3PA 4BDBA 5C4KA 1WBOA 4M69A 1ZXEA 4YJNA 4UYAA 3VRYA 3OHTA 5KE0A 5HBJA 4XBRA 3QD4A 2UZLA 4KKEA 2Z2WA 3COMA 4HCUA 4ONAA 4NUSA 4AT3A 1M2RA 3EN6A 5A6OA 3VS4A 1IAHA 5CF6A 3NVKI 3BBTB 5HI2A 4J71A 1JLUE 5AUVA 4IVCA 3KY2A 5LARA 4GU9A 3ZLWA 4O96A 2BDFA 2QR7A 3NUNA 4XNEA 2XKEA 3LCDA 4D28A 4DTKA 3DZQA 4EYJA 5ETAA 2X6EA 3O7LD 4OTGA 4CCUA 4EK4A 4O84A 3NW5A 3NUSA 4N4SA 1SMHA 3I5NA 3QCQA 3EKNA 3QQJA 5IDNA 5IUIA 3UOLA 2PVLA 4FEQA 5JH6A 3NLBA 4QOXA 4AFEA 4PF4A 3W0PA 2VX3A 3IONA 4O0YA 4Y73A 1V1KA 2CSNA 4FNXA 1Q3DA 3FL4A 2VGPA 4IMYA 2W05A 4IZYA 3GOPA 4P5ZA 4QMWA 1R39A 2REIA 4AN9A 4QP6A 3RPRA 2VWYA 3WZDA 3LFBA 4FV6A 2W5BA 2BTRA 2XAMA 4F0GA 3R63A 3CQEA 1WVXA 2YWPA 3GXLA 3PXZA 4RJ5A 5F1ZA 3QGWA 2GNHA 1KE5A 2RFEA 3TIYA 4IVAA 3BLHA 3QRTA 1H4LA 3GQIA 3QTSA 2WQOA 3R8MA 4FR4A 3MY0A 4JI9A 3DBQA 3NUUA 2HCKA 4W4YA 2W1ZA 5HG7A 4ZIMA 2IZSA 5HCYA 4FYOA 3W1FA 4BFMA 3BGPA 2UZVA 2OF2A 3ZXTA 5J87A 4CD0A 5L2QA 3FUPA 4FKGA 4EJNA 5A4LA 4CTCA 4L68A 3CJFA 2X39A 4O7YA 3GNIB 2WELA 1H27A 2XKDA 3MS9A 4QYYA 5A6NA 2VTAA 2W1IA 2ONLC 4W8EA 3JXWA 4I5PA 2I7QA 2R0UA 1LUFA 3HAMA 5CY3A 5J1VA 2WKMA 1PXLA 4U40A 3LCSA 4EYMA 5I0BA 5LCKA 3OTUA 5LMKC 3ZXZA 4YLLA 2JDVA 2R3MA 5KBQA 1K3AA 2Z7LA 3ORZA 5J9ZA 2YM5A 1MUOA 2IW8A 1REJA 2WU7A 3RPSA 2BKKA 2P0CA 5DH3A 1PXJA 2GNGA 3DFAA 5GIPE 4QMMA 2BZIB 1CMKE 3CLYA 2JIIA 4U41A 4GVAA 2PY3A 3DKFA 4GW8A 4BZOA 3TUCA 2QNJA 4R8QA 4BI1A 4EKLA 1QPCA 1XO2B 1STCE 4MTAA 3DGKA 3DK7A 2C1BA 3IECA 3ORPA 5FDXA 4RIWA 3U4WA 4AX8A 4USFA 4ERWA 3PDTA 2WEIA 5E8UA 4TW9A 4JDHA 3ZRMA 4APCA 2JEDA 3LVPA 3ZC6A 2Y4IB 4O0TA 4FZFB 4DBXA 4L7FA 4G16A 5BQ0A 4FSZA 4XG6A 1UA2A 4IAZA 3PZHA 2W1HA 2X7GA 4CNHA 4DBNA 5IQHA 1VR2A 1PY5A 1PXNA 5CWZA 2F2UA 1ZOEA 4WIHA 2ZDTA 4FSWA 3ZM4A 4TWNA 3EQGA 4YBKA 3KVXA 3QUPA 2KTYA 4UYNA 4XG9A 4RFMA 2W9ZB 1IR3A 4M0YA 3Q6UA 4G6LA 4O7WA 4KRDA 3U55A 3AQVA 1XH8A 2IZTA 4C8BA 4DH1A 4IB5A 3BHTA 3UZRA 4M12A 2FH9A 5IMXA 2RG5A 4RVTA 5CEMA 3MTFA 4L46A 5CZHA 2HW7A 4YO6A 3TKHA 3IW6A 2HYYA 3W2RA 5GZ9A 1YI3A 2J50A 4TN6A 3ZH8A 4RJ3A 3KGAA 5BYLA 3QD2B 5ANIA 3ORXA 4MNFA 2CKEA 4DGGA 2C68A 3E3PA 5HHWA 4EOKA 4MXXA 5HG9A 3BRBA 2QU6A 3R9OA 3FYJX 4F63A 3IOPA 3ORNA 3QQKA 2PVKA 2XM8A 1JOWB 1DI9A 4R7BA 5IISA 1Q61A 4DCEA 1P4OA 2ITVA 3LM0A 2X2MA 2XJ1A 3MB6A 2UW0A 2WO6A 3CQUA 3Q96A 4WNPA 3R71A 5DRDA 3CIKA 3UOHA 2ITOA 4O6LA 5CXZA 1NW1A 4NTTA 2P2HA 4LOOA 5FXQA 3CTQA 4S31A 3FZTA 3PP0A 4WHZA 1APME 2V5QA 3Q3BA 5L4QA 4UMTA 4O4BB 2PYWA 4BKJA 1XH6A 5FEQA 5GJFA 3TV6A 4RZVA 3IW4A 4MXAA 4I4FA 5AR3A 3R9HA 5IQFA 2OFVA 4ANMA 4ZJVA 5LVMA 5DLSA 4HZSA 4GMYA 3ET7A 4NWMA 4BL1A 2C47A 4K11A 5JSMA 4W9WA 5AP2A 4CYIA 1VYWA 4QYFA 4EONA 3BU3A 4DLIA 3BELA 3AT2A 2JIUA 5K4JA 1ERKA 5K0KA 3P7BA 2R4BA 2C5OA 3ROCA 3KREA 4P4CA 4IFCA 4PP7A 2WQMA 2QKWB 4HNIA 5JGDA 4M66A 1H0VA 4H1JA 3GU7A 4GG5A 4AQKA 4RVKA 1GNGA 1Y6AA 5TR6A 1Q24A 4M14A 3CSVA 3EN7A 3MFTA 3QQGA 4FYNA 5E8WA 3ZOSA 2VAGA 4LV8A 5AR7A 5AR5A 2IN6A 3TV4A 3VN9A 1YDSE 5E92A 3TN8A 1ZYCA 2QHMA 4Q5EA 5AAFA 1OECA 3NFFB 4QEBA 2O64A 4J8NA 4LRJA 3MW1A 5FEDA 4C7TA 1VLRA 5FUTA 3Q5IA 5BVWA 4QYEA 3FMDA 4RX5A 1BX6A 4ITHA 3HX4A 4YTIA 3ZYAA 3T8OA 3W8QA 3G6HA 2E2BA 3SLSA 4BKZA 2XIXA 4RVMA 4JG7A 2HOGA 4NM0A 2BTSA 2ZYBA 4L3LA 4NKSA 4WKQA 5L2TA 4AXFA 4AT4A 5M57A 1LPUA 2OXYA 1T45A 4F1OA 2BAJA 4RC4A 5JKGA 4QDVA 2J0LA 2Y4IC 2WMUA 3CEKA 5DOSA 3QQFA 3IW5A 3QZHA 3VVHA 4UBAA 1PW2A 4JL9A 2UVZA 4GJ2A 3UG1A 4QTCA 5EI2A 1E1XA 2GNJA 3G0FA 4XJ0A 3VAPA 4IB1A 5CAPA 3CS9A 4O2ZA 2YIWA 4BHNA 4ZMEA 3MFSA 4FG9A 3FAAA 3N9XA 5L8KA 4ZSAA 4DN5A 1SYKA 4HYIA 3WZKA 3F3ZA 1JWHA 2PHKA 2VTIA 5ANEA 2J2IB 4BIDA 4GIIA 4R3CA 3PJ3A 4F0IA 3HVCA 1PYEA 1GAGA 3FMEA 1UNHA 4O38A 3D5VA 4NU1A 3O96A 2JAMA 4MD9E 5A46A 3CXWA 3SQQA 2J6MA 3V6SA 5K0XA 2YLFA 3RZFA 3UNKA 5BNJA 4I24A 5TOZA 4MXOA 4EOMA 3PY1A 3GUBA 3QC9A 3U51A 2BIYA 4XLVA 4BF2A 3R7YA 4BDGA 5AA8A 2BCJA 2QURA 3ERKA 1YVJA 2XNBA 3JY0A 4E6AA 4Y8DA 3FI8A 1YI6A 4CFMA 4IVBA 2W1GA 3K2LA 4TKSA 4BDAA 3HLLA 4CFXA 3PLSA 5BMMA 4D4RA 1O6LA 4EOLA 3FPMA 3ACJA 4EHEA 3VUTA 1IA8A 5AV1A 4Z3VA 2B0QA 3ZCLA 4IFGA 1RW8A 4XG2A 3VJOA 4CYJA 5HIEA 3LLAA 5JQ8A 4DDIA 3C4EA 4JR3A 5AWMA 2P3GX 3F61A 2XKFA 3BEGA 4CCBA 3C5UA 5K5XA 2ITYA 3OEZA 2R3OA 5J8IA 3SD0A 3FKLA 1QL6A 2J0IA 4R3RA 4EH5A 4A7CA 3A7FA 4WSQA 3U87A 4QP4A 2CLQA 3ZM9A 2WTJA 4FL2A 4I0SA 3G90X 5EDRA 4D1SA 3DY7A 3EQDA 3L8VA 4ZY5A 3C0IA 2IW6A 4LOQA 3W16A 2YN8A 1G8AA 2V7OA 5CVFA 4OGRA 3VBVA 3I0OA 4EZ3A 4YURA 5E4HA 1U5QA 2W5HA 3O8TA 3PE1A 3RVGA 5B2MA 4JX7A 3B8RA 1PXIA 5IPJA 4IVDA 3RNIA 3F2AA 1PXMA 5KMJA 2EB2A 4O4CA 3O23A 4FI1A 5IA0A 4RWJA 5E8SA 5CSVA 4X3JA 4IWQA 4FTIA 4NZWB 3VBYA 4EI4A 3UOJA 4D2WA 5AFVA 5HO6A 4KKGA 1BLXA 4L53A 3W18A 4XYFA 3SHEA 4A9YA 3TUDA 1YXXA 3HMMA 1Q97A 4GT5A 3UYSA 2C3IB 2EVAA 1OZ1A 4QMVA 4PMPA 1TQPA 2C6MA 3AGMA 3JS2A 1W84A 2YDKA 3D5XA 4FUXA 4WD5A 1ZYSA 4UWBA 5EQPA 3BU6A 3MH1A 5D7AA 5L8JA 5AJQA 3ZLYA 3W8LA 1UNLA 2EB3A 3FHIA 3AT3A 3GI3A 4F9BA 4D4VA 2XJ0A 1OGUA 5E7RA 4E1ZA 5CU6A 3AC5A 2OXDA 4H39A 4S2ZA 3DKOA 4FV7A 3Q9YA 3CP9A 4I5MA 4NCTC 5EI6A 3TIZA 2G9XA 2HELA 3D83A 2VRXA 3R30A 4YJVA 3E8NA 3QTWA 2WGJA 5T68A 1Q5KA 3G6GA 3A99A 4BWKA 4DEIA 5C27A 3DKCA 3QZGA 4BDCA 5AP1A 5GZAA 3LXKA 5DGZA 4BWXA 3HECA 5GJDA 3FEGA 1PKDA 4FT7A 4TTHB 5L2IA 2O2UA 4RSSA 3RJCA 4C58A 5LQFA 5M56A 1FGIA 2I1MA 4IIRA 4R1VA 1X8BA 3QQHA 4E6CA 2HXLA 3BL7A 3R8VA 5IUHA 2CGWA 2WMVA 4W4VA 5EOBA 5CVGA 5IDPA 1U54B 1WFCA 2FA2A 4HVGA 4CV9A 2DWBA 3MGYA 3UZPA 4DEGA 3TZ8A 2XA4A 3RI1A 5M4UA 4ZLOA 2WTVA 4IX3A 2OWBA 2FSMX 3HRFA 5LXMA 3KXXA 2XAOA 3C4WA 3M2WA 4G3DA 4YTHA 1H1QA 5KMMA 4FOBA 1JKSA 4FTTA 4LMUA 4A07A 3QTUA 5I9VA 3O5AA 5J95A 4NIFA 4O21A 1PMNA 5EH0A 3LOKA 2XYNA 4EQUA 3MI9A 4IE9A 2GHLA 4BI2A 4YJTA 1OI9A 3DAEA 4RQKA 4QTBA 5DNRA 4AXEA 3ELJA 3L1SA 3PPJA 4XMOA 5JQ5A 4B99A 3E64A 2ERZE 3MBLA 2W06A 5DT4A 3TTIA 3TV7A 2OJIA 2C6EA 4F6SA 1Y8YA 5FTQA 5EM6A 3FMMA 2PZIA 3TNHA 5CU2A 3L8PA 2EXEA 2XVDA 1B38A 4LOPA 5EM7A 3PG3A 5CLPA 5ANKA 3BCEA 3QYZA 3VW6A 4OTWA 2BVAA 3PXFA 3NYVA 4QMTA 4YJUA 4O81A 3CGOA 4ZTMA 1XBAA 3AC8A 3P7CA 4I0RA 4RIOA 2C6IA 3WIKA 5EYCA 1TFFA 5DG5A 4EORA 3HKOA 3V8TA 3OEFX 3OY3A 1YKRA 2YM4A 3KN5A 4K18A 4M67A 3TNPC 5FGKA 3VS0A 4ZZOA 3MESA 4FE2A 3FMLA 3DQWA 4O4DA 3VQHA 3BYSA 3NAXA 1J3HA 4KBAA 3R7UA 3HNGA 1CM8A 4ALVA 4F7SA 5GIOE 3KRLA 4D5HA 3WOWA 4YGAA 2JDOA 1ZLTA 2PVFA 1URWA 4JXFA 4YLKA 3V5WA 4AE9A 3EFJA 2YM8A 3A60A 3OTVA 3G0EA 4FKJA 2VTPA 4NEUA 3I7CA 4TYHB 4DFZE 1JSTA 1O6YA 4OT6A 2Y6OA 3TI1A 3UOKA 4BCIA 4DLJA 3GENA 3LFFA 3QHWA 3ZMMA 2JBPA 4X3FB 2CGVA 3IGOA 4HZRA 4OTFA 3WF9A 5HG8A 4QDEA 4CZYB 2YIRA 2ITQA 1E9HA 4QMLA 3VBWA 3DLSA 3G9LX 3WILA 1Z5MA 3NS9A 3OWKA 4KS8A 3AG9A 4G5JA 4I23A 2C0TA 5M44A 4PV0A 3KULB 5F94A 4UMUA 5CU0A 2IO6A 4CFVA 4NM3A 2X9EA 2ONLA 3P7AA 4RRVA 4XP3A 3RM7A 3UPXA 3G5DA 3O71A 2XK6A 5I9UA 3A7JA 3W0OA 2VNWA 4V05A 4G34A 4DH7A 1HCLA 3BIZA 5M06A 5M09A 2I40A 2QU5A 3M11A 4O6EA 1PHKA 3EKKA 3ZO2A 4UN0C 3RAKA 1J1BA 3KXHA 4W4WA 5EFQA 2F7EE 2VTJA 5LMKA 5ANGA 5ACKA 4GS6A 3QLGA 3UODA 3IDPA 4ITJA 4IX6A 4JDIA 3VBXA 3GU6A 5DR6A 2VTLA 3UO4A 3LXLA 4D0XA 3C13A 1OVEA 2FSTX 3HV5A 4JS8A 4RIXA 5AR8A 3QXOA 3TTJA 3TDWA 1XMMA 3W2QA 1CKIA 5EQEA 3ENHA 5E90A 2Z60A 5J79A 2QOOA 1FBNA 4G2FA 4LGHA 4RJ6A 1GJOA 5FG8A 2CN8A 5DEYA 3KMWA 2ZV8A 3LXNA 3QXPA 4R7IA 1VJYA 4FZ7A 4P2KA 1MRYA 5EHOA 2PUNA 5DI1A 4FRFA 2JIVA 4YNOA 3PVUA 3HZTA 5HQ0A 4O7RA 4DCAA 3DTCA 3EFWA 2GFSA 3QKMA 4BCQA 3Q2JA 1H1PA 2ZOQA 4FSMA 4IAKA 2WQNA 4JLCA 5CQUA 1H08A 4ZSEA 3NIEA 5FTGA 2R3IA 3PWYA 5J9LA 1GY3A 2B9IA 5IF1A 3D4QA 3ORMA 3IDBA 2CMWA 2Y8OA 1UU7A 2W5AA 4GCJA 4FV0A 4FKSA 5HKMA 5ANOA 5JZJA 3PFQA 3ZUVA 5FP5A 3V5TA 5CAOA 2OFUA 2YWVA 3QA8A 1M7QA 2V7AA 3BYVA 3ANRA 2C5XA 3GC7A 3S2PA 4C62A 2YAKA 4AFJA 4FX3A 3ZFYA 4XHKB 3ML1A 2OG8A 3R7VA 3Q52A 1OIUA 2XNGA 2O65A 3OOGA 4XG4A 3VBQA 3EHAA 2QR8A 3AC2A 3I1AA 4P7EA 3UMXA 5A4TA 5EDPA 2XCKA 5HIBA 1KE9A 1TKIA 4KIPA 2WAJA 2E9NA 5AP4A 5KZ0A 2VO3A 3U8WA 3DCVA 4EK6A 4EOIA 5L2SA 3W0MA 3GBZA 4MK0A 3OFMA 1BI8A 3FLYA 4JAJA 5AP0A 3VBTA 1DI8A 1FMKA 5KHXA 5EKNA 5A4EA 5H8BA 3NYOA 4FTKA 4KIKB 4EEVA 3DXNA 4QTAA 2AEGA 2IJMA 4FIFA 4PDPA 2WTDA 4ANLA 5LMAA 2X9FA 3PPKA 4D9TA 5IH5A 2ITUA 3P79A 4TYIA 2QO7A 4C38A 4OT5A 3KMUA 4CKJA 4U45A 4E6DA 2QO2A 3OUNB 4IM2A 4RG0A 1GIJA 1O9UA 4ARKA 2R7BA 3I79A 3MJ2A 5T3QA 4QQCA 3GC0A 2Q0BA 4GU6A 4R5SA 3EQPA 5K9IA 3FZ1A 4KD1A 4OTQA 1ZAOA 2CCIA 2ZM4A 3L9MA 3R7IA 3SA0A 5HX6A 4ZS4A 4FSUA 1H26A 2OJJA 4BCPA 4P5QA 4PX6A 5LJJA 2PZRA 1TVOA 1ZYJA 3KXMA 3DAKA 4NJ3A 5ETCA 3UQCA 3RMFA 2CKPA 1JPAA 1TZDA 1J7UA 4O27B 3EYGA 3QHRA 4XRJA 4CV8A 2PZPA 4ZOGA 3OWJA 2O3PA 4RX8A 5GNKA 5DT3A 4JRVA 3QCYA 3D7TB 3E92A 1XH9A 5E8ZA 1V0PA 3THBA 3I7BA 5FLFA 1H07A 4FIJA 4NK9A 4WA9A 3CBLA 2HW6A 1M7NA 1M14A 3EN5A 3PIXA 2JDTA 2JC6A 5AV3A 5DWRA 4V0GA 2R3KA 2VZ6A 4EH2A 4D58A 4Q5HA 3U6JA 3QA0A 3R04A 3ZO3A 2ZV9A 3QRUA 4ACGA 3CTJA 1Q4LA 3G9NA 5FBNC 3IGGA 4YMJA 2YIYA 3D2IA 3NIZA 3WIGA 4LV7A 1UU3A 3O8UA 1OKYA 3FQSA 2GS7A 3REPA 3MJ1A 4YLJA 2ZMDA 4FIGA 5HLWA 3LCTA 2XS0A 1I09A 3SOAA 2G2HA 3BI6A 5M4CA 3R73A 4D2PA 4EWQA 4BTKA 3L8XA 3H30A 4TWOA 4BDDA 2GNLA 3EL7A 5KKRB 1ST4A 4XG7A 3AKLA 3PUPA 1Q8YA 2R3QA 3TJCA 4FEUA 4CQEA 5KCVA 4FEVA 2IEWA 4Y95A 3LJ1A 3OWLA 4F70A 4GK4A 3UNJA 1K9AA 2VTRA 3LQ5A 4M15A 2UW5A 3PRIA 4TNBA 4H3QA 4E26A 5HIDA 4ANOA 2B54A 4RBLA 3VUIA 4EZ5A 4UWCA 2CNUA 4PDYA 3FV8A 4GK2A 2XK7A 3H0ZA 3IDCA 3MA6A 3OY1A 3POOA 3ZONA 3NGAA 1JSUA 3ZRKA 2YIXA 5IA4A 2OJ9A 3GC8A 4FL3A 3I81A 3BBWA 3KXZA 4PTCA 3V04A 4WUAA 2YHVA 4ZXTA 1XBBA 3CJGA 4GK3A 4IC8A 2F2CB 2ZAZA 4L8MA 2PE2A 5J7HA 3FSFA 4BN1A 4FIHA 1J1CA 2ITWA 1PF8A 3LZBA 5J5SA 4O7NA 2C30A 2WTIA 4F9AA 5AUUA 4DFUA 1BMKA 3PJ8A 1KE8A 4F1MA 5B0XA 2BFYA 3BLRA 4KBKA 4KIQA 4I94A 4OTRA 2PVNA 4QTEA 4E4LA 1W83A 5CEPA 3AMYA 4IBMA 4J53A 5G6VA 3VS3A 4EOOA 3ZS5A 4EK8A 4XG3A 3AD6A 4KRCA 1P4FA 3BHVA 5CX9A 3E3BX 5AP3A 3H0YA 4A4OA 1G8KA 2HY81 4UZDA 2I0EA 5LCJA 3LM5A 4BTJA 3CR0A 3QZIA 1CKJA 3IOKA 4DEAA 5HNIX 4YC8A 4FICA 1URCA 4BYJA 5A14A 2DYLA 2G2IA 4IX5A 4EHZA 2QOLA 2ETKA 4HNFA 4IXPA 5M55A 2C5YA 5HOAA 3F69A 4MX9A 4ZMFA 4CTBA 4EKKA 4BTFA 2PSQA 3AXWA 1NVRA 3FMKA 3FY2A 4FNYA 1OKVA 5HTBA 1J7LA 2Q83A 5CU4A 3EMGA 2PK9A 3MN3A 4AU8A 3D2KA 4ZSGA 1IASA 3MH2A 3DBFA 5EKOA 2GHGA 3VS6A 2GDOA 3KN6A 3NRMA 4G3CA 4MNEA 2P2IA 2UVXA 3POZA 3W0NA 3NX8A 4FZDB 2J4ZA 2OO8X 3RHKA 5IEXA 2VTQA 3CKWA 3RAIA 3DPKA 4KNBA 3F66A 1NT2A 4ANQA 2WMBA 2RKUA 4O0WA 5DR9A 3VO3A 5HEZA 3A7IA 5IQCA 3QU0A 5IA3A 4GT3A 3UQGA 3PVWA 3UTOA 3ENMA 3PA4A 5IU2A 2UW3A 2WMXA 4CQGA 1JKLA 5HU3A 4QQTA 4JIKA 3MH0A 2B55A 4FNWA 1GZOA 1OL1A 2OGVA 2WQBA 4S33A 3R8LA 1CKPA 4A06A 4FODA 5CANA 2B1PA 3S95A 2WU6A 4V0GB 3UIBA 5TO8A 4I6FA 4HPUE 3GGFA 4I6BA 1Y8GA 5IA5A 3VS2A 1JNKA 4LDTA 2XNEA 4YSJA 3NR9A 4ZLYA 3AD5A 1W0XC 2R3PA 3VNTA 1REKA 1WMKA 4IEBA 4A4LA 2FSLX 4GL9A 2BDJA 2C6KA 3MFUA 4M69B 3SRVA 3UIMA 4PDSA 3BPRA 2JLDA 2VTSA 3FZPA 1LP4A 4EH7A 5LVNA 3DK3A 3NAYA 2IVSA 4NCTA 4BGQA 2CPKE 2A4LA 4HGTA 4E3CA 3R21A 4USEA 4NYEA 4XLIA 1VZOA 1Q3WA 2VUWA 5BPYA 4FTRA 4UMPA 3EOCA 4AW5A 4H3PA 2XMYA 5AAEA 3QD0A 2OICA 4EL9A 3HEGA 4ALWA 3UZTA 5E8TA 4NH1A 2HWOA 3IQ7A 3P5JC 4ANSA 4CFNA 5JFSA 4MUQA 3FXZA 4IAYA 4EHVA 2QKRA 3DQXA 2PE1A 2QLUA 4M7IA 4EH9A 4BRXA 5JFWA 4O82A 3DJ5A 5CAQA 4DFBA 4WRSA 3AGLA 4M3QA 5H2UA 2OH0E 4FIIA 4IM0A 2E9OA 4O1PA 4QQJA 2V62A 4L43A 2A2AA 3ZEWA 3W2PA 5HD4A 5AA9A 2HWPA 3UG2A 1ZOHA 4OTDA 2R5TA 3R00A 2WB8A 3R7OA 4PNKA 4J97A 3FI4A 2UW7A 2PL0A 3HA8A 3QWJA 4OLIA 3ZTXA 4CKRA 2IPXA 5JEBA 4CMTA 5AUWA 2XANA 4ZP5A 1J91A 3N51A 3QRJA 3FBVA 3MYGA 1IG1A 4Z16A 4B0GA 4A9SA 4B9DA 4F78A 3HYHA 2YZAA 4LUDA 4K1BA 5A3XA 2A19B 5HBHA 3HA6A 3LXPA 4HYHA 3VS7A 3F88A 4EBWA 4AXDA 5IQEA 3DS6A 3AC4A 2B9HA 3MPMA 3NW6A 4E5WA 1M2PA 5CF5A 5JRQA 2W1FA 3GCPA 4DEHA 1M2QA 5AUXA 3AT4A 3R2BA 2C3JA 2XZSA 2ZV7A 4D2TA 3KL8A 3P9JA 4BCJA 4C02A 2WIPA 3RK7A 2XUUA 3VUGA 2GTNA 5C8NA 2YABA 2FO0A 3UP7A 4CRSA 4O7SA 2R3HA 2WMWA 3NFGB 5JZNA 3ZU7A 2QQ7A 3UBDA 2QI8A 2O63A 4MNEB 4UXQA 4UZHA 5EW8A 4G5PA 3QCSA 3FC1X 2JITA 1HOWA 2QCSA 3KK9A 1Q62A 1Y91A 1NXKA 5D12A 1XH5A 2UW4A 3BHYA 3P78A 4FTLA 1U46A 5DT0A 5HTCA 4GKIA 1PKGA 4BDEA 5EHYA 3HV4A 4LGDA 4UX9A 4APPA 2G01A 4RIWB 1IAJA 4CG8A 4EC9A 2EU9A 3WARA 3W2SA 3OT8A 4NKAA 1JVPP 5CALA 3U6HA 3OROA 1Z9XA 3WF6A 4BC6A 3V6RA 1ST0A 3S0OA 2CGXA 4FUYA 1ZY4A 4I41A 4J98A 4FKQA 2I0YA 4J95A 3ZUTA 3OXIA 1R0EA 2PUIA 2H6DA 3HMPA 4PPCA 4JDKA 5FTOA 1PMVA 3R1YA 2BUJA 5AM7A 3ZUUA 4Z9LA 4FGRA 4J99A 3W0RA 4B7TA 2OI4X 4JIAA 3DLZA 3MY5A 4OTIA 3QC4A 2WTCA 4O91A 1CSNA 2QLQA 5F95A 3E88A 3Q9ZA 3UP2A 5A9UA 4C2WA 2XNMA 3UO6A 2F7ZE 2XKCA 2YJRA 3DB8A 4J1RA 4F4PA 3LQ3A 4CG9A 5HZNA 4EZ7A 4FSRA 5L3AA 3FSKA 4EOPA 4UY9A 4XBUA 3MPAA 3OC1A 4YC3A 4I5HA 4YPDA 2YM7A 5DA3A 5TE0A 4EC8A 3Q4ZA 1SVGA 1UVRA 4PTEA 5AX9A 5CAUA 1YXUA 2O8YA 4FSNA 4XG8A 2J0JA 3R22A 3N4VA 3NNVA 4DG3E 3GU4A 3SOCA 3PJ1A 3MA3A 5KMIA 2UVYA 1W7HA 3CGFA 4A9UA 2C0IA 2EWAA 3R02A 3VF9A 3U6IA 2OIDA 3MVJA 4X6QC 2XIRA 4BGGA 4YZCA 1OIRA 3HV7A 3LJ2A 2VTNA 4BIEA 3C1XA 5LVPA 3TT0A 2H9VA 1MQ4A 3PA5A 4HW7A 4O86A 5AUYA 2WOUA 2OIQA 4W8DA 4J7BA 5D1JA 4N6ZA 3COHA 5HX8A 1WBWA 1NVSA 4ACMA 4BCHA 4ENXA 4U44A