2QO7A

Human epha3 kinase and juxtamembrane region, dephosphorylated, amp-pnp bound
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
278
Chain Sequence
TYVDPHTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 278
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo7A01
5KO1A 3GUBA 2WTWA 3FDNA 3L8SA 4I6QA 3TACA 4UWYA 1OL1A 4ZOGA 4YTCA 3FSFA 5EDRA 5IUHA 2IN6A 3VBWA 4YZCA 4RA4A 3HAMA 3MVHA 4FK6A 1QPDA 2OZOA 3GQIA 1RJBA 3VRYA 4E26A 4KUJA 1GZKA 3CQUA 4ZMEA 3HV5A 3ZONA 3LXPA 3NUNA 4YTIA 4BI2A 4Q9ZA 3R1NA 4HCVA 2ZDUA 1Q8UA 2VTHA 4MXAA 3RALA 5L2SA 1E1XA 2QU6A 5CSXA 4YJNA 2C1BA 3CPBA 3A4OX 4OAVB 4GS6A 3TZ7A 2ZMDA 3LFFA 4KS7A 3W32A 2ITXA 3CY3A 1FGIA 1BLXA 3U51A 4EK3A 4M13A 2OF2A 4UN0C 2Q0BA 3LIJA 4BCHA 4FKLA 3R9DA 4M84A 2QURA 3AD4A 4TNBA 3R7OA 3OTUA 3C0IA 2E2BA 4NW5A 4S31A 5EYMA 3V5WA 1MRUA 3MESA 4FIGA 1YWVA 2PHKA 3JPVA 1G8AA 2UV2A 4V0GB 1HCKA 1LUFA 3R1YA 3NYNA 5ANEA 4E6CA 1Q8ZA 4RWJA 4DLJA 2R3RA 4RWIA 4NL0A 3R1SA 2FB8A 4XMOA 4J99A 3WZJA 3PE1A 2CSNA 2XYNA 3Q2JA 2QR8A 5LOHA 4FE2A 3O17A 3MH1A 2X8DA 3AC1A 3DNDA 1FVVA 2YLEA 3OUKA 3RPOA 4HYHA 1XBAA 2V7AA 3DFCB 2JFMA 3R7VA 3DK7A 3BHTA 1Q61A 5HZNA 4RPVA 4FYNA 4AZTA 5JGBA 5C1QB 2RF9A 2C6KA 1MP8A 3QKKA 3KRJA 2PVJA 5DHJA 3FPQA 4YZNA 3RJCA 4EQMA 2C6EA 3QQHA 4YLLA 2RFNA 3UP7A 3VUGA 4BDHA 1ERKA 3M1SA 2KULA 4FOCA 3T3UA 3L8VA 3P5KA 3DB8A 1Q8WA 1A48A 1OUYA 4ZTHA 5LARA 3FZTA 2CDZA 1JKTA 1BI8A 1FVRA 1WAKA 4AS0A 2XNOA 3NRMA 4KWPA 4TYHB 3PWYA 4U9AA 5EH0A 4O84A 3OT8A 2E9PA 2R3NA 2XVDA 4HCUA 3BHUA 4IDTA 4EH4A 3D0EA 1ZYDA 4FSTA 2O2UA 2PUNA 4YC6A 4MXZA 5AR4A 5HO6A 2V7OA 1H1RA 2C5VA 5EYKA 4EUUA 2W0JA 1OIRA 2J0MB 3W18A 4S32A 4Z16A 3WZDA 3ZZEA 3K54A 3SX9A 5M57A 4MAOA 2W99B 4BRXA 4BCKA 1M17A 4EOIA 2XM8A 2WIHA 3KFAA 3N51A 3F3VA 4S2ZA 2LAVA 2ITVA 3WF9A 2C68A 3QLGA 3BI6A 4FK3A 4U7ZA 4DYMA 5FG8A 2XF0A 2JD5A 5KHWA 3F69A 4U8ZA 5L2QA 3UNKA 3HUCA 1ZYCA 4K11A 4NSTA 2A0CX 4MD7E 4ZSEA 1Y6AA 4EBWA 1Q8YA 4L3PA 3O50A 4LOOA 4G3DA 1NVSA 4FEVA 1UKIA 5D9HA 4CKIA 2XK8A 2WMXA 3LJ0A 3OTVA 3ZUUA 3TM0A 4V01A 1OI9A 2GU8A 5DVRA 1KE6A 2XIRA 3PRIA 4K8AA 4ZSJA 3ZU7A 4BZNA 3NNXA 4DG0E 2CKEA 4F09A 5CF5A 4ZIMA 5L8JA 4XEYA 3QRJA 3DBDA 3G15A 4KRDA 3ROCA 4L45A 5DT3A 4O7RA 3L8XA 1H1WA 2OZAA 2Y6MA 4E4LA 3DBEA 2YZAA 5H3QA 5A4TA 5GZ9A 2J9MA 3PG3A 2BTRA 4O83A 4G31A 4UZDA 1KV2A 4FTIA 3WILA 3NDMA 2CJMA 3G9NA 4E4MA 2ITQA 2VWWA 3VS3A 2W7XA 2X39A 3A7HA 3BLQA 1FQ1B 3P9JA 3PUPA 4Z7GA 4K18A 1XH7A 4M67A 1U54B 3FI3A 5HG8A 3TNQB 3FMJA 4O0RA 3O0GA 3E62A 2C6MA 2PVNA 2WD1A 5CQUA 3R7YA 3W8QA 4DITA 2XKFA 4ZJVA 4RC3A 5EM6A 5J8IA 4MBIA 1PXPA 4DT9A 3A61A 1IR3A 1Z5MA 2JFLA 4UMTA 4APPA 1OM1A 4ACGA 4QNAA 3QXOA 4ALUA 3CXWA 1UVRA 2O64A 2NPQA 2WMBA 4RSSA 2NO3A 1K3AA 3I6UA 5AP6A 3MN3A 4XV2A 4DBNA 4XG4A 5G1XA 3R83A 3QC4A 4QMSA 2B4SB 4E6QA 5H8BA 3RTPA 1DS5A 2PWLA 2DS1A 1GIHA 2ZV7A 3PA3A 4FODA 5JH6A 3P1AA 2J51A 2ZB0A 5FP6A 3FJQE 2PVLA 4G34A 4A4LA 5DH3A 3DJ5A 4F7SA 3BE2A 3EQGA 4Q5HA 4CGAA 3FPMA 1XHAA 3P7CA 4DCEA 5CU2A 2W1GA 4IX3A 3BBTB 4ANMA 3VBXA 1Q41A 1WBWA 2HZIA 2VWIA 2BHHA 4ZJJA 2X7FA 2R3OA 3FY0A 4MD9E 2RG5A 4QTDA 4QMLA 5E8TA 5H8EA 5HOAA 4DH3A 1LPUA 1MRYA 2X8EA 3CEKA 3SHEA 5GIOE 2ZV2A 5CVFA 4DGGA 5FTGA 5IEVA 4LGDA 4JS8A 5A46A 2BAJA 5CXZA 4Y8DA 5CZIA 4UWBA 4B0GA 4JT3A 5E4HA 3TKIA 3QTXA 3VHEA 4ASDA 3UOLA 2YM5A 4I4EA 4IWOA 5LVLA 2XKEA 4MKCA 3KB7A 1BYGA 4OLIA 2V62A 4CQEA 2VWZA 2VTJA 3Q4TA 1YXSA 5D1JA 4AZVA 2B53A 3D5UA 2ZYBA 4EK4A 1GOLA 4FG7A 3T3VA 3IGGA 3GU8A 3DY7A 1IA9A 3R2YA 5CEMA 2JDSA 4YHFA 5FEDA 1OKVA 2F57A 4WBOA 3U8WA 1DM2A 3HA6A 4O96A 4R7HA 3TL8A 2AYPA 4LMUA 3WYYA 4IANA 3FHRA 2O8YA 4IVDA 3KULB 4WT6A 3GI3A 4M8TA 3QX2A 4C34A 5KE0A 2QOCA 4G3CA 5CU6A 4BDKA 1PXKA 4ZMFA 4MWIA 3GU4A 3GOKA 3PPJA 3PDTA 4E93A 1OITA 3QD4A 3IOPA 3KCFA 4IM0A 5BQ0A 3NWWA 3CC6A 3EHAA 4KBKA 3WBLA 3HMNA 3Q9XA 4F4PA 4JQEA 3MH0A 4LRKA 3DQWA 2VX1A 3UVRA 3AMAA 2Z8CA 3D14A 4G5PA 2FSOX 4AACA 4UY9A 5A3XA 3GCSA 3KXGA 1OL7A 3KVWA 4Z3VA 3MJ2A 5HD7A 3D4QA 3LFSA 4QP3A 4F0GA 5KKRC 2W5HA 1PMVA 5A4QA 3EIDA 1YOJA 3KXNA 2W1CA 4EH5A 1V0OA 2BZIB 4M66A 2R3KA 4CKRA 1ATPE 5DFPA 3PSDA 3BLHA 2OJJA 5T68A 4FMQA 3FEGA 4FI1A 3W2QA 4RIWB 2BRGA 4AGCA 1BX6A 2O65A 3KMWA 4QMZA 4RVLA 1XJDA 2X8IA 2R7IA 4GFGA 3WZKA 3EL7A 2VTTA 3FUPA 5AV2A 5CF6A 2PZRA 5T3QA 5AV0A 3H9FA 4KIQA 3Q5IA 4ASEA 3IGOA 4CYJA 4ITJA 3I0QA 1J7UA 1SVGA 2CMWA 1GY3A 2IZSA 4BDCA 2R3MA 2WMVA 4KD1A 4FTUA 4IQ6A 4L42A 2FH9A 4ZSGA 3R71A 3RAIA 5GIPE 3PLAE 3PVUA 4TWNA 2J0LA 5JZNA 4R5SA 5J95A 1OIUA 1QPEA 4FTOA 3LQ5A 3VRZA 4BY9E 2EXMA 2YA9A 3LCKA 1GAGA 3V8WA 5BPYA 3FLQA 4IAFA 3THBA 2WTVA 3ORIA 5LVNA 5AV3A 4O7WA 5AV1A 3IOKA 1ZOHA 3IW8A 3K5VA 5FDXA 4RVTA 4E73A 4BICA 2BDWA 1IG1A 3PWDA 4QTEA 4I20A 1YXUA 5CEIA 2UVZA 5IA0A 4UYNA 4I0SA 5L6WL 2WELA 3B8QA 4XJ0A 2RIOA 4D5HA 3LJ1A 1YDSE 4JR3A 2QOIA 2C3KA 3PY0A 4KIPA 4L00A 2UZBA 2WHBA 5LMBA 4MVFA 2IVVA 2P3GX 5BMSA 4WKQA 2QOQA 4X2KA 3RAWA 2X7GA 3VS4A 4BL1A 2ZV8A 4LM5A 3CS9A 4XOZA 3T9TA 3EJ1A 5AFVA 4UALA 2Y8OA 3NUPA 2Y4IB 4MXCA 3EN5A 4C4IA 4AGUA 3EFKA 3SRVB 1UA2A 2YEXA 3KXXA 3G6HA 2P33A 5ANIA 3DKGA 4BDJA 3RP9A 3PVBA 4AN9A 4FYOA 4HYSA 4E20A 5A6NA 5ETAA 2GNJA 4O1OA 3V04A 3DJ6A 2NP8A 2AC5A 1ZYSA 4UZHA 3G6GA 3H10A 2J6MA 3NW6A 4NM5A 3WZEA 5B2LA 4YJOA 4U42A 3O8PA 4XV3A 4XG8A 5HCXA 3F7ZA 3FLZA 2VNWA 3C51A 3LKMA 4NUSA 4C59A 5AUVA 5ETCA 3WF8A 3TKHA 3IKAA 5AA8A 1X8BA 1XQZA 4QPMA 5LXMA 4L68A 2CGWA 1KV1A 1WMKA 3D83A 1KUTA 1G5SA 3QRUA 4NKSA 5GJGA 3NR9A 3QALE 4YU2A 4ANQA 4MYGA 3GVUA 4HCTA 4OT6A 3F7WA 3MI9A 3RMFA 4R8QA 4YJQA 4IVCA 2W06A 3CY2A 4PV0A 5CI7A 5HD4A 3EQHA 4DBXA 4IC8A 3G0FA 4JDJA 3ORNA 4I3ZA 3UMXA 4RJ3A 5JMSA 2E9NA 1IAHA 3QC9A 1M2QA 1CDKA 3T8OA 5AX9A 2WEVA 4ONAA 3N4TA 2FSLX 1M52A 4IMYA 4WRSA 4O1PA 5GJFA 3W16A 3S95A 1R0EA 5J1WA 3FC1X 1SYKA 5KMMA 3IO7A 4AOJA 4BKYA 4JDKA 5F1ZA 4IH8A 2VWVA 4FV4A 3ENMA 4QPSA 3UG2A 4J7BA 1VR2A 3E64A 4KIKB 5L2TA 4AFEA 3C5UA 4HGSA 3PJ1A 1CKIA 2FVDA 2UZDA 4JBQA 5HGIA 1PMNA 4CNHA 3S2PA 2WKMA 3P0MA 3PP0A 4KB8A 4BIBA 2QOBA 3NS9A 5AP3A 3FY2A 5CU3A 4RQKA 3ZCLA 4A9YA 3DGKA 4V04A 3F3WA 1A06A 4XBRA 4HVSA 3BRBA 3MS9A 1ZXEA 4XH6A 4GFOA 5T6KA 4HZSA 5AUZA 4F9YA 3BQCA 4J98A 4MNEB 3WIKA 2X6DA 3EWHA 2OF4A 4H3QA 3TN8A 3UIXA 4QTCA 2EVAA 4QYFA 4WO5A 2C0OA 3BYMA 4RVKA 5HBEA 4NTTA 4UEUA 4I94A 3UJGA 4E4NA 3EQBA 4C3PA 4IB5A 5GZAA 4QP9A 3E88A 5M06A 3U9CA 4F1MA 4AFJA 3QTIA 3F5GA 3BELA 4LRJA 4FIFA 2W5AA 5IDNA 2XNMA 3E3BX 4F99A 4O91A 3Q5ZA 2YABA 2F7ZE 4BDAA 3MDYA 3F61A 3E3PA 3DJ7A 3QX4A 5IH5A 1JSVA 3LFBA 5EHYA 2Z7LA 3CE3A 2SRCA 3GFEA 2OG8A 4GU6A 5JEBA 3QU0A 2PY3A 2XNEA 3BGZA 5I9ZA 3COIA 4X2GA 4FIHA 5HIBA 5IA3A 4XV9A 4BGHA 4Z7HA 3ATTA 3REPA 1LEWA 2Z2WA 4FTLA 5DR6A 5F94A 4D55A 4FL1A 1OL5A 1IA8A 1E9HA 2CGUA 3F66A 3AC3A 3JVSA 4E6AA 4N57A 4PY1A 1Z9XA 4K1BA 2ZB1A 2W9ZB 4FG9A 2CGVA 5EHOA 4BFMA 3JY9A 4D0XA 3UQCA 3MA3A 1YDRE 3BHHA 3R8VA 3I60A 3WZUA 2I40A 3P79A 4EHVA 2Z02A 1HCLA 5CALA 5HVJA 2AC3A 4BCPA 3I79A 4USFA 4FTQA 2OSCA 3RZBA 2YAAA 3ATSA 4NYEA 1WBVA 2WTKB 3FXXA 1J1CA 2YM8A 4C38A 5IEYA 3A8XA 4UMUA 2UZNA 1FINA 4BWPA 3ANQA 3BE9A 3QYZA 5AR8A 4AE6A 4C4HA 4EBVA 4EH9A 4F64A 1WBSA 4M7IA 3BYUA 5I9YA 3JVRA 4EOMA 5IISA 4FEXA 3S4QA 4FNWA 4BYIA 1GIIA 3KN6A 5K5NA 1F3MC 3L1SA 3R7UA 5GNKA 4FL2A 4AA5A 2YCSA 1Y91A 1BUHA 3A4PA 2I0EA 3CKWA 1CKJA 4M3QA 3RNIA 4HVIA 4IAKA 3OG7A 1KSWA 4OBPA 2PE0A 4PDSA 2H8HA 1DAWA 1PRYA 3KC3A 1YOMA 4RJ5A 2F4JA 3QKMA 5JFXA 5LJJA 3LOKA 3VQHA 3QCYA 3QQKA 3WF5A 4BCNA 5FRIA 2X9FA 4EOQA 3PJCA 2B9HA 3R04A 2QG5A 2ZM3A 2VRXA 2YZLA 3PVGA 3UGCA 4BTJA 4TWOA 3KRXA 2UUEA 2BRMA 3HGKA 4DTBA 4G16A 3WF7A 3A2CA 1KE8A 4PPBA 2UVYA 2WOUA 4NIFA 4ZY4A 2VO7A 4MX9A 2IWIA 4FKOA 2ZMCA 4ZS0A 5C8KA 5A14A 2JEDA 3CR0A 3V5LA 4RJ8A 4JRNA 3QQFA 4Y83A 3OW4A 4DAWA 3DKFA 3HEGA 4KA3A 4E5AX 3EKKA 4FTMA 1XR1A 1M2PA 2WO6A 4FZ6A 3Q96A 3FKNA 3QCXA 4AX8A 2W4KA 2YJSA 3VUIA 2GQSA 3DV3A 4NM3A 5AMNA 2Z7SA 4DFYA 3E8NA 3KEXA 3E87A 1WCCA 1QCFA 2UW5A 3MJ1A 3U6JA 5A9UA 4I6BA 3LCDA 4IFGA 4WD5A 1S9JA 2X4FA 2OICA 4DEAA 4EC9A 2V55A 4O27B 4FIEA 4L01A 1H25A 3DPKA 2C0TA 4MF1A 5DEWA 3RM6A 5CYIA 3O71A 5FTQA 3D5WA 5IH4A 3PIXA 2C6IA 4FICA 4ZEGA 1TQMA 4DFNA 3IQ7A 1JLUE 3B2WA 4WNPA 3ORMA 5HE1A 3F2NA 4IAYA 1JAMA 3V5PA 4UWCA 5TOZA 1Q99A 4YC8A 4LUEA 4I5PA 1K9AA 4O7SA 3C1XA 2R0IA 4M0YA 5ANDA 3TZ8A 3AXWA 2R3PA 5IDPA 2PUPA 1JPAA 2J7TA 4HOKA 4CG9A 3RBWA 4NW6A 4BN1A 1VJYA 3F5PA 5DR9A 4CV8A 4ZSLA 1CKPA 4O7YA 3C0HA 3ZUTA 4GIHA 5KZ0A 3D15A 4FV7A 3UOKA 4FKWA 5DBXA 5IEXA 2ITYA 3ANRA 4G9RA 4FNYA 5GZ8A 3A60A 4RT7A 2NRUA 4KSPA 4YJUA 5F95A 3ZTXA 5JRQA 4BWXA 3ZLYA 5HX6A 5FXSA 4OTDA 4H3BA 2CLXA 4FKVA 1ZARA 3D94A 3HMPA 3MY1A 4IVBA 1J7IA 4B4LA 4QMNA 3LQ3A 4DGLC 2GTMA 4RZWA 3NPCA 2WTKC 3AGMA 3NEWA 2UW8A 4I5CA 4NK9A 4PDOA 5AP1A 4CRLA 2PUIA 5KMJA 2J0KA 3SC1A 1H27A 3G5DA 1DI8A 4EH8A 3GCVA 3EL8A 4AE9A 5KBRA 5A6OA 4E1ZA 5DRBA 2I7QA 5KBQA 5LMKA 4F6WA 1YWNA 3C4ZA 4C37A 2OLCA 4O7NA 5IMEA 5BVNA 3E92A 3NNUA 3C7QA 4L43A 3VN9A 4J52A 1PMEA 1I09A 3BHYA 5M4FA 3DFAA 2F7EE 2XKCA 3LMIA 3FZ1A 4CFXA 5J5SA 5HIDA 4JR7A 4QOXA 4C36A 3ZFMA 2GPHA 2BFYA 2XUUA 3ZFXA 1G3NA 3QRTA 3SLSA 3GT8A 5CS6A 4ENXA 4FUYA 3CTJA 1JBPE 2FYSA 4GKHA 2JAMA 2HOGA 1UWHA 5IQDA 2C3IB 4BF2A 4FBXA 1J7LA 4TZRA 2CNQA 1Y6BA 3WARA 2HENA 5BUEA 5HI2A 3UO6A 5B2MA 5HHWA 4WG4A 5HNGA 4R6VA 1ZOGA 3QGWA 5C27A 2XIXA 3PP1A 4FTCA 3AOXA 3I6WA 2JKOA 5DA3A 3W2SA 2VU3A 4BDIA 2HIWA 1OIQA 3CP9A 4J1RA 4WA9A 2IZUA 5IQAA 2Z60A 4AU8A 4ACCA 4XG3A 5BX0A 2CNUA 3ZSIA 2ITWA 4BIDA 2BRHA 4IB1A 4QMVA 4QPAA 4NCTA 3AQVA 3KY2A 1XH9A 3MFUA 4FT7A 5AR5A 4E5WA 4HW7A 2PZIA 4C4GA 2G2FA 4P7EA 3NX8A 3FQHA 2W05A 3W2RA 4ASXA 1T45A 4N6YA 1SVEA 2HY0A 1UU8A 2ERKA 3OWPA 1P2AA 2E9OA 2PTKA 3U9NA 5JKGA 4AT4A 4QP8A 3PA4A 3GC0A 3HUBA 4LG4A 3PLSA 3NGAA 3II5A 4I92A 3TTIA 3PRFA 4B8MA 5JFSA 3AD6A 3MGYA 1WBOA 1P5EA 1H8FA 3IPHA 3QQJA 3UNJA 4DH7A 4U79A 3OWKA 4BR3A 2X7OA 4I6FA 3TT0A 4PWNA 3VS7A 1OB3A 4I0TA 2VWBA 3COKA 5EHLA 3QA0A 4OW8A 3UDBA 3TDVA 2W1HA 4EOPA 3UP2A 3GU7A 2QOKA 3MH2A 2ITUA 4ITIA 5K9IA 3TI1A 4IJPA 5HCZA 4PDPA 3KRLA 3Q3BA 4BCMA 4GKIA 3FLYA 2PMLX 2RSVA 2XA4A 4IZ5A 3UO5A 2HXQA 5AM7A 3AGLA 5FM2A 3I4BA 3ZEPA 3KK9A 2R3LA 5J9YA 3FE3A 2WQNA 2R3HA 1WBTA 3HDNA 3D7TA 5BUIA 3TNPC 4AF3A 3BU5A 2OWBA 4ZLOA 4XBUA 1H0WA 1J1BA 3JUHA 2WTDA 3NNWA 3Q52A 2UW3A 2OH0E 3FQSA 3ZYAA 4ZTMA 4QQJA 2B0QA 2X2KA 3BX5A 4F6UA 4G17A 5DG5A 1NXKA 2ITPA 1R39A 3PZEA 5AA9A 3DAKA 3VO3A 4FTNA 4C4EA 3QD0A 1GZNA 2XNBA 3Q9YA 2ITOA 4FV5A 2XK3A 3ZEWA 2QOHA 3UE4A 4WG3A 4EJNA 3UVQA 1OBDA 4G3FA 5IU2A 4AW2A 5HCYA 4AOTA 4AG8A 3LW0A 3DA6A 1V0PA 3LXLA 4G9CA 2CCIA 2EB3A 2XIKA 4NT4A 2GTNA 2WMQA 1IEPA 3GNIB 3E5AA 3IONA 3FMNA 4FSQA 5ACKA 1U4DA 3EOCA 4QRCA 5KKRB 1QL6A 4PMPA 3V6SA 4RIXB 5AADA 3SXFA 1NW1A 4ANNA 2DYLA 4H39A 3SGCA 4FUXA 3ORKA 4J96A 4YZBA 4X2NA 5AAEA 1WVYA 4YBKA 5AM6A 5EG3A 5AR3A 3JYAA 4AA0A 4YJVA 4N6ZA 2JIUA 3CD8A 5HLPA 3Q32A 4QMMA 4BCFA 3JR1A 4YNEA 3R8ZA 3TJDA 3ZRKA 3VQUA 5FUTA 3O2MA 4OR5A 3FLSA 4GRBA 4P4CA 4PX6A 4AW1A 4D4YA 4JAIA 4IAAA 4L52A 3O7LD 1R3CA 5DEYA 2UZUE 5E91A 4ZTRA 3Q4CA 2YM3A 4FVQA 4PTGA 4RFYA 2UW0A 4EHEA 3NNVA 3QUEA 4YJTA 4U97A 4EYMA 5CEKA 5HO8A 4CFVA 4UMPA 2GNHA 2PVFA 3LFDA 1R1WA 4ZZOA 4AN2A 3V51A 5J79A 4HYUA 3KXMA 5J87A 4JOAA 4WNMA 5E1SA 3NLBA 1XKKA 4MTAA 4BCGA 5L3AA 3TV4A 2ACXA 2I1MA 2ONLC 2RFSA 3VJNA 4AXAA 2CHLA 2FGIA 3AMYA 4DH5A 2IW6A 4B9DA 2VTLA 1SZMA 2IVTA 1PJKA 4FKSA 1UV5A 4LV8A 1OL6A 5E8VA 3M2WA 4CRSA 5I4NA 2XH5A 4HZRA 3OOGA 5EYDA 1UWJA 4EH3A 3UZTA 4G6OA 3CTQA 4ANOA 3EQIA 1MRVA 4LOQA 4RIYA 4Y72A 1YI6A 2J0JA 3OMVA 2A1AB 5IF1A 4RC4A 4I41A 1B39A 3WI6A 4XYFA 2H6DA 3NYXA 3OEFX 3NVKI 4EC8A 3SOAA 4YHJA 2Y4PA 2YWPA 4P2KA 3KRWA 3LFAA 3MPTA 5BYZA 4MK0A 2PU8A 3GU6A 1YRPA 4K9YA 4O81A 4EWQA 4EOJA 3FHIA 3RPVA 4GV1A 5DT0A 5BVDA 2OFVA 3T9IA 3VS0A 3QHRA 4PRJA 1OKWA 1Q97A 4QYGA 4GIIA 2V22A 2QO9A 5D7AA 4XV1A 4XP0A 4IJ9A 5TR6A 1P4FA 2VD5A 4X3FB 5FLFA 3CQEA 3QTRA 3PYYA 4BDGA 2G1TA 3DT1A 2ZDTA 3L9NA 3MFRA 3BV3A 4XP2A 4ZZMA 5AV4A 5FDPA 2GS6A 5EW8A 4F6SA 4IZAA 3QTWA 3DBCA 5AP2A 4CG8A 4IHPA 2CLQA 3BZ3A 3MPAA 4ACMA 4WRGA 4YMJA 4NWMA 5CU0A 3R9HA 3VHKA 3VBYA 4D1ZA 5IUGA 5AUUA 2F49A 2WQMA 3SDJA 4DEDA 3QZGA 2C6DA 4JG6A 3QBNA 3QGYA 3BIZA 4S34A 3W2PA 3EYHA 2BRBA 4I4FA 5FGKA 4EZ7A 1R78A 2R2PA 2O63A 2W96B 3GC8A 4J8MA 4P5ZA 3HV7A 3SV0A 3UO4A 5E1EA 4H05A 2A19B 2UZLA 1H24A 3ODZX 4GJ3A 4NEUA 4CSVA 4Q9SA 3MB7A 2YM7A 1PYXA 5E90A 3C4FA 4AGDA 3SA0A 5D7VA 5M44A 4O0XA 3PXQA 5I9WA 5D10A 4MEDA 4FT3A 1FMKA 3FMEA 2PVHA 1M7NA 3U87A 3WE8A 3W1FA 1CM8A 1GIJA 4FV8A 4IVAA 3QA8A 4RFMA 2OW3A 4I0RA 2OBJA 3OP5A 4UMQA 2RFEA 2G2IA 4Z9LA 4YZMA 2XNGA 5FWKK 4A4OA 4CCBA 2JIIA 4DEGA 5LVOA 3HP5A 2BTSA 3QZIA 5AR2A 3D5VA 4H1JA 2ZOQA 2YISA 5EKOA 2OFUA 2JC6A 3QL8A 5C01A 3VUMA 3QTZA 1OL2A 5JSMA 3KXHA 2FO0A 4M15A 3TV6A 4F1OA 2ETMA 1XBBA 4ASZA 3LZBA 4AZSA 3LFEA 1SNXA 3KA0A 4O7ZA 1LP4A 2YWVA 4RX5A 4R78A 4USDA 3GQLA 4F63A 5JQ8A 4OTQA 3AC2A 4M69A 5JGDA 4EH7A 3R30A 1PHKA 3UZRA 5CI6A 1Q3DA 5HNBA 2C5YA 4I5MA 4W8DA 4XG9A 3KU2A 3TEIA 2ITTA 4DTKA 1Q8TA 4RX9A 1FGKA 4TYEA 5AAGA 4EZ5A 3LFCA 1ZWSA 3W33A 5M09A 3JY0A 5ETIA 3ZBXA 2QHNA 4LFIA 3OXTA 4I5HA 3R2BA 5CNOA 2JAVA 3TXOA 2IJMA 2VGOA 3MBLA 5IUIA 3DLSA 4K6ZA 3Q04A 1O9UA 4AAAA 4TWCA 5ITAA 3ELJA 3BYSA 3H30A 2RG6A 4UXQA 1KWPA 4GW8A 4DH1A 3IECA 2IG7A 4YBJA 4CD0A 4YNOA 4FEUA 3QD3A 4YGAA 2VWXA 3PPZA 3FXWA 2F9GA 4O86A 1TQIA 2VNYA 3OROA 4QQCA 1UU7A 5M08A 3P08A 3LLTA 4NM0A 5AP0A 4I22A 3R73A 3LMHA 4OTPA 4CFWA 4C35A 3B2TA 2IW9A 4RWKA 1OKYA 3ACJA 3VUDA 5BVWA 5K5XA 3VBVA 3S0OA 1GZOA 3I1AA 2NNWB 4GVJA 5IQFA 2C4GA 2ZAZA 4FTKA 3TZ9A 3UPXA 4NFMA 4C4JA 4XX9A 2EXCX 3AMBA 4C2VA 3MTFA 4I24A 3EFWA 4D4SA 5HEZA 3GFWA 1OMWA 5E8UA 2VTQA 2VTOA 3RHKA 2JBOA 1RW8A 3QCQA 2PUUA 4FNXA 3A99A 1WZYA 4RVMA 3ZSGA 4D1SA 3KREA 3UQFA 3AT4A 4C4FA 5A54A 3DOGA 1H07A 2B1PA 3MIYA 3UOJA 3KK8A 5E8XA 4EJ7A 2JDTA 4C61A 5A4EA 1Q62A 1QMZA 3IW5A 3KRRA 2QU5A 3UOHA 4DA5A 1PMUA 3FV8A 4DFZE 5H8GA 4W4VA 4XNEA 3SD0A 5KNJA 4X3FC 5BVKA 5HU3A 1L3RE 1A9UA 4CT2A 1E1VA 5IG1A 3UZPA 2QOFA 3GC9A 3EQCA 1Y8GA 3FL5A 4IW0A 3A7GA 3DAJA 2HWOA 2CPKE 2CCHA 4APCA 4O6LA 5M56A 2BZKB 3ID6C 3EN4A 4FZAB 1JOWB 1PXNA 3PA5A 5B7VA 4UX9A 1ZOEA 4ZTNA 4QMWA 3PJ8A 3CIKA 2BZJA 2YN8A 3CPCA 4PNIA 2WXVA 3VW6A 2VX3A 4AZEA 4BDEA 3OD6X 2OO8X 1WFCA 2W17A 4XCUA 3RZFA 2WMUA 4V0GA 4A07A 3IW7A 5F20A 4KABA 3VULA 4DH8A 3KF4A 1OBGA 4BTFA 2X81A 4HPTE 3U4WA 3WE4A 4O7TA 1ZYLA 4U5JA 3FZOA 1FOTA 5I9XA 4TW9A 3RM7A 5M07A 3A7FA 5EOBA 1UNHA 3Q53A 2WU7A 1ZMVA 4R5YA 1ZYJA 4ZAUA 3FI4A 3G9LX 2XJ0A 3OW3A 4WBBB 4CXAA 2OIBA 2X1NA 4IZ7A 4XG6A 4YTFA 2JITA 3RKBA 4E5BA 2HZ4A 2WMSA 2XK9A 3BEGA 4PL5A 4QP6A 4YHTA 4D4RA 3MFTA 2XP2A 2BKKA 4FSMA 2Y6OA 4HNIA 2HYYA 4QYEA 3NZ0A 3DS6A 4YR8A 2VO6A 3V5JA 4DN5A 5L8KA 4CLJA 5BYLA 3KMMA 4PMMA 5C8NA 5KMIA 3C5IA 2C30A 4FV1A 2IZRA 2WNTA 2XRWA 5H2UA 3SXRA 4O2ZA 4G2FA 5AR7A 4D5KA 3VBQA 4TKSA 1UNGA 4FT9A 4USEA 4PDYA 5EM5A 3PPKA 4RQVA 3FKOA 5BVEA 5KZIA 4TYHA 2XJ1A 5DLSA 3RAKA 3NUXA 3SVVA 3QWKA 3OWJA 3E8EA 2BHEA 4Q2AA 3MIAA 3ORLA 3R01A 1Y8YA 4FKGA 2VWUA 3VUTA 4A06A 4D58A 3EZRA 3EMGA 4Z55A 3HAVA 2GNGA 3DZQA 4N70A 2P4IA 4BIEA 4GEOA 1H00A 3F88A 3MA6A 3TZMA 4HVGA 1UU3A 3PY3A 5EM7A 4GL9A 1H4LA 5JFVA 5ETFA 3S3IA 2R3FA 2VN9A 5L6OA 3QLFA 3R6XA 4F7LA 4D28A 3ZMMA 3ODYX 2FUMA 1EH4A 2LGCA 3NUSA 2HZ0A 1TQPA 2QC6A 4U6RA 4UXLA 3QRKA 4HNFA 4TNDA 5A4LA 4LGGA 4TWPA 3ROYA 4QMQA 1YOLA 4D9UA 3ORXA 5LWMA 2CKQA 4EZ3A 2VZ6A 4FF8A 1YVJA 1JSTA 4D2SA 4RLKA 4EOSA 2OZAB 2B9IA 3IDPA 3HYHA 2YITA 4AOIA 5E9EA 5HBHA 1BKXA 1M7QA 2OJ9A 4Y85A 4JNWA 4DEIA 4DGNA 5DOSA 3I5NA 3IDBA 3LM5A 2IW8A 2EUFB 4FEWA 4YLJA 3SW4A 3R9NA 3ZLXA 5FXRA 4JI9A 5AEPA 2EWAA 3Q4ZA 2GFSA 2IO6A 4RG0A 4ACDA 1JWHA 1U59A 3NUAA 3BGPA 4ARKA 4C62A 3HV4A 3HRFA 3ZZWA 3GBZA 4S33A 2OXXA 5D41A 5BVFA 4X3JA 4EONA 2G2HA 3FZPA 3OCBA 5HVYA 3ZO4A 3VUKA 5FBOA 4YSMA 2BDJA 2EU9A 5G6VA 2BIYA 4DFUA 2XK4A 2YFXA 2FSTX 4O0VA 4WIHA 3NUYA 5ANOA 2R4BA 1W82A 4BBMA 4E4XA 4W8EA 2B54A 3RPYA 3QKLA 2C6OA 2GS2A 1U54A 3FZSA 4QMOA 2X0GA 3GCPA 3D7ZA 4TN6A 2VTAA 3R8LA 3UIMA 4OT5A 2V0DA 3C50A 2VV9A 3PY1A 4IX5A 1AGWA 1H26A 5FQDC 2PVMA 3KCKA 4F9CA 2Y9QA 3BWJA 4F0FA 4R1VA 1GJOA 3C9WA 4IZYA 2YIQA 3UIUA 4JX3A 2Y0AA 2PK9A 3MFSA 2WU6A 3UC4A 1YXTA 2EB2A 4WUNA 4ORKA 2CN5A 4PPAA 2BROA 2PMIA 3BU6A 3O8UA 3O23A 3QD2B 5E92A 5IA2A 5FEQA 3BCEA 4O22A 3AC4A 2WMRA 5C03A 5CLPA 4FSUA 2B9JA 5TF9A 3KN5A 3QRIA 3U54A 3HMMA 4CV9A 5H9BA 3NAXA 1P14A 3DZOA 3ZRLA 2NRYA 2YIXA 2VX0A 3ORZA 4FSWA 5CAUA 5GINE 3BKBA 3CD3A 3P78A 4FVPA 4A9RA 1Q24A 1U46A 2JBPA 2QCSA 4FA2A 4ANBA 1ZRZA 2IPXA 3ZXZA 3GU5A 2X4ZA 3ALOA 2X9EA 3W2CA 2BCJA 4ZLYA 3FMDA 3N4UA 3FL4A 3KVXA 1VYZA 2BRNA 4JJRA 1OPLA 3TNIA 4QTAA 1GNGA 5K3YA 1ZMUA 4RZVA 2QG7A 4GH2A 5HVKA 3PXFA 5IPJA 1SMHA 2OIQA 4JQ8A 2BILB 5C4LA 4KAOA 5JN2A 3S1HA 3OUNB 1YXXA 3FQEA 3LCTA 3V3VA 4C8BA 1FMOE 3VVHA 3P7AA 4HYIA 2VTMA 2HW6A 2ZM1A 5CEOA 3E93A 2PE2A 4GG7A 3DQXA 5DI1A 5C4KA 5IQBA 4RIOA 1YQJA 1YHWA 1UKHA 2JDVA 4LRMA 4Y5HA 4UYAA 5IQCA 2B52A 3M11A 4JX7A 2QKRA 4ANSA 3EH9A 3OCTA 1APME 2RGPA 4J95A 4QMPA 1JVPP 2YCFA 2XBAA 3HECA 5C9CA 3OWLA 4J97A 5BVOA 2BVAA 3RHXA 3GB2A 2RL5A 5HTIA 3OXZA 3UMWA 2PULA 2VWYA 3KULA 3EFJA 5L6PA 2HK5A 1SNUA 1KE5A 1REJA 2WTCA 3MVMA 3CJFA 4YZDA 3R8PA 4DLIA 2UZVA 3HMIA 4FOBA 3Q9WA 2JDOA 3K5UA 4MF0A 3WYXA 1ZZ2A 3E8DA 4MWHA 4IM2A 2WTIA 4DGOA 4FKPA 3R02A 3H9OA 3I7BA 4YP8A 2XNNA 3DBFA 1J91A 4CT1A 2WMAA 5CEPA 3ZC5A 3OZ6A 3ZO2A 3DXNA 2UW6A 1PXOA 4CZTA 2ZVAA 3NIEA 4ANLA 2W1DA 2R0UA 4EH6A 1CSNA 1JKLA 3S00A 3DNEA 4FVRA 4FTTA 4H3PA 4IIRA 3VW8A 1UNLA 5JK3A 4Y73A 3IK3A 1RDQE 2UZEA 3MH3A 3H0YA 4IACA 4NH1A 3EN7A 4R3RA 4U40A 5CQWA 4L46A 3ZUVA 3FMKA 4RIWA 3KL8A 3L9PA 4U3YA 4B99A 1XWSA 4YURA 5HBJA 4EKLA 4K0YA 2Q83A 4C3RA 3TDWA 4ZY6A 1PXJA 4IE9A 4JDIA 3MWUA 3BBWA 2OI4X 3D5XA 3ZOSA 5CF4A 3SW7A 3ETAA 2JGZA 3PIYA 3ZBFA 4OTRA 3BHVA 5I3OA 4CFMA 2C69A 4KSQA 2R5TA 4LMNA 3UBDA 4GT4A 5CVHA 4ZLZA 4OTHA 3A8WA 5DPVA 2UZTA 4BHNA 4F9AA 1JKKA 2Q0NA 3NMUF 1YDTE 4O0TA 4A9TA 4PNKA 4X7QA 2OJIA 4MD8E 2QNJA 3BV2A 3Q9ZA 4TY1A 4W4WA 4FTAA 3RK7A 4B7TA 4F65A 3E7VA 3POOA 4C33A 2H9VA 2OIDA 4NJ3A 4FGBA 4GK4A 3O96A 2BFXA 2F2UA 3HZTA 4BBFA 5IKWA 2YJRA 4EKKA 3E8CA 3EZVA 4HPUE 2J50A 4MQ2A 3SG9A 3EQFA 5IQEA 5LVPA 3TUCA 3F2RA 4EK8A 4IADA 4FZFB 3LHJA 3QFVA 4FT5A 4UV0A 3BYOA 3AG9A 3F3ZA 5CTPA 4BI1A 3MV5A 4PTCA 3DK3A 3OXIA 4NU1A 5ANGA 3IW6A 3QAME 1JKSA 3COMA 4L44A 5KMLA 3SRVA 4OTIA 2P55A 3PFQA 4IWPA 4JAJA 5E8WA 1H28A 2GSFA 4RBLA 4GK3A 4EOLA 3VS5A 2RFDA 4I6HA 5BMMA 4AT5A 4E6DA 4OBOA 3PJ3A 2YDIA 4D1XA 3NAYA 4YPDA 2OGVA 5B0XA 5TKDA 4QQTA 4PMSA 4AWIA 1JNKA 3UNZA 4H58A 2XKDA 4QD6A 4C3FA 3D2KA 2PL0A 3HX4A 3DK6A 4O0YA 4NKAA 1YXVA 2XK7A 3PE2A 4RX8A 5CANA 2V5QA 2VTRA 1P4OA 3G33A 1URCA 2OJFE 2AUHA 2HELA 4JBOA 4RC2A 4BYJA 4D2PA 4ZY5A 5K0XA 3QCSA 5KCVA 5EQEA 5EW3A 5EI2A 4CVAA 1ZLTA 2J0IA 3N4VA 4A4XA 3LE6A 2XCKA 3NSZA 3R0TA 4M14A 3V8TA 4CFNA 4KINA 4GU9A 5JFWA 1XH8A 4FX3A 4UMRA 1KOBA 4DTAA 4CZYB 2OK1A 4O82A 3DKOA 1XH6A 3MVLA 3KMUA 3NYVA 4G1WA 4JDHA 4AW5A 3E63A 4K33A 5AUXA 2X6EA 4IX4A 2QHMA 3GP0A 4LGHA 3NIZA 4FL3A 3COHA 2XEZA 3OF0A 5FEEA 3OT3A 3QYWA 3VJOA 1IAJA 4NFNA 2WQOA 1JQHA 2C3LA 4L9IA 4U81A 3DDQA 4QTBA 5AP7A 2UVXA 4XG2A 3DBQA 2R3IA 4DF3A 2QO2A 4IB0A 4CEGA 3RK5A 4KIKA 4CFUA 5EI6A 2JKQA 4OTGA 2ETRA 1V0BA 2Z7QA 3Q4UA 5CSHA 3ZH8A 3FI8A 4R3CA 4DT8A 3HV3A 4ZS4A 1YWRA 3ZS5A 1MUOA 3VNTA 3VBTA 2CNVA 3ZDUA 5E8YA 5J7HA 2XBJA 2CN8A 5B2KA 5AAFA 1Q5KA 4IEBA 4L3JA 2QD9A 4MQ1A 2G15A 2VTNA 1W8CA 2OJGA 5AIKA 2GHMA 4QQ5A 2GHGA 5IMXA 4MHAA 3HKOA 4MNEA 2XIYA 2R3GA 1LEZA 3M42A 1W0XC 3OCGA 4BCOA 3WF6A 5HG5A 2VTSA 3CJGA 1T46A 4L53A 3UPZA 1FVTA 4BKZA 4F9BA 4QO9A 5K4IA 1GZ8A 1OUKA 4DFLA 5J5TA 3ERKA 5ANKA 3ALNA 3C0GA 3VAPA 3QZFA 4DG2E 3TUBA 2A27A 1I44A 4Y46A 5IH6A 4YJSA 2XMYA 5KHXA 2B55A 5IQGA 1CMKE 4GG5A 3R21A 2Z7RA 3IW4A 4ZTLA 5HTCA 4FG8A 5M53A 5F4NA 3D2IA 4I21A 5HIEA 4WG5A 2F7XE 4XG7A 4RA5A 5J9LA 3PIZA 3PTGA 4EHGA 4MBJA 3RCJA 5C26A 5EFQA 4DGMA 5CNNA 4M0ZA 4FT0A 5CSPA 4FV2A 2PMOX 2QONA 4JLCA 4HGTA 4PF4A 4RX7A 3RWPA 4YUQA 5M4IA 2GQRA 4F70A 2ITNA 4KNBA 4DFXE 4FV0A 4C0TA 3LFQA 1JSUA 3FXZA 4O0WA 1NY3A 4TPTA 2XZSA 5EW9A 2G9XA 3QTSA 3JXWA 3TV7A 3VS6A 4WOVA 4E3CA 2C5XA 3F5UA 4FIIA 3DB6A 2GDOA 4GSBA 2I0HA 5CY3A 3F9NA 4AW0A 3RNYA 3BLRA 5HG9A 3EN6A 2BAKA 4X0MA 1HOWA 5HO7A 3GOPA 3C13A 1SVHA 1H08A 3RK9A 4BDDA 2I6LA 3BEAA 5I3RA 3G2FA 2YDKA 4R7BA 4FKRA 4EH2A 4BKJA 4PUZA 3AT3A 4G3EA 4FSYA 4QNYA 3DAEA 5DN3A 3R9RA 1XO2B 2IVUA 2J2IB 4IM3A 5LMAA 5CEQA 3QTQA 4QP2A 4BGQA 4L7SA 3ZM4A 3KXZA 5D12A 5TE0A 3FI2A 3ET7A 4RJ7A 4C57A 2PE1A 4AT3A 2WMWA 4IXPA 2KTYA 5KMNA 2GNLA 2E9UA 1TKIA 4ZJIA 4FIJA 3HA8A 1NVQA 2DQ7X 2HY81 2O5KA 3DKCA 3HRBA 2XB7A 5CF8A 4GT5A 5K0KA 3DU8A 1U5RA 3L9MA 4R1YA 2J90A 2OH4A 2VAGA 3QXPA 4X6RA 2J5FA 3UTOA 3WOWA 3TKUA 4QMUA 3E7OA 4BDFA 3U55A 4TYGA 3FMHA 2QO7A 5LQFA 3BYVA 1OECA 3QQGA 1VEBA 3I7CA 3QQUA 4BB4A 3DDPA 3PXKA 4BGGA 4KKEA 2XK6A 2Y7JA 4NIFB 4W4YA 3QUPA 4BZOA 4II5A 5M4CA 1OVEA 3LPBA 4E7WA 3MSSA 4HGEA 3KKVA 4TYJA 4YO6A 3F82A 1FBNA 2YIWA 5M55A 5FBNC 2C1AA 2VGPA 3HLLA 2R9SA 2VTPA 4ID7A 4P5QA 4FTRA 4AGWA 3TUDA 2WFYA 3ZFYA 3R8UA 5DNRA 2HZNA 4O0UA 5ACBC 4AQCA 3DXQA 5AP5A 1ND4A 4MXYA 4BHZA 3RI1A 3HNGA 2YIYA 1U5QA 4PQNA 4EHZA 2JDRA 3R9OA 5HLWA 3H9RA 5HLNA 4EYJA 3AC5A 5DMZA 4X2JA 4FKTA 4U3ZA 3ZXTA 2IVSA 4FV9A 3NW5A 3GXLA 1XH5A 1H1QA 4XUFA 4EWHA 3F5XA 3Q6UA 4A7CA 4M68A 3ZDIA 3EYGA 1J3HA 4L8MA 3VF9A 4C7TA 4WNOA 4FKJA 2XEYA 4IFCA 3BGQA 4MXOA 5E8SA 3RVGA 1WVWA 2WQBA 4OGRA 4Y5QA 3I81A 4YJRA 5IZFA 4KRCA 3UODA 3H3CA 3A7IA 4ZTSA 3SG8A 3RWQA 3RGFA 2YIRA 1F5QA 4RFZA 2GFCA 3DTWA 3GCUA 3K3IA 3LMGA 2QR7A 1F0QA 5HE3A 5C8MA 3I5ZA 3Q6WA 5TT7A 4OBQA 4R3PA 4QP1A 4D0WA 5KMOA 4CMTA 1Z57A 4PP9A 2HW7A 5CSWA 2C47A 2O3PA 4ENYA 5CWZA 3ZHPC 4B8LA 3MYGA 2PPQA 3LCOA 2OXYA 3F2AA 1S9IA 4AN3A 4AP7A 3O51A 5EI8A 3F6XA 2WIPA 2BZHB 3V5TA 4F1TA 4DEBA 1B6CB 1PXLA 1VYWA 3A7JA 1M14A 2WTJA 4CCUA 5CAVA 3G51A 3MTLA 3LXNA 3ZRMA 4V05A 3FMLA 3Q2MA 2VUWA 3HRCA 1W84A 2WMTA 2PZ5A 3KQ7A 3R63A 4EI4A 4S30A 2HAKA 1R0PA 4O38A 3F3TA 1H0VA 3P7BA 4IDVA 4ITHA 2CKOA 4JBVA 4JIKA 2XM9A 2R64A 4CFFA 2XCHA 4R77A 2BDFA 5TO8A 3U6IA 3CLYA 1DI9A 2P0CA 5CZHA 2YACA 3K3JA 5KUPA 5ANJA 5HE2A 4XRLA 2OKRA 2XS0A 4O2PA 3ZM9A 4XRJA 4YJPA 5HICA 2ZM4A 3UG1A 5EQYA 4W9XA 3CGFA 2ERZE 4D9TA 1W83A 4OAUC 2PVKA 2W1FA 4F08A 2BR1A 3HVCA 3NVMB 3FLWA 1B38A 4R7IA 1RQQA 5CAQA 4RWLA 4JQ7A 3OOMA 3SXSA 4FR4A 4TYIA 3HV6A 2W1ZA 4GUEA 4C02A 2IZTA 4IAIA 4PL3A 4X21A 3GENA 4O7LA 4PMTA 3DCVA 4FZDB 4CYIA 5J7BA 3PXRA 4N4SA 1W7HA 4L6QA 1WBPA 4QYHA 4XLIA 2BAQA 1CTPE 4U44A 4EQUA 1G8SA 1L8TA 4GYGA 1OGUA 2H34A 2YHVA 4IBMA 4BI0A 1NT2A 3R00A 4UB7A 3D9VA 5DGZA 5I9VA 3PSCA 1BL6A 4QYYA 2WAJA 3C4EA 4FKIA 4G3GA 4M97A 4NJDA 4PPCA 4U0IA 4QMYA 3LJ2A 4DEHA 3CSVA 4LL5A 3MVJA 1W98A 4IX6A 4MXXA 2FSMX 2VO3A 5CENA 3DXPA 3V8SA 3BWFA 5HQ0A 3VIDA 3I0OA 4GT3A 1FPUA 1AQ1A 3ZO3A 3QZHA 4WHZA 2PZYA 3MW1A 4I23A 5LCJA 4Q5EA 4N0SA 2H96A 4IC7A 4FSZA 3LQ8A 5CX9A 3R28A 2UZWE 5IQIA 2YLFA 4QT1A 3GCQA 3HP2A 3ORPA 4CTBA 3LVPA 4H1MA 4U80A 4WNKA 3R22A 3A62A 5DR2A 3CCNA 2W4JA 2WPAA 4OTWA 3TCPA 5JZJA 4RGJA 5AJQA 2ONLA 4CLIA 4L3LA 4KS8A 4H36A 4IB3A 1LR4A 2UW9A 1XBCA 4I93A 4A9SA 3EQRA 4JBPA 4FEQA 1Y57A 2HCKA 5I0BA 4DINA 5JRSA 2GNFA 4KIOA 1OPJA 3VS2A 3Q60A 3B8RA 5L2IA 4BZDA 1WBNA 3QTUA 4GUBA 3FLNC 5DRDA 3PZHA 3UYTA 4BTMA 4TL0A 4B6LA 3IG7A 4ZK5A 4BCIA 4O0SA 3PXYA 4J8NA 3ZC6A 2ITZA 5EYCA 4CQGA 4G6NA 4LV5A 4QMTA 5J1VA 3FC2A 2ZV9A 4YZ9A 2REIA 5CSVA 3LLAA 3FKLA 4DC2A 1PYEA 2B7AA 4FKQA 1AD5A 5KMKA 1YW2A 1YHSA 5AP4A 1KOAA 3OVVA 2XRUA 4F0IA 4CKJA 5AUTA 3ZSHA 3C4XA 3TWJA 1PXIA 1QPCA 1DAYA 2HWPA 5AX3A 2R3QA 3TNWA 3PXZA 3D7TB 4FC0A 1KE7A 3WIGA 2O0UA 3UC3A 3CQWA 3CKXA 4X6QC 1UU9A 3QF9A 2A4LA 3EB0A 4U43A 4EOOA 3MB6A 1ZZLA 2J4ZA 3W2OA 3L8PA 4JVGA 2XNPA 5EOLA 5AUWA 1OZ1A 4FKUA 2CGXA 4QP4A 2UW7A 1O6LA 2UW4A 3NUUA 4TXCA 5E7RA 3EN9A 2QKWB 4TRLA 5ICPA 3RCDA 2YAKA 5FM3A 1ZY4A 4LI5A 5BYYA 3R7IA 4JIAA 4ZTQA 2A2AA 3AD5A 1YKRA 3SAYA 3QHWA 4I1ZA 4HGLA 4EQCA 2PMNX 4D2WA 3P86A 4HVDA 3ZLWA 2CKPA 2EXEA 4FZ7A 4M12A 4XOYA 4BCJA 5HU9A 1ZMWA 2BALA 2R3JA 2F2CB 1PXMA 5CU4A 5KX8A 4GFMA 1YHVA 2QOLA 4BTKA 4GJ2A 4NZWB 3MPMA 4W4XA 1PY5A 2JLDA 2QLUA 4ZXTA 1YI4A 5CVGA 2XJ2A 1H01A 2OXDA 2QOOA 1O6KA 4GCJA 2W1EA 5GHVA 2C5OA 5IA4A 5L2WA 1O6YA 5LMKC 4ZSAA 4GK2A 4UBAA 5EK7A 5HTBA 3NYOA 4QMXA 4PP7A 4FSNA 5J9ZA 1PKGA 4LYNA 4FSRA 4HVHA 4CTCA 4ALVA 4RIXA 3LAUA 3SQQA 2YERA 2DWBA 4L7FA 2I0YA 5BNJA 4ACHA 3OBJA 1IASA 4YSJA 5K4JA 2WGJA 5CT0A 4BBEA 1VZOA 3W8LA 3FWQA 1OPKA 3UVPA 4EL9A 5CASA 2P2HA 4O7VA 4MNFA 5FD2A 4D2TA 5EKNA 1TVOA 4WSQA 4OTFA 4EORA 3HDMA 4JG7A 4EEVA 4BVUA 4YO4A 4RLLA 1WVXA 4HJOA 4XHKB 3DLZA 3N9XA 1STCE 3UYSA 3VF8A 3LCSA 4CMUA 3OCSA 5HNIX 3KGAA 4J71A 4JXFA 2HXLA 3FSKA 3ULZA 4RJ4A 1IRKA 3QQLA 4AZFA 3GGFA 1H1SA 2ZJWA 4NM7A 2J5EA 2Y4IC 5JT2A 2PZPA 4KBAA 3CTHA 2QI8A 4TT7A 5IA1A 4YPSA 1NVRA 2PVYA 4XP3A 4RIYB 3AT2A 3CBLA 3H0ZA 4NTSA 4NCTC 2GQGA 2BMCA 2JIVA 5F9EA 5DYJA 1MQ4A 4TTHB 4ERKA 4IAZA 2BIKB 2X2LA 3ULIA 3GEQA 4DHFA 3FAAA 4XS2A 4FGRA 3NW7A 3IDCA 2YDJA 2G01A 2B9FA 5LCKA 3MY0A 3L9LA 2YCRA 2JKMA 1KE9A 2QODA 3C4WA 3CGOA 3LFNA 4WUAA 3V6RA 5HX8A 1BL7A 4JG8A 4JL9A 5HG7A 4DFBA 4C58A 4KKHA 3ZLSA 4AA4A 2RKUA 5GJDA 5CAOA 5AIRA 4FNZA 4JRVA 4RRVA 3OFMA 4C2WA 3VC4A 3R8MA 3U4UA 4F7NA 3R7GA 2QQ7A 3BU3A 4CMOA 5D11A 4XLVA 2C5NA 3SKCA 4BWKA 4DEEA 1H1PA 3NCZA 4G6LA 2GMXA 5EDPA 4BCQA 3TNHA 4MH7A 4ALWA 2ESMA 2C0IA 4X2FA 1PKDA 5HORA 4FV3A 5EQPA 2WEIA 3OBGA 5HE0A 2WZJA 1REKA 2YCQA 3POZA 4KKGA 3TIYA 3ZO1A 3EKNA 3EQPA 2E9VA 4L67A 3RINA 4X3FA 4YTHA 2PVRA 4PTEA 5JGAA 5LWNA 3F3UA 2X2MA 3LXKA 4LL0A 1MQBA 1OIYA 5DIAA 3R7EA 3UQGA 5L4QA 3W55A 2WQEA 2P2IA 4DG3E 4U45A 3NCGA 3U6HA 1Q3WA 3FYJX 4OUCA 2ETKA 5FXQA 3PG1A 1BMKA 2I0VA 3OC1A 2GS7A 3TTJA 3ENHA 3HL7A 4D4VA 1PF8A 2OU7A 5M51A 3G0EA 4K77A 2W9FB 2WB8A 3ACKA 2FA2A 4Y95A 3P23A 5L8LA 3O7LB 3QWJA 4DCAA 4GYIA 3FYKX 3PVWA 4F9WA 2R7BA 2GCDA 4AZWA 3QUDA 5CT7A 5HKMA 4O21A 4EK5A 2W4OA 3UIBA 3FMMA 2WOTA 3KF7A 2PSQA 4EOKA 4K2RA 3GC7A 2DUVA 3C4CA 4LOPA 5FP5A 4O6EA 1V1KA 5DE2A 4RMZA 3V5QA 4W9WA 1K2PA 4YLKA 4MCVA 4IWDA 4MBLA 3H4JA 3ORTA 4QP7A 4PL4A 5DWRA 4AUAA 5I5ZA 1OKZA 3PJ2A 2JKKA 3VS1A 3LM0A 3AC8A 3IS5A 5E8ZA 4F7JA 3V01A 1PW2A 1RE8A 1URWA 3FZRA 5CXHA 5EDQA 5AWMA 4D2RA 5FTOA 4IWQA 4ZP5A 1QPJA 1Q4LA 4KBCA 5M4UA 3K2LA 2C6LA 2UZOA 1XH4A 2YM6A 3EFLA 3PSBA 4WSYA 3VUHA 5HESA 5CAPA 4U41A 4RJ6A 1NA7A 3OHTA 3DTCA 4M69B 4LQMA 2PYWA 4G5JA 4DE4A 1ZAOA 5AUYA 3O8TA 2W5BA 1M2RA 4GMYA 2BUJA 3BPRA 1BI7A 4FTJA 4FV6A 4EK6A 2W1IA 3EQDA 2GHLA 3W10A 4ERWA 5JQ5A 3TIZA 5EM8A 2YM4A 3MY5A 2BKZA 3OY1A 3JS2A 1SM2A 3P4KA 4EUTA 4YC3A 2VO0A 5LVMA 2QLQA 5A4CA 4GVAA 1YI3A 3OEZA 3OY3A 5IQHA 4A9UA 2VTIA 4P90A 3TG1A 4E8AA 3TJCA 4BDBA 3RAHA 5I9UA 3OS3A 3RPRA 4BC6A 4ZZNA 2BPMA 3RPSA 2XIZA 3R1QA 4J53A 2GNIA 2QVSE 3BQRA 4LUDA 5BUJA 3ITZA 3G90X 5DT4A 2C6TA 2XYUA 3HMOA 4CZUA 4D2VA 5IA5A 3SOCA 2C3JA 1ZY5A 3VWAA 3FBVA
chains in the Genus database with same CATH superfamily
5KO1A 3GUBA 4BJJA 2WTWA 3FDNA 3L8SA 4I6QA 3TACA 4UWYA 1OL1A 4ZOGA 4YTCA 3FSFA 5EDRA 5IUHA 2IN6A 3VBWA 4YZCA 4RA4A 3HAMA 3MVHA 4FK6A 1QPDA 2OZOA 3GQIA 1RJBA 3VRYA 4E26A 4KUJA 1GZKA 3CQUA 4ZMEA 3HV5A 3ZONA 3LXPA 3NUNA 4YTIA 4BI2A 4Q9ZA 3R1NA 4HCVA 2ZDUA 1Q8UA 2VTHA 4MXAA 3RALA 5L2SA 1E1XA 2QU6A 5CSXA 4YJNA 2C1BA 3CPBA 3A4OX 4OAVB 3AKKA 4GS6A 3TZ7A 2ZMDA 3LFFA 4KS7A 3W32A 2ITXA 3CY3A 4DDGA 1FGIA 1BLXA 3U51A 4EK3A 4M13A 2OF2A 4UN0C 2Q0BA 3LIJA 4BCHA 4FKLA 3R9DA 4M84A 2QURA 3AD4A 4TNBA 3R7OA 3OTUA 3C0IA 2E2BA 4NW5A 4S31A 5EYMA 3V5WA 1MRUA 2XAMA 3MESA 4FIGA 1YWVA 2PHKA 3JPVA 3W0NA 1G8AA 2UV2A 4V0GB 1HCKA 1LUFA 3R1YA 3NYNA 5ANEA 4E6CA 1Q8ZA 4RWJA 4DLJA 2R3RA 4RWIA 4NL0A 3R1SA 2FB8A 4XMOA 4J99A 3WZJA 3PE1A 2CSNA 3NFGB 2XYNA 3Q2JA 2QR8A 5LOHA 4FE2A 3O17A 3MH1A 2X8DA 3AC1A 3DNDA 1FVVA 2YLEA 3OUKA 3RPOA 4HYHA 1XBAA 2V7AA 3DFCB 2JFMA 3R7VA 3DK7A 3BHTA 1Q61A 5HZNA 4RPVA 4FYNA 4AZTA 5JGBA 5C1QB 2RF9A 2C6KA 1MP8A 3QKKA 3KRJA 2PVJA 5DHJA 3FPQA 4YZNA 3RJCA 4EQMA 2C6EA 3QQHA 4YLLA 2RFNA 4LV7A 3UP7A 3VUGA 4BDHA 1ERKA 3M1SA 2KULA 4FOCA 3T3UA 3L8VA 3P5KA 3DB8A 1Q8WA 1A48A 1OUYA 4ZTHA 5LARA 3FZTA 2CDZA 1JKTA 1BI8A 1FVRA 1WAKA 4AS0A 2XNOA 3NRMA 4KWPA 4TYHB 3PWYA 4U9AA 5EH0A 4O84A 3OT8A 2E9PA 2R3NA 2XVDA 4HCUA 3BHUA 4IDTA 4EH4A 3D0EA 1ZYDA 4FSTA 2O2UA 2PUNA 4YC6A 4MXZA 5AR4A 5HO6A 2V7OA 1H1RA 2C5VA 5EYKA 4EUUA 2W0JA 1OIRA 2J0MB 3W18A 4S32A 4Z16A 3WZDA 3ZZEA 3K54A 3SX9A 5M57A 4MAOA 2W99B 4BRXA 4BCKA 1M17A 4EOIA 2XM8A 2WIHA 3KFAA 3N51A 3F3VA 4S2ZA 2LAVA 2ITVA 3WF9A 2C68A 3QLGA 3BI6A 4FK3A 4U7ZA 4DYMA 5FG8A 2XF0A 2JD5A 5KHWA 3F69A 4U8ZA 5L2QA 3UNKA 3HUCA 1ZYCA 4K11A 4NSTA 2A0CX 4MD7E 4ZSEA 1Y6AA 4EBWA 1Q8YA 4L3PA 3O50A 4LOOA 4G3DA 1NVSA 4FEVA 1UKIA 5D9HA 4CKIA 2XK8A 2WMXA 3LJ0A 3OTVA 3ZUUA 3TM0A 4V01A 1OI9A 2GU8A 5DVRA 1KE6A 2XIRA 3PRIA 4K8AA 4ZSJA 3ZU7A 4BZNA 3NNXA 4DG0E 2CKEA 4F09A 5CF5A 4ZIMA 5L8JA 4XEYA 3QRJA 3DBDA 3G15A 4KRDA 3ROCA 4L45A 5DT3A 4O7RA 3L8XA 1H1WA 2OZAA 2Y6MA 4E4LA 3DBEA 2YZAA 5H3QA 5A4TA 5GZ9A 2J9MA 3PG3A 2BTRA 4O83A 4G31A 4UZDA 1KV2A 4FTIA 3W0OA 3WILA 3NDMA 2CJMA 3G9NA 4E4MA 2ITQA 2VWWA 3VS3A 2W7XA 2X39A 3A7HA 3BLQA 1FQ1B 3P9JA 3PUPA 4Z7GA 4K18A 1XH7A 4M67A 1U54B 3FI3A 5HG8A 3TNQB 3FMJA 4AQKA 4O0RA 3O0GA 3E62A 2C6MA 2PVNA 2WD1A 5CQUA 3R7YA 3W8QA 4DITA 2XKFA 4ZJVA 4RC3A 5EM6A 5J8IA 4MBIA 1PXPA 4DT9A 3A61A 1IR3A 1Z5MA 2JFLA 4UMTA 4APPA 1OM1A 4ACGA 4QNAA 3QXOA 4ALUA 3CXWA 1UVRA 2O64A 2NPQA 2WMBA 4RSSA 2NO3A 1K3AA 3I6UA 5AP6A 3MN3A 4XV2A 4DBNA 4XG4A 5G1XA 3R83A 3QC4A 4QMSA 2B4SB 1W2DA 4E6QA 1ST4A 5H8BA 3RTPA 1DS5A 2PWLA 2DS1A 1GIHA 2ZV7A 3PA3A 4FODA 5JH6A 3P1AA 2J51A 2ZB0A 5FP6A 3FJQE 2PVLA 4G34A 4A4LA 5DH3A 3DJ5A 4F7SA 3BE2A 3EQGA 4Q5HA 4CGAA 3FPMA 1XHAA 3P7CA 4DCEA 5CU2A 2W1GA 4IX3A 3BBTB 4ANMA 3VBXA 1Q41A 1WBWA 2HZIA 2VWIA 2BHHA 4ZJJA 2X7FA 2R3OA 3FY0A 4MD9E 2RG5A 4QTDA 4QMLA 5E8TA 5H8EA 5HOAA 4DH3A 1LPUA 1MRYA 2X8EA 3CEKA 3SHEA 2XARA 5GIOE 2ZV2A 5CVFA 4DGGA 5FTGA 5IEVA 4LGDA 4JS8A 5A46A 2BAJA 5CXZA 4Y8DA 5CZIA 4UWBA 4B0GA 4JT3A 5E4HA 3TKIA 3QTXA 3VHEA 4ASDA 3UOLA 2YM5A 4I4EA 4IWOA 5LVLA 2XKEA 4MKCA 3KB7A 1BYGA 4OLIA 2V62A 4CQEA 2VWZA 2VTJA 3Q4TA 1YXSA 5D1JA 4AZVA 2B53A 3D5UA 2ZYBA 4EK4A 1GOLA 4FG7A 3T3VA 3IGGA 3GU8A 3DY7A 1IA9A 3R2YA 5CEMA 2JDSA 4YHFA 5FEDA 1OKVA 2F57A 4WBOA 3U8WA 3AKLA 1DM2A 3HA6A 4O96A 4R7HA 3TL8A 2AYPA 4LMUA 3WYYA 4IANA 3FHRA 2O8YA 4IVDA 3KULB 4WT6A 3GI3A 4M8TA 3QX2A 4C34A 5KE0A 2QOCA 4G3CA 5CU6A 4BDKA 1PXKA 4ZMFA 4MWIA 3GU4A 3GOKA 3PPJA 3PDTA 3PUFC 4DHJA 4E93A 1OITA 3QD4A 3IOPA 3KCFA 4IM0A 5BQ0A 3NWWA 3CC6A 3EHAA 4KBKA 3WBLA 3HMNA 3Q9XA 4F4PA 4JQEA 3MH0A 4LRKA 3DQWA 2VX1A 3UVRA 3AMAA 2Z8CA 3D14A 4G5PA 2FSOX 4AACA 4UY9A 5A3XA 3GCSA 3KXGA 1OL7A 3KVWA 4Z3VA 3MJ2A 5HD7A 3D4QA 3LFSA 4QP3A 4F0GA 5KKRC 2W5HA 1PMVA 5A4QA 3EIDA 1YOJA 3KXNA 2W1CA 4EH5A 1V0OA 2BZIB 4M66A 2R3KA 4CKRA 1ATPE 5DFPA 3PSDA 3BLHA 2OJJA 5T68A 4FMQA 3FEGA 4FI1A 3W2QA 4RIWB 2BRGA 4AGCA 1BX6A 2O65A 3KMWA 4QMZA 4RVLA 1XJDA 2X8IA 2R7IA 4GFGA 3WZKA 3EL7A 2VTTA 3FUPA 5AV2A 5CF6A 2PZRA 5T3QA 5AV0A 3H9FA 4KIQA 3Q5IA 4ASEA 3IGOA 4CYJA 4ITJA 3I0QA 1J7UA 1SVGA 2CMWA 1GY3A 2IZSA 4BDCA 2R3MA 2WMVA 4KD1A 4FTUA 4IQ6A 4L42A 2FH9A 4ZSGA 3R71A 3RAIA 4AXDA 5GIPE 3PLAE 3PVUA 4TWNA 2J0LA 5JZNA 4R5SA 5J95A 1OIUA 1QPEA 4FTOA 3LQ5A 3VRZA 4BY9E 2EXMA 2YA9A 3LCKA 1GAGA 3V8WA 5BPYA 3FLQA 4IAFA 3THBA 2WTVA 3ORIA 5LVNA 5AV3A 4O7WA 5AV1A 3IOKA 1ZOHA 3IW8A 3K5VA 5FDXA 4MUQA 4RVTA 4E73A 4BICA 2BDWA 1IG1A 3PWDA 4QTEA 4I20A 1YXUA 5CEIA 2UVZA 5IA0A 4UYNA 4I0SA 5L6WL 2WELA 3B8QA 4XJ0A 2RIOA 4D5HA 3LJ1A 1YDSE 4JR3A 2QOIA 2C3KA 3PY0A 4KIPA 4L00A 2UZBA 2WHBA 5LMBA 4MVFA 3UDZA 2IVVA 2P3GX 5BMSA 4WKQA 2QOQA 4X2KA 3RAWA 2X7GA 3VS4A 4BL1A 2ZV8A 4LM5A 3CS9A 4XOZA 3T9TA 3EJ1A 5AFVA 4UALA 2Y8OA 3NUPA 2Y4IB 4MXCA 3EN5A 4C4IA 4AGUA 3EFKA 3SRVB 1UA2A 2YEXA 3KXXA 3G6HA 2P33A 5ANIA 3DKGA 4BDJA 3RP9A 3PVBA 4AN9A 4FYOA 4HYSA 4E20A 5A6NA 5ETAA 2GNJA 4O1OA 3V04A 3DJ6A 2NP8A 2AC5A 1ZYSA 4UZHA 2X0PA 3G6GA 3H10A 2J6MA 3NW6A 4NM5A 3WZEA 5B2LA 4YJOA 4U42A 3O8PA 4XV3A 4XG8A 5HCXA 3F7ZA 3FLZA 2VNWA 3C51A 3LKMA 4NUSA 4C59A 5AUVA 5ETCA 3WF8A 3TKHA 3IKAA 5AA8A 1X8BA 1XQZA 4QPMA 5LXMA 4L68A 2CGWA 1KV1A 1WMKA 3D83A 1KUTA 1G5SA 3QRUA 4NKSA 5GJGA 3NR9A 3BL9A 3QALE 4YU2A 4ANQA 4MYGA 3GVUA 4HCTA 4OT6A 3F7WA 3MI9A 3RMFA 3BL7A 4R8QA 4YJQA 4IVCA 2W06A 3CY2A 3NFFB 4PV0A 5CI7A 5HD4A 3EQHA 2ZFYA 4DBXA 4IC8A 3G0FA 4JDJA 3ORNA 4I3ZA 3UMXA 4RJ3A 5JMSA 2E9NA 1IAHA 3QC9A 1M2QA 1CDKA 3T8OA 5AX9A 2WEVA 4ONAA 3N4TA 3W0QA 2FSLX 1M52A 4IMYA 4WRSA 4O1PA 5GJFA 3W16A 3S95A 1R0EA 5J1WA 3FC1X 1SYKA 5KMMA 3IO7A 4AOJA 4BKYA 4JDKA 5F1ZA 4IH8A 2VWVA 4FV4A 3ENMA 4QPSA 3UG2A 4J7BA 1VR2A 3E64A 4KIKB 5L2TA 4AFEA 3C5UA 4HGSA 3PJ1A 1CKIA 2FVDA 2UZDA 4JBQA 5HGIA 1PMNA 4CNHA 3S2PA 2WKMA 3P0MA 3PP0A 4KB8A 4BIBA 2QOBA 3NS9A 5AP3A 3FY2A 5CU3A 4RQKA 3ZCLA 4A9YA 3DGKA 4V04A 3F3WA 1A06A 4XBRA 4HVSA 3BRBA 3MS9A 1ZXEA 4XH6A 4GFOA 5T6KA 4HZSA 5AUZA 4F9YA 3BQCA 4J98A 4MNEB 3WIKA 2X6DA 3EWHA 2OF4A 4H3QA 3TN8A 3UIXA 4QTCA 2EVAA 4QYFA 4WO5A 2C0OA 3BYMA 4RVKA 5HBEA 4NTTA 4UEUA 4I94A 3UJGA 4E4NA 3EQBA 4C3PA 4IB5A 5GZAA 4QP9A 3E88A 5M06A 3U9CA 4F1MA 4AFJA 3QTIA 3F5GA 3BELA 4LRJA 4FIFA 2W5AA 5IDNA 2XNMA 3E3BX 4F99A 4O91A 3Q5ZA 2YABA 2F7ZE 4BDAA 3MDYA 3F61A 3E3PA 3DJ7A 3QX4A 5IH5A 1JSVA 3LFBA 5EHYA 2Z7LA 3CE3A 2SRCA 3GFEA 2OG8A 4GU6A 5JEBA 3QU0A 2PY3A 2XNEA 3BGZA 5I9ZA 3COIA 4X2GA 4FIHA 5HIBA 5IA3A 4XV9A 4BGHA 4Z7HA 3ATTA 3REPA 1LEWA 2Z2WA 4FTLA 5DR6A 5F94A 4D55A 4FL1A 1OL5A 1IA8A 1E9HA 2CGUA 3F66A 3AC3A 3JVSA 4E6AA 4N57A 4PY1A 1Z9XA 4K1BA 2ZB1A 2W9ZB 4FG9A 2CGVA 5EHOA 4BFMA 3JY9A 4D0XA 3UQCA 3MA3A 1YDRE 3BHHA 3R8VA 3I60A 3WZUA 2I40A 3P79A 4EHVA 2Z02A 1HCLA 5CALA 5HVJA 2AC3A 4BCPA 3I79A 4USFA 4FTQA 2OSCA 3RZBA 2YAAA 3ATSA 4NYEA 1WBVA 2WTKB 3FXXA 1J1CA 2YM8A 4C38A 5IEYA 3A8XA 4UMUA 2UZNA 1FINA 4BWPA 3ANQA 3BE9A 3QYZA 5AR8A 4AE6A 4C4HA 4EBVA 4EH9A 4F64A 1WBSA 4M7IA 3BYUA 5I9YA 3JVRA 4EOMA 5IISA 4FEXA 3S4QA 4FNWA 4BYIA 4QDEA 1GIIA 3KN6A 3BLAA 5K5NA 1F3MC 3L1SA 3R7UA 5GNKA 4FL2A 4AA5A 2YCSA 1Y91A 1BUHA 3A4PA 2I0EA 3CKWA 1CKJA 4M3QA 3RNIA 4HVIA 4IAKA 3OG7A 1KSWA 4OBPA 2PE0A 4PDSA 2H8HA 3UDTA 1DAWA 1PRYA 3KC3A 1YOMA 4RJ5A 2F4JA 3QKMA 5JFXA 5LJJA 3LOKA 3VQHA 3QCYA 3QQKA 3WF5A 4DHIB 4BCNA 5FRIA 2X9FA 4EOQA 3PJCA 2B9HA 3R04A 2QG5A 2ZM3A 2VRXA 2YZLA 3PVGA 3UGCA 4BTJA 4TWOA 3KRXA 2UUEA 2BRMA 3HGKA 4DTBA 4G16A 3WF7A 3A2CA 1KE8A 4PPBA 2UVYA 2WOUA 4NIFA 4ZY4A 2VO7A 4MX9A 2IWIA 4FKOA 2ZMCA 4ZS0A 5C8KA 5A14A 2JEDA 3CR0A 3V5LA 4RJ8A 4JRNA 3QQFA 4Y83A 3OW4A 4DAWA 3DKFA 3HEGA 4KA3A 4E5AX 3EKKA 4FTMA 1XR1A 1M2PA 2WO6A 4FZ6A 3Q96A 3FKNA 3QCXA 4AX8A 2W4KA 2YJSA 3VUIA 2GQSA 3DV3A 4NM3A 5AMNA 2Z7SA 4DFYA 3E8NA 3KEXA 3E87A 1WCCA 1QCFA 2UW5A 3MJ1A 3U6JA 5A9UA 4I6BA 3LCDA 4IFGA 4WD5A 1S9JA 2X4FA 2OICA 4DEAA 4EC9A 2V55A 4O27B 4FJVA 4FIEA 4L01A 1H25A 3DPKA 2C0TA 4MF1A 5DEWA 3RM6A 5CYIA 3O71A 5FTQA 3D5WA 5IH4A 3PIXA 2C6IA 4FICA 4ZEGA 1TQMA 4DFNA 3IQ7A 1JLUE 3B2WA 4WNPA 4O4DA 3ORMA 5HE1A 3F2NA 4IAYA 1JAMA 3V5PA 4UWCA 5TOZA 1Q99A 4YC8A 3P5JC 4LUEA 4I5PA 1K9AA 4O7SA 3C1XA 2R0IA 4M0YA 5ANDA 3TZ8A 3AXWA 2R3PA 5IDPA 2PUPA 1JPAA 2J7TA 4HOKA 4CG9A 3RBWA 4NW6A 4BN1A 1VJYA 3F5PA 5DR9A 4CV8A 4ZSLA 1CKPA 4O7YA 3C0HA 3ZUTA 4GIHA 5KZ0A 3D15A 4FV7A 3UOKA 4FKWA 5DBXA 5IEXA 2ITYA 3ANRA 4G9RA 4FNYA 5GZ8A 3A60A 4RT7A 2NRUA 4KSPA 4YJUA 5F95A 3ZTXA 5JRQA 4BWXA 3ZLYA 5HX6A 5FXSA 4OTDA 4H3BA 2CLXA 4FKVA 1ZARA 3D94A 3HMPA 3MY1A 4IVBA 1J7IA 4B4LA 4QMNA 3LQ3A 4DGLC 2GTMA 2X0OA 3NPCA 4RZWA 2WTKC 3AGMA 3NEWA 2UW8A 4I5CA 4NK9A 4PDOA 5AP1A 4CRLA 2PUIA 5KMJA 2J0KA 3SC1A 1H27A 3G5DA 1DI8A 4EH8A 3GCVA 3EL8A 4AE9A 5KBRA 5A6OA 4E1ZA 5DRBA 2I7QA 5KBQA 5LMKA 4F6WA 1YWNA 3C4ZA 4C37A 2OLCA 4O7NA 5IMEA 5BVNA 3E92A 3NNUA 3C7QA 4L43A 3VN9A 4J52A 1PMEA 1I09A 3BHYA 5M4FA 3DFAA 2F7EE 2XKCA 3LMIA 3FZ1A 4CFXA 5J5SA 5HIDA 4JR7A 4QOXA 4C36A 3ZFMA 2GPHA 2BFYA 2XUUA 3ZFXA 1G3NA 3QRTA 3SLSA 3GT8A 5CS6A 4ENXA 4FUYA 3CTJA 1JBPE 2FYSA 4GKHA 2JAMA 2HOGA 1G8KA 1UWHA 5IQDA 2C3IB 4BF2A 4FBXA 1J7LA 4TZRA 2CNQA 1Y6BA 3WARA 2HENA 5BUEA 5HI2A 3UO6A 5B2MA 5HHWA 4WG4A 5HNGA 4R6VA 1ZOGA 3QGWA 5C27A 2XIXA 3PP1A 4FTCA 3AOXA 3I6WA 2JKOA 5DA3A 3W2SA 2VU3A 4BDIA 2HIWA 1OIQA 3CP9A 4J1RA 4WA9A 2IZUA 5IQAA 2Z60A 4AU8A 4ACCA 4XG3A 5BX0A 2CNUA 3ZSIA 2ITWA 4BIDA 2BRHA 4IB1A 4QMVA 4QPAA 4NCTA 3AQVA 3KY2A 1XH9A 3MFUA 4FT7A 5AR5A 4AXEA 4E5WA 4HW7A 2PZIA 4C4GA 2G2FA 4P7EA 3NX8A 3FQHA 2W05A 3W2RA 4ASXA 1T45A 4N6YA 1W2FA 1SVEA 2HY0A 1UU8A 2ERKA 3OWPA 1P2AA 2E9OA 2PTKA 3U9NA 5JKGA 4AT4A 4QP8A 3PA4A 3GC0A 3HUBA 4LG4A 3PLSA 3NGAA 3II5A 4I92A 3TTIA 3PRFA 4B8MA 5JFSA 3AD6A 3MGYA 1WBOA 1P5EA 1H8FA 3IPHA 3QQJA 3UNJA 4DH7A 4U79A 3OWKA 4BR3A 2X7OA 4I6FA 3TT0A 4PWNA 3VS7A 1OB3A 4I0TA 2VWBA 3COKA 5EHLA 3QA0A 4OW8A 3UDBA 3TDVA 2W1HA 4EOPA 3UP2A 3GU7A 2QOKA 3MH2A 2ITUA 4ITIA 5K9IA 3TI1A 4IJPA 5HCZA 4PDPA 3KRLA 3Q3BA 4BCMA 4GKIA 3FLYA 2PMLX 2RSVA 2XA4A 4IZ5A 3UO5A 2HXQA 5AM7A 3AGLA 5FM2A 3I4BA 3ZEPA 3KK9A 2R3LA 5J9YA 3PFYA 3FE3A 2WQNA 3W0MA 2R3HA 1WBTA 3HDNA 3D7TA 5BUIA 3TNPC 4AF3A 3BU5A 2OWBA 3VONA 4ZLOA 4XBUA 1H0WA 1J1BA 3JUHA 2WTDA 3NNWA 3Q52A 2UW3A 2OH0E 3FQSA 3ZYAA 4ZTMA 4QQJA 2B0QA 2X2KA 3BX5A 4F6UA 4G17A 5DG5A 1NXKA 2ITPA 1R39A 3PZEA 5AA9A 3DAKA 3VO3A 4FTNA 4C4EA 3QD0A 1GZNA 2XNBA 3Q9YA 2ITOA 4FV5A 2XK3A 3ZEWA 2QOHA 3UE4A 4WG3A 4EJNA 3UVQA 1OBDA 4G3FA 5IU2A 4AW2A 5HCYA 4AOTA 4AG8A 3LW0A 3DA6A 3O5AA 1V0PA 3LXLA 4G9CA 2CCIA 2EB3A 2XIKA 4NT4A 2GTNA 2WMQA 1IEPA 3GNIB 4AAYA 3E5AA 3IONA 3FMNA 4FSQA 5ACKA 1U4DA 3EOCA 4QRCA 5KKRB 1QL6A 2XANA 4PMPA 3V6SA 4RIXB 5AADA 3SXFA 1NW1A 4ANNA 2DYLA 4H39A 3SGCA 4FUXA 3ORKA 4J96A 4YZBA 4X2NA 5AAEA 1WVYA 4YBKA 5AM6A 5EG3A 5AR3A 3JYAA 4AA0A 4YJVA 4N6ZA 2JIUA 3CD8A 5HLPA 3Q32A 4QMMA 4BCFA 3JR1A 4YNEA 3R8ZA 3TJDA 3ZRKA 3VQUA 5FUTA 3O2MA 4OR5A 3FLSA 4GRBA 4P4CA 4PX6A 4AW1A 4D4YA 4JAIA 4IAAA 4L52A 3O7LD 1R3CA 5DEYA 2UZUE 5E91A 4ZTRA 3Q4CA 2YM3A 4FVQA 4PTGA 4RFYA 2UW0A 4EHEA 3NNVA 3QUEA 4YJTA 4U97A 4EYMA 5CEKA 5HO8A 4CFVA 4UMPA 2GNHA 2PVFA 3LFDA 1R1WA 4ZZOA 4AN2A 3V51A 5J79A 4HYUA 3KXMA 5J87A 4JOAA 4WNMA 5E1SA 4F78A 3NLBA 1XKKA 4MTAA 4BCGA 5L3AA 3TV4A 2ACXA 2I1MA 2ONLC 2RFSA 3VJNA 4AXAA 2CHLA 2FGIA 3AMYA 4DH5A 2IW6A 4B9DA 2VTLA 1SZMA 2IVTA 1PJKA 4FKSA 4QEBA 1UV5A 4LV8A 1OL6A 5E8VA 3M2WA 4CRSA 5I4NA 2XH5A 4HZRA 3OOGA 5EYDA 1UWJA 4EH3A 3UZTA 4G6OA 3CTQA 4ANOA 3EQIA 1MRVA 4LOQA 4RIYA 4Y72A 1YI6A 2J0JA 3OMVA 2A1AB 5IF1A 4RC4A 4I41A 1B39A 3WI6A 4XYFA 2H6DA 3NYXA 3OEFX 3NVKI 4EC8A 3SOAA 4YHJA 2Y4PA 2YWPA 4P2KA 3KRWA 3LFAA 3MPTA 5BYZA 4MK0A 2PU8A 3GU6A 1YRPA 4K9YA 4O81A 4EWQA 4EOJA 3FHIA 3RPVA 4GV1A 5DT0A 5BVDA 2OFVA 3T9IA 3VS0A 3QHRA 4PRJA 1OKWA 1Q97A 4QYGA 4GIIA 2V22A 2QO9A 5D7AA 4XV1A 4XP0A 4IJ9A 4O4EA 5TR6A 1P4FA 2VD5A 4X3FB 5FLFA 3CQEA 3QTRA 3PYYA 4BDGA 2G1TA 3DT1A 2ZDTA 3L9NA 3MFRA 3BV3A 4XP2A 4ZZMA 5AV4A 5FDPA 2GS6A 5EW8A 4F6SA 4IZAA 3QTWA 3DBCA 5AP2A 4CG8A 4IHPA 2CLQA 3BZ3A 3MPAA 4ACMA 4WRGA 4YMJA 4NWMA 5CU0A 3R9HA 3VHKA 2NYAA 3VBYA 4D1ZA 5IUGA 5AUUA 2F49A 2WQMA 3SDJA 4DEDA 3QZGA 2C6DA 4JG6A 3QBNA 3QGYA 3BIZA 4S34A 3W2PA 3EYHA 2BRBA 4I4FA 5FGKA 4EZ7A 1R78A 2R2PA 2O63A 2W96B 3GC8A 4J8MA 4P5ZA 3HV7A 3SV0A 3UO4A 5E1EA 4H05A 2A19B 2A98A 2UZLA 1H24A 3ODZX 4GJ3A 4NEUA 4CSVA 4Q9SA 3MB7A 2YM7A 1PYXA 5E90A 3C4FA 4AGDA 3SA0A 5D7VA 5M44A 4O0XA 3PXQA 5I9WA 5D10A 4MEDA 4FT3A 1FMKA 3FMEA 2PVHA 1M7NA 3U87A 3WE8A 3W1FA 1CM8A 1GIJA 4FV8A 4IVAA 3QA8A 4RFMA 2OW3A 4I0RA 2OBJA 3OP5A 4UMQA 2RFEA 2G2IA 4Z9LA 4YZMA 2XNGA 5FWKK 4A4OA 4CCBA 2JIIA 4DEGA 5LVOA 3HP5A 2BTSA 3QZIA 5AR2A 3D5VA 4H1JA 2ZOQA 2YISA 5EKOA 2OFUA 2JC6A 3QL8A 5C01A 3VUMA 3QTZA 1OL2A 5JSMA 3KXHA 2FO0A 4M15A 3TV6A 4F1OA 2ETMA 1XBBA 4ASZA 3LZBA 4AZSA 3LFEA 1SNXA 3KA0A 4O7ZA 1LP4A 2YWVA 4RX5A 4R78A 4USDA 3GQLA 4F63A 5JQ8A 4OTQA 3AC2A 4M69A 5JGDA 3W0PA 4EH7A 3R30A 1PHKA 3UZRA 5CI6A 1Q3DA 1TFFA 5HNBA 2C5YA 4I5MA 4W8DA 4XG9A 3KU2A 3TEIA 2ITTA 4DTKA 1Q8TA 4RX9A 1FGKA 4TYEA 5AAGA 4EZ5A 3LFCA 1ZWSA 3W33A 5M09A 3JY0A 5ETIA 3ZBXA 2QHNA 4LFIA 3OXTA 4I5HA 3R2BA 5CNOA 2JAVA 3TXOA 2IJMA 2VGOA 3MBLA 5IUIA 3DLSA 4K6ZA 3Q04A 1O9UA 4AAAA 4TWCA 5ITAA 3ELJA 3BYSA 3H30A 2RG6A 4UXQA 1KWPA 4GW8A 4DH1A 3IECA 2IG7A 4YBJA 4BJJB 4CD0A 4YNOA 4FEUA 3QD3A 4YGAA 2VWXA 3PPZA 3FXWA 2F9GA 4O86A 1TQIA 2VNYA 1W2CA 3OROA 4QQCA 1UU7A 5M08A 3P08A 3LLTA 4NM0A 5AP0A 4I22A 3R73A 3LMHA 4OTPA 4CFWA 4C35A 3B2TA 2IW9A 4RWKA 1OKYA 3ACJA 3VUDA 5BVWA 5K5XA 3VBVA 3S0OA 1GZOA 3I1AA 2NNWB 4GVJA 5IQFA 2C4GA 2ZAZA 4FTKA 3TZ9A 3UPXA 4NFMA 4C4JA 4XX9A 2EXCX 3AMBA 4C2VA 3MTFA 4I24A 3EFWA 4D4SA 3TMOA 5HEZA 4DHZA 3GFWA 1OMWA 5E8UA 2VTQA 2VTOA 3RHKA 2JBOA 1RW8A 3QCQA 2PUUA 4FNXA 3A99A 1WZYA 4RVMA 3ZSGA 4D1SA 3KREA 3UQFA 3AT4A 4C4FA 5A54A 3DOGA 1H07A 2B1PA 3MIYA 3UOJA 3KK8A 5E8XA 4EJ7A 2JDTA 4C61A 5A4EA 1Q62A 1QMZA 3IW5A 3KRRA 2QU5A 3UOHA