2JD5A

Sky1p bound to npl3p-derived substrate peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
353
Chain Sequence
FHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE SKY1
publication title The Rgg Domain of Npl3P Recruits Sky1P Through Docking Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 102
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jd5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jd5A01
3TNQB 4I22A 2GFCA 2UZBA 4FTJA 4KRCA 1GJOA 2LGCA 1OPJA 2YCSA 5DT0A 3U4WA 3UOKA 2JKQA 2YDIA 3OT8A 1IR3A 4W8DA 3LFNA 4KKGA 4XX9A 5HBEA 5KO1A 3M42A 3PWDA 3F2RA 1QPDA 4D9TA 3C13A 5CANA 4LL0A 4N70A 4MD7E 3TEIA 2IW8A 3CPCA 4QP7A 5CVFA 2YISA 2IZSA 3VBQA 4D9UA 4O2ZA 3TKHA 1XH7A 2B0QA 4RVTA 3ORNA 3VS3A 5DPVA 2REIA 1WBVA 2YAAA 4FTCA 3ATSA 5CAPA 1YHVA 3HZTA 3TL8A 1APME 1H08A 4C34A 4FE2A 4NL0A 3FUPA 4KIOA 1KE5A 1ZZLA 4S31A 5EM6A 5FP6A 2X7OA 4IXPA 5BYLA 5ANGA 2J0LA 3KQ7A 2DYLA 3E8CA 4FG8A 3I1AA 3ZLWA 4B4LA 4E8AA 1LR4A 3QHWA 4O0XA 4X3JA 5CENA 4EOIA 3AT2A 3LJ2A 4XNEA 1WBTA 2XKCA 4DLIA 2X6EA 1OB3A 3BLRA 4IWOA 4JLCA 4D4RA 3BBTB 2BKKA 2Q83A 5M56A 1E9HA 3K5VA 4BCFA 1WBSA 2GFSA 3R8MA 3NUSA 2Q0NA 3MFTA 5A46A 2G01A 3COIA 3QXOA 5EM7A 3OY1A 4U97A 1OPKA 2I6LA 4K77A 3BWFA 4BWKA 3Q04A 4ZY6A 2XYNA 3IQ7A 5DVRA 2UW8A 2ZM1A 3BBWA 4QYHA 3HNGA 1WFCA 1UNHA 3PZHA 4M8TA 1Q8WA 3LFAA 5AV0A 4FTOA 4IEBA 3R1QA 5HNGA 4X3FB 4ZY5A 4IMYA 3DNEA 3VVHA 1Q61A 1YQJA 1YW2A 4JX7A 5HO8A 2R3KA 4CFFA 3DLZA 4FMQA 5I9XA 2X7FA 4ZK5A 4ZLYA 4FUYA 4X7QA 2WB8A 3H30A 4HGLA 4U9AA 4FKTA 4FG7A 4ZJIA 4FZ7A 4YZBA 3SX9A 1H1WA 2C4GA 4L6QA 2BRBA 2WMRA 1JKTA 3CY2A 4CQEA 4CZYB 3UZRA 1XWSA 3W2QA 5L8JA 5IA4A 2IJMA 3KA0A 3Q3BA 4L7SA 4O91A 4QO9A 3S4QA 4FZFB 4U80A 4F4PA 1WVXA 3NEWA 3OOMA 5ETIA 4S30A 2C3KA 4U42A 3UZPA 4DGMA 2XKEA 4F7LA 3HLLA 3QCSA 1OPLA 3UDBA 3CQUA 3EN5A 4FKIA 3C0HA 4C37A 3RAWA 4F6WA 4CZTA 3TACA 5M51A 1XR1A 2UZLA 2XK9A 3WARA 4MNFA 3MDYA 2VU3A 4A07A 3QUPA 4M67A 4RJ6A 5A9UA 3ZC6A 4XLVA 3QWKA 5A4LA 5EQYA 4FKQA 4FZAB 5BYZA 4I24A 4AFJA 4CV8A 4EOQA 3KFAA 2X4ZA 3UOLA 4BTJA 3QQGA 4CKRA 4KBAA 4XP3A 3DK6A 3H3CA 3EHAA 2OXXA 1LPUA 3VHKA 2ETKA 3EMGA 4MXZA 4DFXE 5IQFA 4EH8A 4QMNA 2VZ6A 2ETRA 2GNJA 2UW3A 2Y4IB 3I0QA 2UVYA 3OCBA 3P0MA 5I3OA 4IZ7A 4PMTA 2ZDUA 1IA9A 4TWNA 5HI2A 1G3NA 4S33A 4KUJA 2UW0A 4I5MA 4AN9A 2QONA 1PYXA 3ACJA 4FT7A 4QPMA 4YZDA 3HEGA 3CGFA 3DKOA 3VBYA 5EOLA 5IUIA 4H1JA 3R7YA 4QMLA 3HAMA 1H00A 3KRLA 3P78A 4RIXB 4IWPA 5LMKA 3BWJA 3CCNA 3R8LA 4BHZA 5CEPA 3UYSA 1CSNA 1OKYA 4HPTE 4YO6A 3ANQA 4FTQA 3F3VA 3SRVA 4DTKA 2R3QA 3QD2B 3FL4A 3C4XA 3UJGA 1HCLA 5K4JA 3JS2A 4AWIA 2H96A 1OL2A 4RZWA 4U45A 4C3FA 4R7BA 1YI3A 4O7ZA 5HLNA 1GOLA 3BU6A 1M7NA 4ZZNA 2OK1A 4WD5A 1YI4A 2P2IA 2EXCX 4EOMA 5H2UA 3UP2A 5DYJA 4R77A 4L68A 2BHHA 5DR2A 4EC8A 5IH4A 2ZMCA 3FLNC 5TE0A 5AR4A 4H3QA 4RVLA 3LFBA 4DINA 1QPEA 2GNIA 3DKGA 4ENYA 1UWJA 5IH5A 3KXHA 3AD5A 2ITYA 3HL7A 5IQIA 3NYVA 4EOPA 3I79A 3VJNA 2R3RA 3BHUA 2OICA 2QOBA 1WBOA 4RA5A 1JQHA 1RJBA 2VAGA 2WMWA 2H6DA 4QPAA 4FK6A 4IAIA 3BQCA 4U0IA 4M7IA 5EM8A 5AR2A 4RWIA 2E9PA 3RAHA 3POOA 3V5TA 4BBEA 4EHVA 2BROA 4LGHA 3QXPA 5IG1A 3JYAA 2XEZA 1F5QA 3H0YA 4FTNA 3ZONA 4DH8A 1YXUA 2NRUA 2YHVA 2CHLA 2IZTA 2W4KA 4M12A 5HIBA 4D5HA 3OHTA 4D2SA 1J91A 4FZDB 4MF1A 3A4OX 4AZFA 4I5CA 4PNIA 4BWXA 2G2FA 3NUUA 3TZ7A 4ZXTA 3C5IA 4ERWA 4QMPA 4J1RA 3T9TA 4O7VA 3AC8A 4GK4A 4J95A 3KK8A 3UOJA 3DV3A 5CNNA 2QG7A 3GVUA 5AAGA 3MTFA 4U8ZA 5CU4A 4DA5A 4NKSA 3QLFA 4TNDA 3C9WA 3AC2A 1H28A 4I20A 2HWPA 3PLSA 1Q8ZA 4NH1A 4S34A 3OD6X 3JXWA 2HIWA 4TWPA 1KV2A 4O38A 4DFYA 3OXTA 2A27A 4BCOA 2XNNA 3DLSA 3NUXA 3BYVA 4U79A 5IQEA 4O0WA 5E8SA 1STCE 4N6ZA 4A4LA 5CQUA 4EH4A 2R3JA 4FC0A 3P23A 4UEUA 2O64A 1UWHA 4I92A 4S2ZA 2YABA 5L8KA 5A54A 2YCRA 2UZVA 5CAOA 4OLIA 4X2KA 4FVQA 3PXYA 2P2HA 4IQ6A 4BY9E 3VC4A 2BRGA 3NNXA 3WE8A 4C4IA 1L3RE 5E92A 3F61A 4CNHA 1PHKA 5IQDA 3JPVA 3FJQE 4UWCA 3WE4A 3H0ZA 3BEAA 3CGOA 3O8TA 5E1SA 4ZTNA 5HE0A 5DEWA 1ZYCA 1OVEA 2ITXA 3P9JA 4JDHA 5IQBA 5C8KA 1U46A 4QMYA 4PF4A 3FXZA 4HCUA 4YO4A 2YLEA 4IVDA 5K0XA 4WT6A 4V01A 4NT4A 4QYEA 1JNKA 1GIJA 4FSQA 4DYMA 4TN6A 2JFLA 3IDPA 3ZBFA 4ANSA 5AEPA 4FV6A 2CCHA 4YJOA 2X8IA 4PL5A 2C3JA 2GS7A 3ORPA 5JGAA 1PY5A 4DEDA 3EKNA 1QPJA 3OVVA 5I9UA 4AZTA 3U6JA 1PKDA 4JDKA 1ZYJA 2CKEA 4U3YA 4E1ZA 5ANJA 4I0RA 3ULZA 4WOVA 3L8PA 3TV4A 3QQHA 2CLQA 3FLYA 4QD6A 5KUPA 5E8XA 1SZMA 4E4NA 2VRXA 4F1OA 5M4CA 2BDFA 1PMVA 1M2QA 1UNLA 2X0GA 2QI8A 2QR7A 2C3LA 4IC8A 1PMEA 4WSQA 4WNOA 2IVVA 2WIHA 5I9YA 2X81A 5DBXA 4JR3A 4D2WA 5HVYA 2WEIA 2W9ZB 4XG6A 3DKFA 4XP0A 2YERA 1IAHA 3D4QA 3W10A 4JXFA 4DEIA 5L6WL 4Y73A 5JH6A 2C6OA 3E7OA 4UWBA 5EW9A 4XH6A 4B8MA 3PUPA 4I3ZA 2XNMA 3L8XA 4Y83A 3UZTA 4DE4A 5JT2A 4ZY4A 4A9TA 4KBCA 4QMOA 5CYIA 4F7JA 3QTUA 3DPKA 2G1TA 4GU6A 4AGWA 1J7LA 3OF0A 3EQDA 2QOFA 4NZWB 2RG6A 4X2GA 4BC6A 4XG3A 4ANNA 4G6LA 3PJCA 3Q6WA 4FKLA 3HV7A 4LGDA 4FSRA 4FA2A 4C0TA 3ZYAA 4C8BA 3DBCA 3DDPA 2W17A 4MVFA 3TIZA 5M09A 3D0EA 2R3IA 3HRFA 3R02A 3LXPA 3MH3A 2XK7A 4KABA 2XK6A 2W99B 4ZIMA 3E5AA 4UYAA 3A7IA 4MXXA 3DOGA 3SA0A 3SHEA 2PU8A 1XO2B 4WBBB 5ETCA 4C57A 5IUGA 4YNEA 4IM0A 5HLPA 5DWRA 5ACBC 5LMBA 2HELA 4IE9A 4QP3A 5FWKK 1OIUA 4XCUA 2F7XE 4JG6A 3HMNA 1KE6A 4WO5A 4R1VA 4CT2A 1OKVA 4AW0A 2E9OA 4IDTA 4DHFA 4KBKA 2UW5A 5HBJA 1UU3A 4P4CA 1U54A 3RALA 3KXNA 5HIEA 4G16A 3R6XA 5IQCA 3E62A 3UPXA 2HWOA 3MY0A 5FDXA 4CQGA 3FHRA 2IWIA 1GNGA 3VW6A 3FYJX 4P7EA 4OGRA 3WI6A 5DA3A 3QRIA 4U3ZA 4EOSA 1ZAOA 4EK8A 3PY3A 3A7HA 5J5TA 2BUJA 2QOIA 1OZ1A 4G3EA 4MK0A 4J97A 5HG7A 3ZH8A 2X39A 4CTCA 2ONLC 5EKNA 4EUUA 4KIKB 3HUBA 4FT3A 2GDOA 4FICA 5E1EA 2ZJWA 4APPA 4EYJA 3CSVA 4IBMA 3OEFX 4TWOA 2C30A 2XIRA 3SOAA 3ZFYA 2HYYA 1YVJA 4RFMA 5J9ZA 4CFNA 5CSWA 1DI9A 4ASEA 4DFNA 2PZYA 4F1MA 4FV4A 4ANMA 1TKIA 3D7TA 3MH2A 1H1PA 2O8YA 2JFMA 2PK9A 2UZNA 3NDMA 4EQUA 3F3WA 2CKOA 3ANRA 5AMNA 3SG9A 2V22A 4OTIA 3L9MA 3Q6UA 1Q97A 3H9OA 1W98A 4J71A 3BHYA 2EXEA 3OTUA 4CFVA 4IVCA 2C1AA 3Q4TA 2C6DA 3F7ZA 3IW4A 2W5HA 1NA7A 3SRVB 5BYYA 5HG8A 4Q9SA 2VTSA 2JITA 3PG3A 4GIIA 4BI2A 5IEVA 4FVPA 3ROCA 5C27A 1WAKA 1F0QA 4ZMFA 3ZO4A 2ZOQA 4PMMA 5A6OA 3ALNA 5FEQA 3RPSA 3LCKA 3QD0A 4QYGA 2GPHA 4TY1A 5EK7A 5L2IA 4BTFA 4PPCA 5AP2A 4LMNA 4X0MA 4ANLA 4FI1A 4Q2AA 2X2LA 2OSCA 1JSTA 2WFYA 2ITQA 5D10A 2JC6A 4GKIA 3ENMA 2RFEA 4OBQA 2UVZA 3F9NA 4HNIA 5K0KA 1W82A 5KHXA 4HVIA 3QCQA 5CI6A 3W16A 1Q41A 3MVJA 3V01A 3UVQA 4ZMEA 2J2IB 5ANDA 3H4JA 3FHIA 2LAVA 3RZFA 3TM0A 3ZZWA 4FKUA 4ANBA 3R7VA 3DJ6A 3ZFXA 5HZNA 3NX8A 4BTMA 1NVSA 2ETMA 1ZMWA 4PPAA 4QP1A 4TYIA 3R9OA 4FIJA 4M97A 2F2CB 2XRWA 3SKCA 4G3DA 5TO8A 3VS2A 1MRYA 5KHWA 2YIWA 2G2HA 2ACXA 1OIYA 3GCPA 3FXWA 4WUAA 4F0GA 1KE9A 3GXLA 3G6HA 2R3LA 4PQNA 4YURA 1EH4A 4TYHB 4RQVA 2QU5A 3V5PA 5J5SA 2WU7A 1GZ8A 2WTWA 3LCOA 4MWHA 1Y6BA 3AMYA 3FBVA 2JKOA 4UMUA 1AQ1A 1Q8UA 4MQ2A 2OFVA 2R4BA 5HU9A 2C6IA 5IA1A 2VGOA 2WQNA 3QTWA 4G31A 4GV1A 3WOWA 5FD2A 4FKGA 4QNYA 5DMZA 5LWNA 3CKWA 4I93A 1A48A 2XMYA 4ITIA 3ZFMA 1J1CA 4FV7A 5CSXA 5JFXA 3IDBA 3W18A 4BBFA 4DCAA 5IQHA 3Q52A 1KWPA 3ZO2A 1GAGA 4M13A 3FI2A 4LGGA 4B99A 5C9CA 3EYGA 4CKIA 2YM6A 2OZAB 3VAPA 3IECA 4YHJA 2YDJA 3AG9A 2R5TA 4Y95A 4A4XA 3A7JA 2ZM4A 4DEHA 4RJ8A 4BDEA 4DFBA 1M2PA 4AA0A 5GZAA 3N4TA 2QURA 4GYIA 4MXOA 3TJCA 3II5A 1XH8A 3D14A 3C4CA 3OTVA 4GL9A 3SXRA 4H3PA 2I1MA 2F7EE 2YZLA 3HV6A 4F6SA 1U5RA 2YM8A 5AR5A 3BYSA 1PXOA 3MPMA 3QALE 3ZM4A 4A06A 4ACMA 5HD4A 3F2AA 2YIYA 4F9AA 2O3PA 4I0SA 3DK3A 4R3PA 5FLFA 4F9CA 4H36A 5BVFA 3EL7A 2UUEA 5LVMA 3OBJA 5EKOA 4FG9A 5A14A 2XB7A 4GK2A 2R3OA 4ZZMA 2F57A 4XUFA 4V04A 4GW8A 4QOXA 4BKZA 3CEKA 3IW5A 2P3GX 2WHBA 1MQBA 3L9LA 4MWIA 4PTGA 4BCNA 4HNFA 4PY1A 4MNEB 1K9AA 4RJ3A 3QX2A 1P14A 4BDCA 3BV3A 3PTGA 3WF9A 5HCXA 4ERKA 4X2NA 2PVFA 5F1ZA 2YLFA 3DGKA 4HCVA 3NVKI 4GKHA 5HVKA 3ORTA 4FOCA 1NY3A 2BRHA 2YM4A 3O8UA 2QQ7A 3MFSA 5IDNA 4I6FA 3AMAA 3SXFA 3UC3A 3FXXA 1Z57A 3KF4A 4F0FA 3CKXA 4AOIA 4L52A 5JZNA 3MJ1A 3F5GA 3BLHA 1TQMA 4C38A 4Y72A 3LLAA 4FT5A 1G8SA 2G2IA 3PJ2A 2JDTA 2W5AA 3FWQA 4AZEA 5CZIA 1O9UA 2PPQA 3PY0A 1U5QA 2ERKA 4IB1A 4JBOA 1ZY4A 4MXYA 5CI7A 5DR9A 3MIAA 3NSZA 2JLDA 4BGGA 1G8AA 3NYOA 4MD8E 2R0IA 4NWMA 4TXCA 1PXJA 4BHNA 1WVYA 1IAJA 4D58A 3NUAA 4YUQA 3TZMA 2VTLA 3LQ5A 3OG7A 4XOZA 4M69B 2PVKA 2FA2A 4ZTQA 4G9CA 2J51A 2W1ZA 4F63A 4NIFA 3KCKA 4I23A 3EQPA 1PXIA 1R1WA 2B4SB 2W1DA 2W4OA 3AXWA 3CP9A 3NCGA 4JDIA 3MPTA 3RPRA 4F64A 1Z9XA 4XG8A 3F6XA 4K0YA 4NTTA 2GS6A 2Z8CA 3QRKA 3EFLA 1H1RA 1UKIA 4IM3A 3MVLA 3IKAA 5DG5A 5IH6A 3JR1A 4J99A 4D55A 1I09A 1Q62A 2HZ4A 4TTHB 4FEQA 2W1IA 4PDPA 4NM0A 5DNRA 4KIPA 3D83A 4MAOA 4U6RA 3PYYA 2QLUA 5TT7A 3FDNA 2WMSA 3FZTA 4KSQA 4LUDA 1XJDA 4MX9A 3R1NA 4RLKA 2RFSA 5JFWA 3IOKA 4M3QA 5DGZA 5CU3A 5JKGA 3LXLA 3R8PA 3RCJA 4HYSA 4O7LA 2JAMA 4OTGA 5IA5A 5B0XA 3EQGA 2VTQA 4ACGA 4FKVA 4IVAA 4CFUA 4D4SA 2BKZA 2O0UA 5IA0A 4MBLA 4ACHA 4LQMA 4O0UA 4J7BA 5ICPA 4MXAA 4E4MA 1DAYA 2AC5A 2R7IA 5AP7A 3NW5A 2JKKA 4DEBA 4QTCA 5A4TA 2AUHA 4FEXA 4N57A 4RLLA 1JSVA 1SNUA 4JRNA 1P2AA 2IO6A 3EQRA 5CZHA 4DCEA 3BEGA 1YXXA 3DB6A 3QA8A 2C6KA 4LRMA 4AG8A 3DT1A 1MP8A 3LFEA 4G3GA 4MHAA 4EEVA 4QYFA 1I44A 4FL3A 4M15A 3TUBA 2XK4A 2PVRA 1OGUA 1JWHA 3ZDIA 3C1XA 4JQEA 2A1AB 4BICA 4YTCA 3LQ3A 1REJA 1RW8A 3CR0A 4AA4A 4L9IA 4ANQA 5IQAA 4TPTA 5EDRA 4PPBA 3O51A 4FUXA 4O0RA 3EZVA 4D1ZA 4IHPA 3GGFA 4GCJA 3VS7A 4OTHA 4PTCA 2CNUA 3K3IA 2BZKB 5IMXA 5AM7A 4MH7A 1TVOA 2QC6A 3G9NA 4G34A 5EOBA 3ZOSA 3W33A 5DOSA 4FKOA 2IW6A 3UIMA 3ZDUA 3IS5A 3QQKA 1H07A 1R78A 4BDDA 5AUUA 2DWBA 1FMOE 3DJ5A 4OUCA 4ALVA 4BBMA 3NAXA 5HO6A 4ACCA 4JBPA 3FI3A 3MSSA 3KL8A 2KULA 4YJTA 3EL8A 2XJ1A 3F66A 3NS9A 4IH8A 4TL0A 4DF3A 4O27B 3COHA 5HCYA 4E93A 1XH4A 4LV8A 4C58A 4M14A 5E7RA 2X2KA 2Y4PA 3EN7A 3R9HA 2AYPA 4JBQA 3LFSA 4RWLA 2OXYA 5KMLA 3NR9A 5L2WA 1FOTA 1FINA 3KULB 3E7VA 3KMWA 2ERZE 4WHZA 4RFZA 4X2FA 2HW7A 2QOCA 3DA6A 3HRCA 4BVUA 2PUNA 4DC2A 4NUSA 4N6YA 1M2RA 3KRWA 1U59A 3IGGA 1K2PA 5C8NA 4RMZA 1CKPA 3BKBA 3WYYA 2WOUA 4QMMA 3QQFA 3LFQA 1O6LA 1WBNA 2XNGA 5DEYA 5CXZA 2PE1A 3S1HA 2VWUA 4RC4A 5L8LA 3UPZA 3FZPA 2JIUA 1GY3A 3BV2A 2C0TA 1M7QA 4RBLA 4DGGA 4YTFA 3GCQA 4L3LA 2GU8A 2VUWA 1PJKA 4JR7A 3SG8A 4BR3A 4OBOA 4UV0A 4KS7A 3S95A 2BZIB 3UNZA 1CM8A 2Y9QA 3BGPA 3EYHA 3OUKA 3GC8A 3Q2MA 3Q4ZA 4JIAA 3KU2A 1AGWA 3PIZA 3R01A 5M4FA 2V55A 4QQJA 4D28A 4DH7A 2W7XA 4IZYA 3K54A 4EOLA 1HCKA 4YBKA 4B9DA 4K8AA 1H26A 4PL4A 3AD4A 4A4OA 3CJGA 3MYGA 3T3UA 4APCA 2UVXA 4CMTA 5EI2A 5GIPE 2RKUA 4FT0A 1H0VA 5LMKC 5LOHA 3L1SA 5AUWA 3V5WA 4NK9A 2BCJA 2JD5A 3VF9A 1E1XA 1OMWA 2VGPA 5L2SA 5GJFA 1Y8YA 3NPCA 2HCKA 4B0GA 3UQCA 5E4HA 4MXCA 1PW2A 2Y6OA 4LUEA 3VBWA 4XG7A 4L44A 5E8ZA 2GQGA 5CLPA 4A9SA 5CT7A 3OWKA 5AV3A 2Q0BA 3R83A 3BX5A 3UGCA 3VQUA 3NMUF 5CX9A 5CEOA 5HNBA 3RBWA 4BCJA 5I0BA 1NT2A 3OUNB 3KXXA 4ZSJA 2EUFB 2ZVAA 3ENHA 3FZOA 3P79A 3THBA 1OKWA 3E8EA 4GVJA 4UMQA 4CVAA 2JKMA 4IB0A 4OT5A 4DITA 3DXPA 2JIVA 3HV3A 5HX6A 3FMEA 3O0GA 4JVGA 2ITUA 3R1SA 4CRSA 4QTEA 5J87A 3A2CA 2QO7A 1KUTA 4DT8A 4F7NA 4DGLC 2YM5A 4BDBA 4J98A 3A62A 3TTIA 4IWQA 1OL5A 3MIYA 4U81A 3ZBXA 5LXMA 4DTBA 4AF3A 3QZHA 5EFQA 2YIQA 4KNBA 2O2UA 2C0OA 3COMA 3A4PA 5DIAA 4O0VA 2PZPA 3GUBA 4DEAA 4YLLA 4RIOA 2B54A 3G0FA 3ZRLA 4BGQA 3AC1A 2CKPA 5M57A 5BVEA 2F7ZE 1ZWSA 3NNWA 5GHVA 4BZDA 1YDTE 4TT7A 5AUXA 4AACA 5LVOA 3LMHA 2BAJA 2Z7SA 3OP5A 4OTDA 2QG5A 5GJGA 4CD0A 4BGHA 5JSMA 1PF8A 2R3NA 2Z7QA 3V8SA 4JAIA 5T68A 2C1BA 5LCKA 3VUKA 4EKKA 3VJOA 5FBOA 5IKWA 2H9VA 3DBDA 1RDQE 3MV5A 1PMUA 2WQBA 5DT4A 3HUCA 2FB8A 4RSSA 4DGNA 2PMOX 3GU6A 4GYGA 2PYWA 2ITWA 4R1YA 2QKWB 2WMUA 3LM5A 3PA4A 4H58A 1FVVA 2HK5A 3HA8A 4XEYA 3FMDA 4BL1A 2ITPA 3PSCA 3DXNA 1XH9A 3UNKA 3NRMA 4FX3A 3QC4A 3SV0A 4PDSA 1MRUA 2VO0A 3OT3A 3I60A 1PXMA 3UMXA 5HOAA 2JDVA 3NUPA 2FUMA 4NJ3A 4NM7A 5ANIA 1O6YA 5CAUA 4CZUA 5J95A 2B9HA 4K11A 5GIOE 4S32A 1QPCA 3E87A 3EN6A 3SC1A 3GC0A 3O96A 3CC6A 4RQKA 4BI1A 5HCZA 4GUBA 4FTMA 4I6QA 3N51A 2WTJA 5DRDA 4E6AA 3ZRKA 4B8LA 4HVSA 5CU0A 3RK7A 1GIHA 1WVWA 2YM7A 3FYKX 3VNTA 4LG4A 2C5OA 3TZ9A 3ULIA 5ITAA 3N4UA 3AGLA 3HMOA 4BCMA 5BVOA 3QZIA 5CWZA 3PLAE 5HEZA 5KNJA 4GIHA 2OXDA 2PWLA 5FXRA 4EK4A 3CS9A 3KXGA 4FSYA 2QR8A 4ASZA 4I6HA 3ET7A 5C01A 1ERKA 1J1BA 3HX4A 4ZTRA 5CEQA 2OJJA 4L53A 4AW5A 4F0IA 5J1VA 4R78A 4UALA 2QKRA 4HJOA 4MQ1A 4BRXA 2Y7JA 4KWPA 4OTQA 2J0IA 3MH0A 2ZB1A 2XF0A 4C4JA 3HGKA 3JVRA 3KN6A 4C3PA 1QMZA 3QRJA 4RA4A 5FBNC 1W0XC 3WBLA 4RX8A 2PE2A 4ZLOA 2I0EA 4XG4A 4BDAA 2OZOA 4NM3A 5H8BA 3KEXA 4C2VA 2WTDA 1S9IA 2XRUA 5C26A 3KGAA 5JN2A 2XK8A 3GU8A 5BUEA 4JJRA 4EH3A 2VN9A 4FEWA 4FKPA 2IVUA 2EB2A 3DQXA 3EFKA 4CTBA 4J96A 4Z9LA 5F4NA 2YCQA 3PXZA 3R22A 4FT9A 3QLGA 2E2BA 3RWQA 4BIEA 3DZOA 4FL1A 4U5JA 2ITVA 4JQ8A 4AE9A 3I7CA 2RL5A 3HA6A 2JDSA 2C3IB 1NW1A 2RSVA 4YSJA 1JPAA 2YWVA 2C5YA 2QO9A 3VUGA 4IAZA 4IAYA 3BYUA 4IJPA 2VWXA 4CT1A 4PMSA 4ZOGA 3MFUA 3MWUA 4KIQA 3B2WA 4ASXA 2P55A 1SM2A 1YXTA 3VUHA 2OJGA 5CF5A 1LEWA 3W2SA 1FGIA 5K3YA 1TQPA 1P5EA 3DU8A 3R21A 4ZTLA 3UQFA 3NUYA 4DG3E 2F2UA 4XV1A 3Q9XA 2C0IA 3EQCA 3R9DA 1ZMVA 5GNKA 4BZOA 5ANEA 4IAKA 1PRYA 4DN5A 5D7AA 2BMCA 5DE2A 3NW6A 5CF4A 3EZRA 2WPAA 2C5NA 3Q4CA 5M4IA 4XBUA 2GSFA 4QP8A 3ORLA 3DNDA 1URCA 3CD8A 5JQ8A 4ASDA 4F9BA 4PRJA 1YOMA 4HGSA 1A06A 3IW8A 4QMZA 3G33A 1H8FA 2YZAA 4FOBA 4FNZA 5JMSA 5M06A 2XVDA 4FTRA 1FVRA 1YHWA 4MTAA 2QO2A 1CDKA 2Y8OA 1JKSA 4V0GA 2HY0A 2UW4A 4WNMA 3R71A 5E8YA 4O0SA 5IISA 1ZYSA 5E9EA 4FGBA 1B6CB 3TZ8A 3FL5A 4CLIA 4PWNA 4D0XA 2PUUA 4O0YA 5EI8A 2RIOA 5HTCA 3IW6A 3VS6A 4FTAA 4CRLA 3KREA 5K9IA 5CU2A 5BPYA 1CTPE 5H8GA 3QL8A 3TKUA 3AC3A 4CCUA 3POZA 3KRXA 2VTTA 4G5PA 4K6ZA 4LL5A 4HZRA 2X6DA 3LW0A 4P5ZA 4CCBA 4IB3A 1T46A 1RQQA 3KRRA 3ALOA 5M55A 1NVQA 2OKRA 2ESMA 4USFA 5M08A 4TYGA 5JRSA 5GJDA 3WF8A 2VTAA 3G5DA 2PVNA 3M2WA 3QKMA 4QP9A 2XNBA 2XJ0A 3LZBA 4FTIA 1KE8A 4JQ7A 2CCIA 3C0IA 1UU8A 2QOLA 4L3JA 2FVDA 3L8VA 3RM6A 4PDYA 3ORKA 3EQHA 5AP5A 2PZ5A 2W1HA 2X9EA 3PA3A 4U41A 1W8CA 4EH5A 4QT1A 2AC3A 5FP5A 2J5EA 4CMOA 1XH5A 3PVBA 1FVTA 2GMXA 3HKOA 4N4SA 1OL1A 4PL3A 3U8WA 2YACA 5KZIA 5AA9A 3P7CA 3RK9A 1Q8TA 4TYJA 3V3VA 3ZTXA 2ZAZA 4C33A 3BGZA 2BFYA 3AT4A 3EWHA 4HGTA 3LCSA 5AADA 2O63A 4N0SA 4C4FA 4MYGA 4NW6A 2PSQA 5IZFA 3NGAA 5CQWA 4Y8DA 3CE3A 4HOKA 1H27A 3AT3A 3K2LA 3RNYA 2ITNA 5DN3A 3U51A 3VBVA 3ZZEA 4E26A 4AT3A 5K5XA 2OO8X 4G6OA 4OTFA 1KSWA 3KKVA 2Y0AA 4X6RA 1VJYA 2WZJA 5AP0A 5HX8A 3WILA 2QNJA 4WSYA 4CFXA 5E8VA 3OBGA 1Q8YA 5AX9A 3RPVA 1SVGA 2OBJA 3DAJA 3F5UA 3LLTA 1L8TA 2G15A 3WIGA 4FSUA 4U40A 1QL6A 4OW8A 2VO3A 4YNOA 3V04A 3PP0A 5I5ZA 4FL2A 3TXOA 5CF8A 3SW7A 3UVRA 2GTNA 4KRDA 4O2PA 1H1SA 3DAEA 3MI9A 4X21A 3I7BA 3F3TA 4FEVA 1Y91A 3CQEA 3Q4UA 4P5QA 3W32A 5IEYA 1BYGA 3CJFA 4TW9A 1PMNA 4EH7A 1LEZA 2JDRA 2XS0A 1Q3WA 2GCDA 3QTSA 2I0HA 4K2RA 3MA6A 4DTAA 4BI0A 4L3PA 5BUIA 4RX7A 3QZGA 3PVGA 3Q5ZA 2J6MA 3UO4A 3SAYA 5LMAA 3VUDA 3TDWA 3FY0A 3HMIA 5C4LA 4FSTA 4OR5A 5HU3A 3EKKA 1KOBA 2YIRA 3RPYA 4Z55A 2HXQA 5AV2A 5HORA 1UNGA 5HBHA 5EYMA 4BB4A 3D94A 4DT9A 4YC8A 5GZ8A 3EOCA 4RZVA 4ZJVA 4QMUA 3LVPA 5K5NA 3MB6A 3OZ6A 2XNEA 1GZKA 2BIYA 4XMOA 4ZJJA 4UX9A 4L8MA 2YIXA 3GCSA 5KMOA 3DBEA 2UZOA 3QZFA 5JFSA 5LQFA 3HECA 2BIKB 4FKJA 3P1AA 4JNWA 4ONAA 3Q9YA 4A9YA 2ZV2A 5AA8A 1CKIA 1R39A 4FNXA 1W7HA 2R3HA 1SVHA 5E8WA 3QAME 4U7ZA 1XQZA 3C51A 2NNWB 2HZIA 3BE9A 3PSBA 3WZEA 3LJ1A 5HO7A 4FTKA 4AXAA 4EK3A 2X7GA 3FLWA 2WEVA 3AMBA 4TNBA 5AV4A 3QC9A 3LJ0A 5IU2A 4WKQA 4FNWA 5E8TA 2XNPA 4FV9A 4ITJA 3R7EA 3LM0A 4D1SA 3C7QA 5G1XA 1PXPA 4OTPA 4MF0A 2XM9A 1F3MC 1UVRA 1V0PA 3KXZA 5E90A 1OBGA 3FKLA 2IW9A 4O21A 3QRUA 3QTXA 4X3FA 5K4IA 2VWZA 4YC3A 4AZVA 2WMVA 3C4WA 3UIUA 3COKA 3PJ1A 3UG1A 4R7IA 1VEBA 4XV3A 4CMUA 3FKOA 3UO5A 3FC2A 4O6LA 3TV7A 4EK6A 4AN3A 2W96B 3UE4A 4LOOA 5JRQA 4KA3A 4GSBA 4IWDA 4KD1A 5AX3A 5HHWA 4I94A 3TKIA 4NYEA 5H8EA 4FYOA 3FMHA 4RIYA 5DH3A 4LOQA 4J53A 4XRJA 2B9JA 4W4VA 1JOWB 3OCTA 4D2TA 4EHGA 4BYJA 2BRNA 3A61A 2WO6A 2BALA 3F7WA 3R9NA 4EONA 1MUOA 3OC1A 3QX4A 3QYZA 4J8MA 3HV5A 5DR6A 3V5LA 1OM1A 4FTTA 3DZQA 4YJPA 3EB0A 5AIRA 2OW3A 4RX9A 3V5QA 4FIFA 5H3QA 3EN9A 3ZS5A 4AW2A 4XYFA 4F6UA 3DFAA 2YFXA 4GG5A 5AV1A 3HDNA 4LMUA 4OAVB 2A19B 4FSWA 3FC1X 5B2LA 3VBTA 4FKRA 3KN5A 1IG1A 2BZHB 3LQ8A 2VWBA 2XZSA 2YDKA 4BFMA 2WTKC 3VUMA 1Q5KA 3DQWA 1JSUA 3H10A 4V05A 3UTOA 2WIPA 5EG3A 4RPVA 2PTKA 4W9XA 3GNIB 5CTPA 1KE7A 4O22A 1OIQA 4OT6A 3PPZA 2ITOA 1ZXEA 3CQWA 5TOZA 3WF6A 4EHEA 4IIRA 3MB7A 1XH6A 4YJQA 3QTQA 3QTZA 3ZUVA 4PP9A 3LXKA 2XBJA 4WG3A 3LIJA 2GNLA 3RK5A 5JGDA 1R3CA 2I0VA 3NIZA 5AR8A 3OWPA 5IF1A 1YXSA 2JAVA 3C4ZA 4ARKA 4CLJA 4O82A 3GOKA 1ZYDA 3NNUA 3FQHA 4FTLA 3FZSA 5AFVA 3TWJA 2J0JA 3UG2A 5BNJA 5FEEA 3W2CA 3VS4A 4NFMA 5M44A 2OIDA 5TR6A 3F82A 3O7LD 4AOJA 4E3CA 3L9PA 4YSMA 3NNVA 1BKXA 4IZAA 2GHMA 5F95A 2XCKA 5D1JA 4GG7A 2NO3A 3QTIA 4R3RA 4EWHA 3PG1A 5HIDA 5AP6A 2R64A 1DAWA 1ZOHA 2Z7RA 5AUYA 2GQRA 3ORXA 4ZTHA 2BVAA 4LYNA 4F1TA 4JBVA 2X1NA 4YTIA 5HG5A 3E93A 2W06A 4RJ4A 2H34A 4XLIA 3U87A 1FMKA 3GT8A 4GEOA 2PVLA 3RTPA 4CSVA 5IUHA 1QCFA 4TZRA 4E5AX 4P2KA 4YC6A 5DRBA 3FMLA 3VN9A 4QTBA 4YJNA 2OF2A 3D15A 2VTMA 3GP0A 3L8SA 3HMPA 4QP2A 3VS0A 4RC2A 5AUZA 3S3IA 4H05A 2I0YA 4O84A 5M07A 3FMJA 3JUHA 1UA2A 4O1PA 2PULA 3EQBA 4G6NA 4YJSA 3FQSA 3KMMA 3W8LA 4FV8A 5KBRA 4ZTMA 1BMKA 3QCXA 3LOKA 3VUTA 5KE0A 1W84A 3MESA 3MH1A 1YWRA 2VTPA 1ZOGA 1NXKA 5CS6A 2J5FA 1R0PA 2VWVA 1DI8A 4XBRA 3ORIA 1OI9A 2BAQA 2Z7LA 2RG5A 4QP6A 4FV2A 4RG0A 4BKJA 4I5PA 1VYZA 4O6EA 4AX8A 4C35A 3ZM9A 4ZP5A 4FSNA 3IDCA 5EW3A 4BDHA 3ERKA 5BVNA 2V7OA 4QMWA 2VX3A 3O50A 3ZLSA 3EFJA 4AUAA 3NLBA 3W1FA 4QMXA 4MEDA 4A9UA 2C6LA 1H4LA 3UQGA 3V6SA 2HOGA 4KAOA 2ZYBA 1M52A 5FDPA 5FTGA 5L4QA 5AIKA 4EQMA 2YA9A 3GC9A 4EL9A 1MRVA 2RFNA 3NZ0A 5CY3A 4Q9ZA 3R8VA 4E5BA 2IPXA 2PE0A 3RM7A 4HVGA 4ALUA 2ZM3A 4EQCA 3UYTA 3P7BA 3RAIA 4O7WA 2VWYA 1PKGA 1U54B 4UY9A 4O7YA 2XH5A 2V62A 4C3RA 2WMQA 4GFOA 4DBNA 3GU5A 3OW4A 5CVHA 3RAKA 4FIEA 4YLKA 3SW4A 3AQVA 2VV9A 3LE6A 4IZ5A 5HE1A 3CY3A 3OY3A 4CV9A 4Z7GA 2ZDTA 3H9RA 4AT4A 4YR8A 5FRIA 4P90A 4WA9A 2IG7A 3DXQA 3UOHA 3T3VA 3P86A 2JEDA 3V51A 5A6NA 1JKLA 4FV3A 2H8HA 4IW0A 3TNIA 1V0BA 4BCPA 3PPJA 4XRLA 4RVMA 4BDGA 1URWA 2OF4A 3VS1A 4AZSA 2XYUA 4XG9A 5LARA 3UP7A 4AFEA 4AP7A 4CG8A 3IW7A 4KKEA 5KMMA 2CLXA 5KMIA 3OOGA 4QTAA 3H9FA 1DM2A 5CF6A 4O83A 3WZUA 1Q24A 1X8BA 3SD0A 3SVVA 4R3CA 3D7TB 3BQRA 1JAMA 5KMKA 4O7NA 4NFNA 3I6UA 4E4LA 4FODA 3QQLA 5D9HA 5AR7A 2XBAA 2ZB0A 3LHJA 3FZ1A 3PXRA 3A99A 4WNPA 3UC4A 5BQ0A 4NM5A 4QQTA 4YGAA 5EQEA 3ID6C 2X2MA 4E6QA 3ODZX 4NKAA 3PE2A 1Z5MA 4FIHA 1CMKE 4LFIA 4II5A 2WMXA 3PY1A 5ETAA 3ZO1A 5BVWA 3FSKA 4Y5HA 5A4EA 2CNQA 1YOJA 4DGOA 3DDQA 4WIHA 1H24A 1V1KA 3TJDA 2J0KA 3ROYA 4JG7A 1JKKA 4FGRA 2B9FA 4CKJA 3KF7A 3M1SA 2EXMA 4BCQA 3GQLA 2X4FA 4IX5A 2CGVA 3CLYA 4GK3A 1XBCA 2F9GA 3HP2A 4I6BA 3IOPA 4AN2A 3VRYA 2XIXA 2C69A 3HAVA 3GFWA 4FZ6A 2HW6A 5AM6A 1Y6AA 3PVWA 4BWPA 3AOXA 3Q53A 4YU2A 1ZRZA 2A0CX 2HY81 4HGEA 4WRSA 2BHEA 2OFUA 3B8QA 3EIDA 2UW7A 4YP8A 3ZEWA 4IX3A 2VX0A 5FM3A 4RC3A 3OS3A 1M14A 3DTWA 3HYHA 1P4OA 2BRMA 4AW1A 2KTYA 2W05A 3KVXA 4I4EA 2XJ2A 3MGYA 4L46A 2ZV8A 3GBZA 5DT3A 4GRBA 3W8QA 3Q60A 4AGDA 4B6LA 1YDSE 4BDIA 4B7TA 4CXAA 2P0CA 3KXMA 4RFYA 2OJFE 4R5YA 2C6MA 2QOHA 3D5UA 2R3PA 4HYHA 4FIGA 2ITZA 3LPBA 3RNIA 3TNPC 4F65A 2JBOA 3DTCA 4Q5HA 5DLSA 4F09A 2CKQA 2OIQA 3PFQA 5TF9A 3OWJA 2VTRA 3LFFA 3OWLA 4C61A 1ZARA 4FK3A 4DEEA 1M17A 4HW7A 3D5WA 1IA8A 3EJ1A 4QMVA 3NWWA 4WG4A 2C5XA 4EOJA 5CEMA 2W4JA 3W2OA 5J79A 2ITTA 4G3FA 2YITA 3GC7A 2NPQA 5EHYA 5AWMA 3TNWA 3NW7A 3ZU7A 2QVSE 3PIYA 3PJ8A 4K18A 4IX6A 4JI9A 4Y5QA 4GFMA 4RIYB 4DFLA 1FQ1B 1KV1A 3EQFA 4EORA 3KK9A 2C6TA 3PSDA 4XV2A 3R04A 4EI4A 2IN6A 4D0WA 3FQEA 4RJ7A 1WMKA 2CGUA 3BHVA 1S9JA 2XP2A 5B2KA 3R8ZA 1YWNA 4GU9A 3C0GA 4C7TA 1H1QA 2EU9A 3G51A 4NJDA 3O23A 3D2IA 3PXFA 3RINA 4NU1A 2OU7A 3I4BA 4BDJA 4IFGA 3VQHA 3HDMA 1AD5A 4FV5A 3WZJA 2B9IA 2CSNA 4KB8A 5C4KA 3I5NA 2UZWE 4LM5A 4GVAA 2PMIA 4YJVA 3ZSHA 4KIKA 1UU7A 5HGIA 4J52A 4IJ9A 1KOAA 5M53A 4X6QC 4IAAA 3DCVA 4BIBA 4HVDA 3U4UA 2OI4X 4Y85A 3VF8A 4UWYA 3WZKA 2PUIA 2UZUE 2VTNA 2VTOA 4AZWA 3O2MA 2UV2A 1JVPP 3C4EA 3CTHA 1P4FA 2WNTA 3RWPA 3W2PA 2QLQA 5L6OA 2OG8A 3MN3A 1UKHA 3FY2A 4AT5A 4UZDA 5LCJA 4ITHA 3TDVA 2XIZA 3D5VA 4L45A 3C4FA 3LAUA 5HD7A 3P7AA 3K5UA 4RIWA 4DH1A 3Q2JA 3E3BX 4HVHA 2IZRA 4G1WA 4DLJA 3AD6A 3ZLYA 5IPJA 4QMQA 3PXKA 4UMRA 3WYXA 2PVMA 3PZEA 4BTKA 3FPQA 4UYNA 3PXQA 3UBDA 2IVTA 3W2RA 4D2PA 3PDTA 4QQCA 1GIIA 2X8EA 3QUEA 4K1BA 3F69A 2HXLA 4G5JA 4DH5A 1GZNA 3REPA 2QHMA 3TN8A 2QOOA 2I7QA 4Z3VA 3Q96A 3R7UA 1XHAA 2Z60A 5FXSA 3L9NA 4ZS4A 3LKMA 4HPUE 1UU9A 4GT4A 2VTIA 2WTKB 3FLZA 3LFDA 4RX5A 5JK3A 4QMTA 2WQEA 3BZ3A 3ZUUA 4AAAA 2PVJA 2J7TA 5KMNA 3FV8A 3FPMA 5T3QA 4IDVA 4UMPA 4EBVA 4WBOA 4C62A 3FMNA 3WZDA 5IQGA 4NIFB 5CNOA 5AAEA 4YZ9A 2NRYA 2R7BA 4I21A 4GT5A 4UXLA 5ANKA 1IRKA 5FM2A 3B8RA 5HICA 2EB3A 3O7LB 3RVGA 3GENA 4FIIA 5L2QA 3U55A 4EWQA 4R6VA 4QNAA 3OFMA 3VBXA 4KS8A 1Y57A 4LV5A 2UW6A 1RE8A 4W8EA 1BX6A 3CPBA 2WTVA 2PZIA 2C5VA 4KKHA 1YOLA 1J3HA 5CAQA 5LVNA 4FSMA 5E91A 5CEIA 3JY9A 3NAYA 2C6EA 3QF9A 5FEDA 3MTLA 2YN8A 4TYHA 1T45A 4GUEA 3LCDA 5HG9A 4AQCA 5C1QB 3QGYA 2BDWA 1PYEA 3FI8A 2DUVA 3SDJA 2PY3A 4M68A 1H0WA 3C50A 2J50A 3MW1A 3QU0A 1FPUA 5F94A 4E4XA 4F08A 4DEGA 4C4EA 4HCTA 3TT0A 3TUDA 5FUTA 4Q5EA 3ITZA 5EYKA 1Q3DA 2BTSA 4IB5A 4RWJA 4R8QA 3MVHA 4ZZOA 2W5BA 5GZ9A 2CGWA 3G15A 3R0TA 4KINA 2OZAA 4E6DA 3BGQA 3VW8A 4FKSA 4TYEA 2I40A 4H39A 2R3GA 4YPDA 2W1EA 3BRBA 2FSLX 4ZSGA 1BI8A 1OUYA 4MD9E 3F3UA 1BL6A 4YZNA 3UIXA 2PVYA 3FMMA 4H3BA 5HKMA 4GMYA 3NYNA 3D9VA 3UO6A 1CKJA 4I5HA 4D4VA 4AOTA 2HENA 4FKWA 3TCPA 3QUDA 1XBBA 3ZMMA 1IEPA 2BPMA 3BYMA 2QODA 5DI1A 4CFWA 4YBJA 4BN1A 3G9LX 2GS2A 3CD3A 3DJ7A 3UNJA 2WMBA 3IK3A 3RPOA 3ZXTA 3I0OA 3DB8A 3KRJA 1K3AA 1ZYLA 5A3XA 2V7AA 1ZLTA 5D11A 2XNOA 4XOYA 2XK3A 2CN5A 3LCTA 2CGXA 3LMGA 4Y46A 3TNHA 4C4GA 3R9RA 5AP3A 5HNIX 4IFCA 1REKA 2WQMA 4FNYA 3ZUTA 4WRGA 4L67A 4AGCA 3CIKA 5HQ0A 5I9WA 4MNEA 2V5QA 3MJ2A 3QA0A 1PXNA 3MFRA 4YHTA 4TRLA 3FSFA 3R7OA 2W0JA 4EH6A 3D2KA 3PRFA 3R28A 3GI3A 4NTSA 4ZTSA 2R2PA 5HLWA 4BCKA 1B38A 3MY5A 2YEXA 4EOKA 3RCDA 5LWMA 2R3MA 4W4XA 2Z02A 3GU7A 4GS6A 5CXHA 3Q9ZA 3LXNA 5KCVA 2B55A 3KMUA 3LMIA 3BHHA 3ELJA 2VTHA 4ALWA 3QFVA 2OGVA 1ZZ2A 1O6KA 2W1GA 3QYWA 5J1WA 3ZEPA 3C5UA 5J9YA 4ZLZA 3NCZA 2A4LA 3E8NA 3FMKA 4M84A 5G6VA 3QBNA 3FEGA 4RRVA 4FF8A 4C02A 3ZC5A 3NVMB 4G2FA 5CEKA 1Q4LA 4K9YA 4D5KA 4O7RA 3A8WA 4F99A 2Y6MA 2XCHA 4PNKA 4L7FA 1LUFA 3DY7A 4M69A 3R7IA 3ZSGA 2P4IA 3E8DA 5KX8A 4RT7A 5KKRC 5FQDC 4MCVA 2V0DA 3R8UA 4DFUA 2PZRA 5EHLA 3E3PA 4L00A 4BZNA 4OAUC 2OLCA 4HYUA 4JRVA 3KVWA 3GCUA 3PPKA 4BYIA 4W4WA 2CDZA 2FH9A 2IVSA 3VUIA 3U9NA 3ZSIA 4M0YA 5B7VA 2XIYA 5T6KA 4EJ7A 4LRJA 5EM5A 5DHJA 5I4NA 5J7HA 4EJNA 3ZO3A 1YHSA 2YCFA 4IM2A 3SQQA 4DG0E 4EK5A 3Q32A 3V8TA 5D12A 1H25A 2GNFA 3CBLA 5IMEA 3WIKA 2HAKA 2UZDA 3HVCA 2VO6A 2FO0A 4ORKA 3E63A 3EQIA 3KCFA 4YHFA 1NVRA 3QQJA 4O81A 4UXQA 3OCGA 5FXQA 4M0ZA 4JT3A 3OEZA 4ACDA 2XKDA 1OUKA 4DH3A 2YM3A 2JIIA 3QWJA 3ZCLA 4CYJA 1WCCA 5IA2A 2DQ7X 3DKCA 4FBXA 3PVUA 4JS8A 3DS6A 2FSMX 3P4KA 4JAJA 4I41A 3B2TA 4ID7A 4U43A 5CSVA 2J9MA 2YJSA 4ZSAA 2E9NA 5JEBA 3QRTA 4CFMA 3S0OA 2PMLX 1YI6A 3IPHA 5FTOA 1BLXA 3R73A 4EUTA 4AE6A 2HZ0A 2QU6A 2A2AA 2FSOX 4FV0A 1DS5A 1ZY5A 3GEQA 5BMSA 3BE2A 5LJJA 4RJ5A 1BI7A 1GZOA 2F4JA 5D41A 4Z7HA 3ODYX 2VX1A 4IVBA 5B2MA 5LVPA 2P33A 3FKNA 2GQSA 4FEUA 5GINE 2UZEA 4IADA 1YWVA 4TKSA 5BUJA 4YZCA 5FGKA 2WTIA 4BCGA 3G2FA 4JG8A 1OL6A 5CSPA 4AGUA 3QKKA 2VWIA 4TWCA 2UW9A 2OWBA 4PTEA 5EH0A 3W55A 3QQUA 3GCVA 1IASA 2GNHA 2IZUA 3I81A 3TI1A 4A9RA 5EHOA 3RI1A 3V8WA 5I9ZA 4FSZA 2CMWA 2XIKA 3VS5A 3U9CA 5AP1A 2QCSA 3DBFA 4F9WA 1ZMUA 1JLUE 2BR1A 3F5XA 3QTRA 4X3FC 3RHXA 4DBXA 2BFXA 3QHRA 2VNWA 4G3CA 2PL0A 3EN4A 5EDPA 4MBIA 4RIWB 3DBQA 4WUNA 3MY1A 3S00A 4MBJA 4L43A 4PUZA 4BCIA 5E8UA 1OKZA 3GOPA 2WOTA 4UB7A 3MVMA 4UN0C 2EWAA 5JFVA 3UMWA 5HTIA 1UV5A 2XUUA 5M4UA 3BCEA 3OROA 1G5SA 4JX3A 4E7WA 3ORZA 4IANA 5AUVA 5ANOA 3KULA 4H1MA 1Y8GA 5BX0A 2BTRA 2O5KA 4GJ3A 3U54A 1W83A 3PRIA 3OXIA 5D7VA 4ENXA 5JZJA 4C36A 5AUTA 3U6IA 4O1OA 3SOCA 1YRPA 4M66A 1Q99A 3S2PA 2BILB 5TKDA 3R2YA 4CYIA 4D2RA 2XA4A 3OW3A 1YXVA 4PP7A 4OTWA 2RFDA 1OITA 4USDA 4G9RA 4YZMA 2ONLA 3RZBA 2B52A 3FLSA 3HRBA 3E92A 1XKKA 4PX6A 5CT0A 5IA3A 3A7GA 1SYKA 3R00A 5HESA 4JDJA 2OJ9A 3ZXZA 2B7AA 5HE3A 3TTJA 4BDFA 4E6CA 1FBNA 1MQ4A 3N4VA 4RGJA 4PDOA 4ZEGA 4ZAUA 3RKBA 2XKFA 1VR2A 4HZSA 5I3RA 2CNVA 2RF9A 3DAKA 2FGIA 3R2BA 4QP4A 4DAWA 1SVEA 4RVKA 4BCHA 3R7GA 2OJIA 5KZ0A 5AR3A 2Y4IC 5I9VA 3BU3A 3MS9A 3AGMA 2WD1A 4JIKA 4EZ7A 3E88A 3O8PA 3MBLA 3OCSA 4NCTC 2QD9A 5HE2A 2FSTX 4O7TA 1R0EA 3WF5A 3UIBA 3HV4A 4YMJA 2C47A 2WU6A 2UZTA 2VWWA 4O96A 2PMNX 2WAJA 3F5PA 3JVSA 3FAAA 5IDPA 2SRCA 2VTJA 4QPSA 3O17A 3R63A 4BF2A 4D4YA 4E73A 4NW5A 5EYCA 1U4DA 3NUNA 3IONA 3I5ZA 4XP2A 3KC3A 4OTRA 3G90X 4DFZE 2B1PA 5C8MA 2WQOA 2R0UA 2E9UA 3QD4A 3N9XA 4I4FA 3ORMA 2XM8A 4QRCA 4F70A 4IX4A 3QCYA 4FVRA 3T8OA 1VZOA 3IGOA 2QHNA 2J0MB 3E64A 4WG5A 2J90A 2W9FB 3RGFA 2X8DA 3GFEA 2W1FA 3EH9A 5KBQA 4UBAA 1B39A 4GJ2A 4EH9A 3ZLXA 2VD5A 4KSPA 2FYSA 3DFCB 1VYWA 4QTDA 2Z2WA 3RMFA 3HMMA 3T9IA 5L2TA 5IEXA 3EFWA 2BZJA 2G9XA 4NCTA 4NSTA 3SLSA 1JBPE 2ZV7A 5ACKA 5EQPA 5CSHA 4EC9A 2GNGA 2E9VA 3DK7A 3GB2A 4UMTA 4FV1A 4C59A 1J7IA 3KY2A 3SGCA 3Q5IA 4CEGA 4RIXA 5HVJA 5BVDA 4HYIA 1OBDA 4FTUA 3TUCA 1ATPE 3LFCA 4EKLA 4O86A 4EZ5A 3RP9A 2GHGA 3BU5A 4PV0A 4EZ3A 4ZS0A 5JGBA 3KB7A 4C4HA 3OXZA 3TIYA 3Q9WA 2F49A 4F9YA 5CAVA 3UODA 2WELA 3IG7A 3ZRMA 2OH0E 2WTCA 3V5JA 3VHEA 4EYMA 3F88A 3I6WA 3NIEA 2JBPA 3NYXA 4J8NA 3M11A 4L01A 3BIZA 4ZSLA 4R7HA 2YWPA 3RJCA 4YTHA 4D2VA 4R5SA 4EBWA 5DFPA 3FLQA 2NP8A 3GU4A 3GQIA 4X2JA 4XV9A 4IACA 3UVPA 3BI6A 1LP4A 4RWKA 5BVKA 2BAKA 4QYYA 2CN8A 4JL9A 5EI6A 4BIDA 2X9FA 5CU6A 3RHKA 3VRZA 4EHZA 5L3AA 4O7SA 3BPRA 3PE1A 2QOKA 3A60A 4V0GB 4C2WA 2PUPA 3TV6A 3F2NA 3V6RA 3ATTA 3FE3A 5FTQA 3BLQA 3P08A 4BDKA 1YKRA 4GFGA 5CVGA 3FZRA 3A7FA 4K33A 4OBPA 3P5KA 3TG1A 3ETAA 1J7UA 2B53A 4I0TA 1XBAA 4EH2A 2RGPA 2WGJA 5L6PA 1A9UA 4CG9A 2C68A 5F20A 2OH4A 3D7ZA 3WF7A 5CALA 5J9LA 3U6HA 3QGWA 4XG2A 2PHKA 4YPSA 2YAKA 3R30A 1BUHA 4DG2E 3F3ZA 1ZOEA 2GTMA 3VULA 4EOOA 4MKCA 5F9EA 3OMVA 3BELA 4UZHA 4D1XA 1E1VA 3JY0A 5C03A 3SXSA 4QQ5A 2WMTA 2OIBA 1OL7A 5A4QA 1OIRA 1WBWA 3QKLA 3PP1A 5AAFA 3ZHPC 1SMHA 4L42A 1HOWA 4Z16A 4USEA 2JGZA 2PVHA 4XJ0A 2O65A 1PXKA 2VO7A 5FG8A 4AA5A 2HZNA 3CTJA 4GH2A 4A7CA 3R1YA 4LRKA 4NEUA 4U44A 3FI4A 3MA3A 5CASA 2W1CA 4ZSEA 3AC5A 4XS2A 4YLJA 2EVAA 4G17A 4BKYA 1WZYA 5KMJA 5A4CA 2CJMA 4IC7A 4ANOA 2J4ZA 3ACKA 1ND4A 3VIDA 2R9SA 4E20A 2YJRA 3BHTA 2QOQA 1PXLA 4W9WA 3G0EA 4YJRA 4I1ZA 5EDQA 3K3JA 5LVLA 5HTBA 4CGAA 2JDOA 1BL7A 2BDJA 2GHLA 3CXWA 3PA5A 4IAFA 4JOAA 4LOPA 2R3FA 5AJQA 4E5WA 5JQ5A 1YDRE 1TQIA 3AC4A 4QMSA 4XHKB 4AS0A 2CPKE 2ZMDA 5EW8A 2DS1A 3IO7A 4YJUA 2VNYA 2WMAA 4O0TA 3BYOA 5J7BA 5KKRB 1SNXA 5ETFA 2WKMA 2WXVA 4LI5A 2XEYA 3A8XA 1H01A 1FGKA 3VWAA 3D5XA 3PJ3A 4PMPA 5EYDA 4AU8A 3O71A 3G6GA 4GT3A 4W4YA 5BMMA 3MPAA 3HP5A 3QD3A 3CTQA 4FYNA 4F7SA 1V0OA 3PIXA 1WBPA 3PWYA 4FR4A 5AP4A 4WNKA 5H9BA 5J8IA 3VO3A 1OECA 2ZV9A
chains in the Genus database with same CATH superfamily
3TNQB 4I22A 2GFCA 2UZBA 4FTJA 4KRCA 4AXCA 1GJOA 2LGCA 1OPJA 2YCSA 5DT0A 3U4WA 3UOKA 2JKQA 2YDIA 3OT8A 1IR3A 4W8DA 3LFNA 4KKGA 2IF8A 4XX9A 5HBEA 5KO1A 3M42A 3PWDA 3F2RA 1QPDA 4D9TA 3C13A 5CANA 4LL0A 4N70A 4MD7E 3TEIA 2IW8A 3CPCA 4QP7A 5CVFA 2YISA 2IZSA 3VBQA 4D9UA 4O2ZA 4LDTA 3TKHA 1XH7A 2B0QA 4RVTA 3ORNA 3VS3A 2XAOA 5DPVA 2REIA 1WBVA 2YAAA 4FTCA 3ATSA 5CAPA 1YHVA 3HZTA 3TL8A 1APME 1H08A 4C34A 4FE2A 4NL0A 3FUPA 4KIOA 1KE5A 1ZZLA 4S31A 5EM6A 5FP6A 2X7OA 4IXPA 5BYLA 5ANGA 2J0LA 3KQ7A 2DYLA 3E8CA 4FG8A 3I1AA 3ZLWA 4B4LA 4E8AA 1LR4A 3QHWA 4O0XA 4X3JA 5CENA 4EOIA 3AT2A 3LJ2A 4XNEA 1WBTA 2XKCA 4DLIA 2X6EA 1OB3A 3BLRA 4IWOA 4JLCA 4D4RA 3BBTB 2BKKA 2Q83A 5M56A 1E9HA 3K5VA 4BCFA 1WBSA 2GFSA 3R8MA 3PFYA 3NUSA 2Q0NA 3MFTA 5A46A 2G01A 3COIA 3QXOA 5EM7A 3OY1A 4U97A 1OPKA 2I6LA 4K77A 3BWFA 4BWKA 3Q04A 4ZY6A 2XYNA 3IQ7A 5DVRA 2UW8A 2ZM1A 3BBWA 4QYHA 3HNGA 1WFCA 1UNHA 3PZHA 4M8TA 1Q8WA 3LFAA 5AV0A 4FTOA 4IEBA 3R1QA 5HNGA 4X3FB 4ZY5A 4IMYA 3DNEA 3VVHA 1Q61A 1YQJA 1YW2A 4JX7A 5HO8A 2R3KA 4CFFA 3DLZA 4FMQA 5I9XA 2X7FA 4ZK5A 4ZLYA 4FUYA 4X7QA 2WB8A 3H30A 4HGLA 4U9AA 4FKTA 2AEGA 4FG7A 4ZJIA 4FZ7A 4YZBA 3SX9A 1H1WA 2C4GA 4L6QA 2AQXA 2BRBA 2WMRA 1JKTA 3CY2A 4CQEA 4CZYB 1G8JA 3UZRA 1XWSA 3W2QA 5L8JA 5IA4A 2IJMA 3KA0A 3Q3BA 4L7SA 4O91A 4QO9A 3S4QA 4FZFB 4U80A 4F4PA 1WVXA 3NEWA 3OOMA 5ETIA 4S30A 2C3KA 4U42A 3UZPA 4DGMA 2XKEA 4F7LA 3HLLA 3QCSA 1OPLA 3UDBA 3CQUA 3EN5A 4FKIA 3C0HA 4C37A 3RAWA 4F6WA 4CZTA 3TACA 5M51A 1XR1A 2UZLA 2XK9A 3WARA 4MNFA 3MDYA 2VU3A 4A07A 3QUPA 4M67A 4RJ6A 5A9UA 3ZC6A 4XLVA 3QWKA 5A4LA 5EQYA 4FKQA 4FZAB 5BYZA 4DHIB 4I24A 4AFJA 4CV8A 4EOQA 3KFAA 2X4ZA 3UOLA 4BTJA 3QQGA 4CKRA 4KBAA 4XP3A 3DK6A 3H3CA 3EHAA 2OXXA 1LPUA 3VHKA 2ETKA 3EMGA 4MXZA 4DFXE 5IQFA 4EH8A 4QMNA 2VZ6A 2ETRA 2GNJA 2UW3A 2Y4IB 3I0QA 3ML1A 2UVYA 3OCBA 3P0MA 5I3OA 4IZ7A 4PMTA 2ZDUA 1IA9A 4TWNA 5HI2A 1G3NA 4S33A 4KUJA 2UW0A 4I5MA 4AN9A 2QONA 1PYXA 3ACJA 4FT7A 4QPMA 4YZDA 3W0RA 3HEGA 3CGFA 3DKOA 3VBYA 5EOLA 5IUIA 4H1JA 3R7YA 4QMLA 3HAMA 1H00A 3KRLA 3P78A 4RIXB 4IWPA 5LMKA 3BWJA 3CCNA 3R8LA 4BHZA 5CEPA 3UYSA 1CSNA 1OKYA 4HPTE 4YO6A 3ANQA 4FTQA 3F3VA 3SRVA 4DTKA 2R3QA 3QD2B 3FL4A 3C4XA 3UJGA 1HCLA 5K4JA 3JS2A 4AWIA 2H96A 1OL2A 4RZWA 4U45A 4C3FA 4R7BA 1YI3A 4O7ZA 5HLNA 1GOLA 3BU6A 1M7NA 4ZZNA 2OK1A 4WD5A 1YI4A 2P2IA 2EXCX 4EOMA 5H2UA 3UP2A 5DYJA 4R77A 4L68A 2BHHA 5DR2A 4EC8A 5IH4A 2ZMCA 3FLNC 5TE0A 5AR4A 4H3QA 4RVLA 3LFBA 4DINA 1QPEA 2GNIA 3DKGA 4ENYA 1UWJA 5IH5A 3KXHA 3AD5A 2ITYA 3HL7A 5IQIA 3NYVA 4EOPA 3I79A 3VJNA 2R3RA 3BHUA 2OICA 2QOBA 1WBOA 4RA5A 1JQHA 1RJBA 2VAGA 2WMWA 2H6DA 4QPAA 4FK6A 4IAIA 3BQCA 4U0IA 4M7IA 5EM8A 5AR2A 4RWIA 2E9PA 3RAHA 3POOA 3V5TA 4BBEA 4EHVA 2BROA 4LGHA 2NYAA 3QXPA 5IG1A 3JYAA 2XEZA 1F5QA 3H0YA 4FTNA 3ZONA 4DH8A 1YXUA 2NRUA 2YHVA 2CHLA 2IZTA 2W4KA 4M12A 5HIBA 4D5HA 3OHTA 4D2SA 1J91A 4FZDB 4MF1A 3A4OX 4AZFA 4I5CA 4PNIA 4BWXA 2G2FA 3NUUA 3TZ7A 4ZXTA 3C5IA 4ERWA 4QMPA 4J1RA 3T9TA 4O7VA 3AC8A 4GK4A 4J95A 3KK8A 3UOJA 3DV3A 5CNNA 2QG7A 3GVUA 5AAGA 3MTFA 4U8ZA 5CU4A 4DA5A 4NKSA 3QLFA 4TNDA 3C9WA 3AC2A 1H28A 4I20A 2HWPA 3PLSA 1Q8ZA 4NH1A 4S34A 3OD6X 3JXWA 2HIWA 4TWPA 1KV2A 4O38A 4DFYA 3OXTA 2A27A 4BCOA 2XNNA 3DLSA 3NUXA 3BYVA 4U79A 5IQEA 4O0WA 5E8SA 3TMOA 1STCE 4N6ZA 4A4LA 5CQUA 4EH4A 2R3JA 4FC0A 3P23A 4UEUA 2O64A 1UWHA 4I92A 4S2ZA 2YABA 5L8KA 5A54A 2YCRA 2UZVA 5CAOA 4OLIA 4X2KA 4FVQA 3PXYA 2P2HA 4IQ6A 4BY9E 3VC4A 2BRGA 3NNXA 3WE8A 4C4IA 1L3RE 5E92A 3F61A 4CNHA 1PHKA 5IQDA 3JPVA 3FJQE 4UWCA 3WE4A 3H0ZA 3BEAA 3CGOA 3O8TA 5E1SA 4ZTNA 5HE0A 5DEWA 1ZYCA 1OVEA 2ITXA 3P9JA 4JDHA 5IQBA 5C8KA 1U46A 4QMYA 4PF4A 3FXZA 4HCUA 4YO4A 2YLEA 4IVDA 5K0XA 4WT6A 4V01A 4NT4A 4QYEA 1JNKA 1GIJA 4FSQA 4DYMA 4TN6A 2JFLA 3IDPA 3ZBFA 4ANSA 5AEPA 4FV6A 2CCHA 4YJOA 2X8IA 4PL5A 2C3JA 2GS7A 3ORPA 5JGAA 1PY5A 4DEDA 3EKNA 1QPJA 3OVVA 5I9UA 4AZTA 3U6JA 1PKDA 4JDKA 1ZYJA 2CKEA 4U3YA 4E1ZA 5ANJA 4I0RA 3ULZA 4WOVA 3L8PA 3TV4A 3QQHA 2CLQA 3FLYA 4QD6A 5KUPA 5E8XA 1SZMA 4E4NA 2VRXA 4F1OA 5M4CA 2BDFA 2X0GA 1PMVA 1M2QA 1UNLA 2QI8A 1TFFA 2QR7A 2C3LA 4IC8A 1PMEA 4WSQA 4WNOA 2IVVA 2WIHA 5I9YA 2X81A 5DBXA 4JR3A 1XMLA 4D2WA 5HVYA 2WEIA 2W9ZB 4XG6A 3DKFA 4XP0A 2YERA 1IAHA 3D4QA 3W10A 4JXFA 4O4BB 4DEIA 5L6WL 4Y73A 5JH6A 2C6OA 3E7OA 4UWBA 5EW9A 4XH6A 4B8MA 3PUPA 4I3ZA 2XNMA 3L8XA 4Y83A 3UZTA 4DE4A 5JT2A 4ZY4A 4A9TA 4KBCA 4QMOA 5CYIA 4F7JA 1W2CA 3QTUA 3DPKA 2G1TA 4GU6A 4AGWA 1J7LA 3OF0A 3EQDA 2QOFA 4NZWB 2RG6A 4X2GA 4BC6A 4XG3A 4ANNA 4G6LA 3PJCA 3Q6WA 4FKLA 3HV7A 4LGDA 4FSRA 4FA2A 4C0TA 3ZYAA 4C8BA 3DBCA 3DDPA 2W17A 4MVFA 3TIZA 5M09A 3D0EA 2R3IA 3HRFA 3R02A 3LXPA 3MH3A 2XK7A 4KABA 2XK6A 2W99B 4ZIMA 3E5AA 4UYAA 3A7IA 4MXXA 3DOGA 3SA0A 3SHEA 2PU8A 1XO2B 4WBBB 5ETCA 4C57A 5IUGA 4YNEA 4IM0A 5HLPA 5DWRA 5ACBC 5LMBA 2HELA 4IE9A 4QP3A 5FWKK 1OIUA 4XCUA 2ZFYA 2F7XE 4JG6A 3HMNA 3O5AA 1KE6A 4WO5A 4R1VA 4CT2A 1OKVA 4AW0A 2E9OA 4IDTA 4DHFA 4KBKA 2UW5A 5HBJA 1UU3A 4P4CA 1U54A 3RALA 3KXNA 5HIEA 4G16A 3R6XA 5IQCA 3E62A 3UPXA 2HWOA 3MY0A 5FDXA 4CQGA 3FHRA 2IWIA 4DHJA 1GNGA 3VW6A 3FYJX 4P7EA 4OGRA 3WI6A 5DA3A 3QRIA 4U3ZA 4EOSA 1ZAOA 4EK8A 3PY3A 3A7HA 5J5TA 2BUJA 2QOIA 1OZ1A 4G3EA 4MK0A 4J97A 5HG7A 3ZH8A 2X39A 4CTCA 2ONLC 5EKNA 3AKLA 4EUUA 4KIKB 3HUBA 4FT3A 2GDOA 4FICA 5E1EA 2ZJWA 4APPA 4EYJA 3CSVA 4IBMA 3OEFX 4TWOA 2C30A 2XIRA 3SOAA 3ZFYA 2HYYA 1YVJA 4RFMA 5J9ZA 4CFNA 5CSWA 1DI9A 4ASEA 4DFNA 2PZYA 4F1MA 4FV4A 4ANMA 1TKIA 3D7TA 3MH2A 1H1PA 2O8YA 2JFMA 2PK9A 2UZNA 3NDMA 4EQUA 3F3WA 2CKOA 3ANRA 5AMNA 3SG9A 2V22A 4OTIA 3L9MA 3Q6UA 1Q97A 3H9OA 1W98A 4J71A 3BHYA 2EXEA 3OTUA 4CFVA 4IVCA 2C1AA 3Q4TA 2C6DA 3F7ZA 3IW4A 2W5HA 1NA7A 3SRVB 5BYYA 5HG8A 4Q9SA 2VTSA 2JITA 3PG3A 4GIIA 4BI2A 5IEVA 4FVPA 3ROCA 5C27A 1WAKA 1F0QA 4ZMFA 3ZO4A 2ZOQA 4PMMA 5A6OA 3ALNA 5FEQA 3RPSA 3LCKA 3QD0A 4QYGA 2GPHA 4TY1A 5EK7A 4O4DA 5L2IA 4BTFA 4PPCA 5BV3A 5AP2A 4LMNA 4X0MA 4ANLA 4FI1A 4Q2AA 2X2LA 2OSCA 1JSTA 1W2DA 2ITQA 2WFYA 5D10A 2JC6A 4GKIA 3ENMA 2RFEA 4OBQA 2UVZA 3F9NA 4HNIA 5K0KA 1W82A 5KHXA 4HVIA 3QCQA 5CI6A 3W16A 1Q41A 3MVJA 3V01A 3UVQA 4ZMEA 2J2IB 5ANDA 3H4JA 3FHIA 2LAVA 3RZFA 3TM0A 3ZZWA 4FKUA 4ANBA 3R7VA 3DJ6A 3ZFXA 5HZNA 3NX8A 4BTMA 1NVSA 2ETMA 1ZMWA 4PPAA 4QP1A 4TYIA 3R9OA 4FIJA 4M97A 2F2CB 2XRWA 3SKCA 4G3DA 5TO8A 3VS2A 1MRYA 5KHWA 2YIWA 2G2HA 2ACXA 1OIYA 3GCPA 3FXWA 4WUAA 4F0GA 1KE9A 3GXLA 3G6HA 2R3LA 4PQNA 4YURA 1EH4A 4TYHB 4RQVA 2QU5A 3V5PA 5J5SA 2WU7A 1GZ8A 2WTWA 3NFFB 3LCOA 4MWHA 1Y6BA 3AMYA 3FBVA 2JKOA 4UMUA 1AQ1A 1Q8UA 4MQ2A 2OFVA 2R4BA 5HU9A 2C6IA 5IA1A 2VGOA 2WQNA 3QTWA 4G31A 4GV1A 3WOWA 5FD2A 4FKGA 4QNYA 5DMZA 5LWNA 3CKWA 4I93A 1A48A 2XMYA 4ITIA 3ZFMA 1J1CA 4FV7A 5CSXA 5JFXA 3IDBA 3W18A 4BBFA 4DCAA 5IQHA 3Q52A 1KWPA 3ZO2A 1GAGA 4M13A 3FI2A 4LGGA 4B99A 5C9CA 3EYGA 4CKIA 2YM6A 2OZAB 3VAPA 3IECA 4YHJA 2YDJA 3AG9A 2R5TA 4Y95A 4A4XA 3A7JA 2ZM4A 4DEHA 4RJ8A 4BDEA 4DFBA 1M2PA 4AA0A 5GZAA 3N4TA 2QURA 4GYIA 4MXOA 3TJCA 3II5A 1XH8A 3D14A 3C4CA 3OTVA 4GL9A 3SXRA 4H3PA 2I1MA 2F7EE 2YZLA 3HV6A 4F6SA 1U5RA 2YM8A 5AR5A 3BYSA 1PXOA 3MPMA 3QALE 3ZM4A 4A06A 4ACMA 5HD4A 3F2AA 2YIYA 4F9AA 2O3PA 4I0SA 3DK3A 1OGYA 4R3PA 5FLFA 4F9CA 4H36A 5BVFA 3EL7A 2UUEA 5LVMA 3OBJA 5EKOA 4FG9A 5A14A 2XB7A 4GK2A 2R3OA 4ZZMA 2F57A 4XUFA 4V04A 4GW8A 4QOXA 4BKZA 3CEKA 3IW5A 2P3GX 2WHBA 1MQBA 3L9LA 4MWIA 4PTGA 4BCNA 4HNFA 4PY1A 4MNEB 1K9AA 4RJ3A 3QX2A 1P14A 4BDCA 3BV3A 3PTGA 3WF9A 5HCXA 4ERKA 4X2NA 2PVFA 4O4EA 2YLFA 3DGKA 4HCVA 5F1ZA 4GKHA 5HVKA 3ORTA 4I6LA 4FOCA 1NY3A 2BRHA 2YM4A 3O8UA 2QQ7A 3MFSA 5IDNA 4I6FA 3AMAA 3SXFA 3UC3A 3FXXA 1Z57A 3KF4A 4F0FA 3CKXA 4AOIA 4L52A 4QDEA 5JZNA 3MJ1A 3F5GA 3BLHA 1TQMA 4C38A 4Y72A 3LLAA 3BL7A 4FT5A 1G8SA 2G2IA 3PJ2A 2JDTA 2W5AA 3FWQA 4AZEA 5CZIA 1O9UA 2PPQA 3PY0A 1U5QA 2ERKA 4IB1A 4JBOA 1ZY4A 4MXYA 5CI7A 5DR9A 3MIAA 3NSZA 2JLDA 4BGGA 1G8AA 3NYOA 4MD8E 2R0IA 4NWMA 4TXCA 1PXJA 4BHNA 1WVYA 1IAJA 4D58A 3NUAA 4YUQA 3TZMA 2VTLA 3LQ5A 3OG7A 4XOZA 4M69B 2PVKA 2FA2A 4ZTQA 4G9CA 2J51A 2W1ZA 4F63A 4NIFA 3KCKA 4I23A 3EQPA 1PXIA 1R1WA 2B4SB 2W1DA 2W4OA 3AXWA 3CP9A 3NCGA 4JDIA 3MPTA 3RPRA 4F64A 1Z9XA 4XG8A 3F6XA 4K0YA 4NTTA 2GS6A 2Z8CA 3QRKA 3EFLA 1H1RA 1UKIA 4IM3A 3MVLA 3IKAA 5DG5A 5IH6A 3JR1A 4J99A 4D55A 1I09A 1Q62A 2HZ4A 4TTHB 4FEQA 2W1IA 4PDPA 4NM0A 5DNRA 4KIPA 3D83A 4MAOA 4U6RA 3PYYA 2QLUA 5TT7A 3FDNA 2WMSA 3FZTA 4KSQA 4LUDA 1XJDA 4MX9A 3R1NA 4RLKA 2RFSA 5JFWA 3IOKA 4M3QA 5DGZA 5CU3A 5JKGA 3LXLA 3R8PA 3RCJA 4HYSA 4O7LA 2JAMA 4OTGA 5IA5A 5B0XA 3EQGA 2VTQA 4ACGA 4FKVA 4IVAA 4CFUA 4D4SA 2BKZA 2O0UA 5IA0A 4MBLA 4ACHA 4LQMA 4O0UA 4J7BA 5ICPA 4MXAA 4E4MA 1DAYA 2AC5A 2R7IA 5AP7A 3NW5A 2JKKA 4DEBA 4QTCA 5A4TA 2AUHA 4FEXA 4N57A 4RLLA 1JSVA 1SNUA 4JRNA 1P2AA 2IO6A 3EQRA 5CZHA 4DCEA 3BEGA 3PUFC 1YXXA 3DB6A 3QA8A 2C6KA 4LRMA 4AG8A 3DT1A 1MP8A 3LFEA 4G3GA 4MHAA 4EEVA 4QYFA 1I44A 4FL3A 4M15A 3TUBA 2XK4A 2PVRA 1OGUA 1JWHA 3ZDIA 3C1XA 4JQEA 2A1AB 4BICA 4YTCA 3LQ3A 1REJA 1RW8A 3CR0A 4AA4A 4L9IA 4ANQA 5IQAA 4TPTA 5EDRA 4PPBA 3O51A 4FUXA 4O0RA 3EZVA 4D1ZA 4IHPA 3GGFA 4GCJA 3VS7A 4OTHA 4PTCA 2CNUA 3K3IA 2BZKB 5IMXA 5AM7A 4MH7A 1TVOA 2QC6A 3G9NA 4G34A 5EOBA 3ZOSA 3W33A 5DOSA 4FKOA 2IW6A 3UIMA 3ZDUA 3IS5A 3QQKA 1H07A 1R78A 4BDDA 5AUUA 2DWBA 1FMOE 3DJ5A 4OUCA 4ALVA 4BBMA 3NAXA 5HO6A 4ACCA 4JBPA 3FI3A 3MSSA 3KL8A 2KULA 4YJTA 3EL8A 2XJ1A 3F66A 3NS9A 4IH8A 4TL0A 4DF3A 4O27B 3COHA 5HCYA 4E93A 1XH4A 4LV8A 4C58A 3BL9A 4M14A 5E7RA 2X2KA 2Y4PA 3EN7A 3R9HA 2AYPA 4JBQA 3LFSA 4RWLA 2OXYA 5KMLA 3NR9A 5L2WA 1FOTA 1FINA 3KULB 3E7VA 3KMWA 2ERZE 4WHZA 4RFZA 4X2FA 2HW7A 2QOCA 3DA6A 3HRCA 4BVUA 2PUNA 4DC2A 4NUSA 4N6YA 1M2RA 3KRWA 1U59A 3IGGA 1K2PA 5C8NA 4RMZA 4QDVA 1CKPA 3BKBA 3WYYA 2WOUA 4QMMA 3QQFA 3LFQA 1O6LA 1WBNA 2XNGA 5DEYA 5CXZA 2PE1A 3S1HA 2VWUA 4RC4A 5L8LA 3UPZA 3W0NA 3FZPA 2JIUA 1GY3A 3BV2A 2C0TA 1M7QA 4RBLA 4DGGA 4YTFA 3GCQA 4L3LA 2GU8A 2VUWA 1PJKA 4JR7A 3SG8A 4BR3A 4OBOA 4UV0A 4KS7A 3S95A 2BZIB 3UNZA 1CM8A 2Y9QA 3BGPA 3EYHA 3OUKA 3GC8A 3Q2MA 3Q4ZA 4JIAA 3KU2A 1AGWA 3PIZA 3R01A 5M4FA 2V55A 4QQJA 4D28A 4DH7A 2W7XA 4IZYA 3K54A 4EOLA 1HCKA 4YBKA 4B9DA 4K8AA 4AAYA 1H26A 4PL4A 3AD4A 4A4OA 3CJGA 3MYGA 3T3UA 4APCA 2UVXA 4CMTA 5EI2A 5GIPE 2RKUA 4FT0A 1H0VA 5LMKC 5LOHA 3L1SA 5AUWA 3V5WA 4NK9A 2BCJA 2JD5A 3VF9A 1E1XA 1OMWA 2VGPA 5L2SA 5GJFA 1Y8YA 3NPCA 2HCKA 4B0GA 3UQCA 5E4HA 4MXCA 1PW2A 2Y6OA 4LUEA 3VBWA 4XG7A 3UDTA 4L44A 5E8ZA 2GQGA 5CLPA 4A9SA 5CT7A 3OWKA 5AV3A 2Q0BA 3R83A 3BX5A 3UGCA 3VQUA 3NMUF 5CX9A 5CEOA 5HNBA 3RBWA 4BCJA 5I0BA 1NT2A 3OUNB 3KXXA 4ZSJA 2EUFB 2ZVAA 3ENHA 3FZOA 3P79A 3THBA 1OKWA 3E8EA 4GVJA 4UMQA 4CVAA 2JKMA 4IB0A 4OT5A 4DITA 1ST0A 2JIVA 3HV3A 3DXPA 5HX6A 3FMEA 3O0GA 4JVGA 2ITUA 3R1SA 4CRSA 4QTEA 5J87A 3A2CA 2QO7A 1KUTA 4DT8A 4F7NA 4DGLC 2YM5A 4BDBA 4J98A 3A62A 3TTIA 4IWQA 1OL5A 3MIYA 4U81A 3ZBXA 5LXMA 4DTBA 4AF3A 3QZHA 5EFQA 2YIQA 4KNBA 2O2UA 2C0OA 3COMA 4FRFA 3A4PA 5DIAA 4O0VA 2PZPA 3GUBA 4DEAA 4YLLA 4RIOA 2B54A 3G0FA 3ZRLA 4BGQA 3AC1A 2CKPA 5M57A 5BVEA 2F7ZE 1ZWSA 3NNWA 5GHVA 4BZDA 1YDTE 4TT7A 5AUXA 4AACA 5LVOA 3LMHA 2BAJA 2Z7SA 3OP5A 4OTDA 2QG5A 5GJGA 4CD0A 4BGHA 5JSMA 1PF8A 2R3NA 2Z7QA 3V8SA 4JAIA 5T68A 2C1BA 5LCKA 3VUKA 4EKKA 2X0OA 5FBOA 3VJOA 5IKWA 2H9VA 3DBDA 4JMQA 1RDQE 3MV5A 1PMUA 2WQBA 2XALA 5DT4A 3HUCA 4MUQA 2FB8A 4RSSA 4DGNA 2PMOX 3GU6A 4GYGA 2PYWA 2ITWA 4R1YA 2QKWB 2WMUA 3LM5A 3PA4A 4H58A 1FVVA 2HK5A 3HA8A 4XEYA 3FMDA 4BL1A 2ITPA 3PSCA 3DXNA 1XH9A 3UNKA 3NRMA 4FX3A 3QC4A 3SV0A 4PDSA 1MRUA 2VO0A 3OT3A 3I60A 1PXMA 3UMXA 5HOAA 2JDVA 3NUPA 2FUMA 4NJ3A 1G8KA 4NM7A 5ANIA 1O6YA 5CAUA 4CZUA 5J95A 2B9HA 4K11A 5GIOE 4S32A 1QPCA 3E87A 3EN6A 3SC1A 3GC0A 3O96A 3CC6A 4RQKA 4BI1A 5HCZA 4GUBA 4FTMA 4I6QA 3N51A 2WTJA 5DRDA 4E6AA 3ZRKA 4B8LA 4HVSA 5CU0A 3RK7A 1GIHA 1WVWA 2YM7A 3FYKX 3VNTA 4LG4A 2C5OA 3TZ9A 3ULIA 5ITAA 3N4UA 3AGLA 4LV7A 3HMOA 4BCMA 5BVOA 3QZIA 5CWZA 3PLAE 5HEZA 5KNJA 4GIHA 2OXDA 2PWLA 5FXRA 4EK4A 3CS9A 3KXGA 4FSYA 2QR8A 4ASZA 3AKJA 4I6HA 3ET7A 5C01A 1ERKA 1J1BA 3HX4A 4ZTRA 5CEQA 2OJJA 4L53A 4AW5A 4F0IA 5J1VA 4R78A 4UALA 2QKRA 4HJOA 4MQ1A 4BRXA 4AXEA 2Y7JA 4KWPA 4OTQA 2J0IA 3MH0A 1VLRA 2ZB1A 2XF0A 4C4JA 3HGKA 3JVRA 3KN6A 4C3PA 1QMZA 3QRJA 4RA4A 5FBNC 1W0XC 3WBLA 4RX8A 2PE2A 4ZLOA 2I0EA 4XG4A 4BDAA 2OZOA 4NM3A 5H8BA 3KEXA 4C2VA 2WTDA 1S9IA 2XRUA 5C26A 3KGAA 5JN2A 2XK8A 3GU8A 5BUEA 4JJRA 4EH3A 2VN9A 4FEWA 4FKPA 2IVUA 2EB2A 3DQXA 3EFKA 4CTBA 4J96A 4Z9LA 5F4NA 2YCQA 3PXZA 3R22A 4FT9A 3QLGA 2E2BA 3RWQA 4BIEA 3DZOA 4FL1A 4U5JA 2ITVA 4JQ8A 4AE9A 3I7CA 2RL5A 3HA6A 2JDSA 2C3IB 1NW1A 2RSVA 4YSJA 1JPAA 2YWVA 2C5YA 2QO9A 3VUGA 4IAZA 4IAYA 3BYUA 4IJPA 2VWXA 4CT1A 4PMSA 4ZOGA 3MFUA 3MWUA 4KIQA 3B2WA 4ASXA 2P55A 1SM2A 1YXTA 3VUHA 2OJGA 5CF5A 1LEWA 3W2SA 1FGIA 5K3YA 1TQPA 1P5EA 3DU8A 3R21A 4ZTLA 3UQFA 3NUYA 4DG3E 2F2UA 4XV1A 3Q9XA 2C0IA 3EQCA 3R9DA 1ZMVA 5GNKA 4BZOA 5ANEA 4IAKA 1PRYA 4DN5A 5D7AA 2BMCA 5DE2A 3NW6A 5CF4A 3EZRA 2WPAA 2C5NA 3Q4CA 5M4IA 4XBUA 2GSFA 4QP8A 3W0QA 3ORLA 3DNDA 1URCA 3CD8A 5JQ8A 4ASDA 4F9BA 4PRJA 1YOMA 4HGSA 1A06A 3IW8A 4QMZA 3G33A 1H8FA 2YZAA 4FOBA 4FNZA 5JMSA 5M06A 2XVDA 4FTRA 1FVRA 1YHWA 4MTAA 2QO2A 1CDKA 2Y8OA 1JKSA 4V0GA 2HY0A 2UW4A 4WNMA 3R71A 5E8YA 4O0SA 5IISA 1ZYSA 5E9EA 4FGBA 1B6CB 3TZ8A 3FL5A 4CLIA 4PWNA 4D0XA 2PUUA 4O0YA 5EI8A 2RIOA 5HTCA 3IW6A 3VS6A 4FTAA 4CRLA 3KREA 5K9IA 5CU2A 5BPYA 1CTPE 5H8GA 3QL8A 3TKUA 3AC3A 4CCUA 3POZA 3KRXA 2VTTA 4G5PA 4K6ZA 4LL5A 4HZRA 2X6DA 3LW0A 4P5ZA 4CCBA 4IB3A 1T46A 1RQQA 3KRRA 3ALOA 5M55A 1NVQA 2OKRA 2ESMA 4USFA 5M08A 4TYGA 5JRSA 5GJDA 3WF8A 2VTAA 3G5DA 2PVNA 3M2WA 3QKMA 4QP9A 2XNBA 2XJ0A 3LZBA 4FTIA 1KE8A 4JQ7A 2CCIA 3C0IA 1UU8A 2QOLA 4L3JA 2FVDA 3L8VA 3RM6A 4PDYA 3ORKA 3EQHA 5AP5A 2PZ5A 2W1HA 2X9EA 3PA3A 4U41A 1W8CA 4EH5A 4QT1A 2AC3A 5FP5A 2J5EA 4CMOA 1XH5A 3PVBA 1FVTA 2GMXA 3HKOA 4N4SA 1OL1A