3EQGA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a ternary complex with pd, adp and mg2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
343
structure length
314
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqgA01
3MWUA 3K3IA 4D2PA 2RIOA 2WB8A 3ZMMA 4BZOA 3ZTXA 2R9SA 3HDNA 3VWAA 3R04A 4FKOA 1JLUE 3BRBA 4LV5A 5A46A 4D5HA 4RJ5A 4QMYA 3BYUA 2JAMA 2PVMA 2WNTA 3G33A 3UVQA 3ZS5A 5FXSA 5ANOA 3QCSA 5IF1A 4I23A 1DAYA 3RNIA 4J8NA 5BYZA 3V51A 2BIYA 2XJ0A 4GVAA 3KRLA 4GU6A 5AP1A 2XA4A 2GS2A 2Z7RA 3CCNA 1VR2A 3VJNA 3PE1A 2PMOX 1FGKA 3UO5A 4FTAA 5AUTA 4JVGA 4ACHA 3S00A 3RWPA 4M68A 4AGWA 2HZ4A 4FT5A 3OCSA 5I9UA 3O8TA 3EQCA 4E4MA 2PU8A 4FSZA 3KRJA 4IX4A 1O6LA 4QRCA 5HIEA 3PJ8A 4XV3A 3R1YA 4BDEA 2EUFB 1ATPE 1GZOA 4BGGA 2PVHA 4AW0A 5IA3A 4MXCA 2YLFA 4FICA 2ZAZA 3DKOA 3ULIA 3BQCA 4KKGA 4PWNA 4AT4A 1XR1A 3U51A 3M11A 1ZY4A 2DUVA 1BI7A 2X4ZA 3NWWA 4KSPA 5H9BA 2X2MA 3DXPA 3DAEA 3Q4ZA 5FEDA 3KVWA 2GNLA 3UIBA 2QC6A 2PVFA 4WUNA 5FTGA 5ETAA 1ZYJA 4C34A 3AMYA 5EHLA 5HTBA 3PFQA 1OKWA 2BMCA 3PXYA 3RPRA 1YVJA 4FSRA 4FV1A 3G0FA 3K5VA 3LJ2A 3RK7A 5EOBA 3FQEA 4RWJA 4XRJA 3Q9ZA 2JC6A 3QQFA 2CHLA 2YZAA 4CT1A 3PA3A 4E8AA 4HYHA 3COMA 4Y46A 3TUBA 2OICA 2WTKC 1ZLTA 2XYNA 5CY3A 4L42A 4ZTHA 4BTKA 4O6EA 3W55A 4EOIA 4IDVA 4CKJA 4M14A 3KN6A 5JKGA 1H1WA 2UUEA 1XWSA 3VBQA 5EK7A 4L45A 4JIKA 5HE0A 4B99A 5A4CA 5J1WA 3IGGA 4FKRA 3QGYA 3CQUA 4FIJA 3VULA 3BHYA 4DT8A 3RM7A 2UV2A 1BYGA 3LE6A 5CNOA 4PNKA 3PG1A 1ZWSA 3Q4UA 3HAMA 3QCXA 3TDWA 4A9SA 4O7VA 4CFVA 4MF1A 2CGVA 3I6WA 1FMOE 2ZDTA 4RVMA 4F9YA 3CTQA 5KHXA 5IQEA 5EOLA 3SOCA 4C62A 5JFWA 4MD8E 5I9YA 3HUBA 1JKLA 3DPKA 4OTPA 3FQHA 4O7NA 3C13A 2OIQA 3R21A 3LCSA 2CN5A 4I92A 4YC3A 2BRMA 1H24A 2ZV9A 3D9VA 4CD0A 4YGAA 4FK6A 3EKNA 4RZWA 3MDYA 4E6CA 3W16A 2BHEA 3L8XA 3TI1A 3ORZA 3P5KA 4L52A 1J91A 5CZHA 3NAXA 2I0VA 2OZAA 2BUJA 4X2KA 1FINA 1H1SA 4RIXB 4YZNA 3IPHA 4ZTMA 2EB3A 5LWNA 2VTSA 3FMDA 5EFQA 3LVPA 4PTCA 5EI8A 3HL7A 3FZOA 4JX7A 3GCPA 4ZTNA 4LOOA 5HG7A 1KV1A 1Z5MA 4FK3A 4O0SA 4EK3A 4Z7HA 4BY9E 2BZIB 2A2AA 1OMWA 3NNUA 5EHYA 3PXRA 3K2LA 5D10A 4AXAA 2QNJA 3TT0A 4CT2A 2W4JA 2H34A 5L8JA 1ZYSA 2I0HA 2I7QA 3C5IA 3KULB 3FLYA 2XEYA 4LGHA 2WTWA 2YDJA 3EHAA 5DR9A 4M0ZA 5J7HA 5BVWA 4RJ8A 5EH0A 5ACBC 3ZONA 3EQGA 2R3HA 4KINA 5EYDA 1GNGA 2UW7A 3NNVA 3DT1A 3MJ2A 4L46A 5D9HA 4OTRA 1QMZA 4TW9A 1IR3A 3PXFA 4DYMA 4NJ3A 4J98A 3VUTA 4WNKA 2R3GA 3KEXA 3S4QA 4D2TA 5KUPA 3LIJA 4ZTSA 3R8VA 1ZARA 2QU6A 2JDVA 2QLUA 3GBZA 4CFXA 5AEPA 4EJ7A 3UJGA 3RCJA 1BX6A 1MP8A 4AN2A 4R7IA 1H0VA 3DZQA 3KU2A 3ZU7A 2JBPA 5L6PA 3FI8A 5E9EA 1W82A 3F7ZA 3OMVA 2W9FB 4PL4A 2WTIA 4MNEA 3HRCA 2PZ5A 2PTKA 3MVJA 4YJPA 2VTNA 3SAYA 3UNKA 1HOWA 4HPUE 4GUEA 3BHHA 4CEGA 4D2WA 3QZHA 4EOMA 3R2BA 5AA9A 2XNOA 3NIEA 4FMQA 1SNXA 2BAKA 4ZLOA 2YJRA 3SRVA 3GOPA 4ZSAA 3MW1A 3A99A 3NYXA 3QBNA 4GT3A 3G90X 2JKMA 4EBVA 5CEOA 2PUPA 3U54A 5J95A 5FDXA 4E93A 1XH8A 3VS6A 2ITVA 3W2RA 4BI2A 5F4NA 4DFXE 1O9UA 4N6ZA 3FHRA 4OLIA 4U44A 4YJQA 3LM0A 1WVWA 3K5UA 3TNQB 4U3ZA 2UVZA 2C5OA 3OWPA 1K2PA 1K9AA 3ATTA 3TXOA 1S9IA 3CE3A 2BFXA 3PZHA 3F3ZA 4WNPA 4AE9A 3F82A 3P7CA 3UOKA 4BTFA 4CZYB 3JUHA 1R3CA 3U9NA 4YNEA 5HIDA 4JQ7A 2X8IA 2C6DA 3VS3A 3R8UA 2IVUA 4QMWA 5DT0A 3TN8A 2R3OA 3QC9A 2C69A 2WKMA 2Y6OA 2NPQA 4I6FA 4F9CA 3ZO2A 4K11A 3OT8A 5A3XA 1YWNA 4H1JA 2HK5A 3FBVA 5DG5A 1I09A 2QHNA 4YJVA 4G31A 2IW8A 4M8TA 3TKHA 3PPKA 3ZSIA 3UO6A 1Z9XA 2VTHA 3TJDA 5AR3A 2XCKA 5M4IA 1OPLA 2AC3A 2GCDA 3CD3A 2WFYA 2Z7LA 2BVAA 1STCE 4GIIA 3QQUA 4GK2A 4HCVA 4ANQA 4BCIA 4D0WA 2BCJA 4LMNA 3ZLSA 2GNGA 1KWPA 2PZRA 2W1ZA 3DV3A 4O0YA 4LGDA 3S3IA 4AOTA 3F5PA 4EHEA 2VTTA 2RFDA 4DEHA 1XH9A 3BWFA 5LCJA 3ZDUA 4RA4A 3GB2A 2W1FA 2XK6A 1Q5KA 2OH0E 4MH7A 4KRCA 4B0GA 2A0CX 4NTTA 4EK5A 4CNHA 4FEWA 2P2HA 3BGPA 4RJ4A 2WXVA 2IVTA 3KC3A 2P2IA 2WQOA 4O22A 3WZDA 4H05A 3VF8A 1XO2B 4YSJA 4GKIA 2B53A 2XF0A 2HAKA 2WIHA 3ZZWA 4BBEA 1YWRA 3FV8A 2R0UA 3OUNB 2RFSA 5AUYA 3ATSA 2QKRA 4AOJA 3F2RA 2UW8A 3AT3A 4CGAA 1Q3DA 2UZNA 3LFCA 4FNYA 3ANRA 4MNFA 4HJOA 5J5TA 1TKIA 3LQ5A 4BCOA 4AZWA 1PMEA 3PIZA 3C4XA 1H8FA 4U79A 3N4VA 4YTIA 3EZVA 2YEXA 4RQVA 3ULZA 1M2PA 4ERWA 3ENHA 2Y9QA 1U54A 2WQNA 5IA2A 4EZ3A 4K6ZA 3C4CA 1UNGA 4WUAA 5HE1A 2HENA 3R22A 4DHFA 4FEVA 3G6GA 2OH4A 2W1GA 4BDGA 4L7SA 2C5VA 4O7TA 3FXXA 2I0YA 4F6UA 1KE7A 4OBQA 4EYJA 5AM7A 3AD6A 3P78A 2YAAA 3QALE 4AG8A 4D9UA 3GOKA 5I9XA 5M08A 3HA8A 4I0RA 2O64A 4ANSA 5BUJA 3UG1A 2XBJA 3A7IA 4NM3A 3ZUTA 1JKKA 2UZOA 2G2IA 3OD6X 3L9MA 4D28A 3BKBA 4C3FA 2VTIA 3QWKA 2C3KA 4H1MA 3FLSA 3UIXA 5CAOA 3LAUA 4W8DA 3W10A 1KOBA 5ETFA 3ZFYA 2WQMA 4S30A 4L9IA 4ANNA 4XV1A 4OBOA 1NW1A 1ZY5A 2PSQA 4TNBA 3NUSA 4O96A 4E20A 5L6WL 1Y91A 2X7GA 3WIKA 5HNIX 1F5QA 4FTRA 1Y8GA 5IEVA 3IW8A 5KMJA 1URWA 3QHWA 1Q62A 4GT4A 2R3JA 4QMOA 1IASA 2I40A 3UMWA 5HQ0A 3LKMA 1GY3A 4BDBA 3MH1A 3UODA 3QQHA 4IZAA 5CX9A 5LMAA 3B8QA 4A06A 5FUTA 5LVPA 5ITAA 4F99A 3DOGA 3DBDA 3CD8A 4MXZA 4MXYA 4H36A 4B8LA 5LXMA 5CZIA 3C4EA 5A4QA 4IFGA 4O0WA 1RJBA 3FMKA 4RIWA 2ETMA 5DT4A 2O5KA 3RZFA 4TYJA 2VWZA 3QA8A 3TDVA 2VTJA 5KKRC 4AAAA 3KXNA 1G8AA 1U5RA 4DLIA 3DLZA 2PY3A 2Z8CA 3H30A 4FVRA 4OTGA 2ITPA 3R9NA 4BCHA 3DBEA 3IW7A 4GL9A 4WG5A 5GJGA 4ID7A 3ZUUA 3C51A 4FGRA 5IMEA 4RZVA 2F2CB 4G1WA 4KS7A 1RW8A 2JD5A 2Y8OA 3FLWA 3NNXA 4EJNA 2GFCA 2W1CA 1T46A 3GGFA 1MRVA 3AXWA 4TRLA 5CSWA 5E92A 4DBNA 5I5ZA 4O84A 3FY0A 3JVRA 4I5PA 1OL2A 2XNEA 4FT3A 1OBDA 3JR1A 4O0XA 4TZRA 4JBVA 3QU0A 3U9CA 4CCUA 3VAPA 4IWDA 4BYIA 4EOSA 4FODA 3RWQA 3FMNA 3O7LB 3VHKA 3F5UA 1U4DA 3FSKA 3IDPA 2WAJA 5IPJA 2RFEA 4EBWA 5JH6A 3P86A 3L9NA 4IX5A 4OGRA 4F09A 3VUIA 4HVDA 1LR4A 3DK3A 2BHHA 2VRXA 4JDJA 5JRSA 4A4XA 4ZY5A 3D5VA 3Q9YA 2ITWA 5E8TA 2CNUA 4JDIA 3SQQA 3R9OA 2BAJA 2VTAA 3MJ1A 2C68A 5L2TA 2VWIA 4M0YA 1BMKA 4MK0A 1QPEA 4NIFA 2WTDA 4IJ9A 4R8QA 5IISA 2ACXA 4RJ3A 5M4CA 2ZDUA 4XLVA 4H3QA 3ZO3A 3HLLA 2CKQA 2RF9A 2I1MA 2PK9A 3QD2B 2B54A 4DEBA 3L8SA 5GJDA 4EHGA 4ONAA 2CPKE 5FG8A 5H2UA 5JZNA 5KMKA 1LUFA 4QYHA 3PSBA 2XP2A 4TT7A 5FP6A 4MWHA 3S2PA 2GU8A 4F4PA 2WMXA 1OIRA 3EL8A 4C4GA 5TOZA 4FV6A 1JNKA 2UZDA 4PMTA 3QKKA 2ZM4A 2CDZA 4BCJA 2FSMX 3ZC5A 3DK7A 5CU3A 4ZY6A 2ZV7A 5HO7A 2GHLA 3KK8A 4LV8A 2XVDA 5I9WA 4FGBA 3RAHA 2J50A 5GIPE 3EQPA 2VN9A 4M69B 4CKIA 1GIHA 3RI1A 4C59A 3WF8A 4OUCA 1CKPA 3PY0A 4IAKA 4NKAA 4FKLA 3DTWA 3NPCA 4L00A 5D11A 1GIJA 2C6EA 4I0TA 3UZTA 3ALOA 3LCTA 4BRXA 4EZ7A 3O51A 5BVNA 3TNPC 3MV5A 5CAPA 1WVXA 2YERA 2OWBA 2B7AA 3FLZA 2UVXA 3MPTA 5CT0A 1H27A 4EKKA 4I94A 3WF7A 3GENA 2WTKB 4ZJIA 1Y6AA 2WOUA 4WNOA 3TNHA 3CLYA 4Q5EA 3I5NA 5IU2A 4YJUA 3FI2A 4K9YA 3HUCA 4AZFA 5CAUA 1DAWA 3KY2A 4ZJVA 4ZSJA 2WMTA 4LUEA 3GC0A 5CANA 1OPJA 4G6NA 4ZLYA 3EQDA 3C9WA 3HMIA 3CPCA 5CVGA 3VIDA 4PL5A 4F7SA 4BBMA 3F5GA 4M3QA 4PP7A 3TM0A 2XJ1A 2O0UA 3MH0A 5C01A 2GFSA 2WHBA 4GFMA 2V62A 4IVCA 2HWOA 2Y0AA 4FZFB 1YI3A 4YO6A 3DNDA 5DEWA 3TWJA 3V5PA 5CALA 3PIYA 1PXKA 4ZMEA 4JLCA 4OTHA 5L2WA 1K3AA 2BPMA 1XH7A 3UTOA 2E2BA 4DFBA 3ZHPC 1OPKA 1JQHA 1U54B 3VVHA 4CVAA 3LXKA 3DAJA 4UMQA 3QFVA 4IAAA 3F3UA 3FHIA 3CKWA 4L53A 1LP4A 4RLKA 2IW9A 3UQFA 3NNWA 3Q9WA 2H96A 4IHPA 3U6HA 5ANIA 4O83A 3QTWA 4YPDA 3FLNC 3LW0A 3BCEA 4FSUA 4ZOGA 5KHWA 4FTLA 3E5AA 1XBCA 5JT2A 3NCZA 3JYAA 3QXPA 3ZDIA 4C38A 4QO9A 4PQNA 3QTSA 5FDPA 3E88A 4XG2A 1R78A 4IB5A 2PYWA 1W8CA 2R5TA 3PRFA 4FTIA 1F0QA 1OB3A 4NEUA 5IA4A 3THBA 3MY5A 5AP2A 2CLQA 4CFWA 2HXQA 3NGAA 5DI1A 5E8SA 4YHTA 5IUGA 4Y8DA 4EH9A 2QLQA 2W5BA 3E64A 2BROA 3FC2A 1YOJA 3DKFA 3IGOA 3P79A 5FBNC 5FXQA 5BVKA 4C36A 4APPA 5HCZA 3RHXA 3UNJA 2J9MA 2UZLA 4KBAA 4C35A 1YDTE 2XNBA 4G9RA 1YQJA 3U87A 4EL9A 4CZUA 2C1BA 4XBUA 3BU5A 4EC8A 1WBSA 3A8WA 4DE4A 5AV1A 5DYJA 1PXNA 4FZDB 5AP4A 5LWMA 3LQ8A 1OM1A 1L3RE 4R5YA 3WZEA 4DG2E 5JGDA 2J0KA 2GQRA 2OF4A 2X2LA 3EN4A 4HNFA 4UYNA 3RPSA 2VWXA 2ITUA 3QTXA 3FKOA 3SDJA 4QMXA 5IDNA 4AU8A 3T3VA 3PYYA 2WD1A 4H58A 3VUKA 4QMUA 3ZXTA 3BX5A 1W84A 4CLJA 3DXNA 4P5QA 3IW5A 2IZSA 2QOBA 2ONLC 3DS6A 1QPCA 3WF5A 4FIHA 4XG3A 5HX8A 4U42A 4BDKA 3DKCA 3I6UA 1SVEA 3QZIA 2VGPA 5EYKA 4ZK5A 2ZV2A 1DM2A 4E7WA 2HY0A 2WMVA 5EYCA 3FYJX 2ZVAA 3VRYA 4OAVB 4DEGA 3RCDA 3KL8A 1QPDA 3VN9A 2VX1A 3QTUA 3E3PA 5CSHA 4A9RA 3MIYA 3EWHA 5J7BA 4S33A 3MI9A 4O0VA 2GMXA 4LYNA 4A7CA 3T3UA 4IC7A 4V0GB 2EU9A 3LZBA 3MFTA 5HE3A 4DTBA 3H9RA 2X6DA 3QUPA 4WSQA 2HCKA 5HCYA 4GRBA 4IC8A 4JRNA 4FNWA 2Y4PA 3WE4A 3BU6A 1OKYA 3OT3A 3POZA 4ZZMA 3NUAA 5IQBA 4J95A 4QQJA 2QOIA 5K4IA 4U8ZA 5I3RA 4DH3A 4U9AA 2JDRA 3MPAA 3QXOA 3U4WA 2GNHA 5FTQA 3F9NA 4RVLA 4CFUA 2OJFE 3BYVA 5BVFA 3WZKA 3JY9A 4BICA 3B2TA 3F2NA 3QKMA 4YC6A 3LJ1A 4FKQA 4M15A 4UXQA 2XNGA 4MEDA 3G6HA 4GK4A 2XCHA 3G2FA 3H10A 3HV5A 3NYNA 4KIKA 4YTHA 1BLXA 4MQ2A 4Z9LA 5CF8A 5EQEA 4HGLA 4IB0A 3PJ2A 4NW6A 4BVUA 4AACA 2R3NA 4RIYB 4DTKA 2OF2A 3UP2A 4PDOA 5GJFA 4XX9A 4FV5A 5DVRA 4DFUA 4QTCA 3P1AA 3GT8A 3I60A 2HXLA 2JKQA 4IB3A 1EH4A 5CEIA 5M51A 3ORMA 4IZYA 2R7IA 1BL7A 2B4SB 3JY0A 4I93A 4TYIA 2ITOA 2CN8A 5K5XA 3LCOA 3UP7A 2NNWB 3NZ0A 3NUPA 3A7GA 5CSPA 4F1OA 1YDRE 2YWVA 2NRYA 2PE2A 4BKZA 3QRKA 1B6CB 5IDPA 4FL1A 5A9UA 5JZJA 5DIAA 1SMHA 4EYMA 4BZNA 3D7TB 3NDMA 4HYIA 2PZIA 3NUNA 4Z55A 4AUAA 4DAWA 1OUYA 1MRYA 4FSWA 4BHZA 3QRIA 3VUMA 4EH3A 2X81A 3KXMA 4XG4A 4FKJA 3A8XA 1P14A 3HMNA 3RGFA 3ACKA 3PPJA 3L9LA 5AP0A 3UC3A 2QOFA 4YR8A 2WEVA 4RFYA 3NVMB 1M2RA 4PRJA 4WD5A 4YZBA 1LEWA 4CRSA 3DDQA 4GMYA 4ALUA 4C4HA 1GAGA 4CCBA 4WOVA 3P08A 4F7LA 3GU7A 3OXTA 4WBOA 1KUTA 5J8IA 3GCSA 3D83A 5K5NA 2PVNA 2FGIA 3BU3A 3IKAA 3MVLA 4IE9A 3VUHA 2CNVA 4X2NA 4AGUA 2VV9A 4E6AA 1KE5A 1W7HA 2GS7A 2W5HA 3PG3A 4IEBA 4QOXA 4B8MA 3B2WA 5I9ZA 3Q5IA 2A27A 1R0EA 5D7AA 5E8ZA 4TYGA 2XKDA 1E1XA 4YU2A 3BV2A 4Y95A 4ZIMA 4JBQA 4DH8A 2X8DA 3A62A 5J5SA 1PRYA 1VYWA 1NY3A 3KXGA 3Q4CA 4OBPA 4ANLA 3BYOA 4HCUA 4UZDA 5AWMA 5AAEA 4JR7A 4KABA 3C0HA 3VBVA 4ZS4A 3CTHA 5GIOE 1RDQE 3MIAA 2XKEA 4EH6A 2YIYA 1Q8TA 3ZH8A 4FV9A 2IVVA 4QTBA 4V01A 2YM6A 2H8HA 3RBWA 5EM6A 2PHKA 3B8RA 4OT6A 5D1JA 5IA1A 4Z3VA 5LVNA 4QPMA 5CAQA 4FEQA 4EZ5A 5ANJA 2UZVA 2JIUA 4RJ6A 2XKCA 3UQGA 2PWLA 2QONA 3QTIA 4XHKB 1SZMA 3KRWA 5EQYA 4TTHB 1J3HA 3OWLA 3R7UA 3FPMA 3OOGA 5J87A 3QLFA 4F0IA 5AV0A 3FXWA 4YLLA 2BIKB 3PY1A 2E9NA 4X21A 5DFPA 5K0KA 5JGBA 4JOAA 3DGKA 2WEIA 1ZOGA 2W1HA 2R3FA 3E87A 4GJ2A 4P90A 4PUZA 4QTAA 3UC4A 3UYTA 2CKEA 2RG5A 2ONLA 4C3RA 5DR2A 3BQRA 5LVOA 3MH3A 4I6BA 1XHAA 4BN1A 3FE3A 4Q9ZA 4FG8A 5DGZA 2RSVA 1YWVA 5DA3A 5AX3A 4ACMA 3BLQA 4ZLZA 2HWPA 4EONA 3I4BA 2YM4A 4IAZA 3VF9A 4AW2A 4BR3A 4DFYA 3E7OA 4I21A 3FL4A 3GQIA 5AA8A 4BZDA 4YJTA 4O2ZA 3UBDA 2QG7A 4NKSA 1SVGA 4F9BA 1GZ8A 2B9JA 3DDPA 1UA2A 3QHRA 3RPOA 3GC9A 1PYXA 3GXLA 2J6MA 2VO6A 1ZZ2A 5A4LA 3LOKA 4G34A 4YTCA 3U55A 4ACCA 3DB8A 3GC7A 4RX7A 4S32A 5M09A 5A6NA 5KMOA 5EW3A 3ENMA 5T6KA 3V5WA 3QD3A 5L2IA 4YBKA 3OTVA 3MFSA 5IQDA 5AR4A 4J97A 3W8LA 5FBOA 2XK9A 2C4GA 3U6IA 3F3TA 3G51A 1YHVA 2CKPA 4U43A 3ZFMA 3BBTB 3ZLYA 4ZZNA 3TNIA 4QMMA 2CGWA 2QHMA 2KULA 3PSDA 4E4NA 3SD0A 2VD5A 5IH6A 3R63A 3CBLA 4P2KA 3PVBA 3CS9A 4CTBA 4ENYA 3ORLA 1APME 4USDA 2PVYA 4R5SA 2Q83A 2XIZA 3AGLA 1VJYA 5GZ8A 5JFSA 5DNRA 4XYFA 5KZ0A 1PXJA 2P4IA 3UPZA 4CG9A 1UV5A 4RMZA 3PVWA 4IVBA 4BF2A 1OI9A 5ANEA 1W98A 4QYEA 2HZNA 3FI4A 5HO6A 4KIOA 3TACA 3IS5A 4RRVA 4AQCA 1XH5A 2OIBA 1G5SA 3GQLA 3EQFA 4EQCA 3FY2A 4PTEA 2W17A 3DY7A 1CMKE 3WARA 4KIQA 3FZPA 5LOHA 2PVKA 3V5QA 2PVJA 1OL7A 5HE2A 3HNGA 3QD0A 4O7YA 4FSMA 3QWJA 4Q2AA 3ZCLA 2VUWA 1I44A 5FEQA 4AFJA 4FVQA 4ZTRA 4HNIA 3SVVA 5HU3A 4IVAA 2W5AA 2X0GA 2X7FA 4RPVA 1T45A 4U41A 4DGLC 3KF4A 2XEZA 1UWHA 2YCSA 2ZM3A 3DFCB 3OY1A 4G6LA 4YZMA 4JAIA 4JQEA 4S34A 5ACKA 1YHSA 4BDHA 3H9OA 3MGYA 1NVQA 4PMMA 3PWYA 4BCPA 4WO5A 4DCEA 3ORXA 4QT1A 4RC4A 3OXZA 4RVKA 4I5CA 2AYPA 4W4YA 2QD9A 3LFBA 5HKMA 3NUXA 2XMYA 5FEEA 5HNBA 3RAKA 4F1MA 4YJNA 2C0OA 3V8SA 3O7LD 3GU5A 3O96A 2YM3A 5CWZA 5CEQA 5JEBA 3QX2A 4G17A 5HBHA 4TNDA 3IW4A 3RAWA 4HYSA 4B4LA 5BMMA 3T9TA 3QL8A 3QX4A 3FWQA 1J1BA 3GP0A 4UMUA 4N57A 3OBGA 3NYOA 3EQHA 4YJOA 3BHTA 4LRMA 4EI4A 4F64A 3LCDA 3O50A 5C9CA 5F94A 3BE9A 2BKKA 3Q4TA 2OXDA 4ORKA 4JAJA 3Q53A 1Q8YA 4IMYA 5ANDA 4YHJA 1LPUA 3NS9A 5HVKA 3QC4A 4LL5A 3RPVA 4O38A 2UW0A 4AN3A 3R8ZA 4X3FC 4CKRA 5CI6A 4AZVA 2ZJWA 1VYZA 3FMMA 4BDDA 3LFDA 2WTVA 4FTQA 4X2GA 3FZSA 3Q2MA 4GEOA 4GW8A 4W4XA 3OG7A 2OLCA 5I3OA 2ITQA 3HMPA 2JDTA 3HP2A 5E1EA 2Y4IB 3P7BA 2UW3A 4K33A 5ANGA 3KVXA 4U80A 2R3MA 1ZMUA 2R0IA 4RLLA 4P7EA 3BEAA 4XLIA 5M44A 1JKTA 3QRJA 4RIOA 3TZ8A 5IH5A 3R7EA 5AV2A 3OF0A 5T68A 3H0YA 2YIWA 2GDOA 4OTDA 5AIRA 4IH8A 5CENA 3OW3A 2VGOA 1YDSE 3CPBA 2V55A 3O8PA 2ESMA 5F1ZA 4FIFA 4F7NA 3U8WA 1J7UA 2VTRA 5JQ8A 4ZP5A 3KFAA 4LRKA 4WHZA 5KCVA 4DTAA 5IH4A 4UY9A 4IACA 4C2VA 3VW8A 2BALA 2C5YA 4TYHA 4ZEGA 4ALWA 3HMMA 4W9XA 2HW6A 4NM5A 1JWHA 2LAVA 4PL3A 4I41A 2VNWA 3N51A 4NM0A 4UX9A 3QD4A 3Q2JA 4DGOA 4I24A 4LMUA 4EH8A 4YLJA 4FV3A 4IXPA 4O82A 1YXTA 3PY3A 1WBWA 3SXSA 4I0SA 2YCFA 5HBEA 4I4FA 4BHNA 4XV9A 4N70A 5DH3A 5HICA 4MD9E 1CSNA 3DXQA 5EHOA 5H3QA 5GZ9A 4O7ZA 2JBOA 4OT5A 3R7VA 3FKLA 1YXSA 3R83A 4LUDA 2VWBA 3TTIA 4J8MA 2CKOA 4O81A 2GTMA 4J1RA 2OGVA 2PE1A 2W1EA 4PF4A 3OXIA 5L2QA 4GU9A 3A2CA 5L4QA 2OKRA 2OZAB 3HRBA 3OC1A 5AUWA 4AA4A 1PJKA 4EOQA 1Q4LA 2EXCX 3EJ1A 4GYIA 5AADA 4DEEA 2ZB1A 4WRGA 3ZO1A 4D55A 3SG8A 2W0JA 3LLTA 4BCNA 4DFZE 4ACDA 3IO7A 1UKHA 2ZMCA 3K3JA 3VBYA 4E26A 2YHVA 2OG8A 5L8KA 2W99B 3EL7A 3R1QA 4L67A 1PW2A 2B9FA 4FUXA 5JFVA 2XNNA 3Q52A 2W7XA 4C4JA 2J4ZA 5KZIA 4CFFA 3AC2A 2RGPA 4QPSA 4UV0A 2F7EE 4PMSA 3QQGA 2C0IA 3AT2A 3DBCA 4OTWA 2QOCA 3HDMA 3Q32A 3DQWA 1UKIA 5CAVA 1FBNA 5TO8A 3GUBA 4FZ6A 3BGZA 4ZS0A 3VS2A 2CNQA 2BRNA 4AA0A 3MB7A 1WBVA 3I79A 3KGAA 3FEGA 5DE2A 1OL1A 1QCFA 2BDFA 2R7BA 3R2YA 4APCA 3W2CA 2R3RA 3QLGA 3Q96A 1WFCA 4X2FA 2WMRA 4KWPA 4JT3A 4J52A 5HHWA 2WQBA 4DFLA 2VO0A 4LFIA 3R30A 5EM5A 4CV9A 2OXYA 3OBJA 4ZTQA 3WE8A 2XM8A 5BVDA 2EB2A 1UU9A 3A4PA 4JR3A 3NR9A 4MNEB 4QMSA 4ARKA 5FRIA 2NRUA 3F3WA 4GYGA 2BKZA 3RINA 5IG1A 2G15A 2F49A 3COIA 3TNWA 3MTFA 3R9HA 3NSZA 2PULA 4U0IA 2ITNA 2BRGA 3SRVB 3LFQA 4D4YA 4O2PA 3C50A 4DCAA 3KQ7A 5FLFA 4G5PA 4GCJA 5B0XA 2J2IB 5C8MA 3MA6A 4K1BA 4QMTA 5DR6A 4O0UA 2VNYA 4DGNA 4BTJA 4E3CA 2F2UA 3TUCA 3NW6A 4FUYA 3A7JA 3OCTA 4KNBA 1GIIA 5CEPA 2C47A 2DS1A 3C0IA 3E3BX 1TVOA 4QP1A 5IUHA 2H6DA 2ETRA 4JQ8A 1OZ1A 2X8EA 4FTTA 2G9XA 1PXOA 3FI3A 2OK1A 3GCVA 2PL0A 4H3BA 3R8LA 3D94A 3VQHA 4XG7A 4XUFA 4AX8A 3F3VA 4V05A 4W4WA 5B7VA 4AF3A 5JQ5A 2E9OA 4FL2A 3GVUA 2PPQA 3GI3A 3I7BA 3KK9A 4B6LA 4CG8A 5HD4A 4X3FA 4CFNA 3D2IA 2CLXA 3NCGA 3PVUA 4JIAA 4PX6A 3UOLA 4LQMA 3II5A 1Y57A 4A9YA 4GIHA 4IX3A 4I6QA 3BPRA 4C02A 2EXMA 3Q3BA 2XK3A 1SVHA 1PXMA 4BL1A 4D0XA 1H25A 4N6YA 4G3GA 4D4RA 5C8KA 4FIIA 3ORNA 4DH7A 5L3AA 2HZ0A 1ZRZA 1P4OA 4G5JA 2C6OA 4PV0A 3F66A 2PZYA 3ZBFA 4TPTA 3I0OA 3PRIA 4MVFA 3T8OA 5EKNA 4IM2A 4FE2A 2QOKA 2C1AA 4U5JA 3WILA 1MQBA 3NX8A 3DJ5A 2WPAA 3DTCA 2C3IB 2IZTA 3VS5A 4CV8A 5FP5A 4FV8A 4ANMA 4BCQA 1Q99A 2NO3A 2Z60A 3E92A 5F9EA 4Y5HA 5BVEA 4D5KA 3HECA 1DI8A 5HG5A 4YHFA 3ZZEA 4EH4A 3VW6A 4AWIA 5KO1A 5CLPA 4AFEA 4HGEA 4PTGA 2PZPA 3C0GA 3FLQA 3LLAA 3BZ3A 3RHKA 2OJJA 1YOLA 2O2UA 4TXCA 4CLIA 4RGJA 4CMOA 3H9FA 4MXXA 4Q5HA 4QTEA 2VAGA 4LOPA 2PMLX 2X7OA 2XIYA 2QO2A 4WG3A 2XK7A 4FV2A 5E8UA 2P3GX 5AP3A 2OO8X 3AD5A 5F95A 2ZMDA 3E93A 5CVHA 4R3CA 5HOAA 5BQ0A 4RWKA 5CNNA 3AOXA 3R8MA 4BDJA 4EOLA 3ZFXA 4RG0A 3UE4A 4TYHB 4XEYA 4DH5A 2PUNA 3MN3A 2DQ7X 3DZOA 4MXOA 3V6SA 2VTQA 3DAKA 5AV3A 3MBLA 2BDJA 4AGDA 2VO7A 3OWKA 5IMXA 3RALA 4O0TA 5D7VA 2HW7A 4C33A 4KB8A 4L8MA 3VRZA 1UU8A 3MB6A 4KRDA 4IDTA 4YLKA 3LFFA 3UVRA 3BWJA 5JSMA 5CXHA 4ALVA 1OUKA 5K4JA 3OS3A 4LM5A 2J0JA 4DC2A 5KMNA 3ZEPA 3L8PA 5HBJA 3VBTA 5KBRA 2CCIA 2GNIA 3S0OA 4UMPA 4U7ZA 2G1TA 4IW0A 5AM6A 1JPAA 2OIDA 3BYMA 4UMRA 3OEZA 4NW5A 1PMNA 2B55A 2F7XE 1AGWA 2R4BA 5E8VA 3R7OA 3W2OA 5AUXA 3W2QA 4B7TA 3CXWA 4AE6A 4XP3A 4R7BA 3HV7A 5FM3A 4QMPA 2A19B 3BYSA 4F0GA 5IKWA 4TWPA 1L8TA 4AT5A 4EEVA 3W33A 4M13A 3OHTA 1GZKA 3LHJA 2YJSA 5KBQA 4FOCA 3WF6A 4DA5A 3VNTA 3H0ZA 4A9TA 1NVSA 4QMQA 3I81A 3R7GA 4MX9A 5CXZA 4RFMA 3QF9A 5D41A 4DF3A 3DQXA 4FG9A 5EI2A 2BTRA 3PJCA 3AMAA 3AC8A 4CSVA 3U6JA 4EUUA 1OITA 4GG5A 3RNYA 4A9UA 4E1ZA 4HVGA 5LQFA 3PTGA 3SHEA 4V04A 3MY1A 3PUPA 2C6TA 2HYYA 3FSFA 4CMUA 4O7WA 4GSBA 4E5AX 3N4UA 2G01A 2Z7QA 4CQGA 3AC5A 4FTKA 3P23A 3GU6A 4RIWB 5AAFA 3EFKA 3EFLA 3R0TA 4EH5A 3CSVA 1FOTA 2IW6A 5KMLA 2Z02A 3EZRA 1V1KA 3D15A 4ZMFA 2XJ2A 4C8BA 3COKA 2C30A 5CSVA 4E73A 5A4EA 1OL6A 1REKA 3EFJA 4L3LA 5HORA 5AJQA 5J79A 3UIMA 4YZDA 3LPBA 2B9HA 2ITXA 2XK4A 1W83A 3IW6A 4CFMA 2UVYA 4LG4A 4MTAA 4RQKA 4FKIA 5AR8A 3HEGA 3MFRA 2YM5A 3P7AA 2UZEA 3EN9A 2UW9A 4M12A 4DITA 4JG6A 3TZ7A 1M14A 3BLHA 3I0QA 3MPMA 5E8XA 5CF6A 3PJ3A 1JOWB 1ZOEA 4USEA 3KKVA 3IQ7A 5DOSA 4QQ5A 3ANQA 2RKUA 1ND4A 4BFMA 1ERKA 2C5NA 2J0LA 2QODA 4DGMA 2VTMA 4JXFA 3EB0A 4FTJA 5GNKA 4EK4A 1Q61A 3BIZA 3TUDA 3QAME 5I4NA 3UG2A 4F65A 2GTNA 3AGMA 3NW7A 1YKRA 2X6EA 3R71A 4M67A 4Q9SA 4CXAA 3EN7A 2B1PA 3P0MA 4KUJA 5I9VA 2XK8A 4FYOA 4RIXA 5C4LA 3BBWA 4FNXA 4G3EA 3FKNA 3POOA 4KBCA 2V5QA 5AP6A 3ZOSA 4B9DA 5HU9A 5JRQA 4ENXA 4QNYA 3IK3A 3AT4A 3QZGA 4NT4A 4AA5A 4NIFB 4S31A 4LRJA 2FSOX 1H0WA 3R6XA 4QMLA 3SA0A 2RG6A 4CQEA 5J9ZA 2RFNA 3D14A 3GFEA 2QR8A 3KULA 5FQDC 4MWIA 3R9DA 3UO4A 3NW5A 4FV0A 4RX9A 3SXFA 2FA2A 3HA6A 4QP3A 3R01A 4C37A 3IOPA 3EH9A 2PUIA 1R1WA 2QKWB 3E63A 5DHJA 4W8EA 4NH1A 5HESA 2UW4A 5BPYA 1XBAA 2WTJA 3TV4A 3FMJA 5CF4A 4FZ7A 4O1OA 1FVVA 5AUVA 5CTPA 5IQCA 1TQMA 4XOZA 1KOAA 4A07A 3PP1A 1PXIA 4BTMA 4WNMA 5DRDA 5CU4A 4IAFA 4BC6A 5A54A 4R77A 2JKOA 3AG9A 2YLEA 4JL9A 2C3JA 3E7VA 3W2SA 5IA0A 2WU7A 5IQGA 2ERKA 1KSWA 4FYNA 3ZYAA 4F9AA 2R3PA 3ZUVA 3KXZA 4QTDA 5CF5A 3LXPA 4F6SA 3D5XA 4O91A 4C58A 2VWWA 4EOOA 5HGIA 1PMUA 2KTYA 2J90A 5HD7A 4J71A 3ALNA 5E8YA 5C03A 2F9GA 3RJCA 4FIGA 4NYEA 4R3RA 2QURA 4WT6A 3EQBA 2FSLX 1PKDA 3MY0A 4YJSA 1ZOHA 2JDOA 3ZBXA 2J5EA 5HIBA 4ZXTA 4S2ZA 2ZB0A 4ZSEA 1FQ1B 4BI1A 3KREA 1OKZA 2XBAA 3QTRA 4O86A 4PPCA 3FDNA 3R1NA 4EKLA 4BCMA 5JMSA 2CCHA 2R3IA 4K18A 4RX8A 4TWOA 2JITA 3PZEA 4IM0A 3ZRLA 4I20A 3VBWA 2PVLA 4EC9A 4D4SA 3AC3A 5CEMA 1XH4A 3P4KA 3OZ6A 5HVJA 2WMWA 5IQAA 4U97A 3D2KA 5H8EA 3C1XA 3OVVA 3KRRA 2Q0NA 1QL6A 4Y85A 4FTCA 4JG8A 3SOAA 3ORKA 4TY1A 5CU0A 1H1PA 3BHUA 1H01A 2CMWA 2G2FA 3A7HA 3MA3A 3N4TA 4WKQA 1Q8WA 2GSFA 2JIIA 2WMSA 4CMTA 3DCVA 3TG1A 4A4LA 3GEQA 4FT7A 4YSMA 4C4EA 2OZOA 3FYKX 3ZXZA 4L43A 1IG1A 1ZYCA 3OOMA 2QO9A 2V0DA 3BELA 4UZHA 2GHGA 3TCPA 3TZMA 3MH2A 2XYUA 3CIKA 4C2WA 2W1IA 1WAKA 5M4FA 4O7LA 1BKXA 1FGIA 2X1NA 3R8PA 2R2PA 3Q6UA 1X8BA 4RC2A 5CQWA 5BMSA 1ZMWA 2ITZA 2YDKA 1PF8A 1TQIA 3F2AA 3REPA 4CTCA 2QOQA 4FC0A 4M84A 5L2SA 5HO8A 3C5UA 2JKKA 4WG4A 2QR7A 4XJ0A 5CU2A 4IADA 4NU1A 3LJ0A 2PMNX 5L6OA 1VZOA 1JAMA 4IJPA 2XUUA 3NUYA 4XG9A 5IUIA 1MUOA 4A4OA 2YISA 1PMVA 4C4FA 2WTCA 2P55A 2BILB 3GC8A 4X3JA 3WF9A 2LGCA 3ZM9A 2I6LA 3WBLA 5KKRB 4AN9A 2B0QA 5LJJA 2J51A 5FWKK 3HGKA 2IZRA 3V6RA 1U5QA 3C4ZA 4YUQA 4JX3A 4MBIA 3OP5A 3TIYA 3VS0A 1J7LA 4TWNA 1F3MC 2P33A 2ZOQA 4JS8A 3AC1A 4MBJA 4MD7E 1JSTA 5CS6A 4ZTLA 4XP0A 4WBBB 3DU8A 4HGSA 1J1CA 3EYHA 4G16A 3U4UA 2BRBA 1YI6A 1JBPE 1IEPA 1GZNA 5KX8A 3A60A 3HP5A 4IWPA 5C8NA 2Z2WA 2WMQA 4U3YA 2OSCA 4QD6A 4PDYA 3KCFA 5HCXA 2CGUA 2YM7A 3TKIA 3EN5A 4D1ZA 5AV4A 5JK3A 5IQHA 4ZJJA 5CEKA 4NSTA 2Y7JA 2J0IA 3C4WA 5A6OA 2GQSA 2WIPA 2GPHA 3CJFA 3JVSA 4O7RA 4FZAB 1FPUA 2BTSA 4WRSA 5EYMA 4D1SA 2G2HA 4QP4A 4ASZA 5LVMA 2X4FA 3O71A 5EW8A 4KKEA 4XBRA 3UMXA 4FVPA 3ELJA 4GS6A 4EORA 5JN2A 3VC4A 3F61A 1VEBA 2ZV8A 3QTQA 5F20A 3KMUA 5AR7A 2J7TA 4C0TA 2BZKB 1XBBA 3IOKA 3VS7A 5HX6A 1JVPP 3SXRA 3GU4A 1RE8A 4D1XA 3QCQA 4K0YA 4TL0A 2OJ9A 4YC8A 4U40A 4NZWB 4BB4A 3SX9A 4PMPA 1MRUA 5HVYA 2QG5A 5EM7A 1DS5A 1A9UA 1YI4A 2ZM1A 3ZEWA 3GFWA 4F70A 2XIRA 3GU8A 4GT5A 5DPVA 2UW6A 2OI4X 4UB7A 4ZSGA 3COHA 3NAYA 3EFWA 2B52A 3CJGA 5HG9A 4IZ7A 5EDRA 4USFA 3HVCA 4JRVA 3PDTA 4PP9A 3RPYA 2JLDA 4G3DA 5IA5A 1YXVA 1KE6A 2IN6A 2YWPA 3DA6A 4FOBA 4GVJA 4KIKB 4ACGA 4EOJA 5GHVA 4GJ3A 4FKSA 4NJDA 4YZ9A 1OVEA 1WCCA 4GK3A 4G9CA 3DBQA 2QOHA 3ZC6A 4LL0A 3HAVA 3Q60A 2V22A 2VTPA 4IM3A 4OW8A 4YJRA 5CSXA 5HEZA 4K77A 4Y72A 1E9HA 4QMVA 2W1DA 5TF9A 2ZYBA 2F57A 3R9RA 2CSNA 4I6HA 2X9EA 3OCBA 4FIEA 2XNPA 4F7JA 3M1SA 3AC4A 2VZ6A 4OTFA 5CVFA 2PUUA 4FSTA 4RJ7A 1YXXA 4KIPA 3DJ7A 3DJ6A 3LM5A 2QOLA 4QPAA 4GG7A 4R3PA 3R7IA 1UU3A 3DB6A 4RC3A 1CDKA 1KV2A 5AIKA 4MKCA 4DH1A 1J7IA 4E5WA 4EWHA 5KMMA 2I0EA 2O8YA 1GOLA 5EM8A 2GQGA 1B38A 2WMUA 4I4EA 4HZSA 4ZSLA 1H08A 4FKTA 3UOHA 2GNJA 5CYIA 3ROCA 5B2MA 4AW5A 3PWDA 4NTSA 3FL5A 5HLWA 4CZTA 2QOOA 5FTOA 1U46A 4PPAA 5LMBA 2OW3A 4DLJA 2W9ZB 3F5XA 3TL8A 4NK9A 2JEDA 5BVOA 2YCQA 4O7SA 5AR2A 3ORPA 3E8EA 3VUGA 4M66A 4C7TA 4JBOA 4QYYA 3IDBA 4FSYA 5HLPA 1O6YA 3W1FA 4BDAA 4DEAA 4UWYA 4BGQA 4J53A 1Q8UA 3O0GA 5HG8A 3RTPA 3RAIA 2X9FA 4LI5A 4QYGA 2B9IA 4D4VA 4R1YA 4Y83A 4J96A 1W0XC 4I22A 4BWPA 1ZAOA 5EI6A 4IQ6A 2QVSE 3I5ZA 3AD4A 4GV1A 2VTLA 3ZLXA 4D2RA 5AR5A 2A1AB 2RL5A 4WIHA 3TZ9A 3O23A 5DT3A 4F6WA 3H3CA 3KMMA 2X39A 3O8UA 1V0BA 2HELA 4XG6A 3PXKA 3FZRA 3OY3A 2OFUA 2W4OA 2YAKA 3KA0A 3UOJA 2JDSA 1OECA 3F6XA 2F4JA 3HMOA 4U81A 2DWBA 3O17A 1Q97A 3VO3A 2ITYA 4EOKA 3ET7A 3NVKI 2YACA 4M69A 3DBFA 3DNEA 4U45A 5BUEA 4ANOA 5ETCA 2BR1A 3NYVA 2PMIA 3ODYX 3MTLA 3HYHA 3OFMA 4RT7A 3ERKA 5E91A 5EG3A 3FZ1A 3LFEA 4I1ZA 5FGKA 5FM2A 4BKJA 1ZYDA 1OL5A 2W05A 1PXLA 3D4QA 2JFMA 4NCTC 4XG8A 4ZAUA 4G2FA 1A06A 4EH7A 4R1VA 3WYYA 3L9PA 4DINA 1CKJA 4XP2A 4BGHA 5C26A 2FVDA 4YBJA 2UZUE 2WGJA 3C4FA 1XQZA 1CM8A 2QCSA 3OTUA 1WBPA 3TJCA 1PKGA 2XKFA 4JBPA 4FA2A 3HV4A 4KD1A 3CY3A 4BIBA 4IAYA 5E90A 2BDWA 2W06A 4XH6A 2C6IA 4KA3A 4UEUA 1KE8A 3HKOA 3PA5A 5IEXA 3ZLWA 4IANA 3QUDA 1TQPA 4QNAA 1O6KA 1PYEA 2EXEA 1LEZA 3CGFA 4QP9A 2UZWE 5LVLA 3RM6A 3IG7A 3PLSA 3UPXA 5L8LA 2UZTA 4FR4A 3R1SA 4AZEA 4DG3E 4F08A 4O27B 5C1QB 2GS6A 2C6LA 3NRMA 3PE2A 4U6RA 2PVRA 3MVHA 2OU7A 1REJA 4G3FA 4C3PA 4WA9A 3L1SA 4OR5A 3VJOA 4N0SA 4FT0A 4PDPA 1XJDA 4YTFA 3M42A 4L7FA 2E9PA 2R3LA 1IRKA 2NP8A 4IB1A 4I5MA 1GJOA 2BZJA 3EKKA 1WZYA 3AMBA 4FSNA 2HY81 5DEYA 4II5A 3BV3A 2CJMA 3RZBA 5M55A 5J1VA 2XB7A 3RK9A 4IWQA 5I0BA 3FMHA 2XRUA 1NXKA 1Q24A 4R7HA 4GFOA 4JNWA 2WZJA 3UQCA 3PXZA 1CTPE 2REIA 4IFCA 4ITJA 2C0TA 2DYLA 5DBXA 5AUZA 3NEWA 4BDCA 4EWQA 4F0FA 5J9LA 4YNOA 3V8TA 1CKIA 4M97A 3CC6A 4MAOA 2O65A 5HTIA 3AQVA 3QRUA 1FVRA 3QYWA 2AC5A 2FO0A 4CRLA 2YN8A 3UDBA 3O2MA 2O63A 4D9TA 5ICPA 3A4OX 3UIUA 2XM9A 1SM2A 3W2PA 3OROA 4XCUA 2R3KA 3BLRA 5HZNA 4I5HA 1P5EA 3CKXA 1PY5A 4HZRA 4CYIA 3I7CA 3UZRA 2J5FA 4DBXA 4G6OA 5G6VA 3KB7A 1Q3WA 3VHEA 5IEYA 4AOIA 2XZSA 3RKBA 2H9VA 4L6QA 3VS4A 4HGTA 4D2VA 3ORIA 3V8WA 2FH9A 4BIEA 1BUHA 1FMKA 3CY2A 3BEGA 3HV3A 2IO6A 4J99A 4X6QC 1UU7A 1P2AA 2JGZA 2VWUA 2QI8A 4R6VA 4QMZA 4DG0E 4QQTA 4ZZOA 4X2JA 3V5TA 4FKGA 1Z57A 4FNZA 4UWCA 4D58A 3RMFA 4FKPA 3EOCA 2IJMA 4QYFA 1HCKA 3CP9A 3QQLA 3I1AA 2YFXA 4IVDA 5FD2A 1WBOA 1WBTA 3RK5A 3SC1A 3T9IA 1BI8A 2HZIA 3SW7A 2Q0BA 5AFVA 3OEFX 5H8BA 2F7ZE 3LFAA 4YURA 1MQ4A 3UNZA 3NUUA 2WMBA 4NL0A 2OBJA 4TN6A 3VS1A 3VQUA 2VX3A 3PIXA 3TV7A 4BYJA 1ZYLA 3PXQA 4EHVA 1ZZLA 3ZSHA 1SNUA 1QPJA 4FV7A 3G9NA 3R7YA 4AP7A 3ETAA 2V7AA 3LQ3A 2AUHA 2JIVA 4W4VA 3H4JA 4KKHA 2C6MA 5E4HA 2IWIA 1H00A 4M7IA 4DGGA 4YMJA 4E6QA 3FUPA 3QZFA 1HCLA 4GKHA 2VTOA 3PA4A 4K2RA 4C4IA 3KRXA 3G15A 1M17A 4JI9A 4FTOA 3KXHA 1G3NA 4L3PA 5EKOA 4MYGA 3BGQA 5TR6A 4X6RA 3BI6A 5A4TA 2UZBA 3UVPA 2YCRA 5CT7A 4V0GA 3Q04A 3GNIB 3GCQA 3ORTA 1U59A 3N9XA 1PXPA 4FKWA 2HIWA 1Q41A 3CTJA 4HVIA 3D5WA 1B39A 1RQQA 4UXLA 3QA0A 3L8VA 1E1VA 3UYSA 4DEIA 4YPSA 1UNLA 3CQEA 3FC1X 2P0CA 4FL3A 2YZLA 3LXNA 4EOPA 3WZJA 1IA8A 3F69A 2C6KA 1H26A 3EYGA 4FTUA 3MYGA 3G9LX 4LGGA 3HRFA 3ZSGA 1M7QA 2V7OA 4OAUC 2WOTA 1Y6BA 5CU6A 5DMZA 1NA7A 3WZUA 5C4KA 2XRWA 4EQUA 4PY1A 1YHWA 2VWYA 4ERKA 4H39A 4YO4A 3Q6WA 4TWCA 3V5JA 4E4XA 3C7QA 2IG7A 4IBMA 3W32A 3G5DA 4Z7GA 2IZUA 1S9JA 1URCA 3D5UA 4IAIA 2VU3A 3ITZA 4FKUA 2OXXA 2YDIA 3HV6A 4UN0C 4RIYA 3R02A 3DLSA 4BDIA 4HPTE 3VUDA 5K9IA 4NCTA 5BUIA 5HTCA 5B2LA 2A4LA 3EQIA 5HI2A 3D7ZA 5IQIA 4AGCA 2XIXA 3EMGA 3OWJA 5G1XA 5J9YA 4JDHA 4F1TA 1JSVA 4FV4A 4QMNA 2XNMA 2ERZE 5DLSA 1JSUA 2Z7SA 4MHAA 4XNEA 3KMWA 5B2KA 3E8DA 4FTMA 3WOWA 4C61A 1H4LA 5EDQA 3RVGA 3FMLA 4FF8A 5IZFA 3KF7A 4X0MA 4HVSA 1OBGA 3FAAA 3JS2A 3PVGA 4XMOA 4BDFA 4EK8A 1G8SA 3DK6A 5TE0A 3QCYA 4RVTA 5BYLA 5K0XA 5LMKC 3A7FA 3EN6A 4MCVA 3S1HA 3MSSA 4ASEA 2VWVA 3D7TA 3EQRA 4HCTA 4XS2A 4OTIA 5ETIA 3W18A 3TIZA 1OIYA 4P5ZA 1M2QA 4GH2A 4DN5A 5IQFA 4NWMA 4NUSA 4O21A 4P4CA 3ZO4A 5EQPA 4WSYA 4DFNA 5FXRA 4BIDA 1UNHA 4QQCA 5E7RA 1UVRA 3DFAA 3GCUA 3Q9XA 1JKSA 4MBLA 4KSQA 2ITTA 2YIQA 5AX9A 3FXZA 4QP8A 1DI9A 2YIRA 3OUKA 4MQ1A 5D12A 4JG7A 1WBNA 2ETKA 1AQ1A 4F63A 4EHZA 3KCKA 2SRCA 3BHVA 4AW1A 5ANKA 3D0EA 3LFSA 4PDSA 3SW4A 4X7QA 3LFNA 3SG9A 1R0PA 3RP9A 2GNFA 3UZPA 4FBXA 3WYXA 3ZM4A 2OFVA 3FQSA 3OW4A 4FT9A 5JFXA 2CGXA 2Y6MA 3QQKA 2YABA 1IAHA 4RWIA 4PNIA 2R3QA 2WELA 4JJRA 1FVTA 5M56A 1NVRA 3EIDA 3R73A 4XV2A 4GFGA 3ZRMA 4BCGA 5M07A 3FZTA 4C57A 3LMGA 4UWBA 4K8AA 3SLSA 3LMHA 3M2WA 3QKLA 4L44A 4AZSA 4XOYA 2R64A 5BYYA 1A48A 4BWKA 4HOKA 1P4FA 1XKKA 5AAGA 3CGOA 3R00A 4OTQA 2E9VA 3QQJA 2BFYA 5BNJA 4ZY4A 4FEXA 2XIKA 2Y4IC 4PPBA 4UBAA 4FSQA 1OKVA 1WMKA 2YIXA 2FB8A 3WI6A 4IWOA 4W9WA 2OJIA 4AS0A 4H3PA 1H1QA 3MFUA 3HX4A 3R28A 3OCGA 2W4KA 5AMNA 5M06A 4ANBA 4BWXA 1ZMVA 2XH5A 1SYKA 5LARA 3SV0A 2FYSA 5AUUA 2BZHB 2YM8A 3PPZA 3FPQA 4KAOA 5LCKA 3W8QA 4AZTA 4RSSA 3V04A 3IDCA 4IX6A 5M4UA 5TKDA 4G3CA 1ZXEA 2WO6A 2W96B 1V0OA 3PSCA 5T3QA 4FEUA 3QYZA 4R78A 4EUTA 3E8NA 5DWRA 1WVYA 4NFNA 1AD5A 3JXWA 3PJ1A 4L01A 4Y73A 4FG7A 3ID6C 3SKCA 1H28A 4TYEA 3NMUF 4HW7A 2J0MB 4BCFA 4RWLA 4ITIA 4GUBA 2JAVA 4CYJA 5EW9A 5H8GA 1YRPA 4YZCA 5M57A 2WQEA 1KE9A 4EQMA 4QP7A 3FMEA 3KXXA 4IIRA 2BRHA 2C3LA 4UALA 2FSTX 2YITA 3FJQE 5E1SA 2QQ7A 4ITHA 3CEKA 3S95A 1OIQA 1V0PA 1IAJA 4D2SA 3K54A 2VO3A 2PE0A 4L68A 3E8CA 1NT2A 3SGCA 3IECA 3UGCA 3TTJA 2IPXA 3MVMA 4BI0A 3PP0A 4MXAA 3LMIA 1H07A 4BBFA 5E8WA 3V01A 5HNGA 5CASA 3MS9A 3NIZA 4LOQA 4JDKA 4TKSA 4I3ZA 4QP2A 2UW5A 1Q8ZA 3HZTA 1OIUA 1PHKA 2OJGA 4AT3A 4HVHA 3V5LA 5BX0A 4KS8A 3ACJA 4ASDA 4EK6A 5A14A 5TT7A 3TEIA 2E9UA 4X3FB 2VX0A 4RX5A 3VBXA 4UMTA 4O6LA 4XRLA 2O3PA 3DKGA 3A61A 3IONA 2XS0A 3QTZA 5DRBA 3E62A 4HYUA 3F88A 3LXLA 2QU5A 4NFMA 5GZAA 1M52A 5GINE 3LCKA 5AP5A 2QO7A 2IVSA 3CR0A 4EH2A 5C27A 3QGWA 2C5XA 3QRTA 4FX3A 4E6DA 4L3JA 4RBLA 5EDPA 4YP8A 3ROYA 2WU6A 2X2KA 3Q5ZA 4IZ5A 3KN5A 4NM7A 4Y5QA 4BCKA 4O1PA 5HLNA 3G0EA 4E4LA 4FKVA 1H1RA 3WIGA 3JPVA 3CQWA 1YOMA 1XH6A 5K3YA 1M7NA 4N4SA 5CQUA 1BL6A 4MF0A 3TV6A 1Y8YA 1YW2A 4RFZA 3F7WA 3P9JA 4RA5A 4Z16A 5DN3A 5LMKA 3NLBA 4DT9A 4ASXA 4J7BA 1YXUA 2EVAA 2WMAA 3V3VA 3TKUA 5M53A 3ZRKA 4BKYA 1OGUA 2GHMA 4E5BA 5JGAA 4UYAA 2BAQA 4QP6A 1R39A 5KNJA 3PLAE 4FTNA 3BE2A 4DEDA 4KBKA 5CI7A 2JFLA 2FUMA 1UWJA 2YA9A 3QUEA 4O0RA 5KE0A 2EWAA 3MESA 4FI1A 4F9WA 1IA9A 5AP7A 2HOGA 5KMIA 3ODZX
chains in the Genus database with same CATH superfamily
3MWUA 3K3IA 4D2PA 2RIOA 2WB8A 3ZMMA 4BZOA 3ZTXA 2R9SA 3HDNA 3VWAA 3R04A 4FKOA 1JLUE 3BRBA 4LV5A 5A46A 4D5HA 4RJ5A 4QMYA 3BYUA 2JAMA 2PVMA 2WNTA 3G33A 3UVQA 3ZS5A 5FXSA 3VONA 5ANOA 3QCSA 5IF1A 4I23A 1DAYA 3RNIA 4J8NA 5BYZA 3V51A 2BIYA 2XJ0A 4GVAA 3KRLA 4GU6A 5AP1A 2XA4A 2GS2A 2Z7RA 3CCNA 1VR2A 3VJNA 3PE1A 2PMOX 1FGKA 3UO5A 4FTAA 5AUTA 4JVGA 4ACHA 3S00A 3RWPA 4M68A 4AGWA 2HZ4A 4FT5A 3OCSA 5I9UA 3O8TA 3EQCA 4E4MA 2PU8A 4FSZA 3KRJA 4IX4A 1O6LA 4QRCA 5HIEA 3PJ8A 4XV3A 3R1YA 4BDEA 2EUFB 1ATPE 1GZOA 4BGGA 2PVHA 4AW0A 5IA3A 4MXCA 2YLFA 4FICA 2ZAZA 3DKOA 3ULIA 3BQCA 4KKGA 4PWNA 4AT4A 1XR1A 3U51A 3M11A 1ZY4A 2DUVA 1BI7A 2X4ZA 3NWWA 4KSPA 5H9BA 2X2MA 3DXPA 3DAEA 3Q4ZA 5FEDA 3KVWA 2GNLA 3UIBA 2QC6A 2PVFA 4WUNA 5FTGA 5ETAA 1ZYJA 4C34A 3AMYA 5EHLA 5HTBA 3PFQA 1OKWA 2BMCA 3PXYA 3RPRA 1YVJA 4FSRA 4FV1A 3G0FA 3K5VA 3LJ2A 3RK7A 5EOBA 3FQEA 4RWJA 4XRJA 3Q9ZA 2JC6A 3QQFA 2CHLA 2YZAA 4CT1A 3PA3A 4E8AA 4HYHA 3COMA 4Y46A 3TUBA 2OICA 2WTKC 1ZLTA 2XYNA 5CY3A 4L42A 4ZTHA 4BTKA 4O6EA 3W55A 4EOIA 4IDVA 4CKJA 4M14A 3KN6A 5JKGA 1H1WA 2UUEA 1XWSA 3VBQA 5EK7A 4L45A 4JIKA 5HE0A 4B99A 5A4CA 5J1WA 3IGGA 4FKRA 3QGYA 3CQUA 4FIJA 3VULA 3BHYA 4DT8A 3RM7A 2UV2A 1BYGA 3LE6A 5CNOA 4PNKA 3PG1A 1ZWSA 3Q4UA 3HAMA 3O5AA 3QCXA 3TDWA 4A9SA 4O7VA 4CFVA 4MF1A 2CGVA 3I6WA 1FMOE 2ZDTA 4RVMA 4F9YA 3CTQA 5KHXA 5IQEA 5EOLA 3SOCA 4C62A 5JFWA 4MD8E 5I9YA 3HUBA 1JKLA 3DPKA 4OTPA 3FQHA 4O7NA 3C13A 2OIQA 3R21A 4AXDA 3LCSA 2CN5A 4I92A 4YC3A 2BRMA 1H24A 2ZV9A 3D9VA 4CD0A 4YGAA 3BL7A 4FK6A 3EKNA 4RZWA 3MDYA 4E6CA 3W16A 2BHEA 3L8XA 3TI1A 3ORZA 3P5KA 4L52A 1J91A 5CZHA 3NAXA 2I0VA 2OZAA 2BUJA 4X2KA 1FINA 1H1SA 4RIXB 4YZNA 1W2DA 3IPHA 4ZTMA 2EB3A 5LWNA 2VTSA 3FMDA 5EFQA 3LVPA 4PTCA 5EI8A 3HL7A 3FZOA 4JX7A 3GCPA 4ZTNA 4LOOA 5HG7A 1KV1A 1Z5MA 4FK3A 4O0SA 4EK3A 4Z7HA 4BY9E 2BZIB 2A2AA 1OMWA 3NNUA 5EHYA 3PXRA 3K2LA 5D10A 4AXAA 2QNJA 3TT0A 4CT2A 2W4JA 2H34A 5L8JA 1ZYSA 2I0HA 2I7QA 3C5IA 3KULB 3FLYA 2XEYA 4LGHA 2WTWA 2YDJA 3EHAA 5DR9A 4M0ZA 5J7HA 5BVWA 4RJ8A 5EH0A 5ACBC 3ZONA 3EQGA 2R3HA 4KINA 5EYDA 1GNGA 2UW7A 3NNVA 3DT1A 3MJ2A 4L46A 5D9HA 4OTRA 1QMZA 4TW9A 1IR3A 3PXFA 4DYMA 4NJ3A 4J98A 3VUTA 4WNKA 2R3GA 3KEXA 3S4QA 4D2TA 5KUPA 3LIJA 4ZTSA 3R8VA 1ZARA 2QU6A 2JDVA 2QLUA 3GBZA 4CFXA 5AEPA 4EJ7A 3UJGA 3RCJA 1BX6A 1MP8A 4AN2A 4R7IA 1H0VA 3DZQA 3KU2A 3ZU7A 2JBPA 5L6PA 3FI8A 5E9EA 1W82A 3F7ZA 3OMVA 2W9FB 4PL4A 2WTIA 4MNEA 3HRCA 2PZ5A 2PTKA 3MVJA 4YJPA 2VTNA 3SAYA 3UNKA 1HOWA 4HPUE 4GUEA 3BHHA 4CEGA 4D2WA 3QZHA 4EOMA 3R2BA 5AA9A 3W0SA 2XNOA 3NIEA 4FMQA 1SNXA 2BAKA 4ZLOA 2YJRA 3SRVA 3GOPA 4ZSAA 3MW1A 3A99A 3NYXA 3QBNA 4GT3A 3G90X 2JKMA 4EBVA 5CEOA 2PUPA 3U54A 5J95A 5FDXA 4E93A 1XH8A 3VS6A 2ITVA 3W2RA 4BI2A 5F4NA 4DFXE 1O9UA 4N6ZA 3FHRA 4OLIA 4U44A 4YJQA 3LM0A 1WVWA 3K5UA 3TNQB 4U3ZA 2UVZA 4BJJA 2C5OA 3OWPA 1K2PA 1K9AA 3ATTA 3TXOA 1S9IA 3CE3A 2BFXA 3PZHA 3F3ZA 4WNPA 4AE9A 3F82A 3P7CA 3UOKA 4BTFA 4CZYB 3JUHA 1R3CA 3U9NA 4YNEA 5HIDA 4JQ7A 2X8IA 2C6DA 3VS3A 3R8UA 2IVUA 4QMWA 5DT0A 3TN8A 2R3OA 3QC9A 2C69A 2WKMA 2Y6OA 2NPQA 4I6FA 4F9CA 3ZO2A 4K11A 3OT8A 5A3XA 1YWNA 4H1JA 2HK5A 3FBVA 5DG5A 1I09A 2QHNA 4YJVA 4G31A 2IW8A 4M8TA 3TKHA 2X0QA 3PPKA 3UO6A 3ZSIA 1Z9XA 2VTHA 3TJDA 5AR3A 2XCKA 5M4IA 1OPLA 2AC3A 2GCDA 3CD3A 2WFYA 2Z7LA 2BVAA 1STCE 4GIIA 3QQUA 4GK2A 4HCVA 4ANQA 4BCIA 4D0WA 2BCJA 4LMNA 3ZLSA 2GNGA 1KWPA 2PZRA 2W1ZA 3DV3A 4O0YA 4LGDA 3S3IA 4AOTA 3F5PA 4EHEA 2VTTA 2RFDA 4DEHA 1XH9A 3BWFA 5LCJA 3ZDUA 4RA4A 3GB2A 2W1FA 2XK6A 1Q5KA 2OH0E 4MH7A 4KRCA 4B0GA 2A0CX 4NTTA 4EK5A 2ZFYA 3AKLA 4CNHA 4FEWA 2P2HA 3BGPA 4RJ4A 2WXVA 2IVTA 3KC3A 2P2IA 2WQOA 4O22A 3WZDA 4H05A 3VF8A 1XO2B 4YSJA 4GKIA 2B53A 2XF0A 2HAKA 2WIHA 3ZZWA 4BBEA 1YWRA 3FV8A 2R0UA 3OUNB 2RFSA 5AUYA 3ATSA 2QKRA 4AOJA 3F2RA 2UW8A 4DDIA 3AT3A 4CGAA 1Q3DA 2UZNA 3LFCA 3W0MA 4FNYA 3ANRA 4MNFA 4HJOA 5J5TA 1TKIA 3LQ5A 4BCOA 4AZWA 1PMEA 3PIZA 3C4XA 1H8FA 4U79A 3N4VA 4YTIA 3EZVA 2YEXA 4RQVA 3ULZA 1M2PA 4ERWA 3ENHA 2Y9QA 1U54A 1TZDA 2WQNA 5IA2A 4EZ3A 4K6ZA 3C4CA 1UNGA 4WUAA 5HE1A 2HENA 3R22A 4DHFA 4FEVA 3G6GA 2OH4A 2W1GA 4BDGA 4L7SA 3TYKA 2C5VA 4O7TA 3FXXA 2I0YA 4F6UA 1KE7A 4OBQA 4EYJA 5AM7A 3AD6A 3P78A 2YAAA 3QALE 4AG8A 4D9UA 3GOKA 5I9XA 5M08A 3HA8A 4I0RA 2O64A 4ANSA 5BUJA 3UG1A 2XBJA 3A7IA 4NM3A 3ZUTA 1JKKA 2UZOA 2G2IA 3OD6X 3L9MA 4D28A 3BKBA 4C3FA 2VTIA 3QWKA 2C3KA 2IEWA 3FLSA 4H1MA 3UIXA 5CAOA 3LAUA 4W8DA 3W10A 1KOBA 5ETFA 3ZFYA 2WQMA 4S30A 4L9IA 4ANNA 4XV1A 4OBOA 1NW1A 1ZY5A 2PSQA 4TNBA 1TFFA 3NUSA 4O96A 4E20A 5L6WL 1Y91A 2X7GA 3WIKA 5HNIX 1F5QA 4FTRA 1Y8GA 5IEVA 3IW8A 5KMJA 1URWA 3QHWA 1Q62A 4GT4A 2R3JA 4QMOA 1IASA 2I40A 3UMWA 5HQ0A 3LKMA 1GY3A 4BDBA 3MH1A 3UODA 3QQHA 4IZAA 5CX9A 5LMAA 3B8QA 4A06A 5FUTA 5LVPA 5ITAA 4F99A 3DOGA 1W2CA 3DBDA 3CD8A 4MXZA 4MXYA 4H36A 4B8LA 5LXMA 5CZIA 3C4EA 5A4QA 4IFGA 4O0WA 1RJBA 3FMKA 4RIWA 2ETMA 5DT4A 2O5KA 3RZFA 4TYJA 2VWZA 3QA8A 3TDVA 2VTJA 5KKRC 4AAAA 3KXNA 1G8AA 1U5RA 4DLIA 3DLZA 2PY3A 2Z8CA 3H30A 4FVRA 4OTGA 2ITPA 3R9NA 4BCHA 3DBEA 3IW7A 4GL9A 4WG5A 5GJGA 4ID7A 3ZUUA 3C51A 4FGRA 5IMEA 4RZVA 1ST0A 2F2CB 4G1WA 4KS7A 1RW8A 2JD5A 2Y8OA 3FLWA 3NNXA 4EJNA 2GFCA 2W1CA 1T46A 3GGFA 1MRVA 3AXWA 4TRLA 5CSWA 5E92A 4DBNA 5I5ZA 4O84A 3FY0A 3JVRA 4I5PA 1OL2A 2XNEA 4FT3A 1OBDA 3JR1A 4O0XA 4TZRA 4JBVA 3QU0A 3U9CA 3AKJA 4CCUA 3VAPA 4IWDA 4BYIA 4EOSA 4FODA 3RWQA 3FMNA 3O7LB 3VHKA 3F5UA 1U4DA 3FSKA 3IDPA 2WAJA 5IPJA 2RFEA 4EBWA 5JH6A 3P86A 3L9NA 4IX5A 4OGRA 4F09A 3VUIA 4HVDA 1LR4A 3DK3A 2BHHA 2VRXA 4JDJA 5JRSA 4A4XA 4ZY5A 3D5VA 3Q9YA 2ITWA 5E8TA 2CNUA 4JDIA 3SQQA 3R9OA 2BAJA 2VTAA 3MJ1A 2C68A 5L2TA 2VWIA 4M0YA 1BMKA 4MK0A 1QPEA 4NIFA 2WTDA 4IJ9A 4R8QA 5IISA 2ACXA 4RJ3A 5M4CA 2ZDUA 4XLVA 1ST4A 4H3QA 3ZO3A 3HLLA 2CKQA 2RF9A 2I1MA 2PK9A 3QD2B 2B54A 4DEBA 3L8SA 5GJDA 4EHGA 4ONAA 2CPKE 5FG8A 5H2UA 5JZNA 5KMKA 1LUFA 4QYHA 3BLAA 3PSBA 2XP2A 4TT7A 5FP6A 4MWHA 3S2PA 2GU8A 4F4PA 2WMXA 1OIRA 3EL8A 4C4GA 5TOZA 4FV6A 1JNKA 2UZDA 4PMTA 3QKKA 2ZM4A 2CDZA 4BCJA 2FSMX 3ZC5A 3DK7A 5CU3A 4ZY6A 2ZV7A 5HO7A 2GHLA 3KK8A 4LV8A 2XVDA 5I9WA 4FGBA 3RAHA 2J50A 5GIPE 3EQPA 2VN9A 4M69B 4CKIA 1GIHA 3RI1A 4C59A 3WF8A 4OUCA 1CKPA 3PY0A 4IAKA 4NKAA 4FKLA 3DTWA 3NPCA 4L00A 5D11A 1GIJA 2C6EA 4I0TA 3UZTA 3ALOA 3LCTA 4BRXA 4EZ7A 3O51A 5BVNA 3TNPC 3MV5A 5CAPA 1WVXA 2YERA 2OWBA 2NYAA 2B7AA 3FLZA 2UVXA 3MPTA 5CT0A 1H27A 4EKKA 4I94A 3WF7A 3GENA 2WTKB 4ZJIA 1Y6AA 2WOUA 4WNOA 3TNHA 3CLYA 4Q5EA 3I5NA 5IU2A 4YJUA 3FI2A 4K9YA 3HUCA 4AZFA 5CAUA 1DAWA 3KY2A 4ZJVA 4ZSJA 2WMTA 4LUEA 3GC0A 5CANA 1OPJA 4G6NA 4ZLYA 3EQDA 3C9WA 3HMIA 3CPCA 5CVGA 3VIDA 4PL5A 4F7SA 4BBMA 3F5GA 4M3QA 4PP7A 3TM0A 2XJ1A 2O0UA 3MH0A 5C01A 2GFSA 2WHBA 4GFMA 2V62A 4IVCA 2HWOA 2Y0AA 4FZFB 1YI3A 4YO6A 3DNDA 5DEWA 3TWJA 3V5PA 5CALA 3PIYA 1PXKA 4ZMEA 4JLCA 4OTHA 5L2WA 1K3AA 2BPMA 1XH7A 3UTOA 2E2BA 4DFBA 3ZHPC 1OPKA 1JQHA 1U54B 3VVHA 4CVAA 3LXKA 3DAJA 4UMQA 3QFVA 4IAAA 3F3UA 3FHIA 3CKWA 4L53A 1LP4A 4RLKA 2IW9A 3UQFA 3NNWA 3Q9WA 2H96A 4IHPA 3U6HA 5ANIA 4O83A 3QTWA 4YPDA 3FLNC 3LW0A 3BCEA 4FSUA 4O4EA 4ZOGA 4FTLA 3E5AA 1XBCA 5JT2A 5KHWA 3NCZA 3JYAA 3ML1A 3QXPA 3ZDIA 4C38A 4QO9A 4PQNA 3QTSA 5FDPA 3E88A 4XG2A 1R78A 4IB5A 2PYWA 1W8CA 2R5TA 3PRFA 4FTIA 1F0QA 1OB3A 4NEUA 5IA4A 3THBA 3MY5A 5AP2A 2CLQA 4CFWA 2HXQA 3NGAA 5DI1A 5E8SA 4YHTA 5IUGA 4Y8DA 4EH9A 2QLQA 2W5BA 3E64A 2BROA 3FC2A 1YOJA 3DKFA 3IGOA 3P79A 5FBNC 5FXQA 5BVKA 4C36A 4APPA 5HCZA 3RHXA 3UNJA 2J9MA 2UZLA 4KBAA 4C35A 1YDTE 2XNBA 4G9RA 3UDZA 1YQJA 3U87A 4EL9A 4CZUA 2C1BA 4XBUA 3BU5A 4EC8A 1WBSA 3A8WA 4DE4A 5AV1A 5DYJA 1PXNA 4FZDB 5AP4A 5LWMA 3BL9A 3LQ8A 1OM1A 1L3RE 4R5YA 3WZEA 4DG2E 5JGDA 2J0KA 2GQRA 2OF4A 2X2LA 3EN4A 4HNFA 4UYNA 3RPSA 2VWXA 2ITUA 3QTXA 3FKOA 3SDJA 4QMXA 5IDNA 4AU8A 3T3VA 3PYYA 2WD1A 4H58A 3VUKA 4QMUA 3ZXTA 3BX5A 1W84A 4CLJA 3DXNA 4P5QA 1OGYA 3IW5A 2IZSA 2QOBA 2ONLC 3DS6A 1QPCA 3WF5A 4FIHA 4XG3A 5HX8A 4U42A 4BDKA 3DKCA 3I6UA 1SVEA 3QZIA 2VGPA 5EYKA 4ZK5A 2ZV2A 1DM2A 4E7WA 2HY0A 2WMVA 5EYCA 1G8JA 3FYJX 2ZVAA 3VRYA 4OAVB 4DEGA 3RCDA 3KL8A 1QPDA 3VN9A 2VX1A 3QTUA 3E3PA 5CSHA 4A9RA 3MIYA 3EWHA 5J7BA 4S33A 3MI9A 4O0VA 2GMXA 4LYNA 4A7CA 3T3UA 4IC7A 4V0GB 2EU9A 3LZBA 3MFTA 5HE3A 4DTBA 3H9RA 2X6DA 3QUPA 4WSQA 2HCKA 5HCYA 4GRBA 4IC8A 4JRNA 4FNWA 2Y4PA 3WE4A 3BU6A 1OKYA 3OT3A 3POZA 4ZZMA 3NUAA 5IQBA 4J95A 4QQJA 2QOIA 5K4IA 4U8ZA 5I3RA 4DH3A 4U9AA 2JDRA 3MPAA 3QXOA 3U4WA 2GNHA 5FTQA 3F9NA 4RVLA 4CFUA 2OJFE 3BYVA 5BVFA 3WZKA 3JY9A 4BICA 3B2TA 3F2NA 3QKMA 4YC6A 3LJ1A 4FKQA 4M15A 4UXQA 2XNGA 4MEDA 3G6HA 4GK4A 2XCHA 3G2FA 3H10A 3HV5A 3NYNA 4KIKA 4YTHA 1BLXA 4MQ2A 4Z9LA 5CF8A 5EQEA 3W0NA 4HGLA 4IB0A 3PJ2A 4NW6A 4BVUA 4AACA 2R3NA 4RIYB 4DTKA 2OF2A 3UP2A 4PDOA 5GJFA 4XX9A 4FV5A 5DVRA 4DFUA 4QTCA 3P1AA 3GT8A 3I60A 2HXLA 2JKQA 4IB3A 1EH4A 5CEIA 5M51A 3ORMA 4IZYA 2R7IA 1BL7A 2B4SB 3JY0A 4I93A 4TYIA 2ITOA 2CN8A 5K5XA 3LCOA 3UP7A 2NNWB 3NZ0A 3NUPA 3A7GA 5CSPA 4F1OA 1YDRE 2YWVA 2NRYA 2PE2A 4BKZA 3QRKA 1B6CB 5IDPA 4FL1A 5A9UA 5JZJA 5DIAA 1SMHA 4EYMA 4BZNA 3D7TB 3NDMA 4HYIA 2PZIA 3NUNA 4Z55A 4AUAA 4DAWA 1OUYA 1MRYA 4FSWA 4BHZA 3QRIA 3VUMA 4EH3A 2X81A 3KXMA 4XG4A 4FKJA 3A8XA 1P14A 3HMNA 3RGFA 3ACKA 3PPJA 3L9LA 5AP0A 3UC3A 2QOFA 4YR8A 2WEVA 4RFYA 3NVMB 1M2RA 4PRJA 4WD5A 4YZBA 5BV3A 1LEWA 4CRSA 3DDQA 4GMYA 4ALUA 4C4HA 1GAGA 4CCBA 4WOVA 3P08A 4F7LA 3GU7A 3OXTA 4WBOA 1KUTA 5J8IA 3GCSA 3D83A 5K5NA 2PVNA 2FGIA 3BU3A 3IKAA 3MVLA 4IE9A 3VUHA 2CNVA 4X2NA 4AGUA 2VV9A 4E6AA 1KE5A 1W7HA 2GS7A 2W5HA 3PG3A 4IEBA 4QOXA 4B8MA 3B2WA 5I9ZA 3Q5IA 2A27A 1R0EA 5D7AA 5E8ZA 4TYGA 2XKDA 1E1XA 4YU2A 3BV2A 4Y95A 4ZIMA 4JBQA 4DH8A 2X8DA 3A62A 5J5SA 1PRYA 1VYWA 1NY3A 3KXGA 3Q4CA 4OBPA 4ANLA 3BYOA 4HCUA 4UZDA 5AWMA 5AAEA 4JR7A 4KABA 3C0HA 3VBVA 4ZS4A 3CTHA 5GIOE 1RDQE 3MIAA 2XKEA 4EH6A 2YIYA 1Q8TA 3ZH8A 4FV9A 2IVVA 4QTBA 4V01A 2YM6A 2H8HA 3RBWA 5EM6A 2PHKA 3B8RA 4OT6A 5D1JA 5IA1A 4Z3VA 5LVNA 4QPMA 5CAQA 4FEQA 4EZ5A 5ANJA 2UZVA 2JIUA 4RJ6A 2XKCA 3UQGA 2PWLA 2QONA 3QTIA 4XHKB 1SZMA 3KRWA 3UDTA 5EQYA 4TTHB 1J3HA 3OWLA 3R7UA 3FPMA 3OOGA 5J87A 3QLFA 4F0IA 4DHIB 5AV0A 3FXWA 4YLLA 2BIKB 3PY1A 2E9NA 4X21A 5DFPA 5K0KA 5JGBA 4JOAA 3DGKA 2WEIA 1ZOGA 2W1HA 2R3FA 3E87A 4GJ2A 4P90A 4PUZA 4QTAA 3UC4A 3UYTA 2CKEA 2RG5A 2ONLA 4C3RA 5DR2A 3BQRA 5LVOA 3MH3A 4I6BA 1XHAA 4BN1A 3FE3A 4Q9ZA 4FG8A 5DGZA 2RSVA 1YWVA 5DA3A 5AX3A 4ACMA 3BLQA 4ZLZA 2HWPA 4EONA 3I4BA 2YM4A 4IAZA 3VF9A 4AW2A 4BR3A 4DFYA 3E7OA 4I21A 3FL4A 3GQIA 5AA8A 4BZDA 4YJTA 4O2ZA 3UBDA 2QG7A 4NKSA 1SVGA 4F9BA 1GZ8A 2B9JA 3W0PA 3DDPA 1UA2A 3QHRA 3RPOA 3GC9A 1PYXA 3GXLA 2J6MA 2VO6A 1ZZ2A 5A4LA 3LOKA 4G34A 4YTCA 3U55A 4ACCA 3DB8A 3GC7A 4RX7A 4S32A 5M09A 5A6NA 5KMOA 5EW3A 3ENMA 5T6KA 3V5WA 3QD3A 5L2IA 4YBKA 3OTVA 3MFSA 5IQDA 5AR4A 4J97A 3W8LA 5FBOA 2XK9A 2C4GA 3U6IA 3F3TA 3G51A 1YHVA 2CKPA 4U43A 3ZFMA 3BBTB 3ZLYA 4ZZNA 3TNIA 4QMMA 2CGWA 2QHMA 2KULA 3PSDA 4E4NA 3SD0A 2VD5A 5IH6A 3R63A 3CBLA 4P2KA 3PVBA 3CS9A 4CTBA 4ENYA 3ORLA 1APME 4USDA 2PVYA 4R5SA 2Q83A 2XIZA 3AGLA 1VJYA 5GZ8A 5JFSA 5DNRA 4XYFA 5KZ0A 1PXJA 2P4IA 3UPZA 3W0OA 4CG9A 1UV5A 4RMZA 3PVWA 4IVBA 2X0PA 4BF2A 1OI9A 5ANEA 1W98A 4QYEA 2HZNA 3FI4A 5HO6A 4KIOA 3TACA 3IS5A 4RRVA 4AQCA 1XH5A 2OIBA 1G5SA 3GQLA 3EQFA 4EQCA 3FY2A 4PTEA 2W17A 3DY7A 1CMKE 3WARA 4KIQA 3FZPA 5LOHA 2PVKA 3V5QA 2PVJA 1OL7A 5HE2A 3HNGA 3QD0A 4O7YA 4FSMA 3QWJA 4Q2AA 3ZCLA 2VUWA 1I44A 5FEQA 4AFJA 4FVQA 4ZTRA 4HNIA 3SVVA 3W0RA 5HU3A 4IVAA 2W5AA 2X0GA 2X7FA 4RPVA 1T45A 4U41A 4DGLC 3KF4A 2XEZA 1UWHA 2YCSA 2ZM3A 3DFCB 3OY1A 4G6LA 4YZMA 4JAIA 4JQEA 4S34A 5ACKA 1YHSA 4BDHA 3H9OA 3MGYA 1NVQA 4PMMA 3PWYA 4BCPA 4WO5A 4DCEA 3ORXA 4QT1A 3W0QA 4RC4A 3OXZA 4RVKA 4I5CA 2AYPA 4W4YA 4AXCA 2QD9A 3LFBA 5HKMA 3NUXA 2XMYA 5FEEA 5HNBA 3RAKA 4F1MA 4YJNA 2C0OA 3V8SA 3O7LD 3GU5A 3O96A 2YM3A 5CWZA 5CEQA 5JEBA 3QX2A 4G17A 5HBHA 4TNDA 3IW4A 3RAWA 4HYSA 4B4LA 5BMMA 3T9TA 3QL8A 3QX4A 3FWQA 1J1BA 3GP0A 4UMUA 4N57A 3OBGA 3NYOA 3EQHA 4YJOA 3BHTA 4LRMA 4EI4A 4F64A 3LCDA 3O50A 5C9CA 5F94A 3BE9A 2BKKA 3Q4TA 2OXDA 4ORKA 4JAJA 3Q53A 1Q8YA 4IMYA 5ANDA 4YHJA 1LPUA 3NS9A 5HVKA 3QC4A 4LL5A 3RPVA 4O38A 2UW0A 4AN3A 3R8ZA 4X3FC 4CKRA 4O4FA 5CI6A 4AZVA 2ZJWA 1VYZA 3FMMA 4BDDA 3LFDA 2WTVA 4FTQA 4X2GA 3FZSA 3Q2MA 4GEOA 4GW8A 4W4XA 3OG7A 2OLCA 5I3OA 2ITQA 3HMPA 2JDTA 3HP2A 5E1EA 2Y4IB 3P7BA 2UW3A 4K33A 5ANGA 3KVXA 4U80A 2R3MA 1ZMUA 2R0IA 4RLLA 4P7EA 3BEAA 4XLIA 5M44A 1JKTA 3QRJA 4RIOA 3TZ8A 5IH5A 3R7EA 5AV2A 3OF0A 5T68A 3H0YA 2YIWA 2GDOA 4OTDA 5AIRA 4IH8A 5CENA 3OW3A 2VGOA 1YDSE 3CPBA 2V55A 3O8PA 2ESMA 5F1ZA 4FIFA 4F7NA 3U8WA 1J7UA 2VTRA 5JQ8A 4ZP5A 3KFAA 4LRKA 4WHZA 5KCVA 4DTAA 5IH4A 4UY9A 4IACA 4C2VA 3VW8A 2BALA 2C5YA 4TYHA 4ZEGA 4ALWA 3HMMA 4W9XA 2HW6A 4NM5A 1JWHA 2LAVA 4PL3A 4I41A 2VNWA 3N51A 4NM0A 4UX9A 3QD4A 3Q2JA 4DGOA 4I24A 4LMUA 3P5JC 4EH8A 4YLJA 4FV3A 4IXPA 4O82A 1YXTA 3PY3A 1WBWA 3SXSA 4I0SA 2YCFA 5HBEA 4I4FA 4BHNA 4XV9A 4N70A 5DH3A 5HICA 4MD9E 1CSNA 3DXQA 5EHOA 5H3QA 5GZ9A 4AQKA 4O7ZA 2JBOA 4OT5A 3R7VA 3FKLA 1YXSA 3R83A 4LUDA 2VWBA 3TTIA 4J8MA 2CKOA 4O81A 2GTMA 2XAMA 4J1RA 2OGVA 2PE1A 2W1EA 4PF4A 3OXIA 5L2QA 4GU9A 3A2CA 5L4QA 2OKRA 2OZAB 3HRBA 3OC1A 5AUWA 4AA4A 1PJKA 4EOQA 1Q4LA 2EXCX 3EJ1A 4GYIA 5AADA 4DEEA 2ZB1A 4WRGA 3ZO1A 4D55A 3SG8A 2W0JA 3LLTA 4BCNA 4DFZE 4ACDA 3IO7A 1UKHA 2ZMCA 3K3JA 3VBYA 4E26A 2YHVA 2OG8A 5L8KA 2W99B 3EL7A 3R1QA 4L67A 1PW2A 2B9FA 4FUXA 5JFVA 4QDEA 2XNNA 3Q52A 2W7XA 4C4JA 2J4ZA 5KZIA 4CFFA 2XANA 3AC2A 2RGPA 4QPSA 4UV0A 2F7EE 4PMSA 3QQGA 2C0IA 3AT2A 3DBCA 4OTWA 2QOCA 3HDMA 3Q32A 3DQWA 1UKIA 5CAVA 1FBNA 5TO8A 3GUBA 4FZ6A 3BGZA 4ZS0A 3VS2A 2CNQA 2BRNA 4AA0A 3MB7A 1WBVA 3I79A 3KGAA 3FEGA 5DE2A 1OL1A 1QCFA 2BDFA 2R7BA 3R2YA 4APCA 2AQXA 3W2CA 2R3RA 3QLGA 3Q96A 1WFCA 4X2FA 2WMRA 4KWPA 4JT3A 4J52A 5HHWA 2WQBA 4DFLA 2VO0A 4LFIA 3R30A 5EM5A 4CV9A 2OXYA