3EQGA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a ternary complex with pd, adp and mg2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
343
structure length
314
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqgA01
3WF8A 4K6ZA 4USFA 2C6MA 3QKLA 2I0HA 4V05A 4R1YA 3Q4TA 5FXSA 4AN2A 5GIPE 1SVHA 2XH5A 3AMYA 3ZHPC 1UU3A 4FV6A 1GJOA 1GZNA 5EDPA 1CTPE 1PXOA 4R1VA 4LM5A 4QMVA 2BALA 2XNNA 4TRLA 4L8MA 3FXWA 4W8EA 1G5SA 3MVJA 3GEQA 3BZ3A 1K9AA 5EI8A 1ND4A 4D2TA 4G3CA 4Z16A 5LVPA 5ETIA 1KV2A 4NT4A 4IAIA 1U46A 5AV1A 2GPHA 4C58A 3ENHA 2OF2A 4DBXA 4KUJA 2E9OA 5JFWA 3KMWA 4UMTA 5CI7A 3R7IA 1ZZLA 5IQFA 3MA3A 3GQLA 4IHPA 4XOZA 4FKUA 2OW3A 3HL7A 4CD0A 1YDSE 3W2PA 3QHWA 4RJ3A 3HMPA 1YOMA 4O7LA 1GAGA 5C03A 4O81A 2VRXA 4RMZA 2QKWB 3SA0A 4YTIA 4IFGA 5IPJA 3FLSA 4N4SA 5DWRA 2X6EA 4P4CA 2VX1A 4AG8A 3TKUA 4D1ZA 1VYZA 4G3EA 2VTAA 5C27A 1MQBA 2CKOA 3C4EA 3A2CA 3LM0A 4A9UA 2ZYBA 4UXQA 4F65A 4R7BA 5L6OA 3IW4A 3LFDA 3VJOA 5AUZA 4Y72A 3OY1A 3UC4A 3RWQA 1H1SA 3UZRA 4QYGA 4MD8E 5HBHA 2GDOA 4PTEA 3GU7A 4Q9SA 1JSTA 4FKJA 4UZHA 3T9IA 5M06A 3C4ZA 2UVZA 4PP7A 4C02A 4PMPA 5LWNA 2HWPA 3BLRA 2X8DA 4WG4A 2IW9A 4TKSA 5CF5A 1W82A 5CZHA 3NYOA 5DT3A 4ACMA 4LRMA 2RKUA 4KWPA 3LFFA 4RVLA 4LOQA 4CCUA 3GCPA 3S3IA 4XG6A 2CKEA 3UPXA 2ZAZA 3IDCA 1PJKA 5FUTA 4EOOA 4TWOA 2Z7SA 3UYTA 5DG5A 5C26A 1B6CB 2C3KA 4GFGA 4WNOA 4RX5A 4EC9A 2B4SB 2RG5A 3UG1A 5HE1A 3NAXA 1UVRA 2BZHB 2P33A 3FAAA 1NVSA 2Y4PA 3HV6A 4HYSA 4N6ZA 1PMNA 3NW7A 3DXPA 2XZSA 4S31A 4UWYA 5ETAA 3PP0A 5LQFA 4IACA 5CAUA 4I0RA 3HV7A 4HOKA 2WMSA 1R0PA 2XK8A 4X2FA 3HP5A 3CQUA 3D94A 4CFWA 2F7EE 2OIBA 4GEOA 3DK3A 2RFSA 4KIKB 3RPVA 3MTLA 5BMMA 2ITVA 3EQHA 1VEBA 3O8PA 3PUPA 4HYIA 5DR6A 1OVEA 1RE8A 3W55A 4PPCA 4AOJA 2R7IA 5IEVA 3SRVA 2WQMA 3PSCA 2R9SA 4XH6A 2W5AA 2FSMX 3O96A 3E62A 4ACCA 3GC0A 4I20A 1JKLA 2JDTA 4M84A 4MHAA 3G51A 2VGPA 4ARKA 4JR3A 2JKOA 2QI8A 3QXPA 4GYGA 3H10A 3Q52A 2YCSA 4L53A 3ID6C 1CKIA 3SDJA 4BDIA 1Z9XA 3BEGA 2XK6A 3C4WA 3H9RA 4BBEA 4A9SA 4EK8A 2B1PA 4NM0A 2OXDA 3LOKA 3R6XA 4NJDA 3VUKA 1M7NA 3TNHA 1TQIA 2W4OA 5KMKA 3OXZA 1PXMA 3DAKA 3MH2A 4BDBA 3EL8A 3RGFA 2BMCA 5HE2A 2IPXA 3VW8A 2WTJA 4FZ6A 3H30A 4CNHA 4FYOA 1Q5KA 2C68A 3G0EA 3SG8A 3N9XA 2YM8A 2QO9A 3V5JA 3EL7A 1Y6AA 2BRNA 2CSNA 4JG6A 5FLFA 3LFBA 3RHKA 3W8LA 2I0VA 3A8XA 3IO7A 4D5KA 3LJ2A 4TNBA 5M4IA 2BKZA 3II5A 4NIFB 5DGZA 4J52A 3VUTA 3GXLA 5KMLA 4HYUA 1ZOHA 2OFUA 5EHOA 1OIQA 3C51A 4YURA 2IW6A 4F08A 2VWIA 5DEYA 2EXEA 3W8QA 4DITA 4E7WA 3BYMA 4ZLOA 1JAMA 5AR4A 4BCFA 1NW1A 4XJ0A 4FG9A 2UZTA 5HESA 4CYIA 5AM6A 4BCOA 4UMUA 3QZFA 1A06A 2OK1A 2C3LA 4EHVA 3QWJA 3ROCA 4FL2A 3VS5A 5HTBA 1OITA 4QTCA 3LIJA 4X3FC 4DTBA 4F1MA 5KX8A 4L52A 1DI9A 3Q04A 3A4OX 4YZ9A 3UZTA 3WZJA 4X3JA 3N4UA 3QRIA 3POOA 4M97A 3LXLA 4QYFA 1H08A 2HWOA 3MY5A 2CGXA 2FUMA 2ZB1A 1V0BA 2ITTA 4EK3A 2YDJA 2CMWA 4O7SA 4DGNA 5KMIA 5F4NA 1HCLA 4EH5A 3PJCA 4YLJA 3FHIA 3PA3A 2RIOA 3AC4A 4AW1A 5IG1A 2P0CA 4BDCA 4ITJA 3QTSA 1Q61A 5HO8A 4JS8A 3RVGA 4EBWA 1SNUA 2G15A 1H26A 3NVKI 2X6DA 2ZDTA 4FZ7A 4AZWA 2BRGA 2ZV9A 1Q8YA 2C30A 3OHTA 3QTWA 4FKTA 4RX7A 4EWHA 1UKHA 3AMAA 1H1PA 2G9XA 4IB1A 4FV3A 4F9AA 2B53A 2W5HA 3LPBA 2W06A 4OTWA 3PY1A 4YBKA 3V6SA 4X7QA 4EJNA 1MRVA 4E4XA 2YEXA 3UBDA 4BIEA 3GCQA 3UP2A 3LVPA 4Z3VA 3DOGA 1TVOA 4LI5A 3TG1A 4G6NA 2O3PA 2IW8A 1GNGA 1YW2A 3CGFA 4L3PA 3W2OA 5FBOA 3NVMB 4GIHA 2J6MA 2XNOA 4FZDB 3SXRA 4BDEA 4O0UA 5KMOA 4O7TA 4RWIA 4WNKA 3WZUA 4O1PA 4A4OA 4CZYB 4I6HA 5L8KA 3Q2JA 3F5PA 4FI1A 2HZ0A 4FVPA 2VTLA 3OWJA 4O6EA 4Y5QA 4EKLA 4CKJA 4FT5A 2V5QA 3KN5A 1M52A 3NYVA 5FBNC 1J7IA 3KCFA 3OBJA 3DQXA 2GNIA 1UNGA 2XYNA 3DB8A 4FE2A 3ALNA 5CWZA 3JYAA 3C4XA 4HVIA 3QTXA 4CT1A 4QP9A 4EH2A 5K4IA 2Z2WA 4OAUC 4DN5A 3QTZA 1YHSA 3AT2A 4I5MA 4I0SA 3CTQA 5FTOA 4IAFA 3PA5A 3AQVA 5CANA 2VX3A 4BCIA 4M14A 2ERZE 3L8VA 3EQFA 5M4CA 3IGOA 2KTYA 4MBIA 4GT5A 4EBVA 5CYIA 4JBQA 1HCKA 4MF1A 3D5VA 5H2UA 4RX8A 3R8LA 2OKRA 4G1WA 4F64A 2ETMA 2YDKA 3R9DA 3QA8A 1HOWA 2ITUA 2W99B 2Y0AA 4BCKA 4O0VA 4II5A 4O2PA 5A4TA 3LQ3A 2IVSA 4CT2A 1NVRA 5JFVA 3EQDA 2C0IA 4WHZA 1G3NA 3UC3A 3F7WA 1Q8ZA 3KKVA 3C0IA 3GT8A 4DF3A 3TKHA 4BHNA 3DY7A 2WMXA 2YAAA 5EM8A 3FLZA 4IFCA 4JL9A 4U3YA 5A14A 3OS3A 3CTJA 3FL5A 1OL2A 3P23A 5CF4A 5KKRB 4CLJA 4I3ZA 2PVLA 4MNFA 5FEDA 5E1EA 3TNQB 3NUAA 3PPZA 3UYSA 1WVXA 2J0LA 4HGTA 4L42A 3R9NA 4F09A 4AT5A 4KBAA 4Z9LA 3L9PA 4O86A 4FUYA 4ZAUA 2HZNA 3R9RA 3MJ2A 1FVRA 3FLYA 4D0WA 5BMSA 4F9YA 3FJQE 3IW6A 3B2WA 3IGGA 3ELJA 3Q60A 4U3ZA 3ZSIA 3LFQA 3HX4A 3EFJA 3I6UA 3CR0A 2PVHA 4BI0A 3R8UA 3AD6A 4U9AA 2H8HA 2R3OA 3EOCA 2X7FA 4O21A 5DT0A 3OWPA 1LEWA 3DPKA 3TDVA 4FSZA 4KBKA 4XG9A 5IQDA 2QU5A 4MXZA 2C6OA 2VNYA 5EHYA 4ZSJA 3RCJA 3MSSA 1XJDA 3VRYA 4AW0A 5BNJA 3D14A 3NMUF 5G6VA 3G6HA 2W1ZA 3RPYA 3LAUA 3KFAA 5LOHA 4RLLA 3HMIA 2QLUA 4XG2A 4DFZE 4ENXA 3COHA 4O7ZA 4DE4A 3Q9XA 4XP3A 3D15A 1R1WA 4PL3A 5HG7A 3SV0A 5DR2A 2WQNA 4JDKA 3RAKA 1P2AA 3NEWA 3FDNA 3W2RA 3QU0A 1S9JA 3CIKA 5M55A 3W2SA 3O7LB 2YCQA 2UW6A 2VD5A 3E8DA 4OTQA 3VBWA 2QKRA 3GB2A 4ZOGA 5EOBA 3ZC5A 4BZNA 5HCYA 5AMNA 5CU6A 4HNFA 4QMPA 4EQMA 2FH9A 4TXCA 4GFMA 3SD0A 4RWKA 3F6XA 4BFMA 2C4GA 2VWUA 2WQOA 3AG9A 4YLKA 5KZIA 2ITNA 3PG3A 4ANSA 4BTKA 4EONA 5AAFA 4OT6A 2CNQA 2WHBA 3KXXA 4E8AA 5KBQA 4C38A 2C6TA 3R04A 3BELA 4U7ZA 4BKJA 3R1NA 3SHEA 4C4GA 4TL0A 4DCEA 3KY2A 2CHLA 2YM4A 4EL9A 5M09A 1PMVA 2YFXA 4IWQA 5I9WA 5E92A 2VTSA 3VHKA 3BRBA 4D5HA 4G5JA 3CEKA 3Q4ZA 1UV5A 2PZIA 4FIGA 5CEQA 5JFSA 2BVAA 2ZV2A 1OUYA 3L8PA 5HHWA 1XH9A 5CNOA 1M2PA 4YHJA 1BL7A 4E20A 2FSLX 5GHVA 4E26A 3FMJA 3WZKA 1T45A 3F88A 1WBWA 4MNEB 1KWPA 3GOKA 5EW9A 3RINA 3BE2A 4FNXA 4FBXA 4FTUA 5KCVA 3EHAA 3QLGA 2F57A 3CKWA 2C6KA 2GNGA 3CTHA 3PVUA 3Q9YA 4WUNA 3TUBA 4XS2A 4FV4A 2PMLX 4RJ8A 3COMA 4RX9A 3HVCA 2Q0BA 4QP3A 5HE0A 4D9TA 2J0KA 4DFUA 4NTSA 2C69A 3FXZA 2IVUA 4DGOA 4DEIA 2PE2A 3EZRA 3VUMA 3PZEA 5JN2A 3BHVA 3VRZA 3KCKA 2W7XA 3VS0A 4MVFA 4BZOA 3K5VA 3A7HA 4R7HA 4BWPA 4F4PA 1Q99A 5IKWA 2F7ZE 4RFZA 3OCSA 3VBVA 3UPZA 1XH7A 3UVRA 3ITZA 1YWVA 3R7OA 3TKIA 2X39A 5B2LA 5LMBA 4FK3A 4QP4A 3ZLSA 3VO3A 4YZBA 3OFMA 4BDAA 2BZKB 4K18A 4R3RA 1WBVA 3WF6A 3O2MA 4W9WA 1P4OA 3ZZEA 4CGAA 3ZTXA 5IH6A 2QODA 2XIYA 4FTNA 2CCHA 3MI9A 1W83A 2OF4A 3IW5A 3QYWA 3D7TB 3NW5A 3H0ZA 2GU8A 2UZWE 3HA8A 4UWBA 3LLAA 1GOLA 3FI4A 4AZEA 4XG3A 2ZM1A 3NGAA 5EG3A 3VBXA 3WIKA 3PJ3A 2O5KA 3IS5A 3FI3A 5AUXA 1JVPP 2GHMA 1Y6BA 2WMWA 3BHUA 5CF6A 3RPOA 3UJGA 4E93A 2VWVA 3DA6A 3UZPA 1OM1A 2E9PA 3OEFX 3TZ7A 4OBPA 2YWVA 3R71A 4W9XA 2GTNA 5E8XA 2PE1A 3MH0A 3W33A 4C4JA 4YC6A 3LMIA 1YWRA 1JPAA 3DKGA 4F1OA 5A4EA 4D55A 2WMQA 4EHEA 2BTSA 3QQHA 4WBBB 2XNPA 1W98A 1R39A 4MH7A 3RPSA 3U4WA 4E5WA 3IONA 4WBOA 2F4JA 3ZDIA 5EQPA 4CVAA 3BGZA 4KKHA 5CX9A 2OICA 5BVWA 3OWKA 1XBAA 4I21A 3C9WA 4AZFA 5JRQA 3DDQA 5EK7A 3FMDA 4LYNA 4Q5HA 4C3PA 4EOJA 2J2IB 4CKIA 3R2YA 5HQ0A 5JQ5A 4D1XA 3Q2MA 3V8WA 3KMMA 4PPBA 1VR2A 4RIWA 4IWOA 4V04A 5CAOA 3P7AA 4IDTA 2BHEA 4IANA 3PXQA 5IISA 5M44A 5LMKA 2PSQA 4BY9E 2XB7A 5M56A 4NFMA 5CEMA 3PJ8A 3C5IA 1OECA 2BZIB 2C1BA 1IAHA 4FSUA 4I0TA 2EUFB 2VTRA 4GVAA 5F20A 3QC4A 3VULA 4FT0A 3VS6A 3LFSA 4K9YA 3VUIA 3UQCA 3GI3A 4CFXA 2JIVA 4CV9A 4WG3A 4GFOA 2B9IA 5BVNA 4D58A 3FLWA 3H9FA 4WSYA 4ASEA 3P79A 5GJFA 5H8GA 5HBJA 2ZV8A 4IAZA 4V01A 4S34A 2WD1A 3KULA 5BVKA 2AYPA 4N57A 3DJ5A 2W1GA 3I5NA 3N51A 4PP9A 3ZEWA 4FL1A 5GJGA 3LM5A 4JJRA 4CG8A 4HGLA 5J7BA 4FA2A 2BDWA 3FE3A 3BV2A 5E8YA 3QD3A 3AD4A 3EQPA 4IXPA 4GT4A 3PSDA 4U8ZA 5M4FA 3FZRA 3RBWA 2R3KA 3TUDA 3QXOA 1WCCA 2VZ6A 3BYVA 5B0XA 1OPKA 1DAYA 1YXVA 4APCA 4Q2AA 2R3NA 1LP4A 2R2PA 2UW8A 4NKAA 2JDOA 4PMMA 2BRBA 2UZDA 4RJ6A 4FVQA 5CU4A 5T68A 1KV1A 4FKLA 2PY3A 4AA5A 1UA2A 3FMHA 1W0XC 4WNPA 1Q4LA 3V8TA 2W1HA 3FUPA 4UBAA 4XHKB 3F3TA 4L44A 4EK4A 5CEPA 2WO6A 1FQ1B 3FSKA 4QD6A 4EOSA 5L4QA 3E87A 2AUHA 3ENMA 5L2IA 2XJ2A 2PPQA 3OXIA 4L68A 3RK5A 4FG8A 4M69A 3T3VA 4FV9A 5A4CA 3I4BA 4IVDA 4LRJA 5CT0A 3DNDA 4BC6A 4NK9A 3WZEA 4RC4A 4M0YA 3E93A 1U5QA 5EHLA 3UNJA 1ZXEA 3NCZA 4MX9A 5HGIA 2QR7A 3GENA 2VTMA 1KE5A 2Y7JA 4FG7A 2VO0A 3D83A 3KGAA 3TACA 4JXFA 2C5YA 5DE2A 3R21A 3EFKA 3KK8A 1IA8A 5CSHA 3VS3A 4EI4A 5HNIX 4D9UA 1Y8YA 4JX7A 3BU6A 3BPRA 4UMQA 3V51A 3ORPA 4K77A 3NR9A 3VF9A 4A4LA 3LKMA 3PE2A 2XUUA 3TT0A 4QNAA 5CT7A 3DK7A 3O23A 5BUJA 2W4JA 3R02A 1Q8TA 3GU6A 3UOLA 5BYZA 1U54A 3D2KA 1BUHA 3PRIA 1YOLA 4KKGA 2VWWA 1SZMA 3U8WA 4JVGA 4TN6A 2BILB 3S1HA 3LFAA 2BZJA 3ZBXA 4FEQA 4FL3A 1W8CA 3RK9A 4UB7A 2VWXA 2FSTX 4W4YA 5LCKA 5K4JA 5E9EA 3RCDA 1VZOA 3ZRLA 4W8DA 4YBJA 5EOLA 4AGCA 4GK2A 4FOBA 4YJNA 5AJQA 2UW9A 4DH3A 2DQ7X 5HO7A 3CS9A 3FY0A 4BYIA 4FSTA 2UZOA 3ZZWA 3ET7A 2YCRA 2YIRA 4MXCA 5AP4A 3FPQA 1Q41A 3SKCA 3LW0A 4AACA 2OG8A 1L3RE 2IJMA 2JC6A 4PRJA 5CSPA 3DAEA 2YLFA 3M11A 5KMJA 2O65A 3NNWA 2OIQA 3TZMA 4JBOA 5LXMA 4ERWA 3QGYA 4LL5A 5D7AA 4YGAA 2PZRA 5EKOA 2CJMA 4G16A 4YMJA 3UE4A 5EKNA 2OXYA 3FWQA 4KNBA 4MQ2A 3RAWA 3HRBA 3F2RA 4BDFA 4BTMA 2VAGA 2WTKB 1I44A 3PLSA 2BAJA 2CN5A 3AT3A 3A99A 5ACKA 3TM0A 3NYXA 5KZ0A 4FV8A 2V0DA 5JK3A 1Q62A 4M8TA 5CVGA 2Z7QA 3EYGA 1DS5A 3U9CA 4QMUA 4UV0A 2B7AA 1PXIA 5HOAA 4QMQA 5J95A 1JKTA 4XP0A 5HG8A 3PY0A 5AAEA 3UGCA 3D4QA 3TJDA 3EQCA 3R7EA 4AGUA 4YO4A 2JFMA 4QMOA 5KKRC 2BROA 3UIUA 1QL6A 5ANIA 2Z7RA 2ZDUA 3QKMA 4RJ4A 4YC3A 3IDPA 4G34A 3HDMA 4BCMA 4KIPA 3KRJA 4EKKA 3NYNA 3A7JA 3PP1A 4XNEA 4OBOA 4CFUA 5LWMA 3LCDA 4CG9A 4AW2A 4JBVA 4D4RA 4C2WA 2DYLA 3PXYA 1OKZA 2RL5A 3LXPA 4NUSA 2GQRA 3SX9A 3CLYA 4U97A 5JT2A 2QONA 3CD8A 4NKSA 1KSWA 4C35A 4FV7A 5F9EA 2VTNA 2QHMA 4JX3A 5CY3A 5EQEA 1GY3A 3B2TA 3ATSA 3DBDA 1O6LA 5BVFA 2WIPA 3HYHA 5AP6A 3R8VA 3FC2A 3EQIA 5BQ0A 3QF9A 1JBPE 3KXNA 3GCSA 3ZO4A 5HD4A 5LCJA 4O7NA 5FDXA 2C5OA 2WTDA 4C8BA 4FTQA 4YZMA 3ZDUA 2OZAA 2BCJA 5M53A 4Q9ZA 5AP5A 3DGKA 3C4FA 2RFEA 3PPJA 4F0FA 4GG7A 5C1QB 4MBLA 4EH7A 4EJ7A 4NEUA 2VTIA 4GT3A 2H96A 2Z60A 4U42A 3TV6A 2B0QA 2UZBA 2X2MA 3CY3A 5HKMA 4U44A 4G31A 3BYOA 5I3OA 1LR4A 4FMQA 3MDYA 4EH8A 4ZY5A 1UWHA 3T3UA 3SVVA 2WU6A 5E8WA 2YABA 2JKQA 4QO9A 4GL9A 4ZXTA 4QTAA 3F5UA 4TYHA 3HP2A 3TCPA 2WNTA 4I23A 3VJNA 1XH5A 3V5QA 2F49A 4UMRA 3FMEA 4NFNA 3V6RA 3MFRA 2IG7A 4YJVA 5HD7A 3RWPA 3VUGA 4JBPA 4PQNA 3ZCLA 4U45A 4BDDA 4AUAA 5HG9A 1YRPA 2PK9A 1OZ1A 4KRCA 4O1OA 4XCUA 2R3QA 1PYEA 5TO8A 3TN8A 5IA5A 4ZTSA 4D2RA 5CEKA 4XRLA 1PRYA 2IVVA 4J99A 4IVAA 5J1VA 4Z7HA 5ANDA 2GHLA 4XYFA 3ZM9A 2W9ZB 2C0OA 2HZIA 1LEZA 3R28A 2HYYA 3DFAA 4JDHA 4JRVA 1OKWA 5EW8A 3R7YA 1BKXA 2UVYA 3DV3A 3SOAA 3ZOSA 3G15A 4BIBA 1V0PA 1OL5A 3DLSA 4JDIA 4XX9A 2A1AB 5HNBA 2X7GA 3JXWA 4O0WA 3EWHA 2LGCA 4N70A 4F7JA 2OO8X 2QOQA 3EN9A 3FKNA 4OBQA 5D9HA 5ACBC 4AZTA 5L2TA 3JR1A 4R6VA 3PA4A 4H36A 3W16A 5FM2A 3U4UA 3BWFA 4TT7A 4IX6A 3F82A 1Q8WA 3D5UA 5ETCA 3W18A 4FTJA 2R7BA 4KAOA 3PXFA 4LV8A 1QPCA 3DFCB 4WRGA 4C0TA 1H28A 4XUFA 3TTJA 3PTGA 1SNXA 4R77A 2C5XA 3A7FA 5M07A 4XEYA 3AC2A 4BKZA 5DBXA 4F9CA 1GZKA 1YDTE 3WF7A 1OIYA 2BDJA 3V3VA 3R9OA 2QQ7A 4YPDA 3TUCA 4UXLA 2P4IA 3QCQA 1T46A 5CNNA 3DBCA 3W10A 3QD4A 3E8EA 5E91A 2WMVA 4PF4A 3NNVA 4RBLA 5AUWA 4YTFA 4L3LA 1WBPA 2JKKA 4MXXA 3DK6A 1J3HA 5EDQA 5CENA 3F3UA 4R7IA 2QOLA 3PWYA 4AOIA 4HZSA 5JQ8A 2J5FA 5TF9A 4CMUA 1XBCA 2QC6A 4O0TA 4F7SA 5AIKA 3EIDA 4YJUA 3AT4A 3NUXA 4RC3A 3FZSA 1FOTA 5HTIA 2YIXA 2WQBA 4GS6A 5LVNA 2PMOX 3OUNB 4GW8A 3TZ8A 4IBMA 4J7BA 4AOTA 2RFDA 2J9MA 3OY3A 4FKOA 4I1ZA 3GNIB 2EU9A 5DHJA 5KBRA 2GTMA 4FR4A 2BPMA 4FKWA 5LMKC 4K0YA 3E8CA 2ONLA 5AP1A 5E8UA 4CQGA 4L9IA 3IOKA 4BCJA 4FSWA 4H3QA 2JAMA 2XK7A 4YPSA 4E6CA 2B9HA 1UWJA 1XO2B 3I60A 3FSFA 4FGBA 3R01A 2YA9A 4OT5A 3FQSA 4RIYA 1BMKA 1OPLA 1DM2A 3DBEA 4JI9A 4RFYA 4BGQA 4M66A 5DEWA 1KE6A 3ZH8A 3CD3A 3D7ZA 4FNZA 3MFTA 4IW0A 3M2WA 3K54A 3FLQA 4GYIA 4CTCA 4DINA 4C59A 4QP2A 5AADA 3O8UA 3IW7A 5LJJA 4UEUA 5J7HA 3FI2A 4OW8A 5EYMA 4B6LA 5M57A 1REJA 2Z7LA 5DRBA 3HRCA 2OFVA 3P86A 5DNRA 4AU8A 4DC2A 5FM3A 3QRKA 1FGKA 3QAME 2Z02A 4U79A 2R3LA 4GUBA 4C7TA 4F9BA 4FEUA 3TDWA 1S9IA 4DT8A 5JKGA 4FIFA 4KSPA 4TYGA 4D2VA 4MXAA 3U9NA 5I9ZA 1YI3A 3GC7A 4CTBA 5K0KA 3WIGA 5IH4A 3S0OA 4IC8A 4WA9A 2I0YA 3EN4A 2PULA 3MVMA 2HXQA 2ITYA 3R1YA 4M12A 3EKNA 1H0VA 2RG6A 3PIYA 5AUVA 3RJCA 4ZTLA 2QCSA 1G8AA 4D1SA 3O17A 4XV1A 3U87A 4QMXA 4IVCA 4RZWA 1XWSA 4JR7A 3QRJA 4WT6A 3PLAE 3K3JA 3ZO3A 1PKGA 4DEGA 3E7VA 5CU2A 5DYJA 4E4LA 3I0OA 1BL6A 3E88A 4ID7A 4MD7E 2ZOQA 2UW7A 2QLQA 1IEPA 4PY1A 5DFPA 3RP9A 4GKIA 4F6UA 2QO2A 4U41A 5AP3A 3K2LA 3RAIA 3S95A 3D0EA 4LUDA 4ZP5A 4E5AX 3QL8A 2IZUA 2XVDA 3E3BX 1VJYA 1ZYDA 1OIUA 1XQZA 1OUKA 3U54A 2YIQA 2Y9QA 4DBNA 3C13A 2REIA 2IWIA 2R3MA 4IM0A 4QMWA 3CP9A 3JS2A 5FP6A 5AUTA 4GU9A 5EDRA 4E6QA 5AP7A 2YACA 4B7TA 3NUSA 5CEOA 3FZTA 3ZEPA 1FVVA 2XEZA 1OL6A 2PVMA 4EYJA 2V55A 1Q3WA 5HU9A 4PWNA 4YHTA 2WQEA 4R8QA 3UDBA 5JSMA 4FKIA 4D2WA 3KL8A 3O7LD 3UOHA 3LCTA 4O38A 3L9MA 3ODZX 3OC1A 4IEBA 2YLEA 3DXNA 5I4NA 1O6KA 5AR5A 4BWXA 3E63A 2PHKA 5HIDA 1H4LA 4AQCA 4A9YA 2XS0A 5EW3A 2ITOA 5CU3A 3H3CA 3ZUTA 4OUCA 2R64A 2A2AA 3JY0A 1NXKA 4B9DA 2R3IA 3K5UA 4K2RA 2WEIA 4IJ9A 4BCHA 3FL4A 2YERA 1YOJA 1ZY4A 3GCVA 4C37A 4QRCA 4EC8A 3HAVA 2R0UA 2C6EA 2X7OA 4E4NA 2XBJA 4DTAA 1J7UA 1ZZ2A 4RZVA 4XG7A 4FIJA 4CRLA 4B0GA 3FLNC 4E4MA 4F63A 4CV8A 2XCHA 5BUEA 4YJTA 3SAYA 4NW6A 2BAQA 4RG0A 5I0BA 2XNGA 3WE4A 4LMUA 3OTUA 3MTFA 3PIXA 2UV2A 3VQUA 2XJ0A 3UO5A 5H9BA 5IMXA 4YJOA 5KHWA 2HXLA 2QO7A 4V0GB 4C4FA 1VYWA 5FTQA 4FTIA 3VNTA 3ZFXA 2W9FB 3KEXA 3PFQA 3D2IA 3SOCA 4DH5A 5LVMA 5L3AA 2B52A 2YWPA 2G2FA 3CY2A 2XNMA 5CAQA 1ZOEA 4I5HA 3BV3A 3Q6WA 4I5PA 4QP1A 5FP5A 5B7VA 4ZZOA 4MD9E 3QTIA 3MFUA 3KB7A 4IC7A 3KN6A 5EI6A 3F2AA 2UZEA 4QYYA 4NU1A 3QKKA 3FKLA 1CKPA 1PXNA 1AGWA 3E5AA 2V7OA 2P3GX 3QTQA 4IJPA 4TNDA 4ENYA 2B9FA 3CXWA 1URCA 1ZWSA 3OZ6A 3PVWA 3S2PA 1OBDA 2R5TA 2QURA 4QP8A 4FK6A 4FSMA 4GMYA 3Q32A 3HAMA 5IQGA 4TW9A 4F0IA 4YU2A 4HW7A 3AC3A 3RK7A 4WRSA 3KREA 2X1NA 1LUFA 4FV5A 4JDJA 3F9NA 3TWJA 1XHAA 3TL8A 1WBNA 3PY3A 4P5QA 2WTKC 4KIKA 3G5DA 2Q83A 1JNKA 2VTQA 4RFMA 1OGUA 4ACGA 4C62A 2OIDA 1X8BA 4QMZA 1ERKA 2UW5A 4BWKA 4UALA 3OEZA 3VUDA 4G9RA 4GUEA 3ZXZA 3OCGA 5EQYA 2PUUA 5DRDA 5HCZA 5LVOA 5IUGA 5AFVA 2C3JA 3F2NA 4G6OA 3LE6A 3VC4A 4F70A 3FBVA 2W4KA 4L00A 1XR1A 5HLPA 4MBJA 4H58A 4I4FA 4EH9A 4M68A 2ITXA 4MF0A 5BYLA 4BHZA 2P55A 1WAKA 2A19B 3C50A 4FKQA 4Y73A 3WZDA 4FTLA 3BHTA 3ZXTA 4AP7A 3NRMA 1TQMA 3ZBFA 4AE9A 4FC0A 2HELA 1UU7A 2KULA 5GINE 1YI6A 2XCKA 4NIFA 1OI9A 4DGMA 2Y4IB 3BIZA 2DUVA 4FYNA 3ZSHA 4IIRA 3LMGA 1XKKA 3AGMA 1BI7A 2WGJA 3EQRA 3F3ZA 3L8XA 2J7TA 2ETKA 4LOOA 4M67A 3PE1A 4KSQA 4UWCA 4ZJJA 3LFCA 3ZM4A 1SVGA 2YN8A 1UU8A 3QQJA 3IECA 1OKVA 3AGLA 3D5WA 4ZTRA 4QMLA 1YVJA 3G90X 4H3PA 4X0MA 2NNWB 4R5SA 2WKMA 3OG7A 4ALVA 5BX0A 2XJ1A 2V22A 3QCXA 3P0MA 4USEA 4XV3A 2GMXA 3QD0A 2SRCA 4CSVA 2C5NA 4LGHA 5EM6A 4ANNA 2Z8CA 3DTWA 3H4JA 3GU8A 2W1IA 2ACXA 3Q3BA 1SMHA 2XKEA 4ACDA 4X2NA 1H07A 2A0CX 2ESMA 3BYSA 4RA5A 3DBQA 3R00A 3DU8A 2VV9A 4IX3A 4FEWA 3ULIA 4FNYA 4B8MA 3R8MA 3COKA 3EZVA 2X0GA 3IKAA 3IDBA 4ITHA 4O0RA 2VWYA 5IDNA 3I0QA 4IM2A 3NAYA 2J5EA 4IVBA 1U4DA 5IA3A 3FMNA 5AV2A 4QQTA 4GU6A 4QP7A 4F9WA 2CGWA 2UZUE 2WTCA 3I6WA 3ZRMA 5HLWA 5I9YA 5M4UA 3FHRA 1IG1A 4FIEA 4YUQA 3U6HA 3V5TA 3Q6UA 5HX6A 3KVWA 5KMMA 5J79A 4PNIA 3BYUA 4FIIA 3R2BA 3R8PA 4IWDA 1Q24A 4CYJA 4DFBA 4LG4A 4W4XA 3NDMA 4DH1A 1U5RA 2ITZA 3JPVA 3R7UA 5E90A 5T3QA 4ANOA 5L2WA 3QUPA 3HKOA 2OLCA 2BHHA 5C9CA 4D4YA 5AP2A 4G5PA 3OWLA 3R83A 2RF9A 2XNBA 4XBUA 2YDIA 3ULZA 2FGIA 3G33A 4JIKA 4AA0A 2OZAB 2X81A 3AMBA 2XRWA 3CCNA 4PL4A 3RZFA 1KE8A 3SQQA 4HGEA 1R78A 2EWAA 4GRBA 1IA9A 3FI8A 3B8QA 2JBOA 4J8MA 3ERKA 1FGIA 5J1WA 4WSQA 1CKJA 3POZA 2VO6A 1YXSA 3OVVA 4BGGA 2UVXA 4I22A 3ZLWA 4DHFA 4ORKA 3RM7A 2PVRA 3JUHA 5JZNA 4FZAB 4GSBA 3ETAA 4AZVA 4C4IA 4ZSEA 4AW5A 3PXRA 2BFYA 3DJ7A 2EXMA 5CU0A 4EUTA 5AWMA 4CEGA 3NSZA 5HIBA 3KXMA 3V5WA 5A54A 2WAJA 1PXPA 3LCKA 5HX8A 4YJSA 4EOMA 2WZJA 3D5XA 2OZOA 2WU7A 4IQ6A 5FQDC 3OD6X 4FKSA 3V01A 3ZUUA 5B2MA 4IZYA 4PDSA 5HEZA 3BWJA 4CLIA 4KABA 4LL0A 5DMZA 1QPDA 4QTBA 3MPTA 1CDKA 5CF8A 3E92A 4PMTA 3RAHA 2VGOA 1W7HA 3FQEA 4FSNA 4JG7A 2ZM4A 5IH5A 4DGLC 1QPEA 4J98A 3DQWA 2B54A 4QYHA 5AR3A 5FXQA 2OH0E 4NSTA 5IQIA 3MGYA 3N4VA 3QA0A 1MP8A 3DBFA 2YIWA 4RWLA 4C33A 3O50A 4X21A 2RGPA 1OKYA 4C61A 1E1XA 4NCTC 3KRWA 4FKPA 3SRVB 3VUHA 2PWLA 2JGZA 5BPYA 5L8LA 4RVMA 2CKPA 5J9ZA 4UN0C 3MVHA 4JOAA 4ANLA 4C3RA 1NT2A 1ZAOA 3QGWA 1H1QA 5BYYA 1G8SA 3QUEA 4W4VA 2F2UA 4J53A 4WD5A 5E8VA 4J97A 2BR1A 2QOBA 4IAKA 4B99A 4DEEA 4EHZA 5A9UA 3AC5A 4EOQA 4PNKA 2EXCX 4OR5A 2B55A 4EQCA 2CNUA 5A4LA 4DT9A 3MYGA 4TWNA 3FMMA 4MYGA 4CCBA 4EUUA 3RHXA 4GJ2A 1PW2A 3G6GA 3DKFA 3HV3A 3DZQA 3FYKX 1Q3DA 2F7XE 4M3QA 5H3QA 3VS7A 2YHVA 5HLNA 3H9OA 4WOVA 4I92A 4EZ5A 4MWIA 2OI4X 3CC6A 3OMVA 4KIOA 3UG2A 4RC2A 3LQ5A 1OIRA 1KUTA 2AC5A 2JLDA 2IO6A 2W0JA 3NUYA 3ORTA 3TZ9A 4DLIA 4H05A 3I7CA 3LQ8A 3DJ6A 2ZMCA 4TPTA 1SVEA 3GGFA 2OBJA 3TNWA 1NVQA 2XIZA 2GCDA 4L01A 4RIOA 3CQWA 4WO5A 4BVUA 2OGVA 1GIIA 3ACJA 3R9HA 1YWNA 3ZFYA 3UOJA 3R7GA 4DEDA 4E5BA 1AD5A 4Q5EA 4R3CA 5TOZA 4RVTA 4X2JA 3F69A 4OTDA 4EOKA 5L6PA 3W2CA 2JD5A 4E3CA 1P5EA 3NLBA 1WBTA 4BYJA 3EN5A 4F1TA 4DTKA 1FMKA 4XMOA 3TI1A 4YNEA 5EI2A 5C4LA 1V0OA 4FTMA 2HK5A 1H25A 3VBQA 1PHKA 2PUIA 2GS7A 3A7IA 2G2IA 4MCVA 4U43A 5CXHA 1BI8A 3ZS5A 1A9UA 4OTPA 4WG5A 1KE9A 2VWZA 5D7VA 3R7VA 4ASXA 1M2QA 4ZTQA 3I81A 1XH4A 3ORNA 3OOMA 1PXLA 4S33A 1YXXA 2JBPA 5TR6A 2BIYA 3FYJX 4CFMA 4IX5A 1M17A 2W17A 3EKKA 3OF0A 2R3FA 2JDSA 3G9NA 3Q9WA 4DYMA 2R3GA 3WI6A 5J5TA 1FBNA 4MNEA 3JY9A 2YM6A 5JH6A 5T6KA 3KF7A 5HNGA 2H34A 4P5ZA 1KOBA 5EM7A 5IQAA 3U51A 4HCTA 5AR2A 2F9GA 2YJRA 4IB3A 3PSBA 2I40A 1K2PA 3ZLYA 1RJBA 3F66A 3FZ1A 4FTAA 5IMEA 5BVDA 2W5BA 3CSVA 3E8NA 4LGGA 4IDVA 4A06A 4A9TA 2W1DA 4IZ7A 5CQUA 3PXKA 2I7QA 3UIMA 2VO7A 1JOWB 4MAOA 3QZGA 5CVFA 4EWQA 2YIYA 3OBGA 1GIJA 1P14A 2GS2A 2ZB0A 1IASA 2O2UA 2QU6A 2FO0A 2YISA 3P7CA 4H3BA 5CZIA 5M51A 2P2HA 1J91A 4NM7A 4BKYA 2VN9A 5H8BA 5JZJA 3OOGA 3F5XA 5DPVA 2OJ9A 2Y6MA 4IB5A 3RNIA 3PVGA 3VVHA 4D4VA 4L6QA 1IR3A 4OTIA 5ANGA 5HICA 5CI6A 4EORA 3D7TA 4RQVA 3ANRA 3DB6A 5IA0A 2GFSA 3F3WA 4XRJA 3BQCA 4BDGA 4M0ZA 2X8EA 3DAJA 2BKKA 2PVKA 2ZM3A 3ORLA 5CQWA 3QX2A 4A9RA 2A27A 2IN6A 5LARA 2C1AA 3ORIA 4FODA 4U5JA 3O71A 2W1CA 2GQGA 3VHEA 1JSUA 4DA5A 4EOIA 5DOSA 3E7OA 4X3FA 3MW1A 5AX3A 2VTJA 5AA8A 4IZAA 5F95A 4JAJA 2BDFA 4QYEA 4APPA 4PDOA 4XLVA 2VTOA 3HA6A 4RT7A 3ZMMA 1H8FA 1STCE 4EQUA 3QRTA 4EK6A 2NRUA 2C6IA 3NNXA 4R5YA 5IUIA 2OU7A 2W96B 5CASA 2A4LA 2NO3A 2QG7A 4N0SA 1EH4A 5ANJA 4OTGA 2QG5A 4RA4A 4JQ7A 4KD1A 3DKCA 5J9LA 4OTRA 3F5GA 4O0SA 4HVSA 3HMNA 3IQ7A 2JEDA 4S2ZA 3S4QA 2IVTA 1PXJA 3A4PA 3MIYA 2UW3A 3BLQA 3FV8A 5G1XA 3UO6A 4A7CA 4BCGA 4CFNA 3HECA 4ZJVA 2R3HA 4L7FA 5GNKA 4A07A 3G2FA 1XBBA 1F3MC 4F7LA 4YNOA 1P4FA 2BRMA 4ZTHA 5BUIA 2XIXA 4ITIA 2Q0NA 4Y46A 2PUNA 4J8NA 2IZTA 4HNIA 4DEAA 4D2SA 4YSJA 1Q97A 4DFXE 2PUPA 4FV2A 2UZLA 3AC1A 3ORMA 3CGOA 1ZY5A 3C0HA 5HVJA 5CVHA 3RKBA 5BVOA 5HVYA 3GU4A 1PF8A 3P5KA 5K9IA 2C47A 3ROYA 5A3XA 2PYWA 3MB6A 1ZYLA 5I9UA 4CMOA 3KXHA 4M13A 4MKCA 4LOPA 2BFXA 4QMYA 1E1VA 5DR9A 3RMFA 3RTPA 4R78A 5TE0A 3U6IA 4ALUA 4AXAA 5J9YA 4GV1A 3SLSA 1OPJA 5EYKA 1WBOA 4C36A 4CRSA 4ZZMA 3ZU7A 4ALWA 3QCYA 4LFIA 4G3FA 3QQKA 3VIDA 5CAPA 4USDA 5A46A 2I0EA 4CZTA 1Y91A 2WTIA 4L67A 3VF8A 3ZO1A 2HY81 2PZPA 3KK9A 5IEYA 1XH8A 3GC8A 3P9JA 1SYKA 2JDVA 4FT7A 2VO3A 4RIXA 2QHNA 2O63A 2WPAA 4CKRA 3C0GA 4OGRA 4M7IA 5TKDA 4DG0E 4NW5A 4F0GA 1JKKA 1RW8A 4EH6A 3MFSA 2OJGA 4FTCA 5CEIA 3SC1A 2YITA 3ZO2A 2XIRA 5FEQA 3MN3A 4MXOA 2PTKA 2Y4IC 4HVGA 2HENA 4YP8A 3GBZA 4XV2A 2LAVA 2BRHA 2JFLA 4C2VA 4BCQA 4QTDA 4KS7A 4XV9A 4TYJA 3V8SA 4JT3A 2C5VA 2HIWA 4FKVA 4EYMA 4GKHA 4C4HA 3QQGA 2E2BA 2GNHA 2BTRA 5FWKK 5CLPA 5D1JA 2PZYA 4Y95A 3EYHA 3P7BA 4I6BA 3P1AA 4XLIA 4PDYA 3B8RA 2O8YA 1WMKA 3SXFA 5HI2A 5M08A 1PMEA 3QYZA 3TIYA 3FQHA 5A6NA 4PUZA 4O84A 3FZPA 4BZDA 3MV5A 1APME 2WFYA 3NCGA 2I1MA 2UUEA 3LFEA 4C57A 5JFXA 4NYEA 1H01A 3F61A 5D12A 3BEAA 5IQEA 2I6LA 3FY2A 1Y8GA 3UMWA 5KUPA 5GZ8A 3WBLA 2XYUA 3VAPA 2OJIA 3GQIA 4HGSA 4FNWA 1RDQE 3THBA 1PYXA 4ASZA 4DEBA 3U6JA 4CFFA 5IU2A 2ZVAA 3EFLA 5GZ9A 4RVKA 2V62A 2WMAA 3BCEA 3HV5A 4ZK5A 4XBRA 1ZMVA 3I79A 4MQ1A 3RI1A 3ZYAA 3UNKA 2VTPA 2YZAA 3U55A 5AAGA 3UODA 4I94A 4IM3A 4O91A 5FEEA 2WMUA 2YM5A 4BI1A 3JVSA 4QQ5A 5DA3A 3PIZA 5JRSA 4U0IA 4HPTE 3BBTB 4EZ3A 1PKDA 4XG4A 5DIAA 4LQMA 4O7YA 1H1WA 5IQHA 2QNJA 5JMSA 4TYIA 4YZNA 3SGCA 3NWWA 3WOWA 2X9EA 5L2QA 3PG1A 4O96A 5DN3A 3SW4A 5K5NA 3MBLA 3FEGA 2CGUA 2PE0A 3KRLA 3BU5A 4B4LA 5FG8A 1OBGA 2CN8A 3AOXA 3KXZA 3MIAA 3UVPA 4O27B 2XKDA 4FV1A 1W84A 4IMYA 3RPRA 1Z57A 3ZRKA 3CJFA 1GIHA 4ASDA 1CM8A 4E6DA 2W05A 4BL1A 5BVEA 5DT4A 3L9LA 3FMKA 5HIEA 3V5LA 4XG8A 1H00A 4YZCA 2FVDA 5CXZA 3C4CA 3CBLA 3QALE 4WNMA 2YCFA 1CSNA 4IX4A 4H39A 1FINA 4OAVB 4ZIMA 4H1JA 2XRUA 3HGKA 3ALOA 3W32A 4F7NA 2J51A 3VS1A 5AV4A 4NJ3A 5JGBA 2YAKA 3C7QA 3KRXA 4R3PA 3E3PA 3Q4CA 4FV0A 3VBYA 4AAAA 3LCSA 3LFNA 4O2ZA 1H1RA 2ITWA 3UQFA 2OWBA 3A62A 3UQGA 1U59A 4IAYA 2XK9A 2CDZA 3NIEA 3PRFA 4BN1A 4YR8A 4ZMEA 1ZYJA 5AEPA 3I7BA 4CXAA 1YKRA 1F5QA 4AX8A 4O7WA 5FXRA 4Z7GA 5EYDA 5KNJA 4G17A 5CAVA 4FTTA 4K33A 3V5PA 3UMXA 4TTHB 3GOPA 4RIWB 4BR3A 2XEYA 3BHHA 4AS0A 1DAWA 5K5XA 3A7GA 3F7ZA 4FOCA 1PY5A 1BLXA 3EH9A 3PWDA 3EB0A 2R0IA 4ZLYA 2GHGA 5JGAA 4EH3A 1QMZA 3F3VA 3GP0A 4TY1A 3EMGA 3BGPA 4NM3A 3HMOA 3QFVA 3QQUA 3NUPA 4TYEA 4U80A 4HCUA 3KVXA 4QMSA 2C0TA 4Z55A 5C8KA 3NIZA 3QTUA 1A48A 2HW6A 5AUYA 4S32A 1V1KA 4NH1A 2QOKA 4UX9A 3BGQA 4ZY4A 2PL0A 1H27A 2WXVA 3IOPA 4UYNA 4MWHA 1TKIA 3P08A 2HY0A 2QVSE 4OTHA 5HBEA 4AE6A 2C3IB 4FKRA 4AN9A 4C3FA 3R22A 2H6DA 3KULB 4I93A 5HU3A 2GFCA 4O83A 5C01A 3SW7A 2OJFE 4WKQA 4ONAA 5E8ZA 4IZ5A 4P90A 5D10A 3CE3A 5FD2A 4D4SA 4KB8A 3GFEA 1ZOGA 4YJQA 1OB3A 2X4FA 3JVRA 3NX8A 4FF8A 3CJGA 2WMTA 1ZMWA 3EFWA 4QMMA 3N4TA 3I1AA 2QOCA 3QCSA 4JAIA 4HVHA 4YTCA 1J7LA 4YZDA 4F6SA 3A8WA 3KRRA 2W1FA 2X2KA 4FVRA 5AUUA 3O8TA 2B9JA 3V04A 5KHXA 3SXSA 2CLXA 2WMBA 1YHVA 5K3YA 3GCUA 2PVJA 3LXNA 4YC8A 3OXTA 2XM8A 5C4KA 4ZLZA 2JKMA 4JRNA 4AA4A 4RGJA 2V7AA 4ZSAA 4WUAA 3EJ1A 3DKOA 2VX0A 2XF0A 3KXGA 4GG5A 5I5ZA 2WOUA 5HG5A 3TXOA 3HZTA 4PTCA 1YDRE 4GK4A 5IUHA 2ONLC 4QQCA 5IA4A 4BF2A 1UKIA 3TJCA 4DEHA 4M69B 3ACKA 3OUKA 5CSWA 2OXXA 3OP5A 3PJ2A 3R63A 4DGGA 2OH4A 3KA0A 3PXZA 4MXYA 1AQ1A 4PPAA 2QOOA 2GNJA 2R3RA 4XOYA 5EYCA 3E64A 4PL5A 5GJDA 2CPKE 2QR8A 3IG7A 4U6RA 4X2KA 4AFEA 5HORA 3M42A 4MK0A 3UO4A 2JIIA 2JIUA 4HVDA 5IF1A 1MRYA 1FMOE 3DDPA 4GH2A 5IEXA 1UNLA 1YI4A 4Y85A 1GZ8A 4ANBA 3Q4UA 3VS2A 2JITA 3MWUA 2WTVA 3BHYA 3KC3A 1UU9A 3KF4A 4FSQA 4FTOA 4ANQA 4K11A 3AC8A 2X2LA 4E6AA 1U54B 4BTJA 2VU3A 4BCPA 1URWA 4O6LA 5I3RA 4IWPA 1QCFA 5D41A 1BYGA 3LMHA 5F94A 3MJ1A 2O0UA 3R8ZA 3OROA 3QZIA 3ATTA 3AXWA 5AP0A 1YQJA 4LGDA 3UTOA 4ZTMA 2R3JA 2WOTA 2XMYA 3GVUA 4ZMFA 2FB8A 4BDHA 3PDTA 4EZ7A 4ZS0A 3C1XA 4KIQA 3TIZA 3ZUVA 5ANEA 5AV0A 2E9NA 2HAKA 3ORKA 3UIXA 2CGVA 4BI2A 3Q53A 4BDJA 3IPHA 2E9VA 4J96A 4E1ZA 3DXQA 2C6LA 4KINA 4ZJIA 3HRFA 4X6RA 3BKBA 4BCNA 3CQEA 1ZARA 4QMTA 2WMRA 4YTHA 4NWMA 5CSVA 2DS1A 4EOLA 2J50A 3BI6A 3UVQA 5A4QA 1PMUA 5E8SA 5E4HA 3ZSGA 4XP2A 5E7RA 3KQ7A 4YLLA 3A60A 2ERKA 2NRYA 2XKFA 3NPCA 4FT9A 5AV3A 3MB7A 4QT1A 3NUNA 5HTCA 1WVWA 2UW0A 1XH6A 5H8EA 2PVNA 2Y8OA 3HLLA 3NS9A 5FGKA 2RSVA 3HEGA 2EVAA 1NA7A 3D9VA 5F1ZA 3TV4A 4KBCA 1REKA 4AZSA 2NP8A 3NW6A 4S30A 3EQBA 4KRDA 2PZ5A 3PVBA 4G3DA 4YJRA 3MESA 4OTFA 4NCTA 2G01A 3LXKA 4QP6A 3TTIA 4O22A 4FEXA 3DS6A 4RLKA 4ZS4A 4FSRA 5AM7A 3MPAA 5AX9A 2QD9A 3Q9ZA 4LV5A 4FTRA 1B39A 3QUDA 4Y8DA 4N6YA 3MH1A 4X2GA 4W4WA 5E1SA 4BTFA 4D28A 4EH4A 2ETRA 5DVRA 4I6QA 3PJ1A 4HYHA 3QC9A 3H0YA 2ZJWA 3PPKA 5B2KA 4JIAA 5LMAA 4O0YA 3IW8A 4FZFB 4FICA 4ZTNA 4FKGA 2QOIA 4I24A 4B8LA 5HO6A 3UIBA 5ICPA 5CSXA 5J5SA 1Q8UA 4G3GA 4M15A 5IQCA 1OL1A 1QPJA 2O64A 2R4BA 3FMLA 3MY1A 5D11A 5JGDA 4F99A 2WELA 3OCTA 2JAVA 4NZWB 2VTHA 5ANOA 2YZLA 4O7RA 4D0XA 1DI8A 2XP2A 3R0TA 5DLSA 3COIA 1FVTA 2PVFA 5KO1A 2BUJA 3WYXA 4G9CA 3BBWA 1NY3A 1JQHA 5I9VA 4L7SA 4TWPA 3S00A 2OJJA 3DCVA 4BB4A 3VS4A 3EQGA 4DH7A 4ACHA 1H0WA 3C5UA 4EK5A 4GK3A 4HPUE 4X3FB 3WF5A 4AWIA 4MTAA 4QQJA 2OSCA 4MEDA 4O7VA 1RQQA 3LJ0A 3ZONA 3OT8A 4UZDA 3UNZA 1WVYA 4BICA 2FA2A 3FKOA 3DZOA 4TWCA 2YM3A 3PZHA 1JSVA 3OT3A 3WE8A 1E9HA 5FDPA 1UNHA 2JDRA 3LCOA 4FX3A 4IADA 4AGDA 2HW7A 5HZNA 5KE0A 2IZRA 4AF3A 5CALA 2VWBA 3QRUA 4NL0A 4DFYA 4HJOA 5K0XA 4PMSA 5C8NA 4QPAA 2J0JA 4U81A 1MQ4A 2GS6A 3FPMA 2YJSA 4HCVA 4NM5A 3K3IA 4DG3E 4TYHB 3MY0A 5DI1A 1H24A 3G9LX 1KE7A 3DTCA 2UW4A 3RNYA 4QMNA 3BLHA 3QWKA 5A6OA 1F0QA 4KA3A 2ZMDA 3GC9A 4ZSLA 4ZSGA 3WILA 4AT3A 3O51A 1WBSA 1ZYSA 3LJ1A 4CZUA 4ERKA 3FXXA 5ITAA 5KMNA 3IK3A 2P2IA 3RZBA 1CMKE 4ANMA 4JQEA 4J95A 4PTGA 4IH8A 3OTVA 3I5ZA 1FPUA 3L1SA 4E73A 5FTGA 4RQKA 1ZYCA 2XNEA 4RJ5A 4GIIA 3OW4A 2PMNX 5AR7A 5L6WL 3UOKA 4ZZNA 2GSFA 1K3AA 3LZBA 4K8AA 1MRUA 2HCKA 1ZMUA 2WB8A 4LRKA 4A4XA 4BGHA 4C34A 4UY9A 3AD5A 1M14A 5LVLA 1TQPA 1IAJA 4I5CA 1L8TA 3TNIA 4GJ3A 3NUUA 4AN3A 3HV4A 4I6FA 3DLZA 5CTPA 1YHWA 3HNGA 5HCXA 3NNUA 4RIXB 3QTRA 2ZV7A 4QNYA 3TNPC 5HVKA 4ZY6A 3L9NA 2HZ4A 4CMTA 5IDPA 5AIRA 2G1TA 3FZOA 5DH3A 1Z5MA 4Y83A 4P2KA 4QTEA 2GNFA 3TEIA 1J1BA 5J8IA 2RFNA 2FSOX 5ETFA 4P7EA 4UMPA 3R1QA 3ZC6A 5E8TA 3DNEA 2J0MB 2G2HA 1OL7A 3KMUA 4L3JA 4HZRA 4L46A 1KOAA 4G2FA 3MVLA 1LPUA 1ZLTA 4JG8A 4FT3A 4J1RA 2NPQA 4YHFA 1YXUA 3MH3A 4V0GA 5IA1A 3QQLA 3VWAA 4CFVA 5L8JA 4K1BA 3MA6A 3CPBA 2X8IA 2EB2A 3P78A 2DWBA 2Y6OA 3ZFMA 4DLJA 2PU8A 1R0EA 3EN7A 5GIOE 3EN6A 1MUOA 3Q5IA 2C6DA 3HUBA 5EM5A 4D2PA 2VUWA 3PYYA 3HDNA 3W1FA 1J1CA 3RALA 2ITPA 2XK4A 4ZEGA 3R1SA 3ORXA 4DG2E 1WZYA 3CPCA 2CNVA 3ANQA 2XA4A 4BBMA 3HMMA 4BRXA 3O0GA 4F6WA 4BIDA 1O6YA 1BX6A 3L8SA 4EEVA 4QPSA 3MS9A 1I09A 5ANKA 4BBFA 5EFQA 2HOGA 3LLTA 2F2CB 3MPMA 5AA9A 3BQRA 4L45A 1M2RA 2XKCA 4AGWA 3QQFA 2E9UA 4QOXA 2QOHA 5IZFA 2CKQA 3T9TA 4NTTA 4DAWA 5AR8A 4O0XA 4J71A 4LUEA 4PV0A 4FEVA 3GFWA 4RIYB 3OW3A 5FRIA 2X9FA 5L2SA 3Q5ZA 5HE3A 3BU3A 3T8OA 4IAAA 4RSSA 2CCIA 4UYAA 4DFNA 3M1SA 4G6LA 3ORZA 1O9UA 5I9XA 2GNLA 4RWJA 3SG9A 5EH0A 3BE9A 4FUXA 3DT1A 2IZSA 3W2QA 3WARA 2EB3A 3Q96A 4RPVA 5IQBA 1WFCA 3UP7A 1M7QA 3VBTA 4PDPA 4EOPA 4DCAA 3RM6A 3FC1X 2FYSA 5CS6A 4PX6A 4YO6A 5C8MA 3QX4A 3VN9A 4CQEA 1JWHA 3LHJA 2QOFA 2CLQA 2AC3A 2WEVA 2J0IA 1YXTA 2XIKA 3QLFA 4I41A 4GCJA 1JKSA 4LMNA 4DH8A 2UZVA 4IB0A 1R3CA 1OMWA 4O82A 2R3PA 3QD2B 4C4EA 2XBAA 3GU5A 3QHRA 3NZ0A 4X6QC 4EHGA 3BX5A 3WYYA 2PVYA 4FGRA 4RJ7A 2VNWA 3R73A 4L43A 4YJPA 5J87A 3ZLXA 1B38A 5TT7A 2GQSA 1Y57A 4YSMA 3HUCA 2ITQA 3CKXA 1GZOA 4AFJA 1ATPE 3WF9A 4FSYA 3REPA 4OLIA 3VW6A 2J90A 3P4KA 2H9VA 4DFLA 4Y5HA 4JNWA 5IA2A 2X4ZA 2XM9A 5JEBA 3VQHA 4QPMA 2BAKA 1PXKA 2YM7A 2VTTA 4JQ8A 2WIHA 4JLCA 1SM2A 4IE9A 4WIHA 3ODYX 4KKEA 3QZHA 5GZAA 2WTWA 2W1EA 3G0FA 1JLUE 4FIHA 4KS8A 4I4EA 3QBNA 4AT4A 3OCBA 4RRVA 4U40A 4TZRA 3A61A 2XK3A 3R30A 3GUBA 3TV7A 3KU2A 2PMIA 4GVJA 2BIKB 2J4ZA 1ZRZA 4FTKA 1IRKA 4BDKA 4H1MA 2UZNA
chains in the Genus database with same CATH superfamily
3WF8A 4K6ZA 4USFA 2C6MA 3QKLA 2I0HA 4V05A 4R1YA 3Q4TA 5FXSA 4AN2A 5GIPE 1SVHA 2XH5A 3AMYA 3ZHPC 1UU3A 4FV6A 1GJOA 1GZNA 5EDPA 1CTPE 1PXOA 4R1VA 4LM5A 4QMVA 2BALA 2XNNA 4TRLA 4L8MA 3FXWA 4W8EA 1G5SA 3MVJA 3GEQA 3BZ3A 1K9AA 5EI8A 1ND4A 4D2TA 4G3CA 4DHZA 4Z16A 5LVPA 5ETIA 1KV2A 4NT4A 4IAIA 1U46A 5AV1A 2GPHA 4C58A 3ENHA 2OF2A 4DBXA 4KUJA 2E9OA 5JFWA 3KMWA 4UMTA 5CI7A 3R7IA 1ZZLA 5IQFA 3MA3A 3GQLA 4IHPA 4XOZA 4FKUA 2OW3A 3HL7A 4CD0A 1YDSE 3W2PA 3QHWA 4RJ3A 3HMPA 1YOMA 4O7LA 1GAGA 5C03A 4O81A 2VRXA 4RMZA 2QKWB 3SA0A 4YTIA 4IFGA 5IPJA 3FLSA 4N4SA 5DWRA 2X6EA 4P4CA 2VX1A 4AG8A 3TKUA 4D1ZA 1VYZA 4G3EA 2VTAA 5C27A 1MQBA 2CKOA 3C4EA 3A2CA 3LM0A 4A9UA 2ZYBA 4UXQA 4F65A 4R7BA 5L6OA 3IW4A 3LFDA 3W0PA 3VJOA 5AUZA 4Y72A 3OY1A 3UC4A 3RWQA 1H1SA 3UZRA 4QYGA 4MD8E 5HBHA 2GDOA 4PTEA 3GU7A 4Q9SA 1JSTA 4FKJA 4UZHA 3T9IA 5M06A 3C4ZA 2UVZA 4PP7A 4C02A 4PMPA 5LWNA 2HWPA 3BLRA 2X8DA 4WG4A 2IW9A 4TKSA 5CF5A 1W82A 5CZHA 3NYOA 5DT3A 4ACMA 4LRMA 2RKUA 4KWPA 3LFFA 4RVLA 4LOQA 4QEBA 4CCUA 3GCPA 3S3IA 4XG6A 2CKEA 3UPXA 2ZAZA 3IDCA 1PJKA 5FUTA 4EOOA 4TWOA 2Z7SA 3UYTA 5DG5A 5C26A 1B6CB 2C3KA 4GFGA 4WNOA 4RX5A 4EC9A 2B4SB 2RG5A 3UG1A 5HE1A 3NAXA 1UVRA 2BZHB 2P33A 3FAAA 1NVSA 2Y4PA 3HV6A 4HYSA 4N6ZA 1PMNA 3NW7A 3DXPA 2XZSA 4S31A 4UWYA 5ETAA 3PP0A 5LQFA 4IACA 5CAUA 4I0RA 3HV7A 4HOKA 2WMSA 1R0PA 2XK8A 4X2FA 3HP5A 3CQUA 3D94A 4CFWA 2F7EE 2OIBA 4GEOA 3DK3A 2RFSA 4KIKB 3RPVA 3MTLA 5BMMA 2ITVA 3EQHA 1VEBA 3O8PA 3PUPA 4HYIA 5DR6A 1OVEA 1RE8A 3W55A 4PPCA 4AOJA 2R7IA 5IEVA 3SRVA 2WQMA 3PSCA 2R9SA 4XH6A 2W5AA 2FSMX 3O96A 3E62A 4ACCA 3GC0A 4I20A 1JKLA 2JDTA 4M84A 4MHAA 3G51A 2VGPA 4ARKA 4JR3A 2JKOA 2QI8A 3QXPA 4GYGA 3H10A 3Q52A 2YCSA 4L53A 3ID6C 1CKIA 3SDJA 4BDIA 1Z9XA 3BEGA 2XK6A 3C4WA 3H9RA 4BBEA 4A9SA 4EK8A 2B1PA 4NM0A 2OXDA 3LOKA 3R6XA 4NJDA 3VUKA 1M7NA 3TNHA 1TQIA 2W4OA 5KMKA 3OXZA 1PXMA 3DAKA 3MH2A 4BDBA 3EL8A 3RGFA 2BMCA 5HE2A 2IPXA 3VW8A 2WTJA 4FZ6A 3H30A 4CNHA 4FYOA 1Q5KA 2C68A 3G0EA 3SG8A 3N9XA 2YM8A 2QO9A 3V5JA 3EL7A 1Y6AA 2BRNA 2CSNA 4JG6A 5FLFA 3LFBA 3RHKA 3W8LA 2I0VA 3A8XA 3IO7A 3TYKA 4D5KA 3LJ2A 4TNBA 2IF8A 2BKZA 3II5A 4NIFB 5DGZA 4J52A 3VUTA 3GXLA 5KMLA 4HYUA 3BL9A 1W2DA 1ZOHA 2OFUA 1OIQA 3C51A 5EHOA 2IW6A 4F08A 4YURA 2VWIA 4O4EA 5DEYA 2EXEA 3W8QA 4DITA 4E7WA 3BYMA 4ZLOA 1JAMA 5AR4A 4BCFA 1NW1A 4XJ0A 4FG9A 2UZTA 5HESA 4CYIA 5AM6A 4BCOA 4UMUA 3QZFA 1A06A 2OK1A 2C3LA 4EHVA 3QWJA 3ROCA 4FL2A 3VS5A 5HTBA 1OITA 4QTCA 3LIJA 4X3FC 4DTBA 4F1MA 5KX8A 4L52A 1DI9A 3Q04A 3A4OX 4YZ9A 3UZTA 3WZJA 4X3JA 3N4UA 3QRIA 3POOA 4M97A 3LXLA 4QYFA 1H08A 2HWOA 3MY5A 2CGXA 2FUMA 2ZB1A 1V0BA 2ITTA 4EK3A 2YDJA 2CMWA 4O7SA 4DGNA 5KMIA 5F4NA 1HCLA 4EH5A 3PJCA 4YLJA 3FHIA 3PA3A 2RIOA 3AC4A 4AW1A 5IG1A 2P0CA 4BDCA 4ITJA 3QTSA 1Q61A 5HO8A 4JS8A 3RVGA 4EBWA 1SNUA 2G15A 1H26A 3NVKI 2X6DA 2ZDTA 4FZ7A 4AZWA 2BRGA 2ZV9A 1Q8YA 2C30A 3OHTA 3QTWA 4FKTA 4RX7A 4EWHA 1UKHA 3AMAA 1H1PA 2G9XA 4IB1A 4FV3A 4F9AA 2B53A 2W5HA 3LPBA 2W06A 4OTWA 3PY1A 4YBKA 3V6SA 4X7QA 4EJNA 1MRVA 4E4XA 2YEXA 3UBDA 4BIEA 3GCQA 3UP2A 3LVPA 4Z3VA 3DOGA 1TVOA 4LI5A 3TG1A 4G6NA 2O3PA 2IW8A 1GNGA 1YW2A 3CGFA 4L3PA 3W2OA 5FBOA 3NVMB 4GIHA 2J6MA 2XNOA 4FZDB 3SXRA 4BDEA 4O0UA 5KMOA 4O7TA 4RWIA 4WNKA 3WZUA 4O1PA 4A4OA 4CZYB 4I6HA 5L8KA 3Q2JA 3F5PA 4FI1A 2HZ0A 4FVPA 2VTLA 3OWJA 4O6EA 4Y5QA 4EKLA 4CKJA 4FT5A 2V5QA 3KN5A 1M52A 3NYVA 5FBNC 1J7IA 3KCFA 3OBJA 3DQXA 2GNIA 1UNGA 2XYNA 3DB8A 4FE2A 3ALNA 5CWZA 3JYAA 3C4XA 4HVIA 3QTXA 4CT1A 4QP9A 4EH2A 5K4IA 2Z2WA 4OAUC 4DN5A 3QTZA 1YHSA 3AT2A 4I5MA 4I0SA 3CTQA 5FTOA 4IAFA 3PA5A 3AQVA 5CANA 2VX3A 4BCIA 4M14A 2ERZE 3L8VA 3EQFA 5M4CA 3IGOA 2KTYA 4MBIA 4GT5A 4EBVA 5CYIA 4JBQA 1HCKA 4MF1A 3D5VA 5H2UA 2XALA 4RX8A 3R8LA 2OKRA 4G1WA 4O4DA 4F64A 2ETMA 2YDKA 3R9DA 3QA8A 1HOWA 2ITUA 2W99B 2Y0AA 4BCKA 4O0VA 4II5A 4O2PA 5A4TA 3LQ3A 2IVSA 4CT2A 1NVRA 5JFVA 3EQDA 2C0IA 4WHZA 1G3NA 3UC3A 3F7WA 1Q8ZA 3KKVA 3C0IA 3GT8A 4DF3A 3TKHA 4BHNA 3DY7A 2WMXA 2YAAA 5EM8A 3FLZA 4IFCA 4JL9A 4U3YA 5A14A 3OS3A 3CTJA 3FL5A 1OL2A 3P23A 5CF4A 5KKRB 1G8KA 4CLJA 4I3ZA 2PVLA 4MNFA 5FEDA 5E1EA 3TNQB 3NUAA 3PPZA 3UYSA 1WVXA 2J0LA 4HGTA 4L42A 3R9NA 4F09A 4AT5A 4KBAA 4Z9LA 3L9PA 4O86A 4FUYA 4ZAUA 2HZNA 2XARA 3R9RA 3MJ2A 1FVRA 3FLYA 4D0WA 5BMSA 4F9YA 5M4IA 3FJQE 3IW6A 3B2WA 3IGGA 3ELJA 3Q60A 4U3ZA 3ZSIA 3LFQA 3HX4A 3EFJA 3I6UA 3CR0A 2PVHA 4BI0A 3R8UA 3AD6A 4U9AA 2H8HA 2R3OA 3EOCA 2X7FA 4O21A 5DT0A 3OWPA 1LEWA 3DPKA 3TDVA 4FSZA 4KBKA 4XG9A 5IQDA 2QU5A 4MXZA 2C6OA 2VNYA 5EHYA 4ZSJA 3RCJA 3MSSA 1XJDA 3VRYA 4AW0A 5BNJA 3D14A 3NMUF 3AKJA 5G6VA 3G6HA 2W1ZA 3RPYA 3LAUA 3KFAA 5LOHA 4RLLA 3HMIA 2QLUA 4XG2A 4DFZE 4ENXA 3COHA 4O7ZA 4DE4A 3Q9XA 4XP3A 3D15A 1R1WA 4PL3A 5HG7A 3SV0A 5DR2A 2WQNA 4JDKA 3RAKA 1P2AA 3NEWA 3FDNA 3W2RA 3QU0A 1S9JA 3CIKA 5M55A 3W2SA 3O7LB 2YCQA 2UW6A 2VD5A 3E8DA 4OTQA 3VBWA 2QKRA 3GB2A 4ZOGA 5EOBA 3ZC5A 4BZNA 5HCYA 5AMNA 5CU6A 4HNFA 4QMPA 4EQMA 2FH9A 4TXCA 4GFMA 3SD0A 4RWKA 3F6XA 4BFMA 2C4GA 2VWUA 2WQOA 3AG9A 4YLKA 5KZIA 2ITNA 3PG3A 4ANSA 4BTKA 4EONA 5AAFA 4OT6A 2CNQA 2WHBA 3KXXA 4E8AA 5KBQA 4C38A 2C6TA 3R04A 3BELA 4U7ZA 4BKJA 3R1NA 3SHEA 4C4GA 4TL0A 4DCEA 3KY2A 2CHLA 2YM4A 4EL9A 5M09A 1PMVA 2YFXA 4IWQA 5I9WA 5E92A 2VTSA 3VHKA 3BRBA 4D5HA 4G5JA 3CEKA 3Q4ZA 1UV5A 2PZIA 4FIGA 5CEQA 5JFSA 2BVAA 2ZV2A 1OUYA 3L8PA 5HHWA 1XH9A 5CNOA 1M2PA 4YHJA 1BL7A 4E20A 2FSLX 5GHVA 4E26A 3FMJA 3WZKA 1T45A 3F88A 1WBWA 4MNEB 1KWPA 3GOKA 5EW9A 3RINA 3BE2A 3PUFC 4FNXA 4FBXA 4FTUA 5KCVA 3EHAA 3QLGA 2F57A 3CKWA 2C6KA 2GNGA 3CTHA 3PVUA 3Q9YA 4WUNA 3TUBA 4XS2A 4FV4A 2PMLX 4RJ8A 3COMA 4RX9A 3HVCA 2Q0BA 4QP3A 5HE0A 4D9TA 2J0KA 4DFUA 4NTSA 2C69A 3FXZA 2IVUA 4DGOA 4DEIA 2PE2A 3EZRA 3VUMA 3PZEA 5JN2A 3BHVA 3VRZA 3KCKA 2W7XA 3VS0A 4MVFA 4BZOA 3K5VA 3A7HA 4R7HA 4BWPA 4F4PA 1Q99A 3NFFB 5IKWA 2F7ZE 4RFZA 3OCSA 3VBVA 3UPZA 1XH7A 3UVRA 3ITZA 1YWVA 3R7OA 3TKIA 2X39A 5B2LA 5LMBA 4FK3A 4QP4A 3ZLSA 3VO3A 2ZFYA 4YZBA 3OFMA 4BDAA 2BZKB 4K18A 4R3RA 1WBVA 3WF6A 3O2MA 4W9WA 1P4OA 3ZZEA 4CGAA 3ZTXA 5IH6A 2QODA 2XIYA 4FTNA 2CCHA 3MI9A 1W83A 2OF4A 3IW5A 3QYWA 3D7TB 3NW5A 3H0ZA 2GU8A 2UZWE 3HA8A 4UWBA 3LLAA 1GOLA 3FI4A 4AZEA 4XG3A 2ZM1A 3NGAA 5EG3A 3VBXA 3WIKA 3PJ3A 2O5KA 3IS5A 3FI3A 5AUXA 1JVPP 2GHMA 1Y6BA 2WMWA 3BHUA 5CF6A 3RPOA 3UJGA 4E93A 2VWVA 3DA6A 3UZPA 1OM1A 2E9PA 3OEFX 3TZ7A 4OBPA 2YWVA 3R71A 4W9XA 2GTNA 5E8XA 2PE1A 3MH0A 3W33A 4C4JA 4YC6A 3LMIA 4MUQA 1YWRA 1JPAA 3DKGA 4F1OA 5A4EA 4D55A 2WMQA 4EHEA 2BTSA 3QQHA 4WBBB 2XNPA 1W98A 3NFGB 1R39A 4MH7A 3RPSA 3U4WA 4E5WA 3IONA 4WBOA 2F4JA 3ZDIA 5EQPA 4CVAA 3BGZA 4KKHA 5CX9A 2OICA 5BVWA 3OWKA 1XBAA 4I21A 3C9WA 4AZFA 5JRQA 3DDQA 5EK7A 3FMDA 4LYNA 4Q5HA 4C3PA 4EOJA 2J2IB 4CKIA 3R2YA 5HQ0A 5JQ5A 4D1XA 3Q2MA 3V8WA 3KMMA 4PPBA 1VR2A 4RIWA 4IWOA 4V04A 5CAOA 3P7AA 4IDTA 2BHEA 4IANA 3PXQA 5IISA 5M44A 5LMKA 2PSQA 4BY9E 2XB7A 5M56A 4NFMA 5CEMA 3PJ8A 3C5IA 1OECA 2BZIB 2C1BA 1IAHA 4FSUA 4I0TA 2EUFB 2VTRA 4GVAA 5F20A 3QC4A 2X0QA 3VULA 4FT0A 3VS6A 4BJJB 3LFSA 4K9YA 3VUIA 3UQCA 3GI3A 4CFXA 2JIVA 4CV9A 4WG3A 4GFOA 2B9IA 5BVNA 4D58A 3FLWA 3H9FA 4WSYA 4ASEA 3P79A 5GJFA 5H8GA 5HBJA 2ZV8A 4IAZA 4V01A 4S34A 2WD1A 3KULA 5BVKA 2AYPA 4N57A 3DJ5A 2W1GA 3I5NA 3N51A 4PP9A 3ZEWA 4FL1A 1TZDA 5GJGA 3LM5A 4JJRA 4CG8A 4HGLA 5J7BA 4FA2A 2BDWA 3FE3A 3BV2A 5E8YA 3QD3A 3AD4A 3EQPA 4IXPA 4GT4A 3PSDA 4U8ZA 5M4FA 3FZRA 3RBWA 2R3KA 3TUDA 3QXOA 1WCCA 2VZ6A 3BYVA 5B0XA 1OPKA 1DAYA 1YXVA 4APCA 4Q2AA 2R3NA 1LP4A 2R2PA 2UW8A 4NKAA 2JDOA 4PMMA 2BRBA 2UZDA 4RJ6A 4FVQA 5CU4A 5T68A 1KV1A 4FKLA 2PY3A 4AA5A 1UA2A 3FMHA 1W0XC 4WNPA 1Q4LA 3V8TA 2W1HA 3FUPA 4UBAA 4XHKB 3F3TA 4L44A 4EK4A 5CEPA 2WO6A 1FQ1B 3FSKA 4QD6A 4EOSA 5L4QA 3E87A 2AUHA 3ENMA 5L2IA 2XJ2A 2PPQA 3OXIA 4L68A 3RK5A 4FG8A 4M69A 3T3VA 4FV9A 5A4CA 3I4BA 4IVDA 4LRJA 5CT0A 3DNDA 4BC6A 4NK9A 3WZEA 4RC4A 4M0YA 3E93A 1U5QA 5EHLA 3UNJA 1ZXEA 3NCZA 4MX9A 5HGIA 2QR7A 3GENA 2VTMA 1KE5A 2Y7JA 4FG7A 2VO0A 3D83A 3KGAA 3TACA 4JXFA 4JMQA 2C5YA 5DE2A 3R21A 3EFKA 3KK8A 1IA8A 5CSHA 3VS3A 4EI4A 5HNIX 4D9UA 1Y8YA 4JX7A 3BU6A 3BPRA 4UMQA 3V51A 3ORPA 4K77A 3NR9A 3VF9A 4A4LA 3LKMA 3PE2A 2XUUA 3TT0A 4QNAA 5CT7A 3DK7A 3O23A 5BUJA 2W4JA 3R02A 2X0PA 1Q8TA 3GU6A 3UOLA 5BYZA 1U54A 3D2KA 1BUHA 3PRIA 1YOLA 4KKGA 2VWWA 1SZMA 3U8WA 4JVGA 4TN6A 2BILB 3S1HA 3LFAA 2BZJA 3ZBXA 4FEQA 4FL3A 1W8CA 3RK9A 4UB7A 2VWXA 2FSTX 4W4YA 5LCKA 5K4JA 5E9EA 3RCDA 1VZOA 3ZRLA 4W8DA 4YBJA 5EOLA 4AGCA 4GK2A 4FOBA 4YJNA 5AJQA 2UW9A 4DH3A 2DQ7X 5HO7A 3CS9A 2IEWA 3FY0A 4BYIA 4FSTA 2UZOA 3ZZWA 3ET7A 2YCRA 2YIRA 4MXCA 5AP4A 3FPQA 1Q41A 3SKCA 3LW0A 4AACA 2OG8A 1L3RE 2IJMA 2JC6A 4PRJA 5CSPA 3DAEA 2YLFA 3M11A 5KMJA 2O65A 3NNWA 2OIQA 3TZMA 4JBOA 5LXMA 4ERWA 3QGYA 4LL5A 5D7AA 4YGAA 2PZRA 5EKOA 2CJMA 4G16A 4YMJA 3UE4A 5EKNA 2OXYA 3FWQA 4KNBA 4MQ2A 3RAWA 3HRBA 3F2RA 4BDFA 4BTMA 2VAGA 2WTKB 1I44A 3PLSA 2BAJA 2CN5A 3AT3A 3A99A 5ACKA 3TM0A 3NYXA 5KZ0A 4FV8A 2V0DA 5JK3A 1Q62A 4M8TA 5CVGA 2Z7QA 3EYGA 1DS5A 3U9CA 4QMUA 4UV0A 2B7AA 1PXIA 5HOAA 4QMQA 5J95A 1JKTA 4XP0A 5HG8A 3PY0A 5AAEA 3UGCA 3D4QA 3TJDA 3EQCA 3R7EA 4AGUA 4YO4A 2JFMA 4QMOA 5KKRC 2BROA 3UIUA 1QL6A 5ANIA 2Z7RA 2ZDUA 3QKMA 4RJ4A 4YC3A 3IDPA 4G34A 3HDMA 4BCMA 4KIPA 3KRJA 4EKKA 3NYNA 3A7JA 3PP1A 4XNEA 4OBOA 4CFUA 5LWMA 3LCDA 4CG9A 4AW2A 4JBVA 4D4RA 4C2WA 2DYLA 3PXYA 1OKZA 2RL5A 3LXPA 4NUSA 2GQRA 3SX9A 3CLYA 4U97A 5JT2A 2QONA 3CD8A 4NKSA 1KSWA 4C35A 4FV7A 5F9EA 2VTNA 2QHMA 4JX3A 5CY3A 4QDEA 5EQEA 1GY3A 4LDTA 3B2TA 3ATSA 3DBDA 1O6LA 5BVFA 2WIPA 3HYHA 4DDGA 5AP6A 3R8VA 3FC2A 3EQIA 5BQ0A 3QF9A 1JBPE 3KXNA 3GCSA 3ZO4A 5HD4A 5LCJA 4O7NA 5FDXA 2C5OA 2WTDA 4C8BA 4FTQA 4YZMA 4LV7A 3ZDUA 2OZAA 2BCJA 5M53A 4Q9ZA 5AP5A 3DGKA 3C4FA 2RFEA 3PPJA 4F0FA 4GG7A 5C1QB 4MBLA 4EH7A 4EJ7A 4NEUA 2VTIA 4GT3A 2H96A 1W2FA 2Z60A 3W0MA 4U42A 3TV6A 2B0QA 2UZBA 2X2MA 3CY3A 5HKMA 4U44A 4G31A 3BYOA 5I3OA 1LR4A 4FMQA 3MDYA 4EH8A 4ZY5A 1UWHA 3T3UA 3SVVA 2WU6A 5E8WA 2YABA 2JKQA 4QO9A 4GL9A 4ZXTA 4QTAA 3F5UA 4TYHA 3HP2A 3TCPA 2WNTA 4I23A 3VJNA 1XH5A 3V5QA 2F49A 4UMRA 3FMEA 4NFNA 3V6RA 3MFRA 2IG7A 4YJVA 5HD7A 3RWPA 3VUGA 4JBPA 4PQNA 3ZCLA 4U45A 4BDDA 4AUAA 5HG9A 1YRPA 2PK9A 1OZ1A 4KRCA 4O1OA 4XCUA 2R3QA 1PYEA 5TO8A 3TN8A 5IA5A 4ZTSA 4D2RA 5CEKA 4XRLA 1PRYA 2IVVA 4J99A 4IVAA 5J1VA 4Z7HA 5ANDA 2GHLA 4XYFA 3ZM9A 2W9ZB 2C0OA 2HZIA 1LEZA 3R28A 2HYYA 3DFAA 4JDHA 4JRVA 1OKWA 5EW8A 3R7YA 1BKXA 2UVYA 3DV3A 3SOAA 3ZOSA 3G15A 4BIBA 1V0PA 1OL5A 3DLSA 4JDIA 4XX9A 2A1AB 5HNBA 2X7GA 3JXWA 4O0WA 3EWHA 2LGCA 4N70A 4F7JA 2OO8X 2QOQA 3EN9A 3FKNA 4OBQA 5D9HA 5ACBC 4AZTA 5L2TA 3JR1A 4R6VA 3PA4A 4H36A 3W16A 4DDIA 5FM2A 3U4UA 3BWFA 4TT7A 4IX6A 3F82A 1Q8WA 3D5UA 5ETCA 3W18A 4FTJA 2R7BA 4KAOA 3PXFA 4LV8A 1QPCA 3DFCB 4WRGA 4C0TA 1H28A 4XUFA 3TTJA 3PTGA 1SNXA 4R77A 3VONA 2C5XA 3A7FA 5M07A 4FRFA 4XEYA 3AC2A 4BKZA 5DBXA 4F9CA 1GZKA 1YDTE 3WF7A 1OIYA 2BDJA 3V3VA 3R9OA 2QQ7A 4YPDA 3TUCA 4UXLA 2P4IA 3QCQA 1T46A 5CNNA 3DBCA 3W10A 3QD4A 3E8EA 5E91A 2WMVA 4PF4A 3NNVA 4RBLA 5AUWA 4YTFA 4L3LA 1WBPA 2JKKA 4MXXA 3DK6A 1J3HA 5EDQA 5CENA 3F3UA 4R7IA 2QOLA 3PWYA 4AOIA 4HZSA 5JQ8A 2J5FA 5TF9A 4CMUA 1XBCA 2QC6A 4O0TA 4F7SA 5AIKA 3EIDA 4YJUA 3AT4A 3NUXA 4RC3A 3FZSA 1FOTA 5HTIA 2YIXA 2WQBA 4GS6A 5LVNA 2PMOX 3OUNB 4GW8A 3TZ8A 4IBMA 4J7BA 4AOTA 2RFDA 2J9MA 3OY3A 4FKOA 4I1ZA 3GNIB 2EU9A 5DHJA 5KBRA 2GTMA 4FR4A 2BPMA 4FKWA 5LMKC 4K0YA 3E8CA 2ONLA 5AP1A 5E8UA 4AQKA 4CQGA 4L9IA 3IOKA 4BCJA 4FSWA 4H3QA 2JAMA 2XK7A 4YPSA 4E6CA 2B9HA 1UWJA 1XO2B 3I60A 3FSFA 4FGBA 3R01A 2YA9A 4OT5A 3FQSA 4RIYA 1BMKA 1OPLA 1DM2A 3DBEA 4JI9A 4RFYA 4BGQA 4M66A 5DEWA 3BL7A 1KE6A 3ZH8A 3CD3A 3D7ZA 4FNZA 3MFTA 4IW0A 3M2WA 3K54A 3FLQA 3UDSA 4GYIA 4CTCA 4DINA 4C59A 4QP2A 5AADA 3O8UA 3IW7A 5LJJA 4UEUA 5J7HA 3FI2A 4OW8A 5EYMA 4B6LA 5M57A 1REJA 2Z7LA 5DRBA 3HRCA 3TMOA 2OFVA 3P86A 5DNRA 4AU8A 4DC2A 5FM3A 3QRKA 1FGKA 3QAME 2Z02A 4U79A 2R3LA 4GUBA 4C7TA 4F9BA 4FEUA 3TDWA 1S9IA 2A98A 4DT8A 5JKGA 4FIFA 4KSPA 4TYGA 4D2VA 4MXAA 3U9NA 5I9ZA 1YI3A 3GC7A 4CTBA 5K0KA 3WIGA 5IH4A 3S0OA 4IC8A 4WA9A 2I0YA 3EN4A 2PULA 3MVMA 2HXQA 2ITYA 3R1YA 4M12A 3EKNA 1H0VA 2RG6A 3PIYA 5AUVA 3RJCA 4ZTLA 2QCSA 1G8AA 4D1SA 3O17A 4XV1A 3U87A 4QMXA 4IVCA 4RZWA 1XWSA 4JR7A 3QRJA 4WT6A 3PLAE 3K3JA 3ZO3A 1PKGA 4DEGA 3E7VA 5CU2A 5DYJA 4AXDA 4E4LA 3I0OA 1BL6A 3E88A 4ID7A 4MD7E 2ZOQA 2UW7A 2QLQA 1IEPA 4PY1A 5DFPA 3RP9A 4GKIA 4F6UA 2QO2A 4U41A 5AP3A 3K2LA 3RAIA 3S95A 3D0EA 4LUDA 4ZP5A 4E5AX 2XANA 3QL8A 2IZUA 2XVDA 3E3BX 1VJYA 1ZYDA 1OIUA 4AXFA 1XQZA 2AEGA 1OUKA 3U54A 2YIQA 2Y9QA 4DBNA 3C13A 2REIA 2IWIA 2R3MA 4IM0A 4QMWA 3CP9A 3JS2A 5FP6A 5AUTA 4GU9A 5EDRA 4E6QA 5AP7A 2YACA 4B7TA 3NUSA 5CEOA 3FZTA 3ZEPA 1XMLA 1FVVA 2XEZA 1OL6A 2PVMA 4EYJA 2V55A 1Q3WA 5HU9A 4PWNA 4YHTA 2WQEA 4R8QA 3UDBA 5JSMA 3UDZA 4FKIA 4D2WA 3KL8A 3O7LD 3UOHA 3LCTA 4O38A 3L9MA 3ODZX 3OC1A 4IEBA 2YLEA 3DXNA 5I4NA 1O6KA 5AR5A 4BWXA 3E63A 2PHKA 5HIDA 1H4LA 4AQCA 4A9YA 2XS0A 5EW3A 2ITOA 5CU3A 2XAMA 3H3CA 3ZUTA 4OUCA 2R64A 2A2AA 3JY0A 1NXKA 4B9DA 2R3IA 3K5UA 4K2RA 2WEIA 4IJ9A 4BCHA 3FL4A 2YERA 1YOJA 1ZY4A 3GCVA 4C37A 4QRCA 4EC8A 3HAVA 2R0UA 2C6EA 2X7OA 4E4NA 2XBJA 4DTAA 1J7UA 1ZZ2A 4RZVA 4XG7A 4FIJA 4CRLA 4B0GA 3FLNC 4E4MA 4F63A 4CV8A 2XCHA 5BUEA 4YJTA 3SAYA 4NW6A 2BAQA 4RG0A 5I0BA 2XNGA 3WE4A 4LMUA 3OTUA 3MTFA 3PIXA 2UV2A 3VQUA 2XJ0A 3UO5A 5H9BA 5IMXA 4YJOA 5KHWA 2HXLA 2QO7A 4V0GB 4C4FA 1VYWA 5FTQA 4FTIA 3VNTA 3ZFXA 2W9FB 3KEXA 3PFQA 3D2IA 3SOCA 4DH5A 5LVMA 5L3AA 2B52A 2YWPA 2G2FA 3CY2A 2XNMA 5CAQA 1ZOEA 4I5HA 3BV3A 3Q6WA 4I5PA 4QP1A 5FP5A 5B7VA 4ZZOA 4MD9E 3QTIA 3MFUA 3KB7A 4IC7A 3KN6A 5EI6A 3F2AA 2UZEA 4QYYA 4NU1A 3QKKA 3FKLA 3W0RA 1CKPA 1PXNA 1AGWA 3E5AA 2V7OA 2P3GX 3QTQA 4IJPA 4TNDA 4ENYA 1ST0A 2B9FA 3CXWA 1URCA 1ZWSA 3OZ6A 3PVWA 3S2PA 1OBDA 2R5TA 2QURA 4QP8A 4FK6A 4FSMA 4GMYA 3Q32A 3HAMA 5IQGA 4TW9A