2JD5A

Sky1p bound to npl3p-derived substrate peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
353
Chain Sequence
FHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE SKY1
publication title The Rgg Domain of Npl3P Recruits Sky1P Through Docking Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 102
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jd5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jd5A01
5E1EA 1YHSA 3HP2A 1H1PA 4X7QA 1ERKA 4HYSA 5AP5A 4YTHA 3TZ8A 5E8WA 4N57A 5CU4A 1H08A 3LXKA 1H24A 5I9XA 4FK6A 4GVJA 3F69A 3I4BA 4OTIA 4C35A 1H8FA 4ZMEA 3QC9A 5EDRA 2CNQA 3MH3A 2OLCA 3UNKA 2CDZA 4ZLZA 4QMXA 5LWMA 5I3OA 1BX6A 3EFJA 4BVUA 2C6EA 4PMMA 1P2AA 1YI4A 3EWHA 3VW8A 3HGKA 4YTCA 1JSVA 2V0DA 2NO3A 2R5TA 4U79A 5ETCA 4F9AA 1A06A 2JKKA 4F9YA 2UW6A 4IACA 4BIBA 4WOVA 5IISA 5BMMA 3V8SA 1U46A 1WCCA 5L6PA 1ZMVA 2BDWA 3UE4A 2YDIA 4IWOA 3UP2A 5FXRA 5FTOA 1PXPA 2CLQA 2X7OA 5KMJA 2WMWA 2ZV8A 1WBPA 2R3NA 4IXPA 3UGCA 4RJ3A 3OROA 4A9YA 2W4JA 4EONA 3VBQA 4XV1A 2QLUA 1ZMWA 2GTNA 4FTRA 4U97A 2XKEA 4Y46A 5HE2A 4HGTA 3RCDA 3VBYA 5L2TA 1WBWA 4G9RA 1GNGA 3BE9A 4FV5A 3TZMA 2C30A 3THBA 5C1QB 5AR5A 5KMLA 3FEGA 5IQCA 1URCA 4KINA 4BCHA 5IEVA 1Q61A 4W4XA 1OIUA 3FMMA 4XV2A 5CY3A 2EB3A 4IVDA 3L8VA 3ETAA 3Q4TA 4BF2A 3IW6A 1GZKA 2WMUA 3BKBA 2XK4A 2J5FA 3ANQA 4MH7A 3BBTB 1E1VA 2VO6A 3DKGA 4X2GA 3ET7A 2QR7A 4QO9A 3GU5A 1XH6A 4D1XA 4JRNA 2CGXA 1QPCA 2HWPA 1XH7A 1IA8A 2XCHA 2P55A 3ZRKA 3I5NA 5HE0A 2PE2A 3C1XA 5GZ8A 5HI2A 3TJDA 3UODA 2RFDA 2UW7A 3PA5A 4RVTA 4BDFA 2CNUA 4HNFA 2XNEA 5EK7A 3E8EA 2R3MA 5CLPA 5AWMA 2WMTA 2HZIA 2EXEA 3PA4A 5AMNA 4D0WA 5HNGA 1G3NA 4ACCA 4OGRA 2W96B 3PXKA 3MFSA 4ZXTA 3A2CA 4Q5HA 4ZMFA 2R2PA 4RIYA 3PJ2A 4GK3A 4FTQA 2J5EA 2HYYA 2XIXA 4RSSA 2OZOA 4XBUA 3AT2A 3CPCA 4MF0A 5IZFA 3CY3A 4ZTHA 2QOFA 5AADA 5DA3A 2VO3A 5JFVA 1GZOA 2QO9A 5EYMA 4EC8A 4QPSA 4IAKA 4QMYA 5IMEA 3D83A 4YHTA 3I81A 1XHAA 4RWLA 5AV0A 3TNPC 3VULA 4JS8A 5CAQA 2A19B 4M68A 4QQTA 1YOLA 2HXLA 4KRDA 4E4XA 4U6RA 2WQBA 2OJGA 4ITIA 3MS9A 4K6ZA 3VBWA 2XJ2A 3G33A 4BBFA 2A27A 4KAOA 2W17A 5HIDA 1UNLA 1LEWA 4YLKA 3KY2A 1OL1A 3CIKA 3CP9A 4AWIA 1K2PA 5J8IA 3FLQA 2Z7RA 2IWIA 2BRMA 4GFMA 3DAKA 4LRKA 5K4IA 2Q0NA 4IDVA 2J0KA 5DGZA 5HD7A 2FA2A 3D5VA 3L9PA 2JC6A 4YJVA 5M55A 4BI2A 1P4OA 4GT4A 5KX8A 5J9ZA 2Y7JA 3TIYA 4YUQA 4EOJA 5J5TA 2VGOA 4FICA 3N4TA 3WZDA 3DBEA 3RK7A 5E8TA 5J9YA 3BLQA 5KBQA 1OGUA 2OU7A 3W2QA 2XKFA 4ID7A 4F0FA 1IAJA 4L6QA 3UC4A 3D5UA 1G8SA 3EQFA 3LFSA 4QP6A 2B52A 3UVRA 1YXTA 4ACHA 3SXSA 4D9TA 2EB2A 2UZOA 3A7HA 2HK5A 2QI8A 2VTPA 1MRYA 2ITQA 3IG7A 5IEYA 1JKKA 3GCQA 3QCSA 3R8PA 2B7AA 3F2NA 3TTIA 5JGBA 4QMNA 3C4WA 1H1WA 3LFCA 4MVFA 3VUHA 4DH1A 4OTRA 5CX9A 4ZTQA 5C8MA 3FLWA 3L9LA 4BDJA 4I23A 3LAUA 4HPTE 4IAYA 1BI8A 4CLIA 2VWIA 5ACKA 3Q32A 4BCJA 4DTAA 4TNBA 4LM5A 5A4TA 2B9HA 3OC1A 4ANSA 3A61A 3EFLA 4CMUA 4DEHA 4FVQA 3W2RA 3ZSGA 4IW0A 5M08A 2WQEA 5E92A 1BKXA 2VX0A 3MGYA 5EI8A 5HKMA 4C34A 4D2WA 5HNIX 2WMSA 5AR4A 3RPOA 5L6OA 5EG3A 2W9ZB 1ZYJA 3MPAA 1JBPE 3ZO2A 3MJ1A 5KHWA 4RX5A 2RSVA 2EUFB 3V5PA 2HAKA 4I6FA 2B0QA 2ESMA 4U42A 2C0TA 3DB6A 4ZTMA 2R64A 3WIGA 3LCTA 4NW6A 3ZEPA 1Z9XA 4J95A 3LLTA 2RF9A 2QHMA 3A7IA 3SQQA 3FI3A 4XNEA 2X1NA 4QTAA 3R8LA 4OUCA 3FC1X 3VUDA 4QYHA 1KE8A 3QX4A 3JVSA 3KXGA 2R0IA 5TKDA 2BAKA 4I0TA 2EWAA 3EQHA 5EDQA 3ZLWA 4AGUA 2OXDA 3HDNA 2ZYBA 3EN5A 4I5MA 4EH2A 4EJ7A 3AG9A 4NL0A 5CNNA 1YOJA 4O7VA 3ID6C 4O0XA 4TWNA 2W1EA 4FOCA 1UU9A 3B2WA 3I6WA 3TZ7A 5FP6A 5IUHA 1BYGA 1M14A 4YJSA 1W0XC 5DH3A 3RVGA 1W7HA 3G9LX 3HA8A 3ZCLA 4J98A 3VS0A 3ZONA 1QL6A 3TXOA 3PPKA 3QKLA 4LI5A 4AA4A 4ZK5A 2PU8A 4O7WA 4DH8A 5A6OA 1ZYDA 2AC3A 4CNHA 5M53A 3ZUUA 3A99A 1Y8GA 2GDOA 3BYSA 2R3GA 2IZRA 4H3BA 3LIJA 3UP7A 4TYJA 4DH7A 1J7IA 4KUJA 3C13A 2B54A 2P0CA 3ZSHA 4S2ZA 4RJ5A 3AQVA 1DS5A 2OZAB 2BIKB 2CSNA 4NUSA 5H8EA 1KSWA 5LWNA 4YU2A 4IIRA 3ORMA 2PHKA 4PUZA 4ACGA 2C5VA 4X2FA 3UIBA 5E8VA 3BLHA 3UO6A 3FBVA 4DTKA 4WSYA 4HVSA 4QMVA 1RE8A 4RWIA 4RIWA 4C2VA 4USFA 5DFPA 3UOKA 4XG2A 4F0GA 4GK4A 3FMHA 5GJFA 1OB3A 4L00A 4QP1A 2XEYA 3FL4A 4MBIA 5FM3A 3NGAA 5CU6A 3ENMA 2OK1A 2ZVAA 1UU7A 3FZPA 5I9WA 4I41A 4FTAA 3CGOA 1VJYA 2B9JA 1YHVA 3G6GA 3VS7A 4ENYA 3UQCA 2W06A 4QTDA 4R3PA 3VUMA 4TL0A 4CFMA 3F6XA 3TEIA 4DH3A 3FUPA 3KMWA 3F5PA 3R04A 3UNZA 3PXQA 4C58A 2BZHB 2XRWA 3VO3A 4MKCA 5CT7A 2UZBA 3RPRA 4NJDA 4I4EA 2DQ7X 3EIDA 3FDNA 4TYEA 4DHFA 3M42A 4CCBA 1H0WA 2BUJA 4I24A 4WIHA 4PV0A 4ZTNA 3RM6A 4EH9A 2YZAA 3L9MA 2WQMA 4EKLA 2BDFA 4M0ZA 4PWNA 4DEBA 4RIXA 4HYIA 4ANLA 5ETAA 3R8MA 2ZB0A 3OWKA 4XLVA 4BBEA 1KE7A 2GU8A 2XUUA 3Q9XA 5EM7A 3R8UA 4HZSA 4Z16A 2Z7SA 2J9MA 3ZTXA 4C4JA 3PPJA 3Q3BA 2ITZA 5DG5A 3VHKA 4TNDA 4V0GB 5F9EA 3QX2A 1JAMA 4Z3VA 2YZLA 3UYTA 4OBPA 2ACXA 1XKKA 4YNOA 5HBJA 2FUMA 4AOJA 3NAYA 5EHLA 2ZJWA 3KXXA 5L2SA 1JSUA 4O83A 4G5JA 4BDIA 2BILB 3K2LA 2BZJA 3C0GA 4R8QA 5LOHA 1ZOHA 2F7XE 4YBJA 3B8QA 1WBVA 4CMOA 4FSRA 4DCEA 3KMMA 4FV0A 3AGMA 2IZTA 5IKWA 3KRWA 3TV6A 1ZMUA 2NRYA 3EYGA 4BDKA 4C0TA 1ZARA 4AGCA 4NIFA 4R5SA 5FTGA 1FVTA 3FKOA 5EYDA 4EZ7A 4JL9A 4QP4A 2JIVA 3UO5A 4O2PA 4Q5EA 4M12A 5AJQA 5F1ZA 2X39A 3V51A 4O6EA 3EQPA 4TPTA 4QPAA 2BCJA 3MYGA 4XG4A 2B53A 5AP6A 5J79A 3C4CA 2HIWA 2G1TA 3R1YA 2CCIA 4D5KA 4M84A 4QD6A 4EWQA 3R9NA 2VNWA 1WVWA 5AR2A 3VVHA 1PF8A 5CENA 5L2WA 1PMNA 2OGVA 1PXOA 5D9HA 4DFXE 5AV3A 2WB8A 4KB8A 4GCJA 4XCUA 3DS6A 5GNKA 3GFEA 2PPQA 3PIXA 5A4EA 4O96A 3BQCA 3WF6A 4W8DA 3HX4A 2IPXA 3BZ3A 3GC9A 4YJTA 3RPSA 3UOHA 4ZLYA 1PY5A 5AP1A 3F3WA 3Q96A 3DJ7A 2XKDA 2C1AA 3IW5A 2OI4X 2VWVA 3EL7A 2YWPA 4UZDA 3QA0A 2VUWA 3F88A 2F57A 4KA3A 4EBVA 1JPAA 3CXWA 5D12A 2C47A 4N4SA 2C0OA 1K3AA 3REPA 4BTMA 1NT2A 3VBXA 1CKPA 3FXZA 5AUUA 3DB8A 3FMLA 4N0SA 3AT3A 3T9IA 5EM8A 3UQGA 4PY1A 4X3JA 1OM1A 2QD9A 4UWBA 2GNIA 2WMQA 3C7QA 1PMEA 3DAJA 3NUUA 3HA6A 3WI6A 4XUFA 3UG2A 3QZHA 4FSWA 4FSMA 5BUJA 2RFEA 3NRMA 3NIZA 3ZXTA 5M44A 3LLAA 3F2AA 1IASA 5BVNA 2OH0E 4G6NA 2WTVA 2OSCA 2X7FA 5IPJA 3NLBA 3PPZA 3Q9YA 3QLGA 4IAIA 2VO7A 3R8ZA 3UOLA 4BCIA 4C62A 2JGZA 3G6HA 4I6HA 3CCNA 3PTGA 5HESA 4PPCA 5IQBA 1QMZA 3PLAE 2C6OA 4BCNA 5EQEA 2I0YA 4JBOA 3ORZA 2XRUA 5HO8A 3BV2A 3E8NA 1REKA 3RAWA 3NUAA 3JXWA 5IQDA 4J8MA 4J52A 2B55A 1IG1A 1CDKA 2H8HA 4F7LA 4PF4A 4QP9A 2PVYA 3O8TA 2FGIA 3OCTA 5ANIA 3ZLSA 4YZNA 4K18A 3KREA 4KBKA 3DCVA 3OWJA 4XP3A 5GHVA 3SC1A 4BCOA 2ITUA 4DGNA 4HVDA 4I6BA 2ITYA 4MWHA 4ERWA 3F3TA 1OL5A 1U4DA 2Q0BA 2XNOA 3LFNA 3R7EA 4ZZMA 4ZY6A 3P1AA 5FLFA 2GS7A 1YI6A 3QXPA 3E92A 5CU3A 5M4UA 3DLZA 3HAMA 3COKA 4TZRA 2FSMX 4H3PA 3QAME 3WYYA 3PZHA 2REIA 4RBLA 3E3BX 5IA3A 1CMKE 3DV3A 2H6DA 5DRDA 3HUCA 4ARKA 2PE0A 2YM6A 2R7IA 1WBNA 4JAJA 3U6HA 3GT8A 4XX9A 4FE2A 3QZGA 1M52A 2C5XA 4AOIA 5HBHA 2GHMA 2Y9QA 3PWDA 4FODA 3U6JA 4FSTA 3A60A 3GC8A 2XNGA 3FJQE 4UMTA 2GNJA 3Q4ZA 4X6QC 4JOAA 4B0GA 2WMAA 5AR7A 5AAGA 3AXWA 1P4FA 2HENA 2VWZA 2UUEA 3CTJA 4G5PA 1TQMA 1OVEA 4MBLA 4WO5A 5EQPA 2YACA 3QXOA 4RLLA 1ZYSA 3NS9A 5JK3A 4ALUA 1RQQA 3C4XA 1Q8UA 4K2RA 2DWBA 5KBRA 4BB4A 3H9OA 4EI4A 1DAYA 4GG7A 5AA9A 3BGPA 3MPTA 5K5NA 3S95A 2ONLC 4BZDA 1UWHA 3DJ6A 2JIUA 2C3LA 2Y4IB 3JVRA 5CI7A 4BCMA 4NU1A 1YVJA 1FVRA 4W4WA 3UBDA 3ZBFA 2QONA 2OO8X 3VC4A 2ZMDA 3PG1A 4KSQA 4YPDA 3Q9ZA 3LQ3A 4C57A 3OOGA 4FI1A 5A4QA 3E87A 4FIGA 2R4BA 1OL6A 4PMSA 3ULZA 4GG5A 1KE6A 1JSTA 2C4GA 3TCPA 4OTWA 3VAPA 1OPLA 4W4YA 4FKLA 4LMNA 2F2UA 5CAUA 4C02A 5FP5A 4F7SA 4GJ2A 4IFCA 4TYHB 4USDA 4ZP5A 2YCSA 5DI1A 3DGKA 3OOMA 4AT3A 3DTWA 3Q4UA 4LMUA 4R1YA 5ETFA 3UMXA 3QZIA 3Q52A 3EFWA 2XS0A 3HRCA 5C4LA 1OI9A 4IVAA 4F7NA 4ANBA 3C4ZA 3E62A 3KCKA 5CAOA 2VTIA 3I79A 3VS4A 3UOJA 4EHZA 4FZ6A 5L8LA 2JDOA 2RG6A 4RX8A 2Y6MA 3PXRA 3U55A 2VO0A 3E63A 3OMVA 1M2PA 4G3GA 1F5QA 4HW7A 3FY0A 1KV2A 3QD4A 3UIMA 4CV9A 3NZ0A 5J95A 3Q6WA 3WBLA 3BYOA 4E73A 3FKNA 3HMOA 3HLLA 4BZNA 3H4JA 3T9TA 5HICA 3TUCA 4FKWA 2VTQA 3DKOA 4IQ6A 4AN2A 2I7QA 1VZOA 1JKLA 3BCEA 3QRIA 1YHWA 3FC2A 5DN3A 4FKQA 4O1PA 1FGIA 3IPHA 4EK8A 3JPVA 4PP7A 2CHLA 5CSPA 3ACKA 1SVGA 5HU3A 2KULA 2OBJA 4LOPA 2YWVA 3BYMA 4FC0A 5ICPA 2GTMA 4TW9A 4RJ7A 4XJ0A 3VQHA 3I1AA 4NYEA 1V0PA 1OMWA 2QKRA 3OCSA 4LRMA 4UYNA 5HG5A 4C4EA 2O3PA 4K1BA 4AG8A 5EOBA 4PNKA 2FSLX 5E8YA 2Z02A 4FV9A 3SXFA 3F9NA 4M15A 4EHEA 5ANEA 4QMSA 3NWWA 4XOYA 3O50A 4M8TA 4BHZA 2XMYA 3NYOA 4GJ3A 2QG7A 4IEBA 4ALWA 4MXXA 3WZKA 4RJ6A 2IZUA 4CG9A 4MD8E 3FZTA 3LJ2A 2R3PA 4ANNA 4X6RA 4BCPA 5EW9A 3QBNA 5IDNA 4G17A 2ZMCA 2R7BA 1UVRA 2J0JA 3C4EA 4X0MA 4Y83A 3ULIA 5C8NA 4J7BA 4MNEB 2F7ZE 3PY0A 3II5A 4FTTA 3S2PA 3HRFA 3LE6A 2C0IA 1OKZA 3DPKA 4CD0A 4J99A 2R3FA 3GVUA 1QPEA 2WMBA 3COMA 3LMGA 4HGLA 1P14A 3GCSA 3S3IA 4CEGA 4ZJVA 2XEZA 4GU9A 5CQUA 4AE9A 5DR6A 2C5YA 3VHEA 1O9UA 5EM6A 2V55A 4PL5A 4EH6A 2JAVA 1LP4A 4JDIA 1Q62A 2V5QA 4DFUA 2WHBA 3FPMA 5CVGA 3W33A 3TL8A 4UV0A 2XYNA 2Y8OA 2QU5A 3MH0A 4FBXA 2I40A 3I0QA 5LVNA 3VS1A 5L2IA 5IUIA 5CANA 3PJCA 4R5YA 5AV2A 3NR9A 5ANOA 4DEIA 2WTCA 4A9SA 4BCQA 3DNEA 1OZ1A 4KIPA 2FYSA 3FHRA 4ZOGA 1EH4A 5A3XA 2YJRA 2W1FA 1ZY5A 4ZJJA 1SNUA 3P7BA 4JJRA 4XYFA 1H0VA 3P08A 3BU3A 4UMQA 3WOWA 4NZWB 2ITPA 5G6VA 3JY0A 2PUNA 3TV4A 2XIZA 5TF9A 4JIAA 2J0IA 4PNIA 5DVRA 3NUSA 3LCOA 1GIHA 4EUUA 3OS3A 2P2IA 4BWKA 4MX9A 3JY9A 5D11A 5CZIA 2IW6A 4AW1A 3R9OA 4JQ7A 4YO4A 2UV2A 3O23A 2YHVA 5A9UA 2RFSA 2XBAA 2VD5A 1AQ1A 1H01A 1YW2A 3RNYA 4EH5A 4YJNA 1FOTA 3G0EA 4UMPA 2XJ0A 3IOPA 2JDRA 1WZYA 3E5AA 4FZFB 4DCAA 2ZB1A 5FBOA 3QUPA 4IZ7A 2JDVA 3GBZA 5DEWA 4IZAA 1JWHA 2PE1A 3OP5A 3OW3A 4H1MA 5TE0A 4X2JA 4Y85A 4AZVA 4CTBA 2G2IA 2PVHA 5HD4A 4DG3E 4RA5A 4AW0A 4RT7A 4FV8A 5M4IA 3LZBA 5L3AA 2VTMA 3BPRA 5AUTA 2E9NA 5IA5A 3FLSA 3V8WA 3ODZX 4B8MA 4R77A 3MFTA 3WE8A 4EOIA 1ZOGA 2Z7LA 3QTSA 1O6LA 4ZSEA 4AX8A 1PRYA 4GFOA 5IA0A 4EC9A 2X8EA 1H26A 4O27B 5HLPA 4F4PA 3S4QA 4U80A 3MIYA 3LPBA 4RGJA 3VF9A 4RWKA 3R71A 4MCVA 5CAPA 5CEMA 4KD1A 3PVUA 2EXCX 4GIIA 4A4XA 4D4YA 3P4KA 2XK7A 3PLSA 3CJFA 3PG3A 2ZM4A 5AM6A 5AUWA 2XZSA 3MVMA 3PWYA 4O91A 4C4GA 3FHIA 5ACBC 4AXAA 2E9PA 4GVAA 1Q8ZA 2DUVA 4PTEA 3K5VA 4IMYA 5DLSA 3OBGA 2XK8A 3ZEWA 4LFIA 1ZY4A 3LQ8A 4J96A 3AMBA 4C8BA 2UW0A 3VBTA 3NYVA 2JLDA 5IUGA 3K5UA 3ATSA 4CCUA 3MJ2A 4YZBA 4GKHA 2P4IA 4FSQA 2P2HA 4U3YA 1E9HA 2OJIA 3IONA 3PE2A 4H39A 3FZ1A 4M13A 4TKSA 5CSHA 5A46A 2YN8A 4MQ1A 1UNHA 4IB3A 5LVLA 3R28A 3LCDA 4EH8A 2BFXA 3ROCA 4CMTA 2PULA 2GNHA 3FYKX 2BVAA 3ENHA 5EH0A 3V5QA 4EQMA 3GGFA 3OW4A 3ROYA 3P7CA 4YZCA 4XV9A 4Z55A 3DTCA 3DXQA 2E9UA 3NUPA 3CR0A 5LCKA 2I0EA 3FWQA 4FYNA 4BGHA 5L4QA 2OJ9A 5DE2A 1OBGA 4LUDA 5HX6A 2WD1A 4WNKA 2GFSA 4JIKA 3E7VA 4P5ZA 3RKBA 2VGPA 4GW8A 4IX4A 4L3LA 4G31A 4ZS0A 3BLRA 3RP9A 3CS9A 4B4LA 3HYHA 3LW0A 5HE3A 3C0IA 3FMJA 3MIAA 3V5WA 3ZC5A 2R3JA 2QHNA 3RAHA 4C7TA 5C03A 1FPUA 2RKUA 4BCFA 1SVEA 2V22A 4XRLA 4BTKA 4F08A 3AOXA 5BVDA 5C01A 3MVJA 4KSPA 4A4OA 3GQLA 4RFMA 5HGIA 2ZV7A 4FF8A 4QTEA 3PIZA 5CTPA 2OF2A 5FG8A 2XBJA 4L9IA 3MA6A 5FQDC 4EK6A 5CF4A 4EQUA 4CKJA 1YRPA 3G9NA 2W1HA 4JQEA 5HVYA 1YKRA 2C3KA 5HBEA 1Q4LA 2PVNA 3NNXA 5HCXA 3B2TA 4LUEA 4KRCA 5D10A 4R7HA 4KIKA 4BDDA 1Q41A 4J8NA 2YM5A 1ZAOA 5DEYA 4QMWA 4ASEA 3PXFA 3F66A 2VWWA 4E5BA 3A4OX 5DIAA 4KBCA 1Q8WA 2WPAA 2JKMA 4MEDA 4FZAB 1Z5MA 4LOQA 3PRFA 5DRBA 3FY2A 1VYZA 5LCJA 1K9AA 4IM2A 3CE3A 3F3UA 1LEZA 2IO6A 3R8VA 2WIPA 2GFCA 3TJCA 2WMVA 1R0PA 2V7AA 3IKAA 4KABA 3D14A 4M7IA 3LXPA 3D15A 3VS3A 4C38A 4KNBA 5GINE 2OW3A 2ZAZA 4JR7A 4FSYA 2HZ0A 4FYOA 2ZOQA 5ANDA 4EK3A 4F65A 1DI9A 2QOQA 1PMVA 3QQUA 4HGEA 4Q9SA 5KO1A 3MESA 4K9YA 1WBTA 2QOIA 3MSSA 3W2OA 3ZM4A 4R78A 4F6WA 3IW4A 4PDSA 1J91A 4CFUA 3IECA 4FNYA 4MAOA 3MPMA 3PUPA 2YJSA 3W18A 2NNWB 5IQIA 2GQSA 3ZZWA 4CXAA 3D5XA 4YGAA 3U51A 4YZMA 2CLXA 3GOKA 5AX3A 3RTPA 4DINA 4EH4A 3ZS5A 2Y6OA 4JBVA 4AF3A 1T46A 2Z60A 3K3IA 5HE1A 1JKSA 3PFQA 3ZDUA 3H0YA 3MB6A 4S33A 1J7LA 3QD2B 5ETIA 4B99A 4F64A 3TTJA 2RFNA 2IW9A 2W1IA 2BRBA 3ATTA 3QU0A 3PJ8A 2VTHA 3KQ7A 2XF0A 3D7TA 3EKKA 5CEQA 3QD3A 3CTQA 5E4HA 2GHGA 1OL7A 4YLLA 5C27A 4FIFA 3W1FA 3DA6A 5HTIA 5HCZA 4IADA 3ZLXA 1IEPA 5HX8A 1UKHA 4I94A 4L3PA 4RG0A 3NMUF 4RIXB 3O2MA 4YTIA 4TWPA 4UMUA 3UG1A 1O6KA 4FA2A 4I22A 2IVSA 3NYXA 2GSFA 2QURA 3QUDA 4CTCA 3QTWA 1NW1A 1STCE 3Q9WA 3QTRA 4RJ8A 4F09A 4A4LA 3LHJA 4LL5A 2GHLA 4ZY4A 5BVOA 4O7NA 1BL7A 3MW1A 4KS8A 3SRVB 5CZHA 2V62A 3LCSA 2WQNA 4FK3A 4FIIA 2WAJA 4RQVA 4MXOA 5BMSA 4FL3A 3BU6A 3BE2A 4B9DA 5J1VA 2PSQA 3OD6X 4E3CA 2UVXA 4HNIA 3MV5A 1PHKA 5FTQA 5K5XA 5LQFA 4D9UA 2X9FA 4TRLA 4B6LA 4E6DA 2WMRA 3UDBA 4WT6A 4ZTRA 1CKIA 4DFLA 2VX1A 4U5JA 4O7SA 3TKHA 5CSWA 4R3CA 4HJOA 4BKZA 4AT4A 3OZ6A 1CTPE 3ZSIA 1RW8A 3SG8A 3LFEA 3NUYA 4IC8A 4OLIA 4FEQA 2NRUA 3VNTA 1GIIA 2PVLA 3AD6A 4I5HA 1HCKA 4BC6A 4K8AA 3QUEA 1R39A 3TM0A 4HGSA 3BU5A 3C5UA 3TT0A 2HCKA 2R3LA 4IVBA 2VZ6A 3O0GA 4OTDA 4U8ZA 4U3ZA 4WKQA 4IAZA 5TR6A 1GY3A 3EQCA 5BYYA 3P86A 3IDPA 1OKYA 4FSNA 3HP5A 2C6KA 3R1NA 4O6LA 3R1SA 3TWJA 2ZM1A 2X9EA 4O86A 1W82A 2ZV9A 5HQ0A 3BGZA 4MF1A 4O0SA 4PMTA 4YHJA 3WF7A 5EKNA 4NT4A 4KKEA 4AZEA 3RWQA 5E90A 4YSMA 4IJPA 2BFYA 3R00A 4APCA 3U9CA 4C3RA 2KTYA 3KEXA 2YIWA 4E20A 3WZJA 2O64A 2W5AA 4Z9LA 5I5ZA 3T3UA 1Q8TA 4TN6A 4A9TA 1YXVA 4ZZOA 4GU6A 4GH2A 5JN2A 5K3YA 3KK9A 2F49A 2VU3A 4FT9A 3UNJA 2X2LA 3TNQB 3GU6A 2JDSA 2YISA 2NP8A 2XK9A 3KXMA 4F6UA 5B2LA 4DF3A 3N51A 2UVZA 3LFDA 3KVXA 2OIDA 5HIBA 2VTNA 3NNVA 5IEXA 1IAHA 4AZSA 1ZOEA 5DHJA 2O8YA 3AMYA 4FV6A 4PPBA 1A9UA 4AS0A 5M51A 3EL8A 3C51A 1SVHA 4HPUE 1R78A 3T8OA 1UU8A 3SG9A 5DT0A 2ERZE 2ETKA 4TWOA 1YWNA 4L7SA 2A4LA 2C5NA 2OIBA 5D1JA 3TG1A 3P9JA 5C26A 3SD0A 3DDPA 2B4SB 4I0SA 4GUEA 2CJMA 2G15A 2VTTA 4YC3A 1YDRE 4BI0A 4DG0E 4E93A 1F3MC 4FV1A 5CSVA 4D58A 4DLIA 3TUBA 4EUTA 5IQGA 3EN4A 4BTJA 4FL1A 3V3VA 3HDMA 1OECA 3E93A 2YERA 1XH9A 3AC2A 4EK4A 5ANJA 5LMAA 3E7OA 5CF5A 2QKWB 1FMOE 2WMXA 4YJOA 4JG6A 5IQFA 5EHOA 5AP2A 2I1MA 4M69B 3RNIA 5CS6A 5JRSA 4C37A 1M17A 2BRHA 3PXYA 2YIRA 3HV6A 4U40A 3IOKA 3W2CA 5J9LA 5LXMA 4WNPA 4ERKA 1Y8YA 4IANA 3FMDA 3KVWA 4RVKA 4WRSA 4XG7A 2A0CX 2OKRA 4RZVA 4X21A 5FD2A 4RA4A 5HVJA 2HOGA 3TI1A 3ORLA 1Q24A 4OTQA 1U54B 4G6OA 4UYAA 4U81A 5GZAA 5J7HA 3F5UA 1PXKA 3H9FA 3ZBXA 5EDPA 3LFFA 4I21A 5C4KA 4ONAA 1U5QA 3HV4A 4QMUA 4EJNA 4IC7A 3RAKA 3PSBA 4D2RA 4GYGA 4E7WA 1ZWSA 5IQHA 3CTHA 3F3ZA 5TT7A 2BAJA 1VEBA 4R6VA 3NCGA 2OZAA 3CJGA 3SX9A 2JBPA 3DBDA 4XMOA 5DNRA 4YP8A 3VF8A 3GOPA 1TQIA 2X2KA 5FDXA 1CSNA 2W4KA 3BHHA 5GZ9A 4IJ9A 4HYUA 4I5PA 2VN9A 5IH4A 3FMEA 3GXLA 2NPQA 3DK3A 2PK9A 5AUZA 3R7VA 1QPDA 4U44A 1KOAA 4FTNA 2ITVA 3TNWA 4DE4A 4RJ4A 4WD5A 4E8AA 1KWPA 3UPXA 4JG8A 2WELA 4LV8A 4RZWA 2H9VA 2YIYA 4I5CA 5KMKA 5K4JA 4KKGA 2YDKA 2AYPA 3K54A 4XG8A 4JQ8A 4JG7A 2ITXA 4TT7A 4X2KA 5AFVA 4IX5A 3VS6A 2O5KA 3F82A 3ZXZA 4TXCA 3RK5A 4RPVA 1ZLTA 3IGGA 3P23A 4NFNA 5HTCA 4OAUC 2G2HA 2YM4A 4I93A 2I0VA 4AGWA 3F3VA 4LL0A 1W84A 3N9XA 4JI9A 5EI6A 3PRIA 2W05A 2YM7A 4NJ3A 2YCFA 2F7EE 5EOLA 4QMPA 2FSTX 2C3IB 2Y0AA 3KKVA 1Q97A 2BZKB 2HW7A 2BALA 3OUKA 4NCTC 4YC6A 4C4HA 4AFEA 5B2MA 4G2FA 3OT8A 4I92A 4MXZA 4O82A 4O0YA 1FQ1B 5A6NA 3R02A 3NVMB 3FMNA 3EHAA 3P0MA 2Z8CA 3HRBA 5M4CA 3QC4A 4ZS4A 2DYLA 3ZUVA 4ZSGA 3HEGA 1XH8A 4RX7A 3SDJA 3KRJA 3JUHA 5HG9A 1OUKA 3BRBA 2ZDUA 3PYYA 4NK9A 3W10A 3R6XA 1OL2A 4PTGA 3UQFA 3OTUA 4DEDA 4U41A 1PXIA 2OWBA 4IX3A 4D1SA 3W16A 2Q83A 4V0GA 4FT7A 3WE4A 3AD4A 2BDJA 2XK6A 3GCUA 5D7VA 3W55A 2YABA 2WXVA 3KN6A 4PRJA 4NSTA 2VTJA 4TTHB 4O0WA 5C9CA 2WIHA 4BYIA 3P7AA 4BIDA 1XBAA 3E64A 3G51A 4CFXA 4IB5A 3U8WA 4CSVA 4DAWA 3ODYX 3NSZA 1JQHA 5AIRA 2XKCA 3POZA 3QHWA 2IW8A 4ITJA 4E6CA 5E91A 2J51A 2H34A 4HVHA 4FMQA 4HCUA 3R7OA 3SLSA 4WBOA 3U87A 2VRXA 2R3HA 4OTHA 2BKKA 5FEEA 3CQUA 4NTSA 3ZM9A 4QMTA 4QNYA 2CCHA 2XP2A 4II5A 4MK0A 3ZO3A 2PZIA 5I9YA 2WTDA 4L3JA 5FXQA 4UALA 4E4NA 1PW2A 1W8CA 4GV1A 2F9GA 1Q3DA 2CN5A 3HV3A 4LRJA 4NW5A 2YM8A 5KKRB 5CI6A 3SVVA 1REJA 3BI6A 3QQHA 4IAFA 2JEDA 3GU4A 3PZEA 3D2KA 3VJNA 1ZRZA 5AA8A 5CAVA 1ZYCA 3C50A 1KOBA 3FSKA 2CN8A 2JKOA 4LOOA 3DNDA 4NM5A 4O2ZA 2BR1A 1KE9A 5EYCA 3R7IA 1VYWA 3EYHA 3R9DA 5HU9A 3AC5A 4FNZA 4FEVA 3DK7A 4O7RA 2PL0A 5T3QA 2C5OA 2PVFA 2QC6A 4UZHA 4Y95A 5D7AA 3VBVA 2HXQA 2UZLA 1SMHA 3OXIA 1IA9A 4FKVA 2BAQA 3QQKA 3GCVA 4PTCA 4BHNA 3FXXA 3VW6A 5HZNA 3VRZA 5L8JA 5JZJA 3F61A 4G6LA 2ITTA 1PYEA 3R22A 5KMMA 2G9XA 3H0ZA 2WOUA 3VUGA 4L45A 1J1CA 3BHTA 2QOCA 3KXZA 5IA4A 4DH5A 3Q53A 5KZ0A 3FPQA 3ZRLA 2RGPA 3TNHA 2VWYA 4RLKA 2P33A 4L44A 1Z57A 1PKDA 5HG7A 5AV4A 4RFZA 1WFCA 2PTKA 4YJRA 2ONLA 4S30A 3SXRA 2J6MA 3COIA 3KMUA 3TNIA 4FX3A 5DMZA 3N4UA 5HOAA 1FBNA 1NY3A 4DA5A 4FSZA 4QRCA 5JFXA 2GQGA 4JX3A 4TY1A 4WHZA 4GUBA 3TDVA 3VUIA 4XG3A 4A9RA 4BWXA 3HECA 2YCQA 4NM0A 3QRJA 2CKQA 1OIYA 3M1SA 4FUXA 1Q3WA 4NFMA 2UZEA 3I5ZA 3IGOA 4JR3A 4YSJA 4QT1A 4Y8DA 4ZAUA 4BBMA 3RZFA 3KULB 4AN9A 5EW3A 4YR8A 5EW8A 4FT5A 4X3FB 3BX5A 3GENA 4JT3A 5L2QA 3UO4A 2HELA 2HY0A 1PMUA 2JFLA 1H1SA 4Y73A 3WARA 4FEWA 3LQ5A 4UWYA 3PXZA 3JS2A 4DTBA 1OKVA 2CKEA 2PMIA 3GU7A 5AAFA 1DI8A 3TACA 5LMKC 4G1WA 3C4FA 1S9JA 4A7CA 4RVMA 3RHKA 2BTSA 4CG8A 1BI7A 3EZVA 5HLNA 2YLFA 3QCQA 3NVKI 3LJ0A 4LG4A 5JQ8A 2BMCA 4AW2A 2OH4A 4Y5QA 3LFAA 2ETRA 2RG5A 5HHWA 3VS2A 3AT4A 2C6LA 5CF6A 3UVPA 5T68A 4AACA 2PMNX 4P2KA 4FTMA 2GNGA 1XBCA 1M2RA 2EU9A 2SRCA 4QYEA 4DG2E 1WMKA 3E88A 3QQJA 2OIQA 2Y4IC 4KBAA 5FUTA 2C6DA 3GCPA 3R7YA 3BHYA 3FLYA 3IK3A 4GEOA 4YZDA 5KMNA 2QO2A 4EZ5A 3O7LD 3RINA 3UYSA 4DFBA 2XA4A 4MHAA 5K0KA 3H10A 3O71A 4GSBA 2RIOA 4H3QA 4ITHA 4NTTA 5CT0A 2QO7A 4QTCA 2C6MA 2VWUA 5JSMA 1B38A 2HW6A 3W2PA 4D4RA 5IDPA 3NW7A 3PJ1A 2GCDA 3GB2A 3OHTA 4XHKB 3DBFA 4W9XA 4FZDB 4MXYA 5JFSA 2BPMA 4FGRA 3A8XA 3EN7A 2W1DA 1V0OA 5E8ZA 2W1GA 3CPBA 4QOXA 4DN5A 2OF4A 4FNWA 1O6YA 4GIHA 2ZM3A 4G3DA 3DXNA 1Y6BA 1FVVA 3OXZA 2BZIB 3PE1A 3GP0A 4WNMA 2YFXA 2CPKE 1OITA 1PXLA 2W5BA 2XM9A 3QQLA 4CFNA 2A2AA 4M3QA 2YAKA 4QP2A 4APPA 2EXMA 4I20A 3CSVA 3D7ZA 4U45A 4E26A 2UZUE 4XG9A 4USEA 4MQ2A 4EKKA 2QR8A 4NWMA 2GQRA 1YDTE 3ACJA 4I3ZA 3G5DA 1ZZLA 3UIXA 4QQCA 4ZTLA 4BZOA 1JLUE 3MTLA 3ZLYA 5M06A 4CZTA 3RBWA 4FZ7A 3TN8A 4FTIA 3PP0A 4IE9A 1LPUA 3KF7A 5HLWA 2B9FA 3NDMA 3KXHA 3FI4A 1SNXA 3QALE 3QWKA 4DFZE 3FLZA 3TV7A 2GNLA 4NM7A 2OXXA 1F0QA 2UW5A 1XWSA 4F99A 4IH8A 2A1AB 2PWLA 2RL5A 2X4FA 4EYJA 4PDPA 2BRGA 2X0GA 3NNUA 4LGDA 2CKOA 3QRKA 1I09A 4TYHA 4YJQA 4EQCA 2OFVA 2IZSA 3QKKA 4FR4A 4QQ5A 1BL6A 3DK6A 4WG5A 3P78A 4Y5HA 3POOA 2BTRA 1V1KA 2UW3A 2XB7A 1BLXA 1GZ8A 4GYIA 2X6EA 3H30A 3R01A 4GRBA 2IVUA 2W99B 2LGCA 4R3RA 4RIYB 5TOZA 2OJFE 3SHEA 3QFVA 3WIKA 5BX0A 3M11A 2VX3A 2GNFA 2GPHA 2QNJA 5JGAA 1WBSA 4BDBA 5TO8A 3UJGA 2J50A 5CVFA 3KGAA 3O7LB 5CEIA 4D4SA 3RM7A 2VNYA 5F95A 4XBRA 2O0UA 2YLEA 4WUAA 3HV7A 3NCZA 4L7FA 3BEGA 3LCKA 4FG7A 2LAVA 3BHUA 4Q9ZA 3BWFA 2YA9A 5A14A 4DEGA 1URWA 5CXZA 3PJ3A 1OPJA 2V7OA 3IDCA 4RC4A 3JYAA 4KIKB 5CWZA 3CC6A 5ANGA 5M57A 1YWRA 4E5WA 5DOSA 3T3VA 3KB7A 4IZ5A 2C69A 5AUYA 1GOLA 3DBCA 3CD8A 3QL8A 4XV3A 4L42A 4L52A 3ZFYA 2XVDA 3DLSA 3QCYA 2GS6A 3HNGA 4X2NA 2ITNA 5CVHA 4C61A 4C59A 4I1ZA 3OG7A 3COHA 1H4LA 1GZNA 3DAEA 4FVPA 5BVKA 4U43A 1OPKA 4QP7A 2P3GX 2FO0A 2VTOA 3L8SA 2J90A 4MBJA 2ZV2A 4XOZA 5EI2A 4J97A 3D4QA 3ORTA 2PVJA 3U4WA 1NVRA 3MI9A 5J1WA 2HZ4A 3L1SA 3HV5A 2QLQA 3IDBA 4O7YA 4UMRA 2WQOA 4FKPA 1MRUA 4A07A 5E9EA 3EMGA 1MP8A 4MNEA 4QQJA 3FYJX 3DQXA 3C5IA 3ZRMA 4O38A 3OEZA 4C36A 4ZZNA 4CQGA 2HY81 3TDWA 5M4FA 2EVAA 4C3PA 5CASA 4O7TA 4EEVA 1UU3A 2R9SA 1J3HA 4P7EA 1I44A 3Q2MA 4XS2A 5A4LA 3A4PA 4HCTA 4JXFA 4WRGA 3SKCA 4CFVA 3QYZA 3R2BA 4JVGA 2W1ZA 4TWCA 3F7WA 4BGQA 3KK8A 4EBWA 4I0RA 4EHVA 4OTGA 4ZSLA 4L53A 1JKTA 2HZNA 4WSQA 4CT2A 4GL9A 1RDQE 4XP2A 3GI3A 4DFYA 5I9VA 3D7TB 3OWLA 1OIRA 3OXTA 4MYGA 4ENXA 3S1HA 4U7ZA 4YNEA 4ANMA 3MDYA 3GQIA 4BR3A 2C6IA 5BVEA 1DAWA 3R0TA 3QQGA 5AIKA 4BI1A 1W98A 2CGWA 2IN6A 4HZRA 4CQEA 4DT8A 4O7LA 3VRYA 5HO7A 2JAMA 5FDPA 1LUFA 3QRTA 4ACMA 2X8IA 4A06A 2X4ZA 4CRSA 1G5SA 4EOSA 4EYMA 5BUEA 3BYUA 3VJOA 4BICA 1OKWA 2UZDA 3MN3A 4CZYB 2PZRA 4E5AX 3S0OA 3TIZA 4EL9A 4EOQA 5FBNC 3MY5A 3N4VA 3EQIA 4BKJA 1JOWB 2VTSA 3D2IA 3RGFA 4B7TA 2F4JA 4WBBB 1YQJA 3OCBA 3OEFX 3W8QA 4H1JA 1UNGA 3EQDA 4IX6A 5FEDA 2WO6A 5LVPA 2OJJA 2PY3A 5B0XA 5IQAA 3PSDA 3Q04A 5AP4A 4F6SA 2W1CA 4EOOA 4YLJA 1L8TA 4QYGA 5HNBA 3Q5ZA 3QA8A 4FKRA 2BIYA 4BIEA 4BYJA 5IA2A 3HVCA 5LVOA 3LM5A 2R3KA 5D41A 3Q2JA 5EYKA 3MVLA 1ZXEA 4WG4A 4OAVB 2X7GA 3FAAA 5CALA 3MVHA 4GKIA 1XQZA 2WKMA 2J0LA 4AGDA 5FM2A 3LKMA 2Y4PA 1YXSA 4F9WA 3AC3A 1U59A 5AP0A 3V5TA 5EFQA 2WZJA 3EH9A 1OUYA 1U5RA 2XCKA 4RIWB 5G1XA 5A54A 5CNOA 2PUPA 4FKSA 2XIRA 4R7IA 4O22A 4O21A 1FMKA 4FL2A 4EH7A 3QTXA 2GMXA 3QTUA 3SAYA 3BBWA 3V5JA 1V0BA 4OR5A 5E8SA 3SV0A 3C0HA 1WVXA 1YI3A 4AZTA 1UA2A 3HMMA 3G2FA 3PVWA 4IVCA 3RCJA 5I9ZA 3GC7A 4MD9E 5CU2A 3U54A 5F4NA 4GFGA 3CBLA 3QGYA 3BGQA 3HMIA 3G15A 3U9NA 2BRNA 3RJCA 3F5XA 4FT0A 2YAAA 3VS5A 4AT5A 3CKXA 4XLIA 3TKUA 4N6YA 3LFBA 2CGUA 4OW8A 3CEKA 4YBKA 2C6TA 1UV5A 1GIJA 1WBOA 4H58A 5DPVA 3IQ7A 2PZYA 3L8PA 4H05A 3IO7A 1KE5A 3V5LA 4IB0A 2Z2WA 3ORNA 3Q6UA 3WF8A 1A48A 5KZIA 5JEBA 1YXUA 3R7GA 4PL4A 3SOCA 2O65A 2W9FB 4NEUA 5F20A 5AAEA 2UZTA 2I6LA 4FV4A 4RFYA 4UBAA 5JFWA 3UC3A 4ORKA 4DGOA 2WOTA 2QU6A 4BN1A 4RC3A 3IS5A 2J7TA 3I60A 5I3RA 1XJDA 3V6SA 4BDGA 3VN9A 4FTOA 4V04A 3SGCA 2E9OA 3FZRA 4QMQA 3MB7A 3MY0A 2QVSE 5AM7A 5H3QA 1OBDA 4NH1A 4CGAA 5LJJA 4OT5A 4FG8A 4D2VA 5IU2A 3D0EA 3Q5IA 4XRJA 2X2MA 4BDAA 4DGGA 4E4MA 3OCGA 3HAVA 4IDTA 3DY7A 3R30A 4AN3A 1Q5KA 4DC2A 1MRVA 4FG9A 2JKQA 3ANRA 4NIFB 4XG6A 2QOLA 1NVSA 2R3IA 3O8UA 1TKIA 4O0VA 5AEPA 4YC8A 5L8KA 1H1QA 2CGVA 3UMWA 2VTLA 2JIIA 3TZ9A 1J1BA 3EFKA 4DBXA 4ZSAA 4EOKA 3KXNA 2B9IA 3I7CA 3PSCA 4JLCA 1XO2B 2XIKA 3QQFA 3ZC6A 4P90A 4WA9A 4P4CA 4ZIMA 1NXKA 3FXWA 3EJ1A 3GU8A 5E1SA 1L3RE 3RALA 4DITA 2QG5A 4V05A 4CFFA 3UTOA 3F5GA 3OT3A 1UKIA 5AP3A 1CM8A 4EOLA 4UWCA 4AUAA 4C2WA 3DFCB 4S34A 4UX9A 2WNTA 1H27A 4CFWA 2GS2A 4HOKA 3RMFA 3ZHPC 5AP7A 1P5EA 2IJMA 4DT9A 5I4NA 4XH6A 2OXYA 5JRQA 1XH4A 3W32A 2ITOA 1PXJA 3OFMA 3D9VA 3BELA 3HL7A 3FQHA 1Y91A 4BWPA 4IHPA 2CKPA 4BGGA 4QTBA 4FUYA 3QTIA 4F1MA 3CKWA 5CSXA 2FB8A 1R3CA 3PIYA 5DYJA 2WTWA 4PPAA 1FGKA 4IM3A 4AE6A 3UZTA 3DDQA 4ZEGA 4DYMA 3PDTA 4EOPA 4AU8A 3WYXA 5FXSA 3KN5A 2BROA 4L01A 1H07A 3R2YA 4FOBA 4K33A 5AV1A 4D55A 1ZZ2A 2UW9A 5F94A 4TYGA 3OUNB 4MXCA 3R9HA 2XIYA 4KS7A 3RHXA 4RQKA 2HWOA 3W8LA 2BHHA 3EB0A 2FVDA 3MFUA 2W5HA 4H36A 4DLJA 3MA3A 4ALVA 4E6QA 2G01A 3KRXA 4FTUA 2X8DA 1MQ4A 1QCFA 3ZDIA 4QNAA 3DOGA 1PXNA 3HKOA 1GAGA 1YWVA 5DR9A 1G8AA 2OG8A 4HCVA 4F9BA 3UZRA 3DKFA 1IR3A 3CD3A 3UZPA 2J0MB 3PA3A 4DEAA 2AC5A 3MWUA 4G3EA 1M7QA 3AC8A 3QTQA 4L43A 2JFMA 2XNNA 2WEIA 5EQYA 1R0EA 5L6WL 1KUTA 3ZH8A 3DKCA 3VIDA 1UWJA 2WFYA 2VWXA 1IRKA 4PQNA 3MBLA 4YPSA 3WZUA 5CEPA 3V01A 4FTLA 4IZYA 4UXLA 3K3JA 4YO6A 3SRVA 2YIXA 3EQRA 4C3FA 4AOTA 4FKUA 4BFMA 3FI8A 5KE0A 2PMLX 1TQPA 1ZYLA 1YXXA 3FSFA 4GT5A 5GIPE 3A7JA 4O0RA 4OTFA 4ACDA 4S31A 4UEUA 4DBNA 5CYIA 3ITZA 2QOHA 3OWPA 4BL1A 4FKIA 3KA0A 5AUVA 5HVKA 3NW6A 3PVBA 3ALNA 4EHGA 4MWIA 4D2SA 2OFUA 3V04A 3V6RA 3R9RA 4N70A 4DFNA 4DGMA 3O17A 5JGDA 3NIEA 1S9IA 3BIZA 3NEWA 1FINA 4QYYA 4FEXA 4OT6A 3LJ1A 4UXQA 3PY1A 1HOWA 3E3PA 3RPVA 4G3FA 5I9UA 2B1PA 4KIQA 4PX6A 4R7BA 3KU2A 4L8MA 5T6KA 4D4VA 3FE3A 4C4IA 3AD5A 4E1ZA 3LM0A 2JBOA 5LMBA 1OIQA 1VR2A 2R0UA 3DFAA 4FGBA 4ZTSA 2DS1A 4LGGA 5M56A 3NUXA 3I7BA 2XNPA 3SW4A 5HTBA 3DBQA 2UW8A 1H25A 3KCFA 5KMIA 3ORKA 4IAAA 2WTIA 2E9VA 4ASXA 3F2RA 4F1TA 4EWHA 3BEAA 3DU8A 3L9NA 2UVYA 4W4VA 3NX8A 3ERKA 3FI2A 3W2SA 1MUOA 5AUXA 5H2UA 3S00A 3TUDA 3MH2A 2YM3A 4FTKA 2VWBA 4O7ZA 3FQEA 4PMPA 5J7BA 5HG8A 2J4ZA 3BWJA 4CKIA 2C3JA 3A7GA 2PVMA 1JVPP 3A7FA 2W4OA 3NAXA 1PYXA 4FKTA 3FZSA 3ZFXA 4U9AA 4YHFA 1WVYA 3M2WA 3UIUA 5IH6A 1BUHA 4OBOA 2IG7A 2IVVA 3ZMMA 3E8DA 4W9WA 5DT4A 3PVGA 4LGHA 4BKYA 1NA7A 3OTVA 4JDHA 3C9WA 4YMJA 3FL5A 4GT3A 4XP0A 3WZEA 1Q99A 3OBJA 3LXNA 4O1OA 3RI1A 4EZ3A 5DR2A 3EZRA 3HUBA 4F63A 4IM0A 4FKGA 4GMYA 2XM8A 2PYWA 2VTRA 5KHXA 2PMOX 3ZUTA 4FV7A 3LFQA 3CY2A 3SW7A 3DQWA 1Y6AA 4U0IA 4ANQA 4MTAA 4FTCA 5CXHA 2BHEA 5JT2A 4C4FA 5LVMA 2QQ7A 3NW5A 4BCGA 2UW4A 3E8CA 5IH5A 3PY3A 4E4LA 1LR4A 1M2QA 2QODA 4J53A 5AR8A 3DZOA 1H00A 2FH9A 2PZPA 4JAIA 3GUBA 3LXLA 5BPYA 2QOOA 4YTFA 4HVGA 5BQ0A 5C8KA 3AGLA 4NCTA 1SYKA 3P5KA 3ORIA 4JBQA 4IWPA 4O0TA 2WU7A 2PUUA 4K0YA 2R3QA 3ZU7A 4M69A 4BRXA 3U4UA 4L46A 4BTFA 1KV1A 5IG1A 2X81A 3B8RA 3FQSA 5DT3A 5K0XA 4WNOA 4F9CA 5FWKK 4I6QA 3L8XA 4D1ZA 5IA1A 2E2BA 3GNIB 3KRLA 4WG3A 4OBQA 4XEYA 5HIEA 4FTJA 4M67A 3R7UA 1W83A 2I0HA 1U54A 1H28A 4FT3A 4O81A 4AA5A 4JBPA 4CVAA 4ASDA 4OTPA 2ZDTA 3MFRA 3NYNA 4D2TA 3R83A 3KC3A 5HEZA 5LARA 5KNJA 3RWPA 3EN6A 4KKHA 2R3RA 5KMOA 3O8PA 4RWJA 2UZNA 4M14A 4YJUA 1SZMA 4ZLOA 5B7VA 4V01A 4IBMA 4UY9A 4JX7A 3RPYA 4G34A 4BDEA 3ORPA 3KL8A 4HYHA 5BYLA 2AUHA 3CLYA 4BY9E 2UZWE 4EK5A 3VUTA 3IW7A 1AD5A 3QHRA 3QTZA 5H9BA 4IWDA 4AP7A 4R1VA 4RVLA 2C1BA 4FEUA 3ZO1A 3MY1A 4M66A 4AFJA 3EN9A 5KCVA 5BUIA 3EQBA 1NVQA 3I0OA 3V8TA 3ZYAA 4B8LA 4WUNA 4RRVA 5A4CA 5GJDA 5JH6A 2F2CB 5ITAA 4QPMA 4Y72A 5K9IA 5JQ5A 1GJOA 1XBBA 3RZBA 5EM5A 2C68A 1WAKA 4ANOA 2ITWA 4K77A 4RX9A 2X6DA 4QMLA 4J71A 4ZY5A 4JDKA 5M07A 4FIHA 3DXPA 5GJGA 4KIOA 1JNKA 5HO6A 2WTKB 3ALOA 3QWJA 5B2KA 3ZZEA 4MD7E 2XYUA 2Z7QA 4ASZA 1PXMA 4HVIA 4Z7GA 4BDCA 3GC0A 4K11A 3HMNA 5M09A 1XR1A 1AGWA 2O63A 1ATPE 4Z7HA 2H96A 4M97A 3U6IA 4S32A 2XJ1A 4GS6A 4BDHA 3LVPA 2VAGA 5AX9A 1RJBA 4AAAA 3SOAA 3I6UA 2WU6A 3FLNC 3DJ5A 1PJKA 5BVWA 2OICA 3QKMA 4N6ZA 5IF1A 4CLJA 3VQUA 5DWRA 5CU0A 4BCKA 5EHYA 2VTAA 3NUNA 4D28A 3BYVA 3P79A 3LOKA 5CEKA 5JKGA 2R3OA 2YITA 4AQCA 3SA0A 3LMIA 5GIOE 5EKOA 4CYJA 3OY1A 1B39A 1YOMA 4FSUA 3DT1A 4J1RA 4QMOA 3TKIA 3D5WA 4FIEA 5ANKA 2VV9A 4CT1A 5KKRC 4PDOA 3O96A 5IMXA 3Q4CA 3A8WA 4KWPA 1SM2A 3FV8A 4D5HA 4F7JA 2O2UA 3RK9A 4I4FA 4IFGA 5BVFA 4JRVA 2CNVA 3EOCA 3A62A 3ORXA 3ZO4A 3MH1A 3AMAA 3QF9A 5DBXA 3WILA 4C33A 3FMKA 1M7NA 2J2IB 3BHVA 3EQGA 3PP1A 4ZJIA 3NNWA 4LQMA 4F0IA 2QOKA 5E7RA 3G90X 4ZSJA 4EORA 4W8EA 5JZNA 1Q8YA 5H8BA 1YDSE 4YJPA 2CMWA 3R21A 4D0XA 2WGJA 5CEOA 3QCXA 5LMKA 4PDYA 2FSOX 2PVKA 2JDTA 4AW5A 5CF8A 4FNXA 3QD0A 4YZ9A 3QGWA 3UPZA 1J7UA 3CGFA 4CKRA 4NKAA 1TVOA 2QCSA 2YCRA 3BV3A 4G3CA 4RC2A 2PUIA 3JR1A 4AZWA 3KRRA 4CV8A 1BMKA 1B6CB 5HORA 1PKGA 4CYIA 1X8BA 2PVRA 3FZOA 5BYZA 3G0FA 2YIQA 3ELJA 2WEVA 5HCYA 5H8GA 3VWAA 2PZ5A 3AC4A 3H3CA 3MTFA 3QRUA 4DEEA 1CKJA 1MQBA 3EKNA 3IW8A 5E8XA 3Q60A 3CQWA 2WTKC 2XNMA 3R63A 4G9CA 5E8UA 5AR3A 3F7ZA 1APME 4O0UA 4CRLA 1XH5A 4E6AA 1ND4A 3FKLA 4QP8A 4AZFA 2ETMA 2YEXA 3R73A 3OVVA 2BKZA 4NKSA 4QYFA 3DZQA 3AC1A 4LV5A 3VUKA 5BNJA 3RAIA 5KUPA 4MNFA 1QPJA 3GFWA 4FKOA 4QMZA 4X3FC 3CQEA 4JNWA 4LYNA 5I0BA 2WTJA 3D94A 2XNBA 4G16A 4AA0A 3GEQA 4EH3A 2IVTA 4GK2A 1T45A 3ZFMA 3QZFA 3OF0A 4PP9A 4RIOA 3ZOSA 3QYWA 3LMHA 4DGLC 1HCLA 4QMMA 3UVQA 4CZUA 5JMSA 4L68A 4P5QA 3HMPA 2XK3A 3WF9A 2YDJA 4QP3A 2G2FA 3HZTA 3NPCA 2W7XA 2W0JA 3OY3A 5J87A 4O84A 1Y57A 4FV3A 4M0YA 1E1XA 2JITA 4FVRA 2QOBA 2XH5A 5J5SA 3KFAA 4NM3A 3O51A 4IWQA 5FRIA 4F1OA 2JD5A 4UN0C 2UZVA 4FV2A 4JDJA 3WF5A 5FGKA 1H1RA 4FKJA 2ERKA 1R1WA 4RMZA 4FIJA 3BQRA 4MXAA 3H9RA 4IB1A 4A9UA 5IQEA 4TYIA 4F70A 4UB7A 5FEQA 3R1QA 4PL3A 1DM2A 3QLFA 4D2PA 3KF4A 3KULA 4L67A 5CQWA 4X3FA 4Q2AA 4EOMA 4YURA
chains in the Genus database with same CATH superfamily
5E1EA 1YHSA 3HP2A 1H1PA 4X7QA 1ERKA 4HYSA 5AP5A 4YTHA 3TZ8A 5E8WA 4N57A 5CU4A 1H08A 3LXKA 1H24A 5I9XA 4FK6A 4GVJA 3F69A 3I4BA 4OTIA 4C35A 1H8FA 4ZMEA 3QC9A 5EDRA 2CNQA 3W0NA 3MH3A 2OLCA 3UNKA 2CDZA 4ZLZA 4QMXA 5LWMA 5I3OA 1BX6A 3EFJA 4BVUA 2C6EA 3BL7A 4PMMA 1P2AA 1YI4A 3EWHA 3VW8A 3HGKA 4YTCA 1JSVA 2V0DA 2NO3A 2R5TA 4U79A 5ETCA 4F9AA 1A06A 2JKKA 2XAOA 4F9YA 2UW6A 4IACA 4BIBA 4WOVA 5IISA 5BMMA 3V8SA 1U46A 1WCCA 5L6PA 1ZMVA 2BDWA 3UE4A 2YDIA 4IWOA 3UP2A 5FXRA 5FTOA 1PXPA 2CLQA 2X7OA 5KMJA 2WMWA 2ZV8A 1WBPA 2R3NA 4IXPA 3UGCA 4RJ3A 3OROA 4A9YA 2W4JA 4EONA 3VBQA 4XV1A 2QLUA 1ZMWA 2GTNA 4FTRA 4U97A 2XKEA 4Y46A 5HE2A 4HGTA 3RCDA 3VBYA 5L2TA 1WBWA 4G9RA 1GNGA 3BE9A 4FV5A 3TZMA 2C30A 3THBA 5C1QB 5AR5A 5KMLA 3FEGA 5IQCA 1URCA 4KINA 4BCHA 5IEVA 1Q61A 4W4XA 1OIUA 3FMMA 4XV2A 5CY3A 3AKKA 2EB3A 4IVDA 3L8VA 3ETAA 3Q4TA 4BF2A 3IW6A 1GZKA 2WMUA 3BKBA 2XK4A 2J5FA 3ANQA 4MH7A 3BBTB 1E1VA 2VO6A 3DKGA 4X2GA 3ET7A 2QR7A 4QO9A 3GU5A 1XH6A 4D1XA 4JRNA 2CGXA 1QPCA 2HWPA 1XH7A 1IA8A 2XCHA 2P55A 3ZRKA 3I5NA 5HE0A 2PE2A 3C1XA 5GZ8A 5HI2A 3TJDA 3UODA 2RFDA 2UW7A 3PA5A 4RVTA 4BDFA 2CNUA 4HNFA 2XNEA 5EK7A 3E8EA 2R3MA 5CLPA 5AWMA 2WMTA 2HZIA 2EXEA 3PA4A 5AMNA 4D0WA 3ML1A 5HNGA 1G3NA 4ACCA 4OGRA 2W96B 3PXKA 3MFSA 4ZXTA 3A2CA 4Q5HA 4O4BB 4ZMFA 2R2PA 4RIYA 3PJ2A 4GK3A 4FTQA 2J5EA 2HYYA 2XIXA 4RSSA 2OZOA 4XBUA 3AT2A 3CPCA 4MF0A 5IZFA 3CY3A 4ZTHA 2QOFA 5AADA 5DA3A 2VO3A 5JFVA 1GZOA 2QO9A 5EYMA 4EC8A 3W0RA 4QPSA 4IAKA 4QMYA 5IMEA 3D83A 4YHTA 3I81A 1XHAA 4RWLA 5AV0A 3TNPC 3VULA 4JS8A 5CAQA 2A19B 4M68A 4QQTA 1YOLA 2HXLA 4KRDA 4E4XA 4U6RA 2WQBA 2OJGA 4ITIA 3MS9A 4K6ZA 3VBWA 2XJ2A 3G33A 4BBFA 2A27A 4O4CA 4KAOA 2W17A 5HIDA 1UNLA 1LEWA 4YLKA 3KY2A 1OL1A 3CIKA 3CP9A 4AWIA 1K2PA 5J8IA 3FLQA 2Z7RA 2IWIA 2BRMA 4GFMA 3DAKA 4LRKA 5K4IA 2Q0NA 4IDVA 2J0KA 5DGZA 5HD7A 2FA2A 3D5VA 3L9PA 2JC6A 4YJVA 5M55A 4BI2A 1P4OA 4GT4A 5KX8A 5J9ZA 4DDIA 2Y7JA 3TIYA 4YUQA 4EOJA 5J5TA 2VGOA 4FICA 3N4TA 3WZDA 3DBEA 3RK7A 5E8TA 5J9YA 3BLQA 5KBQA 1OGUA 2OU7A 3W2QA 2XKFA 4ID7A 4F0FA 1IAJA 4L6QA 3UC4A 3D5UA 4O4EA 1G8SA 3EQFA 3LFSA 4QP6A 2B52A 3UVRA 1YXTA 4ACHA 3SXSA 4D9TA 2EB2A 2UZOA 3A7HA 2HK5A 2QI8A 2VTPA 1MRYA 2ITQA 3IG7A 5IEYA 1JKKA 3GCQA 3QCSA 3R8PA 2B7AA 3F2NA 3TTIA 5JGBA 4QMNA 3C4WA 1H1WA 3LFCA 4MVFA 3VUHA 4DH1A 4OTRA 5CX9A 4ZTQA 5C8MA 3FLWA 3L9LA 4BDJA 4I23A 3LAUA 4HPTE 4IAYA 1BI8A 4CLIA 2VWIA 5ACKA 3Q32A 4BCJA 4DTAA 4TNBA 3KIOC 4LM5A 5A4TA 2B9HA 3OC1A 4ANSA 3A61A 3EFLA 4CMUA 4DEHA 4FVQA 3W2RA 3ZSGA 4IW0A 5M08A 2WQEA 5E92A 1BKXA 2VX0A 3MGYA 5EI8A 5HKMA 4C34A 4D2WA 5HNIX 2WMSA 5AR4A 3RPOA 5L6OA 5EG3A 2W9ZB 1ZYJA 3MPAA 1JBPE 3ZO2A 3MJ1A 5KHWA 4RX5A 2RSVA 2EUFB 3V5PA 2HAKA 4I6FA 2B0QA 2ESMA 4U42A 2C0TA 3DB6A 4ZTMA 2R64A 3WIGA 3LCTA 4NW6A 3ZEPA 1Z9XA 4J95A 3LLTA 2RF9A 2QHMA 3A7IA 3SQQA 3FI3A 4XNEA 2X1NA 4QTAA 3R8LA 4OUCA 3FC1X 3VUDA 4QYHA 1KE8A 3QX4A 3JVSA 3KXGA 2R0IA 5TKDA 2BAKA 4I0TA 2EWAA 3EQHA 5EDQA 3ZLWA 4AGUA 2OXDA 3HDNA 2ZYBA 3EN5A 4I5MA 4EH2A 4EJ7A 3AG9A 4NL0A 5CNNA 1YOJA 4O7VA 3ID6C 4O0XA 4TWNA 2W1EA 4FOCA 1UU9A 3B2WA 3I6WA 3TZ7A 5FP6A 5IUHA 4F78A 1BYGA 1M14A 4YJSA 1W0XC 5DH3A 3RVGA 1W7HA 3G9LX 3HA8A 3ZCLA 4J98A 3VS0A 3ZONA 1QL6A 3TXOA 3PPKA 3QKLA 4LI5A 4AA4A 4ZK5A 2PU8A 4O7WA 4DH8A 5A6OA 1ZYDA 2AC3A 4CNHA 5M53A 3ZUUA 3A99A 1Y8GA 2GDOA 3BYSA 2R3GA 2IZRA 4H3BA 3LIJA 3UP7A 4TYJA 4DH7A 1J7IA 4KUJA 3C13A 2B54A 2P0CA 3ZSHA 4S2ZA 4RJ5A 3AQVA 1DS5A 2OZAB 2BIKB 2CSNA 4NUSA 5H8EA 1KSWA 5LWNA 4YU2A 4IIRA 3ORMA 2PHKA 4PUZA 4ACGA 2C5VA 4X2FA 3UIBA 5E8VA 3BLHA 3UO6A 3FBVA 4DTKA 4WSYA 4HVSA 4QMVA 1RE8A 4RWIA 4RIWA 4C2VA 4USFA 5DFPA 3UOKA 4XG2A 4AQKA 4F0GA 4GK4A 3FMHA 5GJFA 4QEBA 1OB3A 4L00A 4QP1A 2XEYA 3FL4A 4MBIA 5FM3A 3NGAA 5CU6A 3ENMA 2OK1A 2ZVAA 1UU7A 3FZPA 5I9WA 4I41A 4FTAA 3CGOA 1VJYA 2B9JA 1YHVA 3G6GA 3VS7A 4ENYA 3UQCA 2W06A 4QTDA 4R3PA 3VUMA 4TL0A 4CFMA 3F6XA 3TEIA 4DH3A 3FUPA 3KMWA 3F5PA 3R04A 3UNZA 3PXQA 4C58A 2BZHB 2XRWA 3VO3A 4MKCA 5CT7A 2UZBA 3RPRA 4NJDA 4I4EA 2DQ7X 3EIDA 3FDNA 4TYEA 4DHFA 3M42A 4CCBA 1H0WA 2BUJA 4I24A 4WIHA 4PV0A 4ZTNA 3RM6A 4EH9A 2YZAA 3W0QA 3L9MA 2WQMA 4I6LA 4EKLA 2BDFA 4M0ZA 4PWNA 4DEBA 4RIXA 4HYIA 4ANLA 5ETAA 3R8MA 2ZB0A 3OWKA 4XLVA 4BBEA 1KE7A 2GU8A 2XUUA 3Q9XA 5EM7A 3R8UA 4HZSA 4Z16A 3TMOA 2Z7SA 2J9MA 3ZTXA 4C4JA 3PPJA 3Q3BA 2ITZA 5DG5A 3VHKA 4TNDA 4V0GB 5F9EA 3QX2A 1JAMA 4Z3VA 2YZLA 3UYTA 4OBPA 2ACXA 1XKKA 4YNOA 5HBJA 2FUMA 4AOJA 3NAYA 5EHLA 2ZJWA 3KXXA 5L2SA 1JSUA 4O83A 4DHZA 4G5JA 4BDIA 2BILB 3K2LA 2BZJA 3C0GA 4R8QA 5LOHA 1ZOHA 2F7XE 4YBJA 3B8QA 1WBVA 4CMOA 4FSRA 4DCEA 3KMMA 4FV0A 3AGMA 2IZTA 5IKWA 3KRWA 3TV6A 1ZMUA 2NRYA 3EYGA 4BDKA 4C0TA 1ZARA 4AGCA 4NIFA 4R5SA 2X0OA 5FTGA 1FVTA 3FKOA 5EYDA 4EZ7A 4JL9A 4QP4A 2JIVA 3UO5A 4O2PA 4Q5EA 4M12A 5AJQA 5F1ZA 2X39A 3V51A 4O6EA 3EQPA 4TPTA 1W2CA 4QPAA 2BCJA 3MYGA 4XG4A 2B53A 5AP6A 5J79A 3C4CA 2HIWA 2G1TA 3R1YA 2CCIA 4D5KA 4M84A 4QD6A 4EWQA 3R9NA 2VNWA 3W0OA 1WVWA 5AR2A 3VVHA 1PF8A 5CENA 5L2WA 1PMNA 2OGVA 1PXOA 5D9HA 4DFXE 5AV3A 2WB8A 4KB8A 4GCJA 4XCUA 3DS6A 5GNKA 3GFEA 2PPQA 3PIXA 5A4EA 4O96A 3BQCA 3WF6A 4W8DA 3HX4A 2IPXA 3BZ3A 3GC9A 4YJTA 3RPSA 3UOHA 4ZLYA 1PY5A 5AP1A 3F3WA 3Q96A 3DJ7A 2XKDA 2C1AA 3IW5A 2OI4X 2VWVA 3EL7A 2YWPA 4UZDA 3QA0A 2VUWA 3F88A 2F57A 4KA3A 4EBVA 1JPAA 3CXWA 5D12A 2C47A 4N4SA 2C0OA 1K3AA 3REPA 4BTMA 1NT2A 3VBXA 1CKPA 3FXZA 5AUUA 3DB8A 3FMLA 4N0SA 3AT3A 3T9IA 5EM8A 3UQGA 4PY1A 4X3JA 1OM1A 2QD9A 4UWBA 2GNIA 2WMQA 3C7QA 1PMEA 3DAJA 3NUUA 3HA6A 3WI6A 4XUFA 3UG2A 3QZHA 4FSWA 4FSMA 5BUJA 2RFEA 3NRMA 3NIZA 3ZXTA 5M44A 3LLAA 3F2AA 1IASA 5BVNA 2OH0E 4G6NA 2WTVA 2OSCA 2X7FA 5IPJA 3NLBA 3PPZA 3Q9YA 3QLGA 4IAIA 2VO7A 3R8ZA 3UOLA 4BCIA 4C62A 2JGZA 3G6HA 4I6HA 3CCNA 3PTGA 5HESA 4PPCA 5IQBA 1QMZA 3PLAE 2C6OA 4BCNA 5EQEA 2I0YA 4JBOA 3W0PA 3ORZA 2XRUA 5HO8A 3BV2A 3E8NA 1REKA 3RAWA 3NUAA 3JXWA 5IQDA 4J8MA 4J52A 2B55A 3UDSA 1IG1A 1CDKA 2H8HA 4F7LA 4PF4A 4QP9A 2PVYA 3O8TA 2FGIA 3OCTA 5ANIA 3ZLSA 4YZNA 4K18A 3KREA 4KBKA 3DCVA 3OWJA 4XP3A 5GHVA 3SC1A 4BCOA 2ITUA 4DGNA 4HVDA 4I6BA 2ITYA 4MWHA 4ERWA 3F3TA 1OL5A 1U4DA 2Q0BA 2XNOA 3LFNA 3R7EA 4ZZMA 4ZY6A 3P1AA 5FLFA 2GS7A 1YI6A 3QXPA 3E92A 5CU3A 5M4UA 3DLZA 3HAMA 3COKA 4TZRA 2FSMX 4H3PA 3QAME 3WYYA 3PZHA 2REIA 4RBLA 3E3BX 5IA3A 1CMKE 3DV3A 2H6DA 5DRDA 3HUCA 4ARKA 2YM6A 2PE0A 2R7IA 1WBNA 4JAJA 3U6HA 3GT8A 4XX9A 4FE2A 3QZGA 1M52A 2C5XA 4AOIA 5HBHA 2GHMA 2Y9QA 3PWDA 4FODA 3U6JA 4FSTA 3A60A 3GC8A 2XNGA 3FJQE 4UMTA 2GNJA 3Q4ZA 4X6QC 4JOAA 4B0GA 2WMAA 5AR7A 5AAGA 3AXWA 1P4FA 2HENA 2VWZA 2UUEA 3CTJA 4G5PA 1TQMA 1OVEA 4MBLA 4WO5A 5EQPA 2YACA 3QXOA 4RLLA 1ZYSA 3NS9A 5JK3A 4ALUA 1RQQA 3C4XA 1Q8UA 4K2RA 2DWBA 5KBRA 4BB4A 3H9OA 4EI4A 1DAYA 4GG7A 5AA9A 3BGPA 3MPTA 5K5NA 3S95A 2ONLC 4BZDA 1UWHA 3DJ6A 2JIUA 2C3LA 2Y4IB 3JVRA 5CI7A 4BCMA 4NU1A 1YVJA 1FVRA 4W4WA 3UBDA 3ZBFA 2QONA 2OO8X 3VC4A 2ZMDA 3PG1A 4KSQA 4YPDA 3Q9ZA 3LQ3A 4C57A 3OOGA 4FI1A 5A4QA 3E87A 4FIGA 2R4BA 1OL6A 4PMSA 3ULZA 4GG5A 1KE6A 1JSTA 2C4GA 3TCPA 4OTWA 3VAPA 1OPLA 4W4YA 4FKLA 4LMNA 2F2UA 5CAUA 4C02A 5FP5A 4F7SA 4GJ2A 4IFCA 4TYHB 4USDA 4ZP5A 2YCSA 5DI1A 3DGKA 3OOMA 4AT3A 3DTWA 3Q4UA 4LMUA 4R1YA 5ETFA 3UMXA 3QZIA 3Q52A 3EFWA 2XS0A 3HRCA 5C4LA 1OI9A 4IVAA 4F7NA 4ANBA 3C4ZA 3E62A 3KCKA 5CAOA 2VTIA 3I79A 3VS4A 3UOJA 4EHZA 4FZ6A 5L8LA 2JDOA 2RG6A 4RX8A 2Y6MA 3PXRA 3U55A 2VO0A 3E63A 3OMVA 1M2PA 4G3GA 1F5QA 2X0QA 3FY0A 1KV2A 4HW7A 3QD4A 3UIMA 4CV9A 3NZ0A 5J95A 3Q6WA 3WBLA 3BYOA 4E73A 3FKNA 3HMOA 3HLLA 4BZNA 3H4JA 3T9TA 5HICA 3TUCA 3W0SA 4FKWA 2VTQA 3DKOA 4IQ6A 4AN2A 2I7QA 1VZOA 1JKLA 3BCEA 3QRIA 1YHWA 3FC2A 5DN3A 4FKQA 4O1PA 1FGIA 3IPHA 4EK8A 3JPVA 4PP7A 2CHLA 5CSPA 3ACKA 1SVGA 5HU3A 2KULA 2OBJA 4LOPA 2YWVA 3BYMA 4FC0A 5ICPA 2GTMA 4TW9A 4RJ7A 4XJ0A 3VQHA 3I1AA 4NYEA 1V0PA 1OMWA 2QKRA 3OCSA 4DDGA 4LRMA 4UYNA 5HG5A 4C4EA 2O3PA 4K1BA 4AG8A 5EOBA 4PNKA 2FSLX 5E8YA 2Z02A 4FV9A 3SXFA 3F9NA 4M15A 4EHEA 5ANEA 4QMSA 3NWWA 4XOYA 3O50A 4M8TA 4BHZA 2XMYA 3NYOA 4GJ3A 2QG7A 4IEBA 4ALWA 4MXXA 3WZKA 4RJ6A 2IZUA 4CG9A 4MD8E 3FZTA 3LJ2A 2R3PA 4ANNA 4X6RA 4BCPA 5EW9A 3QBNA 5IDNA 4G17A 2ZMCA 2R7BA 1UVRA 2J0JA 3C4EA 4X0MA 4Y83A 3ULIA 5C8NA 4J7BA 4MNEB 2F7ZE 3PY0A 3II5A 4FTTA 3S2PA 3HRFA 3LE6A 2C0IA 1OKZA 3DPKA 4CD0A 4J99A 2R3FA 3GVUA 1QPEA 2WMBA 3COMA 4AXCA 3LMGA 4HGLA 1P14A 3GCSA 3S3IA 4CEGA 4ZJVA 2XEZA 4GU9A 5CQUA 4AE9A 5DR6A 2C5YA 3VHEA 1O9UA 5EM6A 2V55A 4PL5A 4EH6A 2JAVA 1LP4A 4JDIA 1Q62A 2V5QA 4DFUA 2WHBA 3FPMA 5CVGA 3W33A 3TL8A 4UV0A 2XYNA 2Y8OA 2QU5A 3MH0A 4FBXA 2I40A 3I0QA 5LVNA 3VS1A 5L2IA 5IUIA 5CANA 3PJCA 4R5YA 5AV2A 3NR9A 5ANOA 4DEIA 2WTCA 4A9SA 4BCQA 3DNEA 1OZ1A 4KIPA 2FYSA 3FHRA 4ZOGA 1EH4A 5A3XA 2YJRA 2W1FA 1ZY5A 4ZJJA 1SNUA 3P7BA 4JJRA 4XYFA 1H0VA 3P08A 3BU3A 4UMQA 3WOWA 4NZWB 1G8JA 2ITPA 5G6VA 3JY0A 2PUNA 3TV4A 2XIZA 5TF9A 4JIAA 2J0IA 4PNIA 5DVRA 3NUSA 3LCOA 1GIHA 4EUUA 3OS3A 2P2IA 4BWKA 4MX9A 3JY9A 5D11A 5CZIA 2IW6A 4AW1A 3R9OA 4JQ7A 4YO4A 2UV2A 3O23A 2YHVA 5A9UA 2RFSA 2XBAA 2VD5A 1AQ1A 1H01A 1YW2A 3RNYA 4EH5A 4YJNA 1FOTA 3G0EA 4UMPA 2XJ0A 3IOPA 2JDRA 1WZYA 3E5AA 4FZFB 4DCAA 2ZB1A 5FBOA 3QUPA 4IZ7A 2JDVA 3GBZA 5DEWA 4IZAA 1JWHA 2PE1A 3OP5A 3OW3A 4H1MA 5TE0A 4X2JA 4Y85A 4AZVA 4CTBA 2G2IA 2PVHA 5HD4A 4DG3E 4RA5A 4AW0A 4RT7A 4FV8A 5M4IA 3LZBA 5L3AA 2VTMA 3BPRA 5AUTA 2E9NA 5IA5A 3FLSA 3V8WA 3ODZX 4B8MA 4R77A 3MFTA 3WE8A 4EOIA 1ZOGA 2Z7LA 3QTSA 1O6LA 4ZSEA 4AX8A 1PRYA 4GFOA 5IA0A 4EC9A 2X8EA 1H26A 4O27B 5HLPA 4F4PA 3S4QA 2XALA 4U80A 3MIYA 3LPBA 4RGJA 3VF9A 4RWKA 3R71A 4MCVA 5CAPA 5CEMA 4KD1A 3PVUA 2EXCX 4GIIA 4A4XA 4D4YA 3P4KA 2XK7A 3PLSA 3CJFA 3PG3A 2ZM4A 5AM6A 5AUWA 2XZSA 3MVMA 3PWYA 4O91A 4C4GA 3FHIA 5ACBC 4AXAA 2E9PA 4GVAA 1Q8ZA 2DUVA 4PTEA 3K5VA 4IMYA 5DLSA 3OBGA 2XK8A 3ZEWA 4LFIA 1ZY4A 3LQ8A 4J96A 3AMBA 4C8BA 2UW0A 3VBTA 3NYVA 2JLDA 5IUGA 3K5UA 3ATSA 4CCUA 3MJ2A 4YZBA 4GKHA 2P4IA 4FSQA 2P2HA 4U3YA 1E9HA 2OJIA 3IONA 3PE2A 4H39A 3FZ1A 4M13A 4TKSA 5CSHA 5A46A 2YN8A 3NFFB 4MQ1A 1UNHA 4IB3A 5LVLA 3R28A 3LCDA 4EH8A 2BFXA 3ROCA 4CMTA 2PULA 2GNHA 3FYKX 2BVAA 3ENHA 5EH0A 3V5QA 4EQMA 3GGFA 3O5AA 3OW4A 3ROYA 3P7CA 4YZCA 4XV9A 4Z55A 3DTCA 3DXQA 2E9UA 3NUPA 3CR0A 5LCKA 2I0EA 3FWQA 4FYNA 4BGHA 5L4QA 2OJ9A 5DE2A 1OBGA 4LUDA 5HX6A 2WD1A 4WNKA 2GFSA 4JIKA 3E7VA 4P5ZA 3RKBA 2VGPA 4GW8A 4IX4A 4L3LA 4G31A 4ZS0A 3BLRA 3RP9A 3CS9A 4B4LA 3HYHA 3LW0A 4FRFA 3C0IA 3FMJA 3MIAA 5HE3A 3V5WA 3ZC5A 2R3JA 2QHNA 3RAHA 4C7TA 5C03A 1FPUA 2RKUA 4BCFA 1SVEA 2V22A 4XRLA 4BTKA 4F08A 3AOXA 5BVDA 5C01A 3MVJA 4KSPA 4A4OA 3GQLA 4RFMA 5HGIA 2ZV7A 4FF8A 4QTEA 3PIZA 5CTPA 2OF2A 5FG8A 2XBJA 4L9IA 3MA6A 5FQDC 4EK6A 5CF4A 4EQUA 4CKJA 1YRPA 3G9NA 2W1HA 4JQEA 5HVYA 1YKRA 2C3KA 5HBEA 1Q4LA 2PVNA 3NNXA 5HCXA 3B2TA 4LUEA 4KRCA 5D10A 4R7HA 4KIKA 4BDDA 1Q41A 4J8NA 2YM5A 1ZAOA 5DEYA 4QMWA 4ASEA 3PXFA 3F66A 2VWWA 4E5BA 3A4OX 5DIAA 4KBCA 1Q8WA 4LDTA 2WPAA 2JKMA 4MEDA 4FZAB 1Z5MA 4LOQA 3PRFA 5DRBA 3FY2A 1VYZA 5LCJA 1K9AA 4IM2A 3CE3A 3F3UA 1LEZA 2IO6A 3R8VA 2WIPA 2GFCA 3TJCA 2WMVA 1R0PA 2V7AA 3IKAA 4KABA 3D14A 4M7IA 3LXPA 3D15A 3VS3A 4C38A 4KNBA 5GINE 2OW3A 2ZAZA 4JR7A 4FSYA 2HZ0A 4FYOA 2ZOQA 5ANDA 4EK3A 4F65A 1DI9A 2QOQA 1PMVA 3QQUA 4HGEA 4Q9SA 5KO1A 3MESA 4K9YA 1WBTA 2QOIA 3MSSA 3W2OA 3ZM4A 4R78A 4F6WA 3IW4A 4PDSA 1J91A 4CFUA 3IECA 4FNYA 4MAOA 3MPMA 3PUPA 2YJSA 3W18A 2NNWB 5IQIA 2GQSA 3ZZWA 4CXAA 3D5XA 4YGAA 3U51A 4YZMA 2CLXA 3GOKA 5AX3A 3RTPA 4DINA 4EH4A 3ZS5A 2Y6OA 4JBVA 4AF3A 1T46A 2Z60A 3K3IA 5HE1A 1JKSA 3PFQA 3ZDUA 3H0YA 1W2DA 3MB6A 4S33A 1J7LA 3QD2B 5ETIA 4B99A 4F64A 3TTJA 2RFNA 2IW9A 2W1IA 2BRBA 3ATTA 3QU0A 3PJ8A 2VTHA 3KQ7A 2XF0A 3D7TA 3EKKA 5CEQA 3QD3A 3CTQA 5E4HA 2GHGA 1XMMA 1OL7A 4YLLA 5C27A 4FIFA 3W1FA 3DA6A 5HTIA 5HCZA 4IADA 3ZLXA 1IEPA 5HX8A 1UKHA 4I94A 4L3PA 4RG0A 3NMUF 4RIXB 3O2MA 4YTIA 4TWPA 4UMUA 3UG1A 1O6KA 4FA2A 4I22A 2IVSA 3NYXA 2GSFA 2QURA 3QUDA 4CTCA 3QTWA 1NW1A 1STCE 3Q9WA 3QTRA 4RJ8A 4F09A 4A4LA 3LHJA 4LL5A 2GHLA 4ZY4A 5BVOA 4O7NA 1BL7A 4DHIB 3MW1A 4KS8A 3SRVB 5CZHA 2V62A 3LCSA 2WQNA 4FK3A 4FIIA 2WAJA 4RQVA 4MXOA 5BMSA 4FL3A 3BU6A 3BE2A 4B9DA 5J1VA 2PSQA 3OD6X 4E3CA 2UVXA 4HNIA 3MV5A 1PHKA 5FTQA 5K5XA 5LQFA 4D9UA 2X9FA 4TRLA 4B6LA 4E6DA 2WMRA 3UDBA 4WT6A 4ZTRA 1CKIA 4DFLA 2VX1A 4U5JA 4O7SA 3TKHA 5CSWA 4R3CA 4HJOA 4BKZA 4AT4A 3OZ6A 1CTPE 3ZSIA 1RW8A 3SG8A 3LFEA 3NUYA 4IC8A 4OLIA 4FEQA 2NRUA 3VNTA 1GIIA 2PVLA 3AD6A 4I5HA 1HCKA 4BC6A 4K8AA 3QUEA 1R39A 3TM0A 4HGSA 3BU5A 3C5UA 1ST0A 3TT0A 2HCKA 2R3LA 4IVBA 2VZ6A 3O0GA 4OTDA 4U8ZA 4U3ZA 4WKQA 4IAZA 5TR6A 1GY3A 3EQCA 5BYYA 3P86A 3IDPA 1OKYA 4FSNA 3HP5A 2C6KA 3R1NA 4O6LA 3R1SA 3TWJA 2ZM1A 2X9EA 4O86A 1W82A 2ZV9A 5HQ0A 3BGZA 4MF1A 4O0SA 4PMTA 4YHJA 3WF7A 5EKNA 4NT4A 4KKEA 4AZEA 3RWQA 5E90A 4YSMA 4IJPA 2BFYA 3R00A 4APCA 3U9CA 4C3RA 2KTYA 3KEXA 2YIWA 4E20A 4AXDA 3WZJA 2O64A 2W5AA 4Z9LA 5I5ZA 3T3UA 1Q8TA 4TN6A 4A9TA 1YXVA 4ZZOA 4GU6A 4GH2A 5JN2A 5K3YA 3KK9A 2F49A 2VU3A 4FT9A 3UNJA 2X2LA 3TNQB 3GU6A 2JDSA 2YISA 2NP8A 2XK9A 3KXMA 4F6UA 5B2LA 4DF3A 3N51A 2UVZA 3LFDA 3KVXA 2OIDA 5HIBA 2VTNA 3NNVA 5IEXA 1IAHA 4AZSA 1ZOEA 5DHJA 4LV7A 2O8YA 3AMYA 2IEWA 4FV6A 1A9UA 4PPBA 4AS0A 3EL8A 3C51A 5M51A 1SVHA 4HPUE 1R78A 3T8OA 1UU8A 3SG9A 5DT0A 2ERZE 2ETKA 4TWOA 1YWNA 4L7SA 2A4LA 2C5NA 2OIBA 5D1JA 3TG1A 3P9JA 5C26A 3SD0A 3DDPA 2B4SB 4I0SA 4GUEA 2CJMA 2G15A 2VTTA 4YC3A 1YDRE 4BI0A 4DG0E 4E93A 1F3MC 4FV1A 5CSVA 4D58A 4DLIA 3TUBA 4EUTA 4DHJA 5IQGA 3EN4A 4BTJA 4FL1A 3V3VA 3HDMA 1OECA 3E93A 2YERA 2XARA 1XH9A 3AC2A 4EK4A 5ANJA 5LMAA 3E7OA 5CF5A 2QKWB 4QDEA 1FMOE 2WMXA 4YJOA 4JG6A 5IQFA 5EHOA 5AP2A 2I1MA 4M69B 3RNIA 5CS6A 5JRSA 4C37A 1M17A 2BRHA 3PXYA 2YIRA 3HV6A 4U40A 3IOKA 3W2CA 5J9LA 5LXMA 4WNPA 4ERKA 1Y8YA 4IANA 3FMDA 3KVWA 4RVKA 4WRSA 4XG7A 2A0CX 2OKRA 4RZVA 4X21A 5FD2A 4RA4A 5HVJA 2HOGA 3TI1A 3ORLA 1Q24A 4OTQA 1U54B 4G6OA 4UYAA 4U81A