2JD5A

Sky1p bound to npl3p-derived substrate peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
353
Chain Sequence
FHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE SKY1
publication title The Rgg Domain of Npl3P Recruits Sky1P Through Docking Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 102
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jd5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jd5A01
5EKNA 3R0TA 4IVBA 3KMWA 3SW4A 1H8FA 5E8XA 4EH4A 3BGQA 3I0QA 2X9FA 4FI1A 2QG5A 4BGQA 2F7ZE 2BTRA 1VR2A 4HVHA 3MVJA 4BCGA 2J5FA 3CQEA 2W1EA 5KMLA 3DXQA 3IW7A 2IZSA 3HNGA 4TKSA 2YM4A 2QOHA 4GUBA 4XP3A 4BCOA 3KRLA 3QCYA 3IG7A 3R02A 4I4EA 4O0RA 4ZJVA 5JGBA 3VIDA 5IQIA 2YIYA 3PVGA 5HLPA 5GZ8A 5KUPA 3QUPA 4TXCA 5CSVA 3KL8A 4FEVA 1H1WA 3VBWA 5L2WA 2CJMA 3UG2A 5J7HA 3NIZA 3IOPA 3R7VA 5K0XA 4I0SA 4K77A 2GFSA 2W1ZA 4PMTA 3W2CA 3R8UA 2C6DA 4OTPA 3MJ1A 4K1BA 3HUCA 4I24A 4LRKA 3FL5A 2W4OA 4RC3A 4J95A 1CTPE 3EQHA 4X3FA 3R9OA 4HYSA 3AT2A 3RCJA 1YWNA 4G16A 4C4IA 3VN9A 4AFEA 4I4FA 5AM6A 1JNKA 4U45A 4G17A 3AXWA 1BX6A 2PHKA 4JJRA 1S9IA 1YHWA 4QTAA 5LMKA 3TCPA 3F3WA 4CV8A 4GSBA 4QYYA 2UZWE 3OCSA 1FVRA 4PPCA 4ZK5A 2VTOA 3EN4A 3BU6A 3NEWA 4QMXA 4KKEA 4TRLA 4EWQA 2PTKA 2VO0A 3FMLA 3HDNA 5JKGA 2QQ7A 3DBCA 5FRIA 3FMJA 4KIPA 2XNMA 5EW9A 2OG8A 3VO3A 5JFWA 4PNKA 3PTGA 3AC1A 4BDCA 4GT5A 4AW0A 2YM6A 2PWLA 4FTKA 5CF4A 4KSPA 2YFXA 1J7IA 1M52A 2UZOA 3L9LA 4FT0A 4BCMA 3OUKA 4UV0A 4C4EA 5IQGA 1UV5A 4LUDA 2FSTX 4BDAA 1PXKA 3UO5A 5E8VA 5GNKA 3QUDA 5LARA 3Q04A 2FSMX 3CIKA 4BGGA 5HTCA 5HIEA 4KRCA 2A4LA 3OXTA 3VBQA 4USFA 4EH8A 3U54A 2P33A 4RFYA 5HNIX 4BKZA 4RIYB 2A0CX 5C1QB 4YUQA 2PVKA 2XNGA 5HO8A 3OWKA 3TXOA 2W9ZB 2FYSA 4HVIA 3GQIA 4X2JA 5AV3A 5DR6A 3TT0A 4PMMA 3P08A 5CVHA 4Q5EA 2YDIA 5AV2A 4ANLA 4EQMA 1JAMA 4S30A 2VTSA 4MK0A 3BCEA 5KNJA 2IWIA 4D55A 3JXWA 2HY81 3FLSA 4OBOA 1JSTA 4XLVA 3OY1A 5BNJA 1ZMVA 3F3ZA 5LVNA 3QQUA 2GQGA 4GK4A 2O8YA 2C1AA 3SGCA 4TZRA 2WMAA 1WFCA 3SXSA 4AUAA 2XEYA 5AUYA 4DT9A 4CCBA 4IHPA 4OTFA 3OMVA 2BZHB 3KF4A 2GU8A 3R63A 4PRJA 3UIXA 5F9EA 3GU5A 4IVDA 4JX3A 4CTCA 5M44A 2ZV9A 3SW7A 2W1DA 2WTWA 3DB6A 4IB0A 4WT6A 4BCQA 4DGGA 1LEWA 4AAAA 4IM3A 4OTIA 5CNOA 2PMLX 3E8DA 3HYHA 1Q3WA 4GRBA 3UQFA 4KBAA 3P7CA 4YJQA 3D4QA 1QPCA 1NA7A 4G34A 4GCJA 2J5EA 3TNPC 1JLUE 3P1AA 1XH5A 4RRVA 5K4JA 4KKHA 3HP5A 2VO6A 4EZ3A 4DFBA 2JFMA 1UU3A 2XH5A 2B9HA 4IB5A 4PDYA 2ZDTA 3KXGA 5EM6A 1Q97A 5G6VA 4XUFA 1QCFA 2ETRA 5M4UA 3U4WA 4LMUA 3R1SA 4OTDA 3PLAE 1ZYSA 3BI6A 3F66A 4MBJA 2XNPA 4EOIA 4YJRA 5KHWA 2HWOA 5AADA 4D4RA 2ZVAA 3OWPA 3PSCA 1E1VA 3FUPA 3NUYA 4D2VA 1SZMA 2F49A 3FE3A 5IKWA 2X2MA 4XMOA 1LR4A 1HCKA 4MF1A 4TNDA 4F1OA 4D0WA 2OBJA 4WRGA 4RZWA 4EYJA 3KY2A 3GU4A 3D15A 5TR6A 2VD5A 4AG8A 1KE5A 2BFXA 3TTJA 3UNKA 3KK9A 5CEIA 2Z02A 4AE9A 4FTTA 2J2IB 1STCE 3ODZX 4YJTA 4DT8A 3PG1A 4FL2A 4YZCA 5A3XA 3TKUA 3I1AA 2XIXA 4HPTE 1OL1A 3C13A 5HBEA 4U79A 2R2PA 2XK7A 4I0RA 4QYFA 4EONA 3Q53A 3RKBA 3P7AA 3NNVA 1U5RA 4OTWA 1B6CB 5E8YA 4FODA 3HP2A 3EZVA 3SC1A 1H25A 2J9MA 3RPRA 4FIJA 5IPJA 2X2LA 3PSBA 3IOKA 5EYMA 1XO2B 4FIEA 1OB3A 3M11A 3QD3A 2B53A 1VYZA 3ORPA 5FXQA 1UKIA 3LQ5A 3HGKA 2YZAA 4F9WA 1H26A 5AP3A 4UWYA 4IWOA 4ZY4A 4NL0A 5M06A 4YSJA 2XIKA 2VRXA 4CFFA 1MUOA 2X4FA 5HNBA 3WIGA 4Z7HA 4L46A 2GNIA 5AX3A 3LZBA 5EQYA 3LMIA 3T3UA 2HENA 3CTHA 5K0KA 1LUFA 4HNIA 4YU2A 5CY3A 1U59A 3GU6A 5EG3A 4FT9A 4RJ8A 5BYZA 2IO6A 1XH4A 4CFMA 2BVAA 1FVTA 1DI8A 4E6CA 1YXVA 2XIZA 3DK3A 3Q52A 2ZMCA 3FC2A 2FSLX 1SVGA 2BFYA 3KCKA 3BBWA 4IW0A 3QFVA 4JBPA 3P4KA 3FXXA 3QWJA 4P4CA 5J5TA 2WAJA 4UYNA 3QAME 4R7IA 4QP4A 4F4PA 4R6VA 5CEQA 5FTGA 2FB8A 3AQVA 3C4CA 3AMBA 3QF9A 4YLKA 3RI1A 4G3FA 2JDTA 2PZRA 4CVAA 1OM1A 4KNBA 1YOLA 3EH9A 3TG1A 1BKXA 5DE2A 4C37A 2AC5A 3EFLA 2RSVA 4IAZA 1Q99A 3EN5A 3KXXA 3NYNA 5FP6A 4ZEGA 3DKFA 1OUKA 2B9FA 4ARKA 4ZLZA 4ANBA 2BRMA 3QA0A 3UVPA 5KMJA 4RX8A 3COMA 3EFWA 3WF6A 2OW3A 4MD9E 4DEHA 4AQCA 2CLQA 3DJ6A 1ZYLA 4I3ZA 4C35A 2VTNA 3CP9A 4YZNA 4GG5A 4CFWA 3OXZA 3O17A 5LVOA 4DLJA 2PVFA 4FT5A 4XP0A 4AW2A 5BMMA 4RC2A 3TIYA 3LFAA 4LOQA 3CCNA 5AP1A 5IA3A 4DFZE 4O7YA 4JBOA 2C6IA 4HGEA 3L8VA 2GSFA 3ORIA 2F7EE 4IDTA 3CLYA 4M0YA 4AT5A 4CGAA 4EOKA 5EOBA 3QD2B 3D5XA 3LM0A 3BQRA 4RGJA 4U5JA 3O51A 4YHTA 1BUHA 1U4DA 5M57A 4DC2A 3E8NA 2PE1A 3V5QA 4NW5A 2IZUA 4AW1A 4PDPA 4EL9A 2C5VA 3PPZA 2OJGA 3HVCA 3RK5A 4O7RA 4EK6A 3Q4TA 2WQMA 3D5WA 3ZLWA 4U3ZA 2YA9A 4XRJA 4O21A 4YZBA 5M4CA 4F0IA 2HYYA 4U9AA 1DAWA 2QOCA 3R7UA 4EQCA 5ICPA 3NAXA 5LXMA 3E3BX 3E93A 1M2PA 2VWUA 1P4FA 4I5CA 3B2TA 3JUHA 3AC3A 5CSHA 2B52A 4ZTMA 2XJ1A 2YM8A 4FKWA 4L68A 5C26A 3NNUA 4CMTA 4E4XA 1ZMWA 3G2FA 4MD8E 2BPMA 4M69A 1J1CA 3I6UA 3PYYA 1A48A 5M55A 2ITQA 2WTJA 4CXAA 1OPJA 4BBMA 3EYGA 4D58A 4XBUA 4LRMA 5CQWA 5HLWA 4BGHA 5M53A 4O2ZA 3DKCA 4DFUA 5DNRA 5CU4A 2RG6A 4FG9A 4E6DA 5AFVA 2BZIB 4CCUA 3RAKA 2X39A 4FSRA 4FV6A 2OSCA 3FSKA 4NCTC 4I5HA 4E6QA 2CGUA 5DRDA 2VTRA 4I23A 3EL8A 4QP1A 2GNJA 3HV3A 3EFJA 1Z57A 4H1MA 3V8SA 1PYXA 4DBNA 5AAFA 5J95A 4D4SA 2P0CA 2X6DA 3Q9WA 4FZ6A 1I44A 1JSUA 4IAFA 4D1ZA 4RJ7A 4ANSA 4NTTA 2C5YA 1H1PA 3KB7A 2IZRA 1ZOGA 4FUXA 4FVPA 4JLCA 2GHGA 3LFCA 3LCOA 2FA2A 3TI1A 4YJSA 4D4VA 3LCKA 2CDZA 2ACXA 1OL5A 3FYJX 3NCZA 2J0LA 5CASA 5AAGA 3UZPA 1ZRZA 3VS5A 3FKOA 4JR3A 4IX3A 2ITUA 2RF9A 2YIQA 2OK1A 2WMSA 5DRBA 3PA3A 3PIZA 5HO6A 4BKYA 1M17A 5A6NA 3S1HA 2IVVA 4KIKB 2XK4A 5AP7A 2PVLA 4FV4A 3FLNC 4MWIA 3BWJA 1GZNA 2W4KA 3C4ZA 5IEVA 2OF4A 1K2PA 4NKSA 2C3IB 2VWWA 3F2AA 4IBMA 1W7HA 5JRSA 3RZBA 4AZVA 4EYMA 3ATTA 3EQIA 2E9UA 4DH3A 3A7FA 2O63A 3ANRA 5DBXA 3VUHA 4GL9A 3TKIA 4DG3E 3SA0A 4AP7A 2ZM4A 4G5JA 2F2UA 4D28A 3DDPA 3QTQA 3GOKA 2ZAZA 3FMHA 2OWBA 1G8AA 3C4EA 3TV4A 4IFGA 4N70A 5L6OA 3FEGA 3KXHA 3P9JA 4IAYA 4PTEA 5F1ZA 3LXKA 5IQFA 2BZJA 3RALA 4U80A 3CXWA 4HGSA 4D4YA 2BRNA 4L3JA 4IFCA 2YJRA 3LFNA 2YCFA 5E9EA 5J9LA 3HV4A 4F7LA 4OAUC 4OW8A 3QTXA 2WQOA 3S4QA 2R3GA 3O96A 3UE4A 3G6GA 3POOA 2UW6A 3TKHA 3ZO1A 2RG5A 2JITA 3T9IA 3DOGA 1W82A 3GC7A 1WBWA 3ORZA 3QGYA 3ZO3A 3AC4A 3JY0A 4FL1A 5AUUA 3LPBA 3BYOA 3KMMA 2HXQA 4BCNA 3MH0A 4R7HA 1DS5A 3R7YA 5HE1A 2XJ2A 4CMUA 1WVWA 2WNTA 1XH7A 1AQ1A 2R3PA 3DY7A 5L8KA 3R04A 2BILB 3OT8A 4FTIA 2OZAB 4OT6A 3WF8A 4J53A 5T6KA 5E90A 4MD7E 3AG9A 2YM5A 4IAKA 4DH5A 4DLIA 5JGAA 5FWKK 4ZSAA 2NNWB 4QMLA 3COIA 1F3MC 2BROA 1WMKA 2XKFA 3CJGA 3WI6A 2R5TA 1QPEA 3BEGA 4RWKA 2WTCA 4I93A 3MVHA 5JN2A 3O7LB 5T3QA 4GU9A 2QOQA 1JQHA 2Z2WA 4RVTA 3V04A 1JKKA 2XS0A 4I22A 2R3JA 2OJ9A 2WO6A 3P78A 2W4JA 4WNKA 3GNIB 5ETFA 4ASDA 1FGIA 4E5WA 3KMUA 3UZTA 4A9UA 4MH7A 5KBRA 1URWA 4TTHB 3NW5A 4QPSA 4U40A 4UYAA 5GIOE 4M68A 2CNQA 4BYJA 4XV3A 2C0TA 2WKMA 4ZS4A 3Q5ZA 4QMNA 3QZFA 2C6MA 4LFIA 4W4WA 4XOYA 3VW6A 4C2VA 1OL7A 3B2WA 5CF6A 5IF1A 4A4OA 3FZSA 4EH9A 2B54A 3D94A 4K0YA 4FSUA 1YI6A 4TWPA 5I9UA 2HZ0A 3OY3A 4MXZA 4CQGA 3UNZA 4U42A 4FBXA 4FC0A 3VS7A 4DYMA 3U55A 3QRKA 3C4FA 3LW0A 4P5QA 4J98A 4XP2A 1XJDA 2WEIA 5LMBA 4M67A 3AT4A 4YC3A 1V0BA 4AT4A 2BHEA 2XBJA 2ITOA 2QR7A 4TYGA 1GZKA 1YHVA 2QHMA 3O71A 4XEYA 5ETAA 1UA2A 4RIXB 4Y8DA 3O50A 4MF0A 5EM5A 2HOGA 3Q32A 2DWBA 3SRVB 3G33A 1GY3A 4WHZA 3PXKA 3R73A 3QHRA 5CENA 3C5IA 4EHEA 5HBJA 4O7VA 4LYNA 3HV6A 4M13A 3QC9A 4G9CA 4WG3A 2YLEA 3QCXA 3ZTXA 3AC8A 5AJQA 5B0XA 5HI2A 5AUTA 1Y91A 4I94A 4WO5A 3VS3A 1B39A 4EUUA 4XG7A 4MYGA 3U6HA 4YLJA 3UQCA 4QYHA 3R7GA 3A4OX 2OFVA 2LGCA 4KS8A 1HCLA 3HL7A 4F6SA 2VWIA 4GFMA 3DBFA 4OGRA 3VUIA 4FSYA 3ZS5A 3ZU7A 5IDPA 3EJ1A 3LMHA 1QPDA 4BN1A 4MCVA 2X8DA 5JMSA 4IWQA 1JBPE 3DFAA 5JSMA 3ZXTA 2R9SA 4IH8A 4GYGA 5EI8A 5TF9A 5IQBA 4JI9A 4AS0A 3QD0A 3MY0A 3R7EA 4CD0A 4D2SA 3PZHA 5CEOA 5IA2A 2OICA 4RLKA 4U97A 5ANGA 2ESMA 4RIWB 4O27B 2W1CA 2A19B 1OKWA 5H8GA 4C4GA 2J0IA 2Q0BA 3G0FA 3KRRA 3L9PA 3SVVA 3NLBA 4FG8A 3RAIA 2BIKB 4J8MA 3PDTA 4DTBA 1UU8A 3R7OA 5AP6A 1JKTA 4NH1A 5I9WA 2RGPA 1VYWA 4E4LA 2JIUA 2YERA 2F57A 2WQNA 3VW8A 2VTAA 2X81A 5JK3A 3RAHA 3SDJA 4FV3A 3EQBA 3QCSA 5F4NA 3OZ6A 2XB7A 1V1KA 4PPAA 3GFEA 4V0GB 5DR9A 4AOIA 3UOHA 1Q5KA 4BDDA 5CANA 4WUNA 3F5GA 4YZMA 5KHXA 4FV1A 3R1YA 4H36A 4QTCA 5H9BA 4UN0C 4XV2A 4X7QA 5AV0A 4NJDA 3L9MA 3GENA 4YPDA 4X6RA 3UOJA 1Y6BA 2UVZA 4KRDA 3ZYAA 5AV4A 4GFGA 3DB8A 4MXOA 1CKPA 4KIQA 3LIJA 5IQDA 2VX1A 4PTGA 4FKQA 3ORXA 3DJ5A 4NM3A 2OH0E 5CTPA 4JT3A 3NUNA 4N6ZA 1H0WA 2QO2A 2UZVA 3AD6A 3JVRA 3NUPA 2ZOQA 3PWDA 3EOCA 2QR8A 2NP8A 1PMUA 3VQHA 4EZ7A 1VEBA 3TZMA 4NJ3A 4QMTA 2QU6A 3CPCA 1CKIA 4DFYA 3HZTA 5DPVA 2WU7A 3EMGA 3BZ3A 3ORKA 3BX5A 5IISA 4BFMA 4C3FA 1PMNA 2DQ7X 2FVDA 5DN3A 3VHEA 4A4LA 4ALWA 4IM2A 3OTVA 4V01A 4ZSJA 3HV5A 1E1XA 3LLAA 3JVSA 1QMZA 3K3IA 4NIFB 5HVJA 3NYOA 4PNIA 3W1FA 4ZLOA 3QTZA 4LV5A 3OG7A 4GV1A 4DCEA 4NWMA 3PPJA 4FV5A 4RMZA 3C0HA 2J6MA 1CKJA 1WZYA 3BV3A 4IB1A 3QRTA 3LM5A 1MQ4A 2UZBA 4KBKA 1ZZLA 3AMYA 3CBLA 3GT8A 4EWHA 4IEBA 1PKGA 3RPYA 4E5AX 3BU3A 3MW1A 2QOOA 4XV1A 1YXXA 3OROA 4BTMA 3WF9A 4U3YA 4ANOA 4YJOA 4E3CA 5DH3A 3NW6A 4ZSGA 4FKUA 3KC3A 4UMPA 3UP7A 1UKHA 4F1TA 4GKHA 5J79A 1Q62A 4RC4A 1OPLA 4D2TA 3POZA 3Q4ZA 5AIRA 1REJA 4CFVA 3R1QA 3A4PA 5DVRA 5FUTA 2YHVA 5BUJA 3DS6A 4BWXA 4N57A 4CLJA 5JT2A 3PVUA 4GIIA 4J96A 4JDKA 4ALUA 4R7BA 1J7LA 2X7FA 3NUSA 3TIZA 1XWSA 3NCGA 5M07A 2EXEA 3DLZA 4QQ5A 4AZTA 3FI2A 3KVXA 4BDFA 2ONLA 4JBQA 4WBOA 4DEEA 4MXAA 5EQPA 2CN5A 2WIHA 3Q9XA 3H9FA 2DYLA 3WZUA 2ETKA 2XNOA 4TW9A 1YDRE 3PJ8A 4AW5A 2JKKA 2R4BA 2Y6OA 3GUBA 4IC8A 4OTQA 5FTQA 1T46A 2A2AA 3AMAA 3MPTA 4RIYA 1SNXA 2FO0A 4YR8A 4IANA 2CGWA 1LEZA 2PMIA 2YCSA 4PPBA 3VBTA 5HORA 5CT7A 5L2TA 5DGZA 5C8KA 4FKPA 3KFAA 5CZHA 5AR2A 4FIIA 4ZAUA 3U6JA 3FY2A 2UZDA 3R8MA 5FD2A 5JZNA 4DN5A 2Z7QA 3FDNA 3MFUA 4FGBA 4FKGA 3FL4A 3QWKA 4C4JA 4F9CA 3FZ1A 2JBOA 2EWAA 3FHIA 4DH7A 5A4TA 4F63A 3UPZA 3BQCA 2ZM1A 3CTQA 4K6ZA 4X2FA 4DA5A 1UU7A 3DZQA 3EKNA 5IQEA 3T9TA 3UG1A 2QD9A 4TYHA 1WBPA 2ZV7A 4YJNA 3VS2A 4S34A 3BBTB 3KXMA 2WTKB 5FBOA 4ZOGA 3NUXA 2R7IA 3LFBA 5F95A 4E1ZA 4CG8A 2OI4X 1O6LA 2YWPA 4AZFA 1PY5A 2JIVA 2QNJA 4O0TA 3V5PA 3WYXA 4B0GA 1BMKA 4XX9A 2W5BA 3ZEPA 3O0GA 2XJ0A 5KZ0A 5EI6A 2JDOA 3KK8A 3OWJA 3R7IA 3LLTA 1BL6A 3LFFA 4PP7A 4GVJA 2QURA 5B2LA 3FQEA 3VNTA 3JR1A 5BYLA 2EXCX 3L8SA 4YZ9A 3LFSA 3KA0A 3NWWA 2GMXA 4O0XA 4QMZA 2WMBA 2XA4A 4P2KA 4EH5A 4EH6A 3UC3A 4B9DA 4M7IA 4XH6A 5T68A 3ITZA 1DI9A 2W0JA 5HCXA 4EJ7A 1KWPA 1YXSA 4Y72A 4D5HA 4OTRA 4H05A 2CGVA 3E8EA 1BYGA 1Q4LA 2WPAA 3G9NA 4GJ3A 4RJ4A 3RM7A 2W05A 3A60A 4QD6A 3LXLA 4D2WA 3PLSA 3ZSIA 5DIAA 3EIDA 3MA3A 1ZXEA 4FTAA 3TV7A 4CYIA 4CKRA 4EC8A 4MQ2A 3TV6A 4BDBA 3BHHA 4BCKA 2QLQA 3C7QA 4QMWA 3FLQA 1PXIA 4Y5QA 3KRXA 4QP3A 2PK9A 4E4NA 5J1WA 3OW4A 4YO6A 3BHTA 4UXQA 4NEUA 3UVRA 4FNZA 3E8CA 5ITAA 3NVMB 5CI7A 2B7AA 5E8WA 3LCSA 5GZAA 1UWHA 1Y8GA 4DEGA 4A06A 2VTIA 3R6XA 2G1TA 3HX4A 2WGJA 2PYWA 3SXRA 4HCTA 4ID7A 3ZRMA 3MV5A 3IGGA 5C27A 4GKIA 2V62A 2YWVA 5LMAA 1OBDA 4DG0E 2W1IA 4B4LA 4Y95A 2BDWA 5B7VA 4FK6A 2OGVA 5JH6A 2WXVA 4IJPA 5JRQA 2IZTA 3EQDA 4A9SA 1PXJA 2YAAA 3IW8A 3KEXA 4C3PA 2R3MA 4CKIA 3F2NA 4F09A 3KVWA 3E87A 5D11A 5DA3A 2R3RA 2RIOA 4WSQA 5CEKA 1M2RA 1R0EA 1YWRA 4G31A 2O5KA 3F3TA 5HCYA 1FGKA 4QMMA 3TN8A 5ETCA 5A4EA 4DGOA 4C8BA 2Y7JA 4D1SA 1NW1A 1P4OA 5EYDA 2UZNA 3DCVA 4JRNA 2KULA 2YITA 2UUEA 3D9VA 5IUHA 5AMNA 4G5PA 2XZSA 3R8ZA 3TM0A 5HESA 4TN6A 5LOHA 2AUHA 5CSWA 4M15A 3CJFA 1CSNA 3QX2A 4I20A 4FICA 4OLIA 3IDPA 4QOXA 3UIUA 3CY3A 2VNYA 4QYGA 4ZZMA 1J91A 1H28A 2E9OA 5BVEA 3RWQA 2RFEA 2XYUA 5J8IA 3H9OA 5B2KA 4X3JA 2G2FA 3I5NA 3MSSA 5EHLA 4C7TA 2H96A 4EKKA 2E9PA 4ZLYA 3DBDA 3W8QA 3LFQA 4BVUA 5D9HA 4PL3A 2QI8A 5L8JA 4JXFA 4O0WA 3DTWA 5EHOA 4GK2A 1TQMA 1FVVA 3V01A 2VWVA 2JEDA 3COHA 1OKYA 3PY1A 2O0UA 3PA4A 3V3VA 2YJSA 3CS9A 4NM7A 4QMOA 5DT3A 2GNHA 2UW7A 2WFYA 2VTPA 4BDIA 3WIKA 4ENXA 2HXLA 1BI7A 1WVYA 2QOIA 4BYIA 4EOLA 3ATSA 3R9NA 4A9RA 5CVGA 3LQ3A 2JFLA 2PULA 2PUIA 2PMNX 4D9UA 1Q8UA 4NYEA 3A7GA 1OITA 4J8NA 4L3LA 2DUVA 3VS1A 3S0OA 4XJ0A 2W1HA 2GHLA 5HE0A 4O7NA 4EI4A 4R77A 4O0UA 5HX6A 2OJIA 4WSYA 4F9AA 5IH5A 3D7TA 3G6HA 4PUZA 5H8EA 1OVEA 2QODA 4KIOA 3ZC5A 3O8UA 3RK7A 1WBTA 4QQCA 3EFKA 3DXPA 5AP4A 4PF4A 1YWVA 4L8MA 4DAWA 3R8PA 4EOOA 3QTIA 4FKVA 3OF0A 4IZYA 4B99A 2X7OA 4EH3A 2EXMA 1NVQA 4ZP5A 2XF0A 3K5VA 5IA5A 2O65A 1U54A 3FMNA 3Q60A 3R21A 2HELA 3BWFA 1Y8YA 2GQRA 4USEA 3E7OA 3O2MA 3DJ7A 2BDFA 1U46A 5C8NA 5AUVA 5CF5A 2HZIA 2BR1A 4FEUA 5AEPA 2J50A 3D5UA 2VNWA 4JDHA 1XH8A 4ERWA 4YTFA 1P14A 2XNNA 3O23A 3LKMA 2Z8CA 4RJ3A 1OZ1A 3PJ3A 2BAJA 1MP8A 3FWQA 3FC1X 2VU3A 3R2BA 4ASZA 5HU9A 3W2PA 5A54A 2IW9A 3DGKA 2QHNA 4BZDA 4IQ6A 2ITTA 3BLHA 4C36A 4EHGA 4RA4A 3BRBA 3NAYA 3PXFA 1GOLA 2JIIA 3DKOA 2OXDA 2YCRA 5HVYA 1Q61A 3IO7A 1XHAA 2P2HA 4X6QC 5I9XA 4C3RA 4DGNA 3RNIA 1JPAA 4FT7A 4S32A 5EM7A 2JAVA 2E2BA 2GNFA 1Q8TA 2QOBA 3V5TA 4MVFA 5IQCA 3KN5A 4NT4A 4PMPA 1G3NA 2WB8A 4XYFA 4QNYA 3UBDA 4BCIA 1ZYCA 3HEGA 3BPRA 2BKZA 4CQEA 4C58A 4FTUA 3E5AA 5HQ0A 4J71A 2ETMA 5E8ZA 5AR5A 4CNHA 4V04A 3SG8A 1NT2A 4DG2E 5C4LA 2B9JA 5EYKA 2QONA 4QP6A 4HYIA 1MQBA 3HRCA 3ZEWA 5EW3A 4AZSA 4Z3VA 4TL0A 4KINA 4NW6A 3NYVA 2PY3A 3EZRA 2R0IA 3PXQA 3QLGA 3ZCLA 1URCA 4FG7A 3MFRA 4FYNA 4ACDA 4MAOA 3C1XA 4N0SA 2W96B 5CF8A 4BI0A 4UEUA 1W8CA 4O7TA 2IVTA 1L3RE 3RPSA 4F64A 3PUPA 3TDWA 2JC6A 3ETAA 3IW4A 2ITNA 3F2RA 3UZRA 5FDPA 5IUIA 4RLLA 2VWBA 2CCIA 2GTMA 1O9UA 3NW7A 3OWLA 3DU8A 3E62A 4II5A 5FQDC 3Q2JA 2C3LA 3NS9A 3OCTA 4RQVA 3MESA 2RFNA 5CSXA 5DOSA 2UZTA 4MBIA 5G1XA 3G15A 3FMKA 2JKOA 2DS1A 1YI3A 3FLWA 4QMSA 3H9RA 4ZTLA 3W16A 2V7OA 3ZLYA 3BLRA 3E3PA 3HAMA 5EW8A 4E6AA 2UW5A 3M42A 3RJCA 4ORKA 2WZJA 4BB4A 4R3RA 1F5QA 4CLIA 2QVSE 4FKRA 2JDRA 5IU2A 4O7ZA 5JFSA 1S9JA 1F0QA 3MH1A 3GEQA 1TQPA 4A9YA 4IC7A 3VUGA 3ERKA 1GZOA 4IJ9A 3VVHA 4HOKA 2JGZA 5AR4A 4I41A 3VF8A 2F9GA 3TZ7A 2HWPA 3ACJA 3VS4A 4F9YA 3MGYA 3R2YA 1KV1A 2ITPA 5DT0A 4WBBB 2PVRA 4O2PA 3TJDA 4ANQA 4BIBA 4TYJA 2BIYA 4OTHA 3BYUA 5K5NA 4O7SA 4F0GA 2W7XA 4DEIA 5GZ9A 3IS5A 3IECA 3QU0A 3NYXA 3P7BA 3V5WA 4YTCA 4BI1A 2XKDA 4UZHA 4WIHA 2I40A 1CMKE 2R64A 1KOAA 5DT4A 3EQPA 5FEEA 3PY3A 3ZMMA 4CRLA 3NSZA 3CSVA 3QXPA 3UGCA 3WILA 3VF9A 3SOAA 2C5NA 4L7SA 3RBWA 3E63A 4ALVA 4ZSEA 4HGLA 3ULIA 2R3LA 3I81A 4TNBA 4YP8A 3QCQA 4HNFA 4CZTA 2C6KA 3NUAA 3Q2MA 2ERKA 2BRGA 1G8SA 3RTPA 2WMWA 3BV2A 3THBA 3VRYA 4ASEA 2G15A 4OR5A 3WE8A 2YIRA 3F7WA 3GCPA 3Q9ZA 4RQKA 1YDTE 5CAQA 3CEKA 2XP2A 3EN6A 5FTOA 4U44A 4OTGA 4GJ2A 4RJ6A 1UWJA 2JBPA 5GIPE 3SQQA 3OXIA 4JOAA 3UDBA 3RAWA 3TNIA 3TNWA 3ZONA 3BHYA 4M66A 1RQQA 3C4WA 4IWPA 4TWNA 1OPKA 3FYKX 4O96A 2CN8A 2XRUA 2Z60A 3L8XA 5HIBA 4JR7A 3R9HA 5LCJA 4AGWA 5TE0A 4IE9A 4M12A 3I4BA 3Q6UA 5C8MA 1AD5A 3D5VA 4FTRA 1UVRA 4GMYA 4EORA 4ZTRA 4Z55A 3LFDA 1V0OA 3VWAA 4DGLC 4PMSA 1ZOHA 4Q9ZA 1O6YA 4PX6A 3RVGA 3OEFX 2J51A 4FTCA 3II5A 4E20A 2WMVA 4G3CA 4CSVA 5BX0A 2XK6A 1GZ8A 4L67A 5HD7A 2V22A 3LXPA 3OBJA 4UALA 1H1QA 2PZPA 2PU8A 1LP4A 2G9XA 4XRLA 3RP9A 3SG9A 4M69B 3TUCA 3MIAA 4F7JA 4RIXA 2GNLA 5ACKA 3ZDUA 4NCTA 4KS7A 4R1VA 4EOMA 3UO4A 2PZYA 4FNWA 1PMVA 2CPKE 5DLSA 5ANIA 3WZEA 4ASXA 1Q8ZA 4S31A 3PP1A 3JPVA 2GNGA 2C5XA 2YEXA 3C5UA 3UMWA 2WMQA 1SYKA 4FV0A 5KCVA 2BRHA 1OGUA 2V55A 3FAAA 4L43A 3DXNA 3QZHA 2PZIA 4TT7A 5HHWA 3KXNA 4J97A 1NY3A 3PFQA 3CKWA 2YM3A 2VO7A 5D10A 3G9LX 1M2QA 3ZXZA 5HKMA 3MA6A 4O7WA 5J9ZA 5ANEA 2AC3A 4O1PA 4QTBA 4EEVA 3QQHA 4BICA 2YN8A 2OLCA 3SAYA 3ZM9A 4FGRA 1TQIA 3PPKA 4X2KA 4FF8A 5JFXA 4LI5A 4AT3A 4HZRA 2WU6A 4O84A 5HD4A 2XCKA 1CDKA 4ACHA 3HRFA 3R22A 1XKKA 3OCGA 1BI8A 1Q8WA 5ACBC 1RDQE 4WUAA 4AA0A 4RIWA 3GOPA 2GFCA 4L52A 4FVQA 1FBNA 3VUTA 3BELA 2W06A 3MB7A 1E9HA 3LCTA 3OHTA 2VTMA 4JIKA 4LQMA 4QP2A 4XS2A 3UPXA 3MYGA 4EK3A 4DTKA 3QD4A 3HLLA 3FZPA 2WEVA 4C4HA 2V5QA 5I4NA 4UMTA 3ZOSA 2YABA 4HCUA 5KO1A 1H00A 4ONAA 3PJ2A 3UO6A 4AGUA 1OECA 3VAPA 3ET7A 4FEWA 3K2LA 3IDBA 2WTDA 4WNPA 4B8LA 3L1SA 3Q5IA 5IUGA 4PL5A 3M2WA 4X2NA 4Q9SA 2XUUA 3BKBA 3ZSGA 2QKWB 3PIYA 3EN9A 1ZAOA 2PL0A 2PVHA 3ELJA 3F3UA 4C0TA 4DFNA 3K3JA 1X8BA 4K8AA 3KRWA 2R3HA 4FTLA 5EDRA 4F99A 3FY0A 3HAVA 1YQJA 4MHAA 3HMOA 3TNQB 3DK6A 4UZDA 4U6RA 4JQ7A 3LJ2A 1KSWA 4R3CA 3VULA 3WZJA 2FH9A 3ZDIA 4BCHA 3GQLA 3O7LD 2YDKA 3KQ7A 2JLDA 4FMQA 2IVUA 1OL6A 2IVSA 3QX4A 2GPHA 2UW9A 2XIRA 2JD5A 3F6XA 3FMMA 1T45A 3QTSA 4DBXA 5EDQA 4BIDA 3U51A 5CAUA 2OXXA 4B7TA 4UBAA 4Q5HA 5HICA 4EK5A 3BGPA 3KULA 3KU2A 4IAIA 1VZOA 4CFNA 4BRXA 3GCVA 1GNGA 4AX8A 3OOMA 4J52A 5FXRA 4C2WA 1I09A 5HCZA 1PXMA 2ZYBA 4MQ1A 4NIFA 2C4GA 1PKDA 5ANJA 1IASA 3HKOA 2W17A 3L8PA 3ZFYA 4O91A 4H3QA 4CYJA 5FM3A 4FT3A 2XVDA 1H4LA 4I5PA 3QXOA 4L3PA 3FKNA 5HG9A 4AE6A 5J1VA 5M09A 4LOPA 4F9BA 2QKRA 4Y73A 4FK3A 3UYTA 1RJBA 2VWZA 3MI9A 2WTKC 1J1BA 2B4SB 4FNYA 3EL7A 2PVNA 4DCAA 2JKQA 5TT7A 3SLSA 2C6TA 2FSOX 3GC0A 3RK9A 3RMFA 4BZOA 1M7NA 4BF2A 2PE0A 4KSQA 3E64A 3SOCA 3GXLA 3ACKA 4UMUA 5GJDA 2R3KA 4FEQA 1Q41A 4IMYA 1W83A 4TYIA 3QRUA 5HTIA 1YDSE 3DPKA 2WTIA 4AZWA 3DDQA 4D9TA 4JBVA 2W1FA 4ZZNA 2EB3A 5AIKA 3I6WA 3MFTA 4I5MA 3CD8A 3JS2A 5CQUA 5AR7A 4CMOA 3QUEA 3A8WA 4W4XA 3NX8A 3WYYA 4YC6A 4YMJA 4KBCA 4EOQA 4ITJA 4UX9A 3AOXA 3A7JA 4Q2AA 4ZMFA 1UNHA 1MRUA 4XG2A 4DGMA 3OCBA 2W5AA 2P4IA 5J7BA 5HU3A 4R78A 4YNEA 4X0MA 3I60A 4BDGA 5AUWA 5BVWA 2Q0NA 3RM6A 2VZ6A 4U41A 4E7WA 3S2PA 1ND4A 4D2RA 4RJ5A 4AWIA 4E93A 4FIGA 2C0IA 2UVYA 1JOWB 3FHRA 3QTRA 2WMXA 2WELA 2XRWA 4IX6A 4APPA 4CV9A 2PVJA 5K5XA 1JSVA 5AX9A 5AV1A 3BYVA 4FKJA 3NGAA 1XR1A 3MPMA 1IRKA 3QRJA 2BUJA 2QG7A 3VBVA 3QYZA 4EJNA 2G2HA 5EOLA 5GHVA 5D7VA 3F69A 4TYEA 4ACGA 5TOZA 1ZYJA 3KKVA 4QNAA 4AN3A 2JKMA 4ANNA 5BPYA 4L42A 4RVMA 3EQFA 2OF2A 3UVQA 2H6DA 4O0YA 3SHEA 2REIA 3RPOA 2X6EA 4DH1A 5IQAA 3QQFA 4LOOA 1ZMUA 5KMMA 2RL5A 2OIDA 3NR9A 3JYAA 3QZIA 5IA1A 3IDCA 3TWJA 3DK7A 3NNXA 1ZWSA 4FSTA 4PDSA 5IZFA 3NDMA 3RCDA 1FMKA 5L6WL 3W10A 5IEYA 5IA0A 4XG8A 3EYHA 2HZ4A 4X3FC 5LCKA 2HW7A 3I7BA 3H10A 2ZV2A 4WNOA 4ITIA 2R0UA 4C02A 2BAQA 5I3OA 3DBEA 4I6BA 2I6LA 4N4SA 2C3JA 2XM9A 4WNMA 3R8LA 1IA8A 4U43A 3SD0A 2I0VA 5EYCA 4PY1A 4RFZA 3A62A 3R01A 1OUYA 4M14A 5LMKC 5M08A 1ERKA 1YHSA 3ODYX 3GFWA 3PRFA 1SM2A 2A1AB 4FSWA 4LGHA 5K4IA 1L8TA 5LQFA 1NVRA 4MXCA 4I92A 4RWLA 3COKA 1PXLA 4CRSA 4NM5A 2OO8X 2BHHA 1JWHA 2QC6A 4BIEA 5A14A 4Z7GA 3QGWA 3QC4A 3MB6A 5IDNA 3GI3A 1FPUA 3KF7A 4QP9A 1UU9A 3EB0A 4W9WA 4O86A 2A27A 2XNBA 4PWNA 4NSTA 3OOGA 4JG8A 3AGLA 5AA9A 4S33A 3CD3A 4RWIA 4JDIA 4CT2A 4X2GA 4FSMA 4MNFA 4GVAA 3ZUVA 3TUDA 4JX7A 4K11A 3V5JA 2OJFE 3EN7A 3CKXA 3QKLA 2C0OA 3N4VA 5M51A 2BCJA 4H58A 5IMXA 2X9EA 4XHKB 5DWRA 5L6PA 4FEXA 5D1JA 4G3GA 4O6LA 1Z5MA 4ZY5A 2YZLA 3ZH8A 3IGOA 3HRBA 2UW3A 1Q3DA 2PZ5A 4O82A 3HECA 3ROCA 3WZKA 4MNEB 5K3YA 2OZOA 5AAEA 4RT7A 2XIYA 3UQGA 4RSSA 3ZLSA 4TWOA 3SV0A 4IX4A 5BVDA 5CAVA 4CZUA 2CGXA 2XK8A 2YCQA 1P5EA 4K2RA 3RPVA 5LVPA 4O83A 2R3IA 4BWKA 3SX9A 4AOTA 4P5ZA 1XBCA 1R1WA 3DQXA 1ZARA 2XK9A 3W32A 3DA6A 4HZSA 4K9YA 4H3BA 3Q4CA 2C68A 3G0EA 4UMQA 5CT0A 3O8TA 5E8UA 4BBFA 4KD1A 4ZY6A 3WZDA 3WF5A 3R8VA 1OIRA 2W1GA 4AFJA 4EQUA 2QCSA 3FKLA 4KKGA 3FI3A 3VBXA 4F7SA 5HZNA 3S95A 3ZRKA 3PY0A 3CC6A 4YSMA 3F9NA 4DEBA 1KE7A 5M4FA 3BYSA 3ZLXA 4ERKA 3NZ0A 2VV9A 4JS8A 5CSPA 3HDMA 3W2SA 4BZNA 1UNLA 5I9VA 3DNDA 4PV0A 5KX8A 4RWJA 2ERZE 2NPQA 2OFUA 2OJJA 4FKSA 1QL6A 3VUDA 1U5QA 4EHZA 3GB2A 4BBEA 4IB3A 1APME 4U81A 2E9VA 4U0IA 5AUXA 3R9DA 2RFDA 2J0KA 2B0QA 1Q24A 4IIRA 2R3QA 4FKOA 5BMSA 2EVAA 5F20A 4E4MA 3DBQA 5DYJA 3TDVA 2PVMA 4BDKA 4HGTA 1YVJA 4YTHA 4M8TA 3RINA 4CKJA 5AP0A 4WG5A 3QQGA 4FL3A 4BWPA 1YXUA 4LM5A 4B8MA 3ZSHA 4H3PA 4AN9A 2F2CB 5D12A 2WMUA 5EFQA 2NO3A 4ZMEA 4U7ZA 4JRVA 4EC9A 3H4JA 2ZDUA 1RE8A 4I1ZA 4IVCA 4YZDA 2QO7A 3DNEA 3UOLA 4DEDA 4FZDB 4QT1A 1FINA 2G2IA 3MH3A 4EOPA 2SRCA 3NPCA 5D41A 3OFMA 4TY1A 3F61A 3EHAA 4NM0A 2WOTA 3RHXA 4ZZOA 2R3NA 4PP9A 5CAPA 1EH4A 4QP7A 4ZJJA 2WTVA 2OU7A 2WQEA 3G90X 4BDHA 5KMIA 2BALA 2F7XE 4HVDA 4RVLA 3QBNA 3QKMA 4BTFA 3ROYA 3QTUA 4E8AA 2Y8OA 2C69A 3QL8A 3MFSA 2CNVA 1OIUA 4APCA 3FI8A 3DAJA 4RBLA 3R9RA 2Y0AA 2BAKA 4G3DA 3ULZA 3GU7A 3PZEA 4AOJA 1H01A 2CCHA 1WBNA 3DAEA 4OBPA 4NTSA 3GCSA 3RNYA 2NRUA 4FTMA 2WOUA 4M3QA 1GIJA 2WMRA 4ZTSA 4X3FB 4BL1A 2XNEA 3CGOA 4L7FA 4MWHA 4V05A 5A46A 4AZEA 4HW7A 5JGDA 4W9XA 4KAOA 4TYHB 2Z7SA 4BTJA 3OEZA 4DFXE 4I6HA 3VC4A 2B55A 4HYUA 1KUTA 3MTLA 4XV9A 3DAKA 4JG6A 4NFMA 5C4KA 3GCUA 5BYYA 4L44A 4UMRA 3AGMA 3GC8A 3PG3A 2Z7RA 5I3RA 4UWBA 4XBRA 2CHLA 1XBBA 4YJPA 3TZ8A 4CEGA 5BUEA 2PUPA 1DAYA 4ZTNA 3H0ZA 4JIAA 3ORNA 3IKAA 4ZIMA 3FMEA 4LRJA 3AC5A 1PF8A 4UB7A 4GG7A 2X0GA 1AGWA 4QQJA 4ENYA 3D7ZA 4JG7A 3EQGA 4F1MA 3EQRA 5J87A 4BY9E 5AP2A 3F5UA 1PJKA 4JQ8A 3U6IA 4XOZA 4FOCA 3DQWA 3W33A 4GIHA 5E4HA 1MRVA 4ZTQA 4RPVA 3ID6C 1KE9A 5M56A 4EK8A 4CTBA 3A7IA 4WRSA 5HOAA 4JL9A 4YJUA 3G51A 2X2KA 3MVLA 4O6EA 5CX9A 4FZFB 2PVYA 2XCHA 3AD4A 3IW5A 1WAKA 4BHNA 2BDJA 5IA4A 4FV9A 3G5DA 5BVOA 4JNWA 4O7LA 1ZY5A 4C59A 3EQCA 4Z9LA 2R3FA 3ZHPC 3QRIA 4BCFA 3N4TA 3RHKA 3LQ8A 2YIWA 4M0ZA 3WF7A 3PXZA 5FGKA 1SNUA 4I0TA 2HY0A 4I21A 2ZB0A 4FNXA 2GS7A 1OKZA 5E92A 3U4UA 5KMKA 3KRJA 4KABA 4EBVA 4YJVA 5C9CA 5JQ8A 4C61A 1ATPE 1GIIA 2VGPA 5B2MA 5IH4A 3DFCB 5L8LA 4OUCA 3GC9A 2C6OA 4DE4A 3KN6A 3MVMA 3S00A 4FSQA 2QOLA 4YBKA 1FMOE 4EZ5A 3ORLA 2GHMA 3W55A 3PE2A 4W8EA 3UIMA 1ZLTA 4MKCA 3UNJA 4BDEA 2VWXA 5E8SA 3RWPA 1IG1A 3DLSA 5L2SA 3BHVA 3N51A 4C4FA 5HNGA 3BE9A 5F94A 1Z9XA 5HG8A 5H8BA 2QOKA 4DH8A 1G5SA 2YDJA 4HCVA 5FEDA 4DTAA 4RX7A 2HAKA 4USDA 3BIZA 3H0YA 2VUWA 1YXTA 3CGFA 3MJ2A 3EWHA 2B1PA 1KE8A 2R3OA 3ALNA 5BVNA 3JY9A 3ENMA 1SVHA 3NIEA 4G6NA 5CXHA 4CFXA 3U9NA 4YC8A 5IH6A 5JZJA 4YTIA 3TNHA 1IAJA 3MN3A 2CSNA 3BU5A 1K9AA 5HO7A 3FZRA 2C6LA 3MH2A 2AYPA 4WA9A 4FTNA 4WOVA 5BVKA 3CQWA 4LG4A 2Y9QA 1R78A 2F4JA 2QLUA 1HOWA 4ZS0A 4EKLA 4AF3A 5A9UA 1LPUA 5CZIA 1O6KA 2VTJA 5DFPA 2C47A 4FSZA 2H34A 3GP0A 5EI2A 3ZBXA 5BUIA 3DTCA 3PJ1A 5ANKA 1W84A 3WE4A 3ZRLA 4B6LA 4MXXA 1XH6A 3FV8A 5CWZA 1ZYDA 4BHZA 4L01A 4GU6A 4F6UA 5CU0A 1YOJA 5LJJA 4F0FA 3MS9A 5GINE 4P90A 4TPTA 4R5YA 4F7NA 4DEAA 3TEIA 1H24A 3GGFA 4QO9A 3PXRA 3SKCA 2VTLA 4L9IA 3W2OA 3FXWA 4F6WA 3IPHA 3D83A 2ITYA 4O38A 3K5UA 4FKIA 4OAVB 4L45A 2GDOA 4FIHA 4Y5HA 3LFEA 2OXYA 5E1SA 1WCCA 1YRPA 3E92A 1IR3A 3IW6A 5CI6A 5CNNA 4XG4A 3D7TB 3PIXA 4K33A 3UYSA 4BTKA 4FKTA 3LAUA 3F82A 2CNUA 5HG7A 5ANOA 5J5SA 5L3AA 2Z7LA 5TKDA 2IN6A 5CEMA 4KIKA 4YHJA 2PMOX 4FOBA 3CPBA 2HCKA 4YNOA 5FP5A 1KOBA 3E7VA 5FEQA 5DG5A 2VTTA 5EHYA 4AGCA 3UIBA 2I0YA 1U54B 3F88A 3H3CA 4UWCA 3IQ7A 3TACA 2IW6A 5CU2A 3ZZEA 3FZOA 2KTYA 2GS6A 2BKKA 4QTDA 3LOKA 4RZVA 4NZWB 3ZUUA 1V0PA 1R39A 2PUUA 4IAAA 3FBVA 2BRBA 3T3VA 4AA4A 3BYMA 3Q6WA 2JAMA 4RIOA 1H0VA 5EK7A 3D2IA 3NUUA 1H27A 1GIHA 3AC2A 2G01A 4FUYA 3F7ZA 4MTAA 4MXYA 3FPQA 2UW4A 3I79A 4K18A 1P2AA 4NFNA 4NU1A 4YBJA 4QPMA 5DI1A 2VX0A 1H1RA 3I5ZA 4GW8A 1TKIA 5EQEA 2ZB1A 4QMUA 4D2PA 4CFUA 3QHWA 2VO3A 3B8RA 4FKLA 2P55A 4XG9A 1PXNA 3P5KA 2O2UA 2C30A 3ORTA 5HBHA 3OW3A 3OP5A 5TO8A 3FPMA 3HMIA 3D0EA 3UMXA 5DEWA 2IW8A 2IPXA 5K9IA 5FBNC 4BR3A 4IWDA 5DR2A 4ZSLA 4GS6A 2H9VA 4FTJA 2UV2A 4FV8A 4FYOA 4LL0A 4O22A 5EDPA 2E9NA 4LL5A 2OZAA 4MBLA 2Y4PA 3V8WA 4R1YA 5J9YA 2P3GX 5KBQA 5JQ5A 4HVSA 5HX8A 2CLXA 3EKKA 3NNWA 3ZO2A 3P23A 2WIPA 3LJ1A 1OBGA 3PP0A 1FOTA 2X4ZA 3TZ9A 3SXFA 3BGZA 4ZJIA 3D2KA 3QQJA 3VJOA 4F70A 4E73A 1SMHA 1PRYA 2UVXA 2CKPA 3C50A 4UY9A 3PWYA 5KZIA 1JKLA 2VX3A 3QQKA 3LVPA 2QO9A 1BL7A 5KMNA 4XCUA 4C38A 3FSFA 1Y6AA 4FV7A 5CLPA 2P2IA 4ANMA 3NMUF 4JVGA 1KE6A 4N6YA 2XKCA 3VUKA 3K54A 2RKUA 2HW6A 3ZZWA 4QP8A 4AA5A 4R5SA 2I0EA 2WD1A 5E1EA 3C0GA 1VJYA 3ENHA 2UZUE 4O0VA 5CU3A 4Z16A 3KGAA 2CKQA 5LWNA 5FM2A 4KA3A 4AACA 4C33A 3KREA 2R7BA 3LE6A 3PRIA 4BCJA 4CT1A 2XMYA 3FI4A 2VTQA 5BQ0A 2X8IA 1H07A 3ANQA 1PXOA 2QOFA 3W18A 3GVUA 3UTOA 3R28A 5FLFA 2ITWA 3GCQA 2V0DA 4AGDA 4YURA 3ALOA 4IZ7A 2X8EA 2W9FB 4C57A 1DM2A 5L4QA 4EHVA 4LGDA 4U8ZA 4HPUE 3SRVA 4BKJA 4IACA 3A7HA 5AP5A 2YACA 3DV3A 3P86A 1M7QA 3FLZA 2PPQA 1NXKA 4FIFA 4RA5A 3A2CA 4WD5A 2J7TA 3V8TA 4OT5A 5KKRC 3DT1A 3WBLA 5CALA 2WQBA 4D1XA 4FZAB 5FXSA 4H39A 4KUJA 3QQLA 2X1NA 4F65A 2PE2A 5AWMA 2EU9A 3UJGA 2OIBA 5FG8A 2WHBA 4W4VA 5E8TA 3ZFMA 4G2FA 4KWPA 1R3CA 1PXPA 2Y4IC 4Y46A 5M4IA 3OTUA 4RG0A 2XEZA 4YPSA 1QPJA 3F5PA 3R30A 4R3PA 2HIWA 4DFLA 2V7AA 4FA2A 4GH2A 4QRCA 4BDJA 3Q3BA 1YW2A 3A61A 5I9ZA 3QKKA 1OIYA 3S3IA 2X7GA 4QTEA 1JKSA 4G6OA 4RVKA 3ZO4A 4XLIA 2YIXA 5CS6A 4JDJA 4RFMA 4XNEA 3UODA 3TL8A 3Q96A 5A4QA 1CM8A 5FDXA 3FXZA 3GBZA 3VBYA 4E5BA 3UC4A 2BTSA 2JDSA 2YM7A 1ZOEA 3MDYA 4PDOA 4QMVA 4IZAA 3U8WA 2UW8A 5BVFA 4L53A 1ZZ2A 5DEYA 1REKA 3VS0A 4WKQA 5C03A 5DMZA 1IAHA 2QU5A 4FR4A 1W0XC 3OT3A 5CVFA 2W99B 5D7AA 4MEDA 2B9IA 5LWMA 3T8OA 4O1OA 4GT3A 2ZJWA 2I0HA 4BCPA 3CR0A 3IK3A 4G9RA 3PXYA 4IXPA 5A4LA 2H8HA 4V0GA 3U87A 3PA5A 4W4YA 3QZGA 4FSNA 3W2QA 4G3EA 5CAOA 3I7CA 4ZTHA 3HV7A 2GQSA 1M14A 2VTHA 4HVGA 5KMOA 1W98A 4GYIA 4G6LA 3R1NA 2I1MA 4S2ZA 5I0BA 2ITXA 4YO4A 2I7QA 3LJ0A 1PW2A 2J0JA 3FMDA 4JAIA 1Y57A 4IDVA 1B38A 3TUBA 3UOKA 5HTBA 5DHJA 4A07A 4TWCA 2ITVA 3QALE 2C5OA 4JAJA 4P7EA 4PQNA 4EK4A 5JEBA 3MIYA 3HMNA 4CG9A 3FQHA 4IADA 3U9CA 3VJNA 5L2IA 3R83A 3HUBA 1YOMA 3PSDA 3HA6A 3C9WA 4O81A 2CMWA 4GK3A 5CXZA 1BLXA 4EH2A 3PJCA 1PYEA 4NKAA 4L00A 3E88A 2JDVA 3OBGA 1GJOA 4LV8A 4NK9A 3V6SA 4AU8A 4BC6A 3KXZA 3OUNB 4X21A 4KB8A 3AD5A 3DZOA 2BMCA 4W8DA 3IONA 3UP2A 2O64A 3TTIA 1XBAA 3ZC6A 4XG3A 4FTOA 3RZFA 3WOWA 2PUNA 5E7RA 4EBWA 5IG1A 3N4UA 3MPAA 4H1JA 5A6OA 1PHKA 3F5XA 4DF3A 2J4ZA 5JFVA 5GJGA 3B8QA 5HE2A 4OBQA 1MRYA 3C0IA 3MY5A 2BZKB 1OIQA 4RX9A 4QYEA 2LAVA 1JVPP 1OMWA 1K3AA 5E91A 3TJCA 3ZM4A 4ACMA 3ORMA 2IJMA 4NUSA 4YGAA 3PVWA 2ZM3A 4LGGA 4DINA 1H08A 2FUMA 5L2QA 3L9NA 3W8LA 2GS2A 2HZNA 4IZ5A 3GU8A 2OIQA 4QQTA 1WVXA 5C01A 1GAGA 5AUZA 4FE2A 1OKVA 3VUMA 4AN2A 4FX3A 5IEXA 1ZY4A 4LMNA 4IX5A 4YHFA 3V5LA 4EH7A 4IVAA 2IG7A 2GTNA 4FZ7A 3ZBFA 3AT3A 1WBVA 4D5KA 1Q8YA 3O8PA 4A7CA 2OKRA 2J90A 4DHFA 5CEPA 4D0XA 2W5HA 3LXNA 3PE1A 2C6EA 3VS6A 3FQSA 4J1RA 4R8QA 4QMQA 2O3PA 5HE3A 5ANDA 2J0MB 3D14A 3HMMA 4ITHA 1XH9A 3FZTA 4IM0A 4XG6A 5I5ZA 3R00A 3VHKA 5KKRB 4UXLA 3BE2A 1A06A 1NVSA 2OH4A 1YKRA 5EM8A 3QLFA 3CY2A 2RFSA 3MBLA 2ONLC 3Q4UA 1SVEA 5HIDA 5KE0A 4G1WA 2C3KA 4BI2A 3BHUA 1FQ1B 4QMYA 3V51A 3P79A 2VWYA 3LCDA 3LHJA 2Y4IB 4GUEA 4ZXTA 1J7UA 3QA8A 4I6FA 3PVBA 2UW0A 4J7BA 4Y83A 5CU6A 4FVRA 5LVLA 3ZUTA 4EOSA 3QYWA 5AA8A 5HGIA 5EKOA 3VRZA 3QTWA 3CTJA 3RGFA 4DITA 5I9YA 3H30A 4MNEA 3F3VA 3MTFA 4A4XA 1IA9A 1XQZA 5HEZA 2XBAA 4C34A 5GJFA 5HG5A 2UZLA 1OL2A 3OD6X 2CKOA 2XYNA 3R71A 3V6RA 3KULB 4FTQA 4E26A 4MX9A 5LVMA 2HK5A 1TVOA 3CE3A 4A9TA 3BLQA 4PTCA 4Y85A 4GFOA 3KCFA 4YLLA 1UNGA 3FJQE 3NRMA 2ZV8A 4QPAA 3A8XA 5AR8A 4FV2A 4ACCA 5IQHA 1YI4A 5AM7A 1A9UA 1PMEA 4L6QA 3C51A 3OS3A 4C62A 2UZEA 4HJOA 3BEAA 2Q83A 3MWUA 5ETIA 3VQUA 5EH0A 5HLNA 1J3HA 4EUTA 2YLFA 3C4XA 2C1BA 2VGOA 2VN9A 5AR3A 3OC1A 4WG4A 3WARA 3I0OA 2ITZA 3P0MA 2PSQA 3CQUA 3N9XA 4J99A 2EUFB 2GCDA 3FLYA 2XKEA 3HMPA 2ZMDA 5A4CA 1WBOA 4LUEA 3M1SA 2YISA 2VAGA 3REPA 3NVKI 2EB2A 1H1SA 2FGIA 4GT4A 4M97A 1RW8A 3A99A 3OVVA 4O0SA 4PL4A 4QMPA 4EOJA 4CZYB 3HA8A 2NRYA 5H2UA 2XK3A 5H3QA 3W2RA 1WBSA 1R0PA 2Y6MA 4AXAA 3DKGA 4M84A 2YAKA 5CYIA 1KV2A 4GEOA 5IMEA 4HYHA 4RX5A 2WMTA 4F08A 1IEPA 3LMGA 3Q9YA 4JQEA 2CKEA 4I6QA 3ZFXA 2XM8A 3MY1A 1OI9A 5HVKA
chains in the Genus database with same CATH superfamily
5EKNA 3R0TA 4IVBA 3KMWA 3SW4A 1H8FA 5E8XA 4EH4A 3BGQA 3I0QA 2X9FA 4FI1A 2QG5A 4BGQA 2F7ZE 2BTRA 1VR2A 4HVHA 3MVJA 4BCGA 2J5FA 3CQEA 2W1EA 5KMLA 3DXQA 3IW7A 2IZSA 3HNGA 4TKSA 2YM4A 2QOHA 4GUBA 4XP3A 4BCOA 3KRLA 3QCYA 3IG7A 3R02A 4I4EA 4O0RA 4ZJVA 5JGBA 3VIDA 5IQIA 2YIYA 3PVGA 5HLPA 5GZ8A 5KUPA 3QUPA 4TXCA 5CSVA 3KL8A 3AKKA 4FEVA 1H1WA 3VBWA 1XMMA 5L2WA 2CJMA 3UG2A 5J7HA 3NIZA 3IOPA 3R7VA 5K0XA 4I0SA 4K77A 2GFSA 2W1ZA 4PMTA 3W2CA 3R8UA 2C6DA 4OTPA 3MJ1A 4K1BA 3HUCA 4I24A 4LRKA 3FL5A 2W4OA 4RC3A 4J95A 1CTPE 3EQHA 4X3FA 3R9OA 4HYSA 3AT2A 3RCJA 1YWNA 4G16A 4C4IA 3VN9A 4AFEA 4I4FA 5AM6A 1JNKA 4U45A 4G17A 3AXWA 1BX6A 2PHKA 4JJRA 1S9IA 1YHWA 4QTAA 5LMKA 3TCPA 3F3WA 4CV8A 4GSBA 4F78A 4QYYA 2UZWE 3OCSA 3W0OA 1FVRA 4PPCA 4ZK5A 2VTOA 3EN4A 3BU6A 3NEWA 4QMXA 4KKEA 4TRLA 4EWQA 2PTKA 2VO0A 3FMLA 3HDNA 5JKGA 2QQ7A 3DBCA 5FRIA 3FMJA 4KIPA 2XNMA 5EW9A 2OG8A 3VO3A 5JFWA 4PNKA 3PTGA 3AC1A 4BDCA 4GT5A 4AW0A 2YM6A 2PWLA 4FTKA 5CF4A 4KSPA 2YFXA 1J7IA 1M52A 2UZOA 3L9LA 4FT0A 4BCMA 3OUKA 4UV0A 4C4EA 5IQGA 1UV5A 4LUDA 2FSTX 4BDAA 4AAYA 1PXKA 3UO5A 5E8VA 5GNKA 3QUDA 5LARA 3Q04A 2FSMX 3CIKA 4BGGA 5HTCA 5HIEA 4KRCA 2A4LA 3OXTA 3VBQA 4USFA 4EH8A 3U54A 2P33A 4RFYA 5HNIX 4BKZA 4RIYB 2A0CX 5C1QB 4YUQA 2PVKA 2XNGA 5HO8A 3OWKA 3TXOA 2W9ZB 2FYSA 4HVIA 3GQIA 4X2JA 5AV3A 5DR6A 3TT0A 4PMMA 3P08A 5CVHA 4Q5EA 2YDIA 5AV2A 4ANLA 4EQMA 1JAMA 4S30A 2VTSA 4MK0A 3BCEA 5KNJA 2IWIA 4D55A 3JXWA 2HY81 3FLSA 4OBOA 1JSTA 4XLVA 3OY1A 5BNJA 1ZMVA 3F3ZA 5LVNA 3QQUA 2GQGA 4GK4A 2O8YA 2C1AA 3SGCA 4TZRA 2WMAA 1WFCA 3SXSA 4AUAA 2XEYA 5AUYA 4DT9A 4CCBA 4IHPA 4OTFA 3OMVA 2BZHB 3KF4A 2GU8A 3R63A 4PRJA 3UIXA 5F9EA 3GU5A 4IVDA 4JX3A 4CTCA 5M44A 2ZV9A 3SW7A 2W1DA 2WTWA 3DB6A 4IB0A 4WT6A 4BCQA 4DGGA 1LEWA 4AAAA 4IM3A 4OTIA 5CNOA 2PMLX 3E8DA 3HYHA 1Q3WA 4GRBA 3UQFA 4KBAA 3P7CA 4YJQA 3D4QA 1QPCA 1NA7A 4G34A 4GCJA 2J5EA 3TNPC 1JLUE 4QDEA 3P1AA 1XH5A 4RRVA 5K4JA 4KKHA 3HP5A 2VO6A 4EZ3A 4DFBA 2JFMA 1UU3A 2XH5A 2B9HA 4IB5A 4PDYA 2ZDTA 3KXGA 5EM6A 1Q97A 5G6VA 4XUFA 1QCFA 2ETRA 5M4UA 3U4WA 4LMUA 3R1SA 4OTDA 3PLAE 1ZYSA 3BI6A 4AXCA 3F66A 4MBJA 4O4DA 2XNPA 4EOIA 4YJRA 5KHWA 2HWOA 5AADA 4D4RA 2ZVAA 3OWPA 3PSCA 1E1VA 3FUPA 3NUYA 4D2VA 1SZMA 2F49A 3FE3A 5IKWA 2X2MA 4XMOA 4MUQA 1LR4A 1HCKA 4MF1A 4TNDA 4F1OA 4D0WA 2OBJA 4WRGA 4RZWA 4EYJA 3KY2A 3GU4A 3D15A 5TR6A 2VD5A 4AG8A 1KE5A 2BFXA 3TTJA 3UNKA 3KK9A 5CEIA 2Z02A 4AE9A 4FTTA 2J2IB 1STCE 3ODZX 4YJTA 4DT8A 3PG1A 4FL2A 4YZCA 5A3XA 3TKUA 3I1AA 2XIXA 4HPTE 1OL1A 3C13A 5HBEA 4U79A 2R2PA 2XK7A 4I0RA 4QYFA 4EONA 3Q53A 3RKBA 3P7AA 3NNVA 1U5RA 4OTWA 1B6CB 5E8YA 4FODA 3HP2A 3EZVA 3SC1A 1H25A 2J9MA 3RPRA 4FIJA 5IPJA 2X2LA 3PSBA 3IOKA 5EYMA 1XO2B 4FIEA 1OB3A 3M11A 3QD3A 2B53A 1VYZA 3ORPA 5FXQA 1UKIA 3LQ5A 3HGKA 2YZAA 4F9WA 1H26A 5AP3A 4UWYA 4IWOA 4ZY4A 4NL0A 5M06A 4YSJA 2XIKA 2VRXA 4CFFA 1MUOA 2X4FA 5HNBA 3WIGA 4Z7HA 4L46A 3BL9A 2GNIA 5AX3A 3LZBA 5EQYA 3LMIA 3T3UA 2HENA 3CTHA 5K0KA 1LUFA 4HNIA 4YU2A 5CY3A 1U59A 3GU6A 5EG3A 4FT9A 4RJ8A 5BYZA 2IO6A 1XH4A 4CFMA 2BVAA 1FVTA 1DI8A 4E6CA 1YXVA 2XIZA 3DK3A 3Q52A 2ZMCA 3FC2A 2FSLX 1SVGA 2BFYA 3KCKA 3BBWA 4IW0A 3QFVA 4JBPA 3P4KA 3FXXA 3QWJA 4P4CA 5J5TA 2WAJA 4UYNA 3QAME 4R7IA 4QP4A 4F4PA 4R6VA 5CEQA 5FTGA 3AQVA 2FB8A 3C4CA 3AMBA 3QF9A 4YLKA 3RI1A 4G3FA 2JDTA 2PZRA 4CVAA 1OM1A 4KNBA 1YOLA 3EH9A 3TG1A 1BKXA 5DE2A 4C37A 2AC5A 3EFLA 2RSVA 4IAZA 1Q99A 3EN5A 3KXXA 3NYNA 5FP6A 4ZEGA 3DKFA 1OUKA 2B9FA 4ARKA 4ZLZA 4ANBA 2BRMA 3QA0A 3UVPA 5KMJA 4RX8A 3COMA 3EFWA 3WF6A 2OW3A 4MD9E 4DEHA 4AQCA 2CLQA 3DJ6A 1ZYLA 4I3ZA 4C35A 2VTNA 3CP9A 4YZNA 4GG5A 3TYKA 4CFWA 3OXZA 3O17A 5LVOA 4DLJA 2PVFA 4FT5A 4XP0A 4AW2A 5BMMA 4RC2A 3TIYA 3LFAA 4LOQA 3CCNA 5AP1A 5IA3A 4DFZE 4O7YA 4JBOA 2C6IA 4HGEA 3L8VA 2GSFA 3ORIA 2F7EE 4IDTA 3CLYA 4M0YA 4AT5A 4CGAA 4EOKA 5EOBA 3QD2B 3D5XA 3LM0A 3BQRA 4RGJA 4U5JA 3O51A 4YHTA 1BUHA 1U4DA 5M57A 4DC2A 3E8NA 2PE1A 3V5QA 4NW5A 2IZUA 4AW1A 4PDPA 4EL9A 2C5VA 3PPZA 2OJGA 3HVCA 3RK5A 4O7RA 4EK6A 3Q4TA 2WQMA 3D5WA 3ZLWA 4U3ZA 2YA9A 4XRJA 4O21A 4YZBA 5M4CA 4F0IA 2HYYA 4U9AA 1DAWA 2QOCA 3R7UA 4EQCA 5ICPA 3NAXA 5LXMA 3E3BX 3E93A 1M2PA 2VWUA 1P4FA 4I5CA 3B2TA 3JUHA 3AC3A 5CSHA 4LV7A 2B52A 4ZTMA 2XJ1A 2YM8A 4FKWA 4L68A 5C26A 3NNUA 4CMTA 4E4XA 1ZMWA 3G2FA 4MD8E 2BPMA 4M69A 1J1CA 3I6UA 3PYYA 1A48A 5M55A 2ITQA 2WTJA 4CXAA 1OPJA 4BBMA 3EYGA 4D58A 4XBUA 4LRMA 5CQWA 5HLWA 4BGHA 5M53A 4O2ZA 3DKCA 4DFUA 5DNRA 5CU4A 2RG6A 4FG9A 4E6DA 5AFVA 2BZIB 4CCUA 3RAKA 2X39A 4FSRA 4FV6A 2OSCA 3FSKA 4NCTC 4I5HA 4E6QA 2CGUA 5DRDA 2VTRA 4I23A 3EL8A 4QP1A 2GNJA 3HV3A 3EFJA 1Z57A 4H1MA 3V8SA 1PYXA 4DBNA 5AAFA 5J95A 4D4SA 2P0CA 2X6DA 3Q9WA 4FZ6A 1I44A 1JSUA 4IAFA 4D1ZA 4RJ7A 4ANSA 4NTTA 2C5YA 1H1PA 3KB7A 2IZRA 1ZOGA 4FUXA 4FVPA 4JLCA 2GHGA 3LFCA 3LCOA 2FA2A 3TI1A 4YJSA 4D4VA 3LCKA 2CDZA 2ACXA 1OL5A 3FYJX 3NCZA 2J0LA 5CASA 5AAGA 3UZPA 1ZRZA 3VS5A 3FKOA 4JR3A 4IX3A 2ITUA 2RF9A 2YIQA 2OK1A 2WMSA 5DRBA 3PA3A 3PIZA 5HO6A 4BKYA 1M17A 5A6NA 3S1HA 2IVVA 4KIKB 2XK4A 5AP7A 2PVLA 4FV4A 3FLNC 4MWIA 3BWJA 1GZNA 3ML1A 2W4KA 4JMQA 3C4ZA 5IEVA 2OF4A 1K2PA 4NKSA 2C3IB 2VWWA 3F2AA 4IBMA 1W7HA 5JRSA 3RZBA 4AZVA 4EYMA 3ATTA 3EQIA 2E9UA 4DH3A 3A7FA 2O63A 3ANRA 5DBXA 3VUHA 4GL9A 3TKIA 4DG3E 3SA0A 4AP7A 2ZM4A 4G5JA 2F2UA 4D28A 3DDPA 3QTQA 3GOKA 2ZAZA 3FMHA 2OWBA 1G8AA 3C4EA 3TV4A 3W0NA 4IFGA 4N70A 5L6OA 3FEGA 3KXHA 1OGYA 3P9JA 4IAYA 4PTEA 5F1ZA 3LXKA 5IQFA 2BZJA 3RALA 4U80A 3CXWA 4HGSA 4D4YA 2BRNA 4L3JA 4IFCA 2YJRA 3LFNA 2YCFA 5E9EA 5J9LA 3HV4A 4F7LA 4OAUC 4OW8A 3QTXA 2WQOA 3S4QA 2R3GA 3O96A 3UE4A 3G6GA 3POOA 2UW6A 3TKHA 3ZO1A 2RG5A 2JITA 3T9IA 3DOGA 1W82A 3GC7A 1WBWA 3ORZA 3QGYA 3ZO3A 3AC4A 3JY0A 4FL1A 5AUUA 3LPBA 3BYOA 3KMMA 2HXQA 4BCNA 3MH0A 4R7HA 1DS5A 3R7YA 5HE1A 2XJ2A 4CMUA 1WVWA 2WNTA 1XH7A 1AQ1A 2R3PA 3DY7A 5L8KA 3R04A 2BILB 3OT8A 4FTIA 2OZAB 4OT6A 3WF8A 4J53A 5T6KA 5E90A 4MD7E 3AG9A 2YM5A 4IAKA 4DH5A 4DLIA 5JGAA 5FWKK 4ZSAA 2NNWB 4QMLA 3COIA 1F3MC 2BROA 1WMKA 2XKFA 3CJGA 3WI6A 2R5TA 1QPEA 3BEGA 4RWKA 2WTCA 4I93A 3MVHA 5JN2A 3O7LB 5T3QA 4GU9A 2QOQA 1JQHA 2Z2WA 4RVTA 3V04A 1JKKA 2XANA 2XS0A 4I22A 2R3JA 2OJ9A 2WO6A 3P78A 2W4JA 4WNKA 3GNIB 5ETFA 4ASDA 1FGIA 4E5WA 3KMUA 3UZTA 4A9UA 4MH7A 5KBRA 1URWA 4TTHB 3NW5A 4QPSA 4U40A 4UYAA 5GIOE 4M68A 2CNQA 3UDZA 4BYJA 4XV3A 2C0TA 2WKMA 4ZS4A 3Q5ZA 4QMNA 3QZFA 2C6MA 2AQXA 4LFIA 4W4WA 4XOYA 3VW6A 1OL7A 3B2WA 4C2VA 5CF6A 4A4OA 5IF1A 3FZSA 4EH9A 2B54A 3D94A 4K0YA 4FSUA 4O4CA 1YI6A 4TWPA 5I9UA 2HZ0A 3OY3A 4MXZA 4CQGA 3UNZA 4U42A 4FBXA 4FC0A 3VS7A 4DYMA 3U55A 3QRKA 3C4FA 3LW0A 4P5QA 4J98A 4XP2A 1XJDA 2WEIA 5LMBA 4M67A 3AT4A 4YC3A 1V0BA 4AT4A 2BHEA 2XBJA 2ITOA 2QR7A 4TYGA 1GZKA 1YHVA 2QHMA 3O71A 4XEYA 5ETAA 1UA2A 4RIXB 4Y8DA 3O50A 4MF0A 5EM5A 2HOGA 3Q32A 2DWBA 3SRVB 3G33A 1GY3A 4WHZA 3PXKA 3R73A 3QHRA 5CENA 3C5IA 4EHEA 5HBJA 4O7VA 4LYNA 3HV6A 4M13A 3QC9A 4G9CA 4WG3A 2YLEA 3QCXA 3ZTXA 3AC8A 5AJQA 5B0XA 5HI2A 5AUTA 1Y91A 4I94A 4WO5A 3VS3A 1B39A 4EUUA 4XG7A 4MYGA 3U6HA 4YLJA 3UQCA 4QYHA 3R7GA 3A4OX 2OFVA 2LGCA 4KS8A 1HCLA 3NFGB 3HL7A 4F6SA 2VWIA 4GFMA 3DBFA 4OGRA 3VUIA 4FSYA 3ZS5A 3ZU7A 5IDPA 3EJ1A 3LMHA 1QPDA 4BN1A 4MCVA 2X8DA 5JMSA 3KIOC 4IWQA 1JBPE 3DFAA 5JSMA 3ZXTA 2R9SA 4IH8A 4GYGA 5EI8A 5TF9A 5IQBA 4JI9A 4AS0A 3QD0A 3MY0A 3R7EA 4CD0A 4D2SA 3PZHA 5CEOA 5IA2A 2OICA 4RLKA 4U97A 5ANGA 2ESMA 4RIWB 4O27B 2W1CA 2A19B 1OKWA 5H8GA 4C4GA 2J0IA 2Q0BA 3G0FA 3KRRA 3L9PA 3SVVA 3NLBA 4FG8A 3AKLA 3RAIA 2BIKB 4J8MA 3PDTA 4DTBA 1UU8A 3R7OA 5AP6A 1JKTA 4NH1A 5I9WA 2RGPA 1VYWA 4E4LA 2JIUA 4DHIB 2YERA 2F57A 2WQNA 3VW8A 2VTAA 2X81A 5JK3A 3RAHA 3SDJA 4FJVA 4FV3A 3EQBA 3QCSA 3AKJA 5F4NA 3OZ6A 2XB7A 1V1KA 4PPAA 3GFEA 4V0GB 5DR9A 4AOIA 3UOHA 1Q5KA 4BDDA 5CANA 4WUNA 3F5GA 4YZMA 5KHXA 4FV1A 3R1YA 4H36A 4QTCA 5H9BA 4UN0C 4XV2A 4X7QA 5AV0A 4NJDA 3L9MA 3GENA 4YPDA 4QEBA 4X6RA 3UOJA 1Y6BA 2UVZA 4KRDA 3ZYAA 5AV4A 4GFGA 3DB8A 4MXOA 1CKPA 4KIQA 3NFFB 3LIJA 5IQDA 2VX1A 4PTGA 4FKQA 3ORXA 3DJ5A 4NM3A 2OH0E 5CTPA 4JT3A 3NUNA 4N6ZA 1H0WA 2QO2A 2UZVA 3AD6A 3JVRA 3NUPA 2ZOQA 3PWDA 3EOCA 2QR8A 2NP8A 1PMUA 3VQHA 4EZ7A 1VEBA 3TZMA 4NJ3A 4QMTA 2QU6A 3PUFC 3CPCA 1CKIA 4DFYA 3HZTA 5DPVA 2WU7A 3EMGA 3BZ3A 3ORKA 3BX5A 5IISA 4BFMA 4C3FA 1PMNA 2DQ7X 2FVDA 5DN3A 3VHEA 4A4LA 4ALWA 4IM2A 3OTVA 4V01A 4ZSJA 3HV5A 1E1XA 1W2CA 3LLAA 3JVSA 1QMZA 2X0QA 3K3IA 4NIFB 5HVJA 3NYOA 4PNIA 3W1FA 2X0OA 4ZLOA 3QTZA 4LV5A 3OG7A 4GV1A 4DCEA 4NWMA 3PPJA 4FV5A 4RMZA 3C0HA 2J6MA 1CKJA 1WZYA 3BV3A 4IB1A 3QRTA 3LM5A 1MQ4A 2UZBA 4KBKA 1ZZLA 3AMYA 3CBLA 3GT8A 4EWHA 4IEBA 1PKGA 3RPYA 4E5AX 3BU3A 3MW1A 2QOOA 4XV1A 1YXXA 3OROA 4BTMA 3WF9A 4U3YA 4ANOA 4YJOA 4E3CA 5DH3A 3NW6A 4O4FA 4ZSGA 4FKUA 3KC3A 4UMPA 3UP7A 1UKHA 4F1TA 4GKHA 5J79A 1Q62A 4RC4A 1OPLA 4D2TA 3POZA 3Q4ZA 5AIRA 1REJA 4CFVA 3R1QA 3A4PA 5DVRA 5FUTA 2YHVA 5BUJA 3DS6A 4BWXA 4N57A 4CLJA 5JT2A 3PVUA 4GIIA 4J96A 4JDKA 4ALUA 4R7BA 1J7LA 2X7FA 3NUSA 3TIZA 1XWSA 3NCGA 5M07A 2EXEA 3DLZA 4QQ5A 4AZTA 3FI2A 3KVXA 4BDFA 2ONLA 4JBQA 4WBOA 4DEEA 4MXAA 5EQPA 2CN5A 2WIHA 3Q9XA 3H9FA 2DYLA 3WZUA 2ETKA 2XNOA 4TW9A 1YDRE 3PJ8A 4AW5A 2JKKA 2R4BA 2Y6OA 3GUBA 4IC8A 4OTQA 5FTQA 1T46A 2A2AA 3AMAA 3MPTA 4RIYA 1SNXA 2FO0A 4YR8A 4IANA 2CGWA 1LEZA 2PMIA 2YCSA 4PPBA 3VBTA 1G8JA 5HORA 5CT7A 5L2TA 5DGZA 5C8KA 4FKPA 3KFAA 5CZHA 5AR2A 4FIIA 4ZAUA 3U6JA 3FY2A 2UZDA 3R8MA 5FD2A 5JZNA 4DN5A 2Z7QA 3FDNA 3MFUA 4FGBA 4FKGA 3FL4A 3QWKA 4C4JA 4F9CA 3FZ1A 2JBOA 2EWAA 3FHIA 4DH7A 5A4TA 4F63A 3UPZA 3BQCA 2ZM1A 3CTQA 4K6ZA 4X2FA 4DA5A 1UU7A 3TMOA 3DZQA 3EKNA 5IQEA 3T9TA 3UG1A 2QD9A 4TYHA 1WBPA 2ZV7A 4YJNA 3VS2A 4S34A 3BBTB 3KXMA 2WTKB 5FBOA 4ZOGA 3NUXA 2R7IA 3LFBA 5F95A 4E1ZA 4CG8A 2OI4X 1O6LA 2YWPA 4AZFA 1PY5A 2JIVA 2QNJA 4O0TA 3V5PA 3WYXA 4B0GA 1BMKA 4XX9A 2W5BA 3ZEPA 3O0GA 2XJ0A 5KZ0A 5EI6A 2JDOA 3KK8A 3OWJA 3R7IA 3LLTA 1BL6A 3LFFA 4PP7A 4GVJA 2QURA 5B2LA 3FQEA 3VNTA 3JR1A 5BYLA 2EXCX 3L8SA 4YZ9A 3LFSA 3KA0A 3NWWA 2GMXA 4O0XA 4QMZA 2WMBA 2XA4A 4P2KA 4EH5A 4EH6A 3UC3A 4B9DA 4M7IA 4XH6A 5T68A 3ITZA 1DI9A 2IF8A 2W0JA 5HCXA 4EJ7A 1KWPA 1YXSA 4Y72A 4D5HA 4OTRA 4H05A 2CGVA 3E8EA 1BYGA 1Q4LA 2WPAA 3G9NA 4GJ3A 4RJ4A 3RM7A 2W05A 3A60A 4QD6A 3LXLA 4D2WA 3PLSA 3ZSIA 5DIAA 3EIDA 3MA3A 1ZXEA 4FTAA 3TV7A 4CYIA 4CKRA 4EC8A 4MQ2A 3TV6A 4BDBA 3BHHA 4BCKA 2QLQA 3C7QA 4QMWA 3FLQA 1PXIA 4Y5QA 3KRXA 4QP3A 2PK9A 4E4NA 5J1WA 3OW4A 4YO6A 3BHTA 4UXQA 4NEUA 3UVRA 4FNZA 3E8CA 5ITAA 3NVMB 5CI7A 2B7AA 5E8WA 3LCSA 5GZAA 1UWHA 1Y8GA 4DEGA 4A06A 2VTIA 3R6XA 2G1TA 3HX4A 2WGJA 2PYWA 3SXRA 4HCTA 4ID7A 3ZRMA 3MV5A 3IGGA 5C27A 4GKIA 2V62A 2YWVA 5LMAA 1OBDA 4DG0E 2W1IA 4B4LA 4Y95A 2BDWA 5B7VA 4FK6A 2OGVA 5JH6A 2WXVA 4IJPA 5JRQA 2IZTA 3EQDA 4A9SA 1PXJA 2YAAA 3IW8A 3KEXA 4C3PA 2R3MA 4CKIA 3F2NA 4F09A 3KVWA 3E87A 5D11A 5DA3A 2R3RA 2RIOA 4WSQA 5CEKA 4DHZA 1M2RA 1R0EA 1YWRA 4G31A 2O5KA 3F3TA 5HCYA 1FGKA 4QMMA 3TN8A 5ETCA 5A4EA 4DGOA 4C8BA 2Y7JA 4D1SA 1NW1A 1P4OA 5EYDA 2UZNA 3DCVA 4JRNA 2KULA 2YITA 2UUEA 3D9VA 5IUHA 5AMNA 4G5PA 2XZSA 3R8ZA 3TM0A 5HESA 4TN6A 5LOHA 2AUHA 5CSWA 4M15A 3CJFA 1CSNA 3QX2A 4I20A 4FICA 4OLIA 3IDPA 4QOXA 3UIUA 3CY3A 2VNYA 4QYGA 4ZZMA 1J91A 1H28A 2E9OA 5BVEA 3RWQA 2RFEA 2XYUA 5J8IA 3H9OA 5B2KA 4X3JA 2G2FA 3I5NA 3MSSA 5EHLA 4C7TA 2H96A 4EKKA 2E9PA 4ZLYA 3DBDA 3W8QA 3LFQA 4BVUA 5D9HA 4PL3A 2QI8A 5L8JA 4JXFA 4O0WA 3DTWA 5EHOA 4GK2A 1TQMA 1FVVA 3V01A 2VWVA 2JEDA 3COHA 1OKYA 3PY1A 2O0UA 3PA4A 3V3VA 2YJSA 3CS9A 4NM7A 4QMOA 5DT3A 2GNHA 2UW7A 2WFYA 2VTPA 4BDIA 3WIKA 4ENXA 2HXLA 1BI7A 1WVYA 2QOIA 4BYIA 4EOLA 3ATSA 3R9NA 4A9RA 5CVGA 3LQ3A 2JFLA 2PULA 2PUIA 2PMNX 4D9UA 1Q8UA 4NYEA 3A7GA 1OITA 4J8NA 4L3LA 2DUVA 3VS1A 3S0OA 4XJ0A 2W1HA 2GHLA 5HE0A 4O7NA 4EI4A 4R77A 4O0UA 5HX6A 2OJIA 4WSYA 4F9AA 5IH5A 3D7TA 3G6HA 4PUZA 5H8EA 1OVEA 2QODA 4KIOA 3ZC5A 3O8UA 3RK7A 1WBTA 4QQCA 3EFKA 3DXPA 5AP4A 4PF4A 1YWVA 4L8MA 4DAWA 3R8PA 4EOOA 3QTIA 4FKVA 3OF0A 4IZYA 4B99A 2X7OA 4EH3A 2EXMA 1NVQA 4ZP5A 2XF0A 3K5VA 5IA5A 2O65A 1U54A 3FMNA 3Q60A 3R21A 2X0PA 2HELA 3BWFA 1Y8YA 2GQRA 4USEA 3E7OA 3O2MA 3DJ7A 2BDFA 1U46A 5C8NA 5AUVA 5CF5A 4BJJB 2HZIA 2BR1A 4FEUA 5AEPA 2J50A 3D5UA 2VNWA 4JDHA 1XH8A 4ERWA 4YTFA 1P14A 2XNNA 3O23A 3LKMA 2Z8CA 4RJ3A 1OZ1A 3PJ3A 2BAJA 1MP8A 3FWQA 3FC1X 2VU3A 3R2BA 4ASZA 5HU9A 3W2PA 5A54A 2IW9A 3DGKA 2QHNA 4BZDA 4IQ6A 2ITTA 3BLHA 4C36A 4EHGA 4RA4A 3BRBA 3NAYA 3PXFA 1GOLA 2JIIA 3DKOA 2OXDA 2YCRA 5HVYA 1Q61A 3IO7A 1XHAA 2P2HA 4X6QC 5I9XA 4C3RA 4DGNA 3RNIA 1JPAA 4FT7A 4S32A 5EM7A 2JAVA 2E2BA 2GNFA 1Q8TA 2QOBA 3V5TA 4MVFA 5IQCA 3KN5A 4NT4A 4AXDA 4PMPA 1G3NA 2WB8A 4XYFA 4QNYA 3UBDA 4BCIA 1ZYCA 3HEGA 3BPRA 2BKZA 4CQEA 4C58A 4FTUA 3E5AA 5HQ0A 4J71A 2ETMA 5E8ZA 5AR5A 4CNHA 4V04A 3SG8A 1NT2A 4DG2E 5C4LA 2B9JA 5EYKA 2QONA 4QP6A 4HYIA 1MQBA 3HRCA 3ZEWA 5EW3A 4AZSA 4Z3VA 4TL0A 4KINA 4NW6A 3NYVA 1VLRA 2PY3A 3EZRA 2R0IA 3PXQA 3QLGA 3ZCLA 1URCA 4FG7A 3MFRA 4FYNA 4ACDA 4MAOA 3C1XA 4N0SA 2W96B 5CF8A 4BI0A 4UEUA 1W8CA 4O7TA 1G8KA 2IVTA 1L3RE 3RPSA 4F64A 3PUPA 3TDWA 2JC6A 3ETAA 3IW4A 2ITNA 3F2RA 3UZRA 5FDPA 5IUIA 4RLLA 2VWBA 2CCIA 2GTMA 1O9UA 3NW7A 3OWLA 3DU8A 3E62A 4II5A 5FQDC 3Q2JA 2C3LA 3NS9A 3OCTA 4RQVA 3MESA 2RFNA 5CSXA 5DOSA 2UZTA 4MBIA 5G1XA 3G15A 3FMKA 2JKOA 2DS1A 1YI3A 3FLWA 4QMSA 3H9RA 4ZTLA 3W16A 2V7OA 3ZLYA 3BLRA 3E3PA 3HAMA 5EW8A 4E6AA 2UW5A 3M42A 3RJCA 4ORKA 2WZJA 3W0PA 4BB4A 4R3RA 1F5QA 4CLIA 2QVSE 4FKRA 2JDRA 5IU2A 4O7ZA 5JFSA 1S9JA 1F0QA 3MH1A 3GEQA 1TQPA 4A9YA 4IC7A 3VUGA 3ERKA 1GZOA 4IJ9A 3VVHA 4HOKA 2JGZA 5AR4A 4I41A 3VF8A 2F9GA 3TZ7A 2HWPA 3ACJA 3VS4A 4F9YA 3MGYA 3R2YA 1KV1A 2ITPA 5DT0A 4WBBB 2PVRA 4O2PA 3TJDA 4ANQA 4BIBA 4TYJA 2BIYA 4OTHA 3BYUA 5K5NA 3O5AA 4O7SA 4F0GA 2W7XA 4DEIA 5GZ9A 3IS5A 3IECA 3QU0A 3NYXA 3P7BA 3V5WA 4YTCA 4BI1A 2XKDA 4UZHA 4WIHA 2I40A 1W2FA 1CMKE 2R64A 1KOAA 5DT4A 3EQPA 5FEEA 3PY3A 3ZMMA 4CRLA 3NSZA 3CSVA <