3DK6A

Crystal structure of mutant abl kinase domain in complex with small molecule fragment
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
262
Chain Sequence
DKWEMERTDITMKHKLGQFGEVYEGVWKKYSLTVAVKTLEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal structure of mutant ABL kinase domain in complex with small molecule fragment
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 84
structure length 262
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dk6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dk6A01
4TNBA 3WE4A 2XF0A 3ORIA 3DLSA 5KMJA 4D1SA 3NZ0A 1Y6AA 3AT2A 5E92A 4DT9A 1KSWA 4OTIA 3UZTA 1W7HA 4I1ZA 3NR9A 1URCA 4E73A 3ZSGA 2YCQA 2Z2WA 3NIZA 1ZWSA 3MIYA 1ZYLA 3ORMA 3QD0A 5KBRA 3DJ6A 4IVCA 1XBAA 4PPBA 2WQOA 2ITNA 4LL0A 3NSZA 4R6VA 5D10A 4S31A 4NK9A 4CCBA 3L9PA 4CYIA 5KMIA 1KE8A 3LQ5A 4EBWA 3OWKA 2C5YA 2E9NA 5KKRC 3EQDA 3LFAA 3ZRLA 4DLJA 3UNZA 4WG5A 4TXCA 2RL5A 2XK8A 3TNQB 4WKQA 1JKTA 2OXYA 3FKLA 3AC8A 4CTBA 4WD5A 4L7SA 2PUUA 4F63A 3ZH8A 3H0ZA 5CSVA 4ACMA 4ENXA 3V5WA 5CSPA 5HORA 3PG3A 5GZ9A 3EN4A 4RWIA 4IFGA 4E5WA 1YOJA 5J5SA 2OW3A 4NUSA 5CEIA 3UODA 2E9UA 4QTEA 1PXPA 4A9RA 4IVAA 2GHLA 5D9HA 4DTAA 2PVRA 4IH8A 1V0BA 5HO7A 1K2PA 1ZYDA 3OEZA 3PJ2A 1A9UA 3P1AA 4FMQA 4HYUA 4TYHA 1R78A 5H9BA 2X9EA 4FIHA 3AC2A 3MY0A 3JS2A 5FEQA 1ZY5A 3HAVA 3DBEA 2ZYBA 4CFXA 3FC1X 4E5AX 4F7SA 1LR4A 1F5QA 2C68A 3QUPA 4RJ5A 3ZO3A 2YERA 2C6IA 4LOPA 1DAWA 2PUPA 4MXAA 3EZVA 4B0GA 3PVGA 2QKWB 2X8IA 3AOXA 3PJ1A 3OF0A 3R8LA 3PJ3A 2XH5A 3MWUA 2BRMA 2PZ5A 4DC2A 3GBZA 3PIXA 4BICA 3R2BA 2X2KA 3KKVA 5HIDA 2IPXA 4HNIA 2XNPA 2UW8A 3MS9A 4TZRA 3V6SA 4BCOA 5ACBC 3THBA 2UVZA 4D2PA 2GFSA 3VW8A 3OBJA 2JAMA 1IAJA 4KD1A 4JDJA 2XP2A 5AMNA 5A14A 3GU7A 1FINA 5AP7A 3IOPA 5FGKA 3QLGA 4ZSLA 1WZYA 2BFXA 3GU6A 3QTSA 4HGLA 4TYHB 3E62A 3R9HA 3HL7A 5TF9A 5JN2A 5E4HA 2VWYA 2GNGA 3S00A 1MRUA 1G5SA 2UZUE 4GVAA 3SVVA 1XO2B 2FSOX 2RGPA 3K5UA 3SA0A 4FEWA 4IAIA 3ENMA 3PZHA 3BKBA 4PP7A 3ZEWA 2YZAA 3GXLA 1Q8ZA 4X3JA 2V62A 2ZV9A 2YDJA 3ACJA 3CJFA 2VTSA 2ITZA 2V7OA 4LV8A 3E92A 3EL7A 1H27A 1UA2A 4EOIA 2UZVA 4G6LA 3SRVA 4FTKA 4M0ZA 3LFCA 4O22A 3MESA 3GEQA 4IZYA 4QMVA 4YTFA 5IUGA 3OTVA 3QX4A 1MRYA 4ACCA 5AAGA 1PMNA 4RX5A 2W1IA 3TACA 3TJCA 2BHEA 3ELJA 4A7CA 4C4GA 4UMTA 4TL0A 1SNUA 5F1ZA 5AR3A 4F1TA 2ITXA 4L8MA 4RJ4A 4N57A 5AP3A 1AD5A 2A4LA 2PSQA 3HA8A 1XH6A 1FMKA 2OJ9A 3HECA 4MF1A 4NTTA 4QPSA 4YP8A 3RPRA 3V01A 4PMSA 2IWIA 3ZM9A 3P7AA 2JKMA 3CJGA 3KXZA 2FSMX 3E7OA 1Q62A 5H3QA 2QU6A 4F9YA 4ZP5A 5M44A 3NIEA 2PULA 4AOJA 3AC3A 3VF9A 4QP8A 2PVMA 3Q4ZA 3QZHA 3LMHA 3DZQA 3CKWA 5JFWA 3UYSA 4HVIA 1ERKA 1WBWA 2V55A 2QODA 4PDOA 5BVEA 3QKMA 3FZRA 4FF8A 2ZV8A 3UVQA 2Z7LA 1V0PA 4DFNA 3OW4A 2YM6A 1SVHA 2ZOQA 3QWJA 4FK3A 3QQGA 4QMXA 4BZNA 4C02A 3Q9ZA 4YJRA 1OL1A 2XKCA 2QR8A 3KN6A 2JDVA 4S34A 5AUTA 3RPOA 5CEPA 5KUPA 4BI0A 2VWWA 4YJPA 3U6HA 3FE3A 3VN9A 4AT4A 4D0WA 3PVWA 4O0VA 3EFLA 3NRMA 2OFVA 4BHZA 5C26A 1IR3A 4GT5A 2YWPA 5HHWA 5TOZA 3TM0A 2BAKA 4BIBA 1OIRA 3V5TA 1NXKA 4ZLZA 5JQ5A 3L8VA 4HGEA 4D5HA 4DG2E 3OTUA 4NKSA 4EUTA 4DH3A 5ETIA 2YM8A 3DS6A 5E91A 3EZRA 4N6ZA 5HKMA 3GI3A 2QKRA 3TDVA 3CD3A 1HCKA 3LXKA 3P0MA 5CVFA 1OIQA 2R3KA 3QD4A 4KWPA 3UQGA 1M14A 4BI1A 3P86A 1GIHA 5LMKC 2PVFA 2V5QA 5GNKA 1P5EA 3F3TA 5FXSA 3C51A 2W06A 4IX6A 4BC6A 1Q3DA 1XWSA 1YWVA 4O38A 3DJ5A 3WYYA 4GYGA 3H4JA 4U97A 4U9AA 5CLPA 4FSZA 4ITJA 2R3JA 1YWRA 5KMOA 2VWZA 3M2WA 1XBBA 1YXVA 3OT3A 4K2RA 2W99B 4MEDA 4I24A 4BGGA 1PYXA 1IAHA 1XH9A 4GYIA 4JLCA 2OJGA 4M14A 4CMOA 4F9CA 3TUBA 3HYHA 4XEYA 3R6XA 3D2IA 2IZSA 4MD7E 1YI4A 2AC5A 3FI4A 2ETKA 3LCOA 2I40A 3A4PA 4BYJA 5B2LA 3NW5A 4ALVA 3DDPA 5CXZA 1RDQE 2GNLA 1B6CB 4S32A 2BAQA 3AGLA 3BI6A 3EQCA 4IAFA 4YTHA 3ZRKA 3KRJA 4AA4A 2GCDA 5GINE 2IW8A 3EN7A 2XIYA 4R5SA 3H9OA 3ZO4A 1UNGA 1ATPE 5IF1A 3AMAA 3KF4A 2ITTA 4QTBA 3PSCA 3KGAA 3WOWA 4O7WA 3C4WA 4YJTA 5AV3A 5M56A 2DS1A 2XNBA 3FXXA 3OY3A 2P0CA 4QMSA 3UIXA 2WMVA 3OS3A 3TTJA 1Q5KA 4MBJA 3BLQA 4E4XA 1EH4A 5IA1A 3QKKA 5HG7A 4GU6A 4IAYA 3Q53A 4OTQA 3A8XA 2G01A 2WTKB 4YNEA 2CKEA 4IEBA 5TE0A 5G6VA 1S9IA 3CS9A 2C6EA 3O8TA 3GVUA 5CU2A 5AFVA 5KNJA 4FKRA 5C4KA 4Q2AA 4I0SA 3V5PA 4DYMA 2R3MA 2PMIA 2X9FA 4F64A 5AR7A 5AV4A 3P4KA 5HX6A 5EM6A 3F6XA 3KVXA 3LW0A 3QQHA 4E93A 3ZO1A 4CFVA 2YEXA 4NJ3A 3AD6A 4OTWA 3UOKA 4AWIA 3RM7A 2BVAA 4NIFA 2WMUA 1TKIA 4FVQA 4UV0A 3ZMMA 3F7WA 3R7VA 3ATSA 1UV5A 4HOKA 3COHA 1GZ8A 3PXRA 4L46A 3RK9A 4AE9A 3CTQA 1U59A 3G6HA 2UW5A 4FUXA 4UZHA 3PP0A 4JI9A 3R1NA 5DPVA 2J5FA 3OZ6A 4BTFA 2F7EE 2Y0AA 1W8CA 2OZAA 2V22A 3BX5A 4BCMA 4EZ5A 3PY1A 2A1AB 4IDTA 3QQUA 1GAGA 2OK1A 1O6LA 2UW9A 4J1RA 4FKPA 2WTVA 5C03A 3KREA 5CU3A 3I6WA 1WBPA 2YM7A 4XJ0A 5LVLA 4IXPA 4NU1A 4QP9A 3W55A 2SRCA 3QL8A 4CQEA 1R3CA 5AUUA 2UW0A 1VYWA 3DBDA 4K0YA 4MXCA 2JDOA 2I7QA 1ZZ2A 1ZYSA 4NIFB 4CRLA 4IX5A 5M55A 5DR9A 3T9IA 4BGQA 3R8UA 3QYZA 3V8SA 1QL6A 4NM7A 4X0MA 4MX9A 2DYLA 2XYNA 3RCDA 3A62A 4E5BA 1PXJA 4XLVA 3R1YA 4FBXA 3CLYA 4L45A 4XG9A 3U87A 5DBXA 5I9VA 3ORPA 4FA2A 5BNJA 4I6QA 3IDCA 4KIKA 1OIUA 4DT8A 1J1BA 1OPKA 3MH0A 4HCUA 4YLLA 2YLEA 5DT4A 3FMHA 1RJBA 4RC2A 2F4JA 3LFBA 4Q9SA 1GNGA 4V04A 1GIIA 2G2HA 1L3RE 4PNIA 2VWIA 5GJFA 3MW1A 4EOPA 5AAFA 1YOLA 4M8TA 3NYNA 4GK3A 2IZRA 5HD7A 2E9VA 3HV5A 4MBIA 2WD1A 2C0OA 3HKOA 2W17A 4XH6A 3ORZA 1QMZA 1BMKA 3EMGA 2O8YA 3BV2A 2VGOA 3NS9A 1ZYJA 4YJQA 5KMKA 5AWMA 5IH6A 4ZLOA 2RIOA 2X6DA 3RZBA 4J97A 3FI3A 4R1VA 4B99A 3W16A 4R78A 2CCIA 1BUHA 4S2ZA 3IDPA 2BDWA 3OUKA 3MPMA 4M67A 3OEFX 3ZHPC 1Z57A 2WMSA 4FG9A 2H9VA 4AX8A 1OL5A 3TV6A 2RG6A 2AYPA 4FZFB 3EFJA 4IZ5A 4YJSA 4KIKB 4CFNA 4OAVB 3UZPA 2PUNA 5K5XA 1JVPP 2IJMA 2J0MB 3HV7A 5BVDA 2HWOA 4M0YA 5ANJA 3DXPA 3KXHA 2OSCA 4UMQA 4JQ8A 2PPQA 3E8CA 3RPYA 3ERKA 4ACDA 2X8EA 3GQIA 4NFMA 5CALA 1G8SA 3EQHA 3TN8A 2OXDA 2J5EA 4KAOA 2C5XA 2YLFA 3ZUVA 4EOQA 5IH4A 5KKRB 3RMFA 2P33A 5E8TA 3KRXA 4O2ZA 3HP5A 4FTAA 3LJ2A 4NFNA 4ZTNA 1WBOA 2HZ4A 4TNDA 1MP8A 3BCEA 2XK3A 4O27B 2R5TA 3Q9YA 1YDTE 4PUZA 1ZLTA 4JIAA 2BIYA 3E87A 4LGDA 1HOWA 2CGUA 3PUPA 2J7TA 3E88A 4EK3A 4D4VA 2BRNA 1BL7A 1WVWA 1GJOA 2BZKB 2C6TA 5HNGA 3R9DA 2WQBA 5LOHA 2UW6A 3E3PA 1FVTA 1T45A 3PIYA 4FKOA 4LRMA 4XP3A 4YJOA 5J9LA 1ZOEA 4QPAA 5ICPA 4YBJA 4BWXA 4C59A 4FE2A 4FICA 2EXMA 3CKXA 5FQDC 1J7IA 4PV0A 5LVMA 4MBLA 4MXYA 4G3FA 1UNHA 4WG4A 4U79A 3E63A 3R8PA 3TEIA 4E4MA 4FNYA 4EKKA 4EQMA 3D14A 4E1ZA 5HOAA 2JGZA 2OKRA 2JBPA 2ZV7A 2PMNX 3F66A 4H3QA 4I93A 4DH8A 4DE4A 3F7ZA 2UVXA 3NUNA 2QOLA 5BUIA 4WSYA 3BYMA 3GCVA 3BGQA 4CZTA 5BX0A 3GUBA 3EYHA 2RFSA 4FNZA 2QOKA 1WVYA 2CNUA 4U42A 5M09A 3DK3A 3ZXZA 5A4EA 4DGOA 4O0XA 4DLIA 3AMBA 3PLSA 2XKEA 4C0TA 1Q24A 5B2MA 3NX8A 4CFFA 2PE2A 3G5DA 4BDCA 1PRYA 5FDXA 5EYCA 3QZGA 4YMJA 4IWPA 4JOAA 3A2CA 5HE2A 2ZM3A 4ANOA 5ITAA 3A4OX 4D4RA 3CQUA 4I0RA 4HVDA 4RIWA 3ATTA 4WUNA 4JBQA 3R63A 3CTJA 3W2RA 1H08A 3FPMA 4WUAA 3WE8A 4PL3A 5EW3A 2HOGA 3WF7A 2FSTX 4USEA 4IJ9A 2CKPA 2HK5A 4ZTHA 2WIPA 3QXPA 2BTSA 1KE9A 3C4ZA 4WBBB 3VRZA 4QMNA 4TKSA 4HZSA 3H10A 3MH3A 4LMNA 3ZTXA 1J7LA 5AADA 2J90A 3D94A 4V01A 4L3JA 2C6KA 4QMOA 3CPBA 3TKUA 2J9MA 1IG1A 5IQCA 3DLZA 2YJRA 5HVYA 4BL1A 5EW9A 3L9NA 3ZOSA 3TV7A 1GZNA 1W84A 4TN6A 3ODYX 4RIXA 1JOWB 4BRXA 2R3OA 2XEZA 1LUFA 1WFCA 4FG7A 3VUGA 4Y95A 3FLZA 5CI7A 5HI2A 3ZFXA 4CKIA 3AQVA 3UVPA 1BKXA 1QPCA 3R71A 4PX6A 3NWWA 2GNHA 4Q5EA 5A9UA 4APPA 4IB0A 2WTWA 2HW7A 2XZSA 3D5WA 5AA8A 4PRJA 2X4ZA 5IQHA 2W4OA 4RX8A 2C69A 5J1VA 3MH1A 2C30A 2C6OA 3NNXA 4K77A 4BGHA 3FMEA 2LAVA 3DAJA 3HEGA 4G6OA 5M06A 5M51A 3R8ZA 3DNEA 4RFYA 2JDTA 4GFMA 4RVTA 1DI9A 4LGHA 5AR5A 4FTQA 4YHJA 5LMKA 4DAWA 4RIXB 3I5ZA 2YCFA 4FKIA 2AC3A 3H3CA 2EXCX 2WQMA 4AZTA 4EC8A 4QYYA 4IAZA 4KB8A 2QOHA 4IZAA 4TWOA 2WMRA 3ORTA 4J99A 2HZIA 4BBEA 3PXZA 3G0EA 4X21A 1PXNA 2OO8X 3IS5A 3C9WA 2QOIA 4CXAA 2XK4A 3PYYA 4W4WA 4W8DA 2WPAA 3V8TA 4X2GA 3QCQA 5I9WA 2BR1A 1OB3A 2YIQA 3EQFA 3IECA 4FIGA 4H1MA 3UC3A 5FWKK 1NVSA 4M84A 5F4NA 1S9JA 4RJ6A 4IZ7A 3C0GA 1PMVA 3DK6A 3FLSA 5B2KA 5T68A 3VUTA 2YA9A 2FH9A 4KSPA 1OZ1A 3U9NA 3VO3A 4QYFA 4D2TA 5KMMA 2QOFA 2ZMCA 4AT5A 1PJKA 4FL2A 3RI1A 3LLTA 3TZ8A 4D5KA 3UP7A 3I79A 2REIA 4M69B 2ERKA 5HTCA 4EK5A 4ZY5A 3DKCA 4IJPA 2OG8A 5DIAA 2W1HA 4G3GA 5ETAA 5AR4A 3CBLA 4YZDA 3VBYA 4LL5A 4EYJA 2WEIA 4RLKA 4FVRA 3KMUA 4NW6A 4FTLA 5EHYA 1Y6BA 2HZNA 2OXXA 5D7VA 4QRCA 5J7BA 2JFLA 3BBTB 1H4LA 3F9NA 1H26A 4KA3A 2Z7RA 5IMEA 4EUUA 4JQ7A 5GZAA 4JRNA 3LQ3A 3C4FA 3FDNA 4XV3A 4PDPA 3TG1A 3OCSA 4K8AA 3PTGA 5FTOA 2QD9A 4ID7A 2YAAA 2ITQA 5IA4A 3EWHA 2J0JA 4IIRA 3DKFA 1V1KA 2FUMA 1OKZA 4FKQA 2YAKA 1NT2A 1STCE 3PA4A 4PL4A 3FI2A 1VEBA 2WMBA 4AGWA 4CNHA 4QYEA 4J8MA 1Q3WA 3ZC5A 2J0KA 4F6UA 5HLNA 3COIA 2R3FA 4KRDA 2ZJWA 3ZCLA 2P2IA 2HWPA 4AZFA 4RX7A 1H1QA 1KE7A 3UOLA 4XLIA 4ASZA 1E1VA 3FQHA 5DLSA 3FV8A 2VZ6A 3CP9A 4BR3A 4GU9A 5HGIA 4ZZMA 3NUAA 3AXWA 1JAMA 2CKOA 3B2WA 3SV0A 2WEVA 2W1DA 3IONA 4AZWA 2R3IA 5K3YA 5FP5A 2BFYA 4U6RA 4O6EA 2IW6A 3KFAA 4IDVA 4ALWA 4F0GA 5IPJA 4EZ7A 1DI8A 4F4PA 2W5BA 1OL6A 4BDAA 1FQ1B 2CMWA 4D58A 3FZTA 4DEGA 1H28A 5CF4A 4YJUA 4C4JA 3NUSA 4RWKA 2VX0A 5EYDA 4EJ7A 2RFDA 5AP4A 1AQ1A 2IVUA 5H8EA 3UVRA 5LVPA 4QT1A 3HRCA 3LFDA 4F9AA 4EH6A 5GZ8A 2CKQA 4M97A 4U44A 1ZMUA 4FL1A 3O71A 2XIXA 3UGCA 4AGUA 4D2VA 2H34A 5IH5A 1J1CA 3JY9A 3Q96A 2GNIA 4FL3A 5AUYA 3W1FA 3ZLXA 3ZO2A 3Q9XA 5J87A 3UOHA 3ZUUA 5HCYA 5BMMA 4JT3A 4U43A 3LFQA 2RKUA 2Y6OA 1YXSA 4XG2A 4FKGA 4JAIA 4BTJA 2BALA 3DPKA 2PZYA 5LMAA 4CG8A 3OMVA 2A2AA 1M17A 2WOUA 3ZM4A 1Q8UA 5A4TA 4MH7A 2WGJA 1ZARA 4E6CA 2FO0A 4D28A 3F5XA 1XKKA 2VTAA 3ID6C 3TJDA 5L6OA 2VD5A 3BQCA 2C0TA 4CKRA 4EOJA 1OUYA 4NW5A 5HESA 5EQYA 3KVWA 3QTZA 4QO9A 2VTOA 1E1XA 1JKSA 3CY2A 3FKOA 4IB3A 3VS1A 3DFAA 4FTJA 2XK6A 4EONA 4BN1A 4C4HA 5DRDA 4O7ZA 4RIYA 3IGGA 5CAQA 3PPKA 3LAUA 2O64A 4GSBA 5IQBA 3EQBA 4MCVA 1QPJA 3KCFA 3SDJA 3TNWA 4BKJA 4E26A 5HTIA 2QOBA 5LJJA 3PXQA 5HNIX 4HGSA 2ERZE 5K4JA 4BCNA 1BX6A 4FT7A 3UO5A 4QD6A 4TTHB 3BHYA 2BZJA 5AIKA 3AT3A 4FZDB 4FV0A 4ZAUA 4GFOA 1WBTA 3UO6A 4FT3A 3TDWA 1P4OA 3M11A 3R1SA 4QPMA 4WHZA 4C7TA 4G5PA 4BDKA 4I6HA 2EVAA 2H6DA 2IZTA 4AACA 2PE1A 2VO6A 4J7BA 2C6LA 4PMPA 3L8SA 4ZSAA 1R0EA 4OR5A 4RVMA 4IM2A 2OWBA 4ZY6A 2C3LA 3GOKA 4W9XA 1MRVA 1YXUA 4FNWA 4DGNA 3L1SA 4GUEA 4MAOA 4YTCA 4OAUC 2GTMA 5KCVA 3QCSA 1RW8A 4QMWA 2BCJA 2EU9A 3RZFA 4H39A 5HG5A 3I0QA 3I4BA 3A7JA 4OW8A 5FDPA 3F3VA 3NUXA 4KKEA 2HXLA 4FT9A 4EQUA 3AMYA 3E93A 3R00A 3U51A 3DU8A 4FV8A 1F3MC 3LCSA 5IA0A 2WXVA 4XP0A 3SW4A 4ZOGA 4UWYA 2ITVA 5CT0A 2QURA 4GG7A 3Q5ZA 2W05A 3CQEA 2VTQA 3RPVA 4ZTQA 3BBWA 4EZ3A 4WOVA 3PPZA 4V0GA 2I1MA 4CRSA 3VBXA 4UALA 5TKDA 5AX3A 3KU2A 4CD0A 3NVKI 4DEHA 4AA5A 4YZNA 3JR1A 3FZOA 4GK4A 4AW0A 4C38A 2ZB0A 2ZM1A 3MFTA 4KKHA 4C8BA 3QA8A 3BPRA 3RNYA 3O0GA 3VWAA 2C5NA 2PZPA 4FSTA 4LQMA 5DR2A 3FL5A 4R3RA 1DAYA 3W32A 2XJ0A 4LFIA 3QD3A 2BRBA 2DWBA 4UMUA 3UTOA 4QTCA 3IPHA 1NY3A 1M7NA 1NVRA 4FODA 3EFKA 2WO6A 2YM4A 2Y4IC 5FM2A 4HCVA 3B8QA 4ONAA 4OTFA 3GFEA 3GCUA 4EHZA 4WNMA 5IQDA 3MPAA 4YPSA 5GHVA 4L43A 2JIVA 4RJ3A 2VNYA 3FBVA 4V0GB 3C50A 3BU3A 3D5VA 4RG0A 2E9OA 4D4SA 5AR8A 4K6ZA 1KE6A 4OTPA 3GCSA 1NVQA 5HQ0A 4KUJA 3O51A 4K1BA 1W82A 3KB7A 3MVLA 4QNYA 5KO1A 1IA9A 1O6YA 4H58A 4O7VA 3G51A 3RK7A 3RPSA 4NSTA 3R9RA 4Q5HA 1YHVA 4W9WA 4WNKA 1URWA 1JKKA 3SLSA 3R7UA 4OTHA 2CDZA 5KBQA 3PP1A 5HEZA 4O7YA 4FEVA 4EK8A 5IQGA 1PHKA 3MPTA 1H00A 5L8JA 3QHRA 5L4QA 3PVBA 3SRVB 4DCAA 3VUHA 1PXIA 3BRBA 2WMAA 5ETFA 3P5KA 3ANRA 3OUNB 4ASXA 4RIOA 3CD8A 3IKAA 4I21A 4APCA 3LXPA 2YIYA 4L3LA 2VWBA 3OCTA 4HYHA 4B8MA 5H8BA 4F9WA 3H30A 5HIBA 1W0XC 4RC4A 5IZFA 5FM3A 1YI6A 3E8EA 5ANGA 2DQ7X 3VS2A 4G34A 2GQSA 4C4EA 4HVSA 3P08A 4FGBA 4ASDA 1BLXA 2F49A 1XH5A 2UVYA 4FT5A 3R8MA 2QQ7A 3K2LA 4YNOA 5KZ0A 4AQCA 4GVJA 4DGGA 2NRYA 4A9UA 3IDBA 1U4DA 3V04A 3SKCA 4WRGA 5F94A 3ZZEA 3AC5A 5E8WA 4GT4A 2YDIA 3OWPA 4DG0E 1IA8A 5HTBA 2YIXA 2UZNA 2ZVAA 1CKPA 2JKKA 3MI9A 3PWDA 4B4LA 3F88A 3LXNA 4G2FA 3HUBA 3NAYA 3H0YA 4MNEA 4XYFA 3CQWA 4U41A 4O0SA 3O96A 4AP7A 3UO4A 2F2CB 2QO7A 5DT0A 3SXRA 3RCJA 1JKLA 4DA5A 2JKOA 5H2UA 3ZDUA 3OBGA 4A9SA 1OVEA 4GS6A 4QP4A 2W1GA 1YRPA 3D2KA 5E8VA 2R7IA 3OT8A 3QA0A 1H25A 3G15A 4LM5A 3WF8A 4BDGA 3K3IA 5AIRA 4YLJA 4A07A 4A06A 1BYGA 4D4YA 3DA6A 2ETRA 2JC6A 5DOSA 5BVKA 5EG3A 2OJIA 1SMHA 3NYOA 3E7VA 3ZC6A 5I4NA 3UNKA 2C4GA 3MDYA 4PF4A 4GUBA 5C9CA 5E90A 4KABA 3KRLA 4K9YA 4QMZA 1W83A 4BDIA 2BKKA 4K18A 4X3FC 4EOOA 3DFCB 2PVYA 3EJ1A 4EHGA 1CMKE 1UVRA 2Y7JA 5F95A 4JNWA 5LQFA 2UZEA 5L2TA 4D2SA 5GJDA 4O0RA 4YLKA 2GNFA 5HNBA 3UG2A 4N6YA 3HDMA 2WMQA 3G90X 5AP6A 3C4CA 3HMPA 3LIJA 5A4QA 4TYJA 1H24A 1YXTA 5IA3A 3P7BA 3QXOA 4UBAA 3R73A 4GKHA 2UW3A 4DBNA 3E3BX 2CLXA 3Q04A 2XIZA 5IUIA 2QR7A 2OZOA 3NGAA 4YJVA 2B9HA 2WKMA 4FI1A 3PJ8A 2Y9QA 4KNBA 1SVGA 1YOMA 5L2SA 3ET7A 3O7LB 1GIJA 4FOCA 3U54A 2XK7A 3LOKA 2F9GA 4KKGA 2QG5A 1Y8YA 1IRKA 3P9JA 1ZMVA 4TWNA 2W1FA 3OVVA 4XMOA 3WZKA 3FEGA 1P2AA 3OCGA 3QCYA 2GDOA 2VU3A 3F3ZA 2G1TA 4BI2A 4FTNA 4FV4A 4WSQA 2BTRA 1YW2A 4Y8DA 2W5HA 4LGGA 2OI4X 4KIQA 3SD0A 2W4JA 4CT1A 3L9LA 5JRSA 4NL0A 3FZ1A 5HO8A 2OH4A 4ACHA 5CNOA 4AZEA 2X2LA 5M4IA 4HW7A 4GKIA 4GCJA 3RM6A 3R9OA 4ZIMA 4EH4A 2CHLA 2CN5A 3KULA 3LPBA 4DTKA 5AUWA 2O63A 3I6UA 4DTBA 1RQQA 4FEXA 2ITWA 4QMPA 5CVGA 4ZTRA 1MQBA 3Q32A 4TW9A 3ZBXA 4O1OA 3IO7A 4Y5HA 2B9JA 5HLWA 4UY9A 5IDNA 4IB5A 5FBNC 4A4OA 1OMWA 3BEAA 3SAYA 3KL8A 3GC7A 4MHAA 1YWNA 5HX8A 2X0GA 1OL2A 5FXQA 4F09A 1LP4A 3TZ7A 4O83A 4XUFA 3BZ3A 3VC4A 2E2BA 1OM1A 2PWLA 2WB8A 4IM3A 2XUUA 5AP0A 1H8FA 2R3GA 2UZLA 4U45A 3FY0A 4CKJA 4DEDA 3KULB 2PHKA 4YZBA 4E20A 2VWVA 3AG9A 4C58A 5EYKA 2NPQA 4IACA 3RWQA 4RLLA 4F0FA 4I94A 3OOGA 5TR6A 4AOTA 2OZAB 4HZRA 4J52A 3TNPC 3DXQA 1FVVA 3NVMB 4UB7A 2CLQA 3S2PA 4P5ZA 2P3GX 2X81A 3MVHA 4UWBA 4JAJA 3O17A 3V5QA 4J8NA 1REJA 1YVJA 4M15A 1WVXA 3II5A 4CV9A 1E9HA 2PZRA 3QU0A 3FKNA 2B54A 4F7LA 4PPCA 4EOLA 5E8ZA 3DBCA 4IX4A 4JR7A 5CF5A 4AE6A 2R0UA 3F5UA 3ITZA 2C3IB 4JBVA 4LUDA 2NNWB 1PKGA 2HY81 2QONA 1YHSA 1Y8GA 3UOJA 3SHEA 4UYNA 4DH7A 4L68A 4E8AA 4ZZNA 5HZNA 4QQCA 1ZOHA 3PSBA 3NCGA 4FC0A 4BDJA 2QG7A 4C57A 2QLUA 4NM0A 3ZFMA 5ANIA 1CTPE 5E8UA 1OKVA 2YACA 5KZIA 4D55A 4D9TA 2ESMA 4EOKA 5J9YA 3PZEA 5DFPA 1OIYA 4A9YA 4AZSA 2QCSA 3GU8A 4X2JA 3UNJA 4CEGA 3GC8A 3ZU7A 5A4LA 2B4SB 3BE9A 5FG8A 3FJQE 3U8WA 4B7TA 1J3HA 4ARKA 4O82A 2WMWA 3NYVA 2VGPA 4TRLA 3CTHA 4YO6A 4DH1A 3ZXTA 2BAJA 5EDRA 4R3CA 2Z02A 1FVRA 3O23A 1GOLA 1Q8TA 3P78A 4WO5A 5BPYA 5D1JA 3BV3A 3UYTA 4BIDA 3FSFA 4Z55A 4ZLYA 3CIKA 1Q99A 3L9MA 4PNKA 2X6EA 3BE2A 3EFWA 5E8XA 5JGDA 3W2OA 1Y57A 4ZS4A 3MA3A 4FVPA 3NNWA 5M4CA 2ZV2A 5IQFA 3HV6A 3MFUA 3U55A 1QPEA 3POZA 3IGOA 2NP8A 4RA4A 3DBFA 3FL4A 4QMLA 4OBPA 3HNGA 4JVGA 2VAGA 1OECA 4OT6A 4XRJA 4YZMA 1Q41A 3A7FA 3E8NA 4UXLA 3EOCA 2VV9A 3TL8A 3HAMA 3ANQA 4JDIA 1WMKA 4MWIA 3DTCA 4R8QA 5EOBA 5A3XA 3A8WA 2RFEA 5GIPE 3BYVA 4OLIA 4E6DA 4YSMA 2BRGA 5AJQA 5CAUA 3QYWA 4R77A 2XCHA 5JFXA 2YDKA 4H3BA 1CDKA 3MVJA 4FKLA 4ZJIA 3OCBA 5CEQA 4W4VA 3VHKA 2F57A 5FXRA 5K0KA 3ZZWA 4MKCA 3Q2JA 2ZAZA 3GENA 2QOOA 1VZOA 4WNOA 2I0YA 3FPQA 4AW2A 2WQEA 4NM5A 4ASEA 2J50A 3HRBA 2VO3A 3R30A 4XRLA 5EDPA 3ZLYA 1OI9A 5FRIA 5I5ZA 1HCLA 2IVTA 3F69A 4XBRA 5FTQA 1A48A 3DB6A 3OY1A 3TTIA 3TKHA 2H8HA 2C47A 4D9UA 1TVOA 3FQEA 4K11A 3UMXA 2VTTA 3KCKA 3F3UA 3R04A 5DEYA 3RTPA 5IUHA 3GC9A 5LARA 3FZPA 2RG5A 2OJFE 4I41A 2GS7A 3R9NA 4D2WA 3HGKA 4TYIA 4L9IA 3KEXA 4BZDA 2VX1A 2O3PA 4GIIA 5EI2A 4FTUA 4DFUA 5CAOA 1VJYA 3M42A 3S0OA 5DNRA 3RAIA 2IN6A 3REPA 4FX3A 4R7HA 3NDMA 4DCEA 2WTDA 5M07A 3CEKA 4L52A 4TY1A 3OROA 5CVHA 2WFYA 3S4QA 4FYNA 2YHVA 3W2PA 3OXTA 3ZSIA 3V6RA 5I9XA 4G9RA 2VTNA 4L7FA 4G6NA 1DS5A 5AM7A 3MB6A 3K3JA 1RE8A 1U46A 2LGCA 3SGCA 1T46A 2Y4IB 1UU8A 3WARA 4L67A 2B53A 2WZJA 4RX9A 4FV7A 2UZDA 3PRIA 1OITA 2AUHA 4KIPA 4XS2A 4XX9A 5ANKA 4GRBA 3Q2MA 4CMUA 1I09A 3RKBA 2X4FA 4RA5A 3B2TA 4DFBA 4RIWB 4CV8A 3ODZX 4U3ZA 3VS7A 2X7FA 2JDSA 3Q4UA 4PDSA 5J9ZA 2BIKB 3QTQA 3OP5A 3WF9A 3S3IA 4DBXA 2PTKA 4EH3A 2UW7A 4Z7GA 2JLDA 2GS6A 5JFSA 1OPJA 4CQGA 4XHKB 5C4LA 4ZS0A 1H0VA 3C0HA 2JDRA 4M12A 5HD4A 2GNJA 1PMUA 2PVHA 3GC0A 3I5NA 4FIIA 1WAKA 1TQMA 3HDNA 1PMEA 1REKA 3ULIA 5AV0A 3GOPA 1XR1A 5BVNA 4PTCA 5FBOA 1O9UA 4YU2A 4RWLA 4IVDA 4EH5A 2H96A 4PTEA 3VW6A 2R9SA 4TT7A 2XEYA 2VUWA 3TZ9A 3MFRA 1YKRA 3MN3A 4I6BA 2GTNA 4M66A 3ZEPA 3CC6A 5EQEA 3AC1A 4F70A 5CENA 5J79A 3LXLA 4YPDA 4QP7A 5HICA 4CT2A 5CEMA 3V5LA 2YZLA 3ZUTA 1QPDA 1NA7A 3PWYA 4FV2A 3TXOA 4UMPA 4G3DA 4TWCA 4C2VA 3PXKA 4ZJVA 4U7ZA 4X3FA 3QLFA 3I0OA 2JEDA 3Q6WA 3G6GA 3M1SA 4OTRA 4MD8E 4F7JA 3F5GA 4PY1A 3JVSA 5CXHA 5CZIA 2PU8A 4NZWB 4BDHA 3G33A 3OD6X 3WIGA 5DEWA 4ZSEA 2OBJA 2XJ2A 3VS3A 4GT3A 4FSWA 3FSKA 3CXWA 5ACKA 3ALNA 2HXQA 3IOKA 3A7IA 2XMYA 4ZSGA 3KRRA 4MVFA 5DYJA 4P7EA 2BDFA 4RFMA 2R7BA 5HLPA 4TYGA 4IANA 3DQXA 3TIYA 4AFEA 5CF6A 5EK7A 2OH0E 3JXWA 3W18A 2VO0A 3C4EA 3L8XA 3RP9A 2C3JA 5JRQA 3B8RA 1Q61A 3EKNA 3V51A 3LLAA 3COMA 3ZONA 4BCJA 3R7IA 3LKMA 2X7GA 4A4LA 3RHXA 5BYYA 2FGIA 4DFXE 2Q0BA 1ZY4A 3WIKA 3AC4A 4XBUA 4X3FB 4DINA 5BUEA 4N4SA 3F2RA 3MBLA 1H1PA 3R21A 4Y46A 4RZVA 3ZSHA 1B39A 4LI5A 4OT5A 3C4XA 3DOGA 3JUHA 3JYAA 4I4FA 4GH2A 4TWPA 3PSDA 3CGFA 5AX9A 2WELA 5HCXA 2Z60A 1KV1A 2WTKC 3D7TA 3QUEA 3V3VA 5ANDA 4BTKA 2WTIA 3VBWA 4FKTA 1VYZA 5M08A 3NNUA 3DBQA 3UPZA 4PDYA 2F7ZE 3ZLWA 4PL5A 5K5NA 4ZMEA 1BL6A 5JGBA 4NCTC 3QBNA 4NWMA 4O6LA 3RBWA 2EB3A 3FYKX 2W1CA 2B9FA 3RAWA 2GFCA 3UQFA 4E4NA 2XNEA 2CJMA 4I23A 3VVHA 5E8YA 4MQ1A 2UW4A 3LMIA 1X8BA 3LM5A 5EM5A 2IW9A 3UBDA 4BCKA 4XP2A 4II5A 5M4FA 2UV2A 3BLRA 1OUKA 1CM8A 2C1BA 2VTMA 2PK9A 1CKJA 3F2NA 4XG4A 4E6AA 3VF8A 2B9IA 3D9VA 3R01A 2HW6A 4HPTE 4W4XA 1FBNA 3DB8A 3R7YA 3TI1A 5CF8A 4E4LA 2B52A 4CMTA 2ZMDA 4RVLA 4IAKA 2GU8A 5HO6A 4DH5A 3RJCA 3HX4A 1UWHA 1OKYA 2YIRA 1SNXA 3C7QA 4RFZA 4O0TA 5HE3A 4FOBA 4IFCA 4FTCA 3BLHA 3FUPA 5JFVA 2ACXA 4JBPA 3R1QA 4GEOA 5JH6A 5LXMA 3QKLA 5K9IA 2YISA 2A19B 2XKFA 5IKWA 4BKYA 4CFUA 4YTIA 4CCUA 4LUEA 3HV4A 3R02A 4YO4A 1Q4LA 2OGVA 5HBJA 3NAXA 1P14A 2BDJA 4D1ZA 4LV5A 1R39A 4GW8A 4QMMA 1OKWA 2QI8A 4W4YA 5KE0A 2XK9A 5JZJA 2QHMA 4MTAA 5H8GA 3BYOA 1M2PA 3BU6A 4RZWA 4MK0A 3D4QA 4G3EA 3ORNA 4K33A 4DEBA 3NUUA 5L6PA 3D5XA 1R1WA 3FHRA 3FXZA 2YM5A 2HELA 3WF6A 5JQ8A 2O65A 5BQ0A 5HBHA 5IQAA 4JG8A 4YZCA 4ENYA 5HVJA 4F65A 3LCTA 4OBOA 4A4XA 5IEXA 3FLWA 5K0XA 4G31A 2OF4A 4FTOA 3UIUA 4F9BA 4QQJA 1U5RA 4B6LA 3KRWA 4JRVA 5EOLA 5FP6A 3RAKA 2OU7A 4X6QC 2ONLC 3QZFA 3DAKA 2C6MA 3MYGA 4J95A 5EFQA 5EM8A 2UUEA 4CFWA 2YFXA 4EH8A 3FWQA 3OXIA 2NO3A 2PZIA 4NH1A 3SXFA 4IHPA 4OGRA 3Q5IA 4L6QA 3DY7A 3TZMA 3FLNC 3RNIA 2I6LA 3KC3A 3LFSA 4LRKA 2YITA 3QC9A 5CSXA 4QMQA 4DG3E 5IG1A 3OC1A 2BHHA 2YJSA 2FVDA 3PE1A 4IBMA 5EH0A 3RVGA 5D11A 2O5KA 3CY3A 4RIYB 3S95A 2QU5A 4ALUA 4BZOA 4BY9E 4CFMA 2BZIB 2OFUA 2RFNA 4Q9ZA 5A4CA 3LCDA 2ITPA 3G9LX 5FEEA 2XYUA 1WBVA 4RQVA 3LHJA 2X2MA 5L2QA 3A99A 1Q97A 5E8SA 4PQNA 1SVEA 3UZRA 5J95A 4LRJA 5CQUA 4EEVA 4C33A 5IQIA 3C5UA 4JQEA 2B1PA 3MSSA 2VNWA 3RGFA 3W33A 2R4BA 3QD2B 4BCPA 3EHAA 2CGVA 4I22A 2YN8A 1JSUA 3QRUA 2JITA 2JAVA 3OHTA 5E9EA 4ZK5A 4IC8A 5CT7A 3PE2A 4FV5A 4Z7HA 4I5PA 4IQ6A 3QRKA 4FKSA 2C3KA 3QAME 3DKOA 4GFGA 4NKAA 4UYAA 4DN5A 2R3PA 4ZTLA 2X8DA 3VBQA 5C27A 3U6IA 2QHNA 5TT7A 3DCVA 5CX9A 4EBVA 5HE1A 2P2HA 4NM3A 3GU5A 4QQTA 3LCKA 5IQEA 3UPXA 4RRVA 4JBOA 1LPUA 3WBLA 5CANA 5J5TA 5F20A 2EB2A 4RT7A 2CN8A 1UU7A 3IW8A 1R0PA 4IX3A 3DK7A 2WOTA 3BWJA 3ACKA 3TKIA 4L3PA 5EI6A 3G9NA 4FIEA 3SG8A 4W8EA 4U81A 4BCIA 4X2KA 1G3NA 3DJ7A 5AR2A 2HYYA 4ZMFA 5IA2A 4G5JA 5HIEA 3ENHA 4Y72A 4YJNA 4BCFA 2YM3A 5ANEA 1J7UA 2JD5A 4XV9A 4PP9A 2G15A 3F82A 3LMGA 1CSNA 3W10A 4JL9A 2GPHA 3JY0A 4O86A 4DGMA 4UN0C 4FSNA 4XG6A 2FB8A 4ANLA 3VAPA 3Q52A 4BBFA 4ERWA 4FGRA 4JX3A 3FMLA 2YABA 5I9ZA 3Q3BA 2WMXA 3UMWA 4EH9A 4F99A 4FSMA 5B0XA 1OL7A 4NJDA 4RPVA 3ROCA 2IVVA 2OJJA 3IG7A 4DFLA 1OPLA 4Z16A 5TO8A 2A27A 3VHEA 1W98A 4QMTA 4C4FA 2OLCA 2R64A 1UU3A 4P2KA 4ZY4A 4EHVA 3QQFA 3SOAA 3BGPA 3GQLA 1V0OA 2EWAA 4JR3A 5I9UA 3WF5A 5C8MA 1Q8WA 2J6MA 5CAPA 4O84A 4QTAA 4AG8A 3TUCA 3KK9A 2WTCA 3HLLA 4DEEA 5BYLA 5HBEA 3I60A 4LOQA 5HG9A 3BHHA 3EH9A 3LFEA 5JEBA 3POOA 3W2SA 3Q6UA 2XS0A 2OIDA 3VBVA 1TQPA 5L2IA 5LMBA 5DGZA 4MXOA 3KXNA 1YXXA 5G1XA 4ZEGA 2WQNA 5JT2A 5A46A 3F5PA 4OBQA 2PE0A 4NTSA 2FA2A 4FNXA 2XKDA 5BVWA 4R7IA 4F1OA 1PXMA 3Q9WA 5CSWA 5DN3A 2W0JA 4YSJA 5A54A 4P5QA 4L44A 4AT3A 3AD5A 2ZDTA 3NUPA 4O7SA 1SM2A 5HU9A 3GCQA 4GJ3A 3N9XA 2CSNA 3G2FA 3LFFA 4CLJA 2W96B 2W1EA 2VX3A 1JWHA 3MA6A 4X6RA 4I5CA 4GIHA 3VS6A 1H1SA 4BWPA 4XG3A 3TIZA 2BUJA 3QTUA 2XA4A 3VS5A 4DGLC 3TCPA 5AEPA 5JSMA 2Q83A 1M2QA 1PY5A 2WU6A 3A7HA 2VTRA 2YCRA 3MIAA 1APME 2WNTA 4I20A 5DI1A 3QFVA 1LEWA 3SC1A 4QYGA 2E9PA 4G3CA 4MWHA 4CLIA 4D2RA 4C3RA 2FSLX 4QYHA 4IAAA 4ITHA 4O96A 4C35A 2J0IA 4FUYA 4C62A 3H9RA 4RC3A 4UEUA 3NEWA 1FGIA 4JIKA 4C37A 4MNEB 2VWUA 2VTHA 4XV1A 3BELA 2PMOX 1JSTA 3ALOA 3EN9A 4KS7A 4O21A 3AT4A 4MD9E 2Y8OA 2PVNA 3A60A 3GU4A 4H1JA 3VUDA 4L53A 3UP2A 3T3VA 4ANQA 5FUTA 4IVBA 4M3QA 4YC3A 2XNOA 4AA0A 4NT4A 5BVOA 1ZXEA 4OTGA 5KX8A 4FV6A 4JDHA 3KQ7A 2CGXA 5I3OA 3UJGA 5L8KA 3HMNA 1FOTA 1IEPA 1XJDA 2HAKA 2JBOA 2XRWA 4QOXA 5JK3A 3BHUA 4Y85A 4D1XA 3MVMA 2VTPA 4O0YA 4ZTSA 5AUZA 1PXLA 3QGYA 4FV1A 3D83A 3FMNA 2QOCA 4A9TA 1H01A 3HMMA 5DH3A 4BBMA 5D7AA 4F0IA 3GT8A 4YHTA 3HV3A 4I6FA 1H0WA 4BCGA 2PUIA 4BTMA 4NCTA 2XM8A 5JZNA 5LVNA 3DTWA 3P79A 1JBPE 4BVUA 4DITA 4WT6A 3DNDA 3GNIB 2Z8CA 4EOMA 4USDA 4H36A 4Z3VA 4HVGA 2GQRA 3NMUF 3TV4A 3TUDA 2GHGA 4YURA 2C6DA 4AXAA 5L8LA 5J1WA 4S33A 3RAHA 2BRHA 4J98A 4PTGA 3EQRA 5C8KA 3TWJA 4BYIA 2O0UA 4O2PA 5KMLA 5IMXA 1WBSA 2J4ZA 1JSVA 2QLQA 2R3NA 4HJOA 4FR4A 4AGCA 3UQCA 3R28A 3DAEA 3UC4A 2G9XA 3GB2A 3NCZA 3R8VA 3QGWA 1KUTA 2IZUA 3RK5A 5DHJA 3JVRA 5CNNA 2I0HA 3IW5A 1XBCA 2V7AA 2WMTA 5BVFA 3PA3A 3MY1A 4GL9A 3L8PA 3CCNA 4AW5A 5AP1A 2FYSA 3EN6A 2XJ1A 4C3FA 3KXGA 5CQWA 3WZJA 2W1ZA 4AGDA 1UU9A 2V0DA 3VUKA 2CNVA 4HGTA 4JS8A 4ERKA 5A6OA 3VULA 2CNQA 2JKQA 4Z9LA 3KXMA 4KIOA 5B7VA 4J71A 3PVUA 5LWMA 5IU2A 2YIWA 3ULZA 5L2WA 2C1AA 2YCSA 4AOIA 2HZ0A 1OBDA 3DT1A 4RQKA 4F6SA 5LVOA 4IM0A 3BYSA 3ZLSA 1UWJA 1KOAA 2BKZA 4AS0A 2R0IA 4RVKA 2PMLX 4E3CA 2KTYA 2B0QA 2C0IA 1PW2A 3IW7A 3I81A 4E7WA 3KA0A 3R0TA 1M2RA 2B55A 2EUFB 5FLFA 4ANMA 4ANBA 4BCQA 4YUQA 3BYUA 3DDQA 4EK4A 5DVRA 3PLAE 1KE5A 1M7QA 3OWJA 2W7XA 4CTCA 2NRUA 5AP2A 3U4WA 3CPCA 4JG7A 5AM6A 1B38A 5D41A 1FPUA 4G16A 4ZXTA 5C01A 5IDPA 4CSVA 4EK6A 3CGOA 4XOYA 3PA5A 2XNNA 3RHKA 1UKIA 2VTJA 3R83A 5CEOA 4IMYA 5I9YA 2XRUA 3HUCA 3F2AA 4GK2A 3C1XA 4LMUA 4QP1A 3R7OA 3GP0A 3QRIA 4BHNA 3SG9A 3QX2A 2ONLA 4QMYA 5AV1A 3KK8A 4U80A 5A6NA 4C34A 2WU7A 3Q60A 3V8WA 2JIUA 3QRJA 2X1NA 4YGAA 2B7AA 3IK3A 3E8DA 5CU6A 4KS8A 5EYMA 4C4IA 5CEKA 1MUOA 1ZOGA 2Z7SA 1G8AA 1WBNA 4AN9A 2J2IB 3D0EA 3SOCA 3NLBA 5JMSA 1PF8A 3LJ1A 3HRFA 4RJ8A 5EHLA 3WZDA 2QO9A 3MFSA 2PY3A 4D0XA 4PMMA 5CZHA 1VR2A 2R2PA 4R1YA 4FT0A 5KHXA 3ETAA 3I7CA 3UE4A 5K4IA 2UZTA 4PMTA 3T8OA 4EC9A 4AF3A 2PVJA 3F3WA 5C8NA 4FZAB 1H1RA 3HMOA 4M13A 4M68A 4MF0A 1OGUA 4FKWA 3PXFA 3W8LA 1XH8A 5EW8A 2ETMA 5CY3A 4MQ2A 1KWPA 4YBKA 4CZUA 2Y4PA 4G17A 5HCZA 3HVCA 4IWOA 4OTDA 3CSVA 4EI4A 4GMYA 1KOBA 2X39A 4I3ZA 4JX7A 2ITUA 4Y5QA 3RINA 5FTGA 3DV3A 5DG5A 1H07A 4BDFA 4UZDA 5GJGA 4I0TA 3W2QA 5CTPA 4I4EA 5CS6A 1U5QA 2UZBA 3KY2A 4O0WA 4S30A 4J96A 2GMXA 5L6WL 3ZFYA 4O7LA 2CCHA 4P4CA 4EORA 2VTLA 4O91A 5J8IA 3ZDIA 1FMOE 1YDRE 2QC6A 3ZYAA 1LEZA 3D15A 3VUMA 3WI6A 2GQGA 4DFZE 5I0BA 4TYEA 2RF9A 4JXFA 1Q8YA 1GZKA 3QRTA 2I0VA 3C13A 2VN9A 4IW0A 4IWQA 3A7GA 3C5IA 3EQIA 5HE0A 5I3RA 3IW6A 3VJNA 3VJOA 3U9CA 2W4KA 5DT3A 4F08A 1M52A 5L3AA 2P55A 4I5HA 4O7NA 1ZYCA 3FLQA 1J91A 4IE9A 3SXSA 4R7BA 4AN3A 3I1AA 5M57A 2XNGA 2W5AA 3OFMA 5E1SA 3MJ2A 4JJRA 5D12A 3KN5A 3T9TA 2JIIA 3DXNA 3PRFA 4AAAA 2QO2A 3QTWA 2UZOA 4IWDA 3FMJA 3PJCA 3CE3A 1YQJA 1ZZLA 3QTIA 4TPTA 3VUIA 4AUAA 4KINA 3EQPA 5AV2A 4EWHA 3LE6A 4FSYA 4ZZOA 5IA5A 3H9FA 5CSHA 4GG5A 4KBAA 4IADA 2XB7A 4C3PA 4G1WA 2O2UA 2PVKA 3DGKA 2G2IA 3IW4A 3BEGA 3EN5A 4UXQA 5BMSA 4FYOA 5HVKA 4DFYA 2VRXA 4QP2A 1IASA 4BCHA 3EQGA 1NW1A 2ITOA 3N4UA 3COKA 2P4IA 3MV5A 1CKIA 3ORKA 4FV3A 3VNTA 4FTIA 4EH2A 5M4UA 3WILA 1UKHA 4YR8A 2CPKE 4RSSA 4U3YA 1K3AA 3W8QA 4RBLA 4ORKA 3MTLA 3PIZA 3I7BA 4M7IA 4C36A 3SW7A 4ANNA 4BB4A 4E6QA 3N4TA 4EHEA 3V5JA 1JNKA 3P7CA 1Y91A 3G0FA 4PWNA 3FXWA 4X2NA 5HG8A 2DUVA 2XM9A 4PPAA 4P90A 3VIDA 4FSQA 4F1MA 5CAVA 4C2WA 2WTJA 4JDKA 2PVLA 2VWXA 1OBGA 3FMKA 5EKOA 2XNMA 3BQRA 3FHIA 4FTTA 4CYJA 5LCJA 5GIOE 4EKLA 4N0SA 5CU4A 2PL0A 4YHFA 4EJNA 4XOZA 4O81A 2QOQA 3K5VA 2ZM4A 4RJ7A 4N70A 1PKDA 4EWQA 5JKGA 3NW7A 3HP2A 2OIQA 4UWCA 3S1HA 3HZTA 2BZHB 3FI8A 4FV9A 3WYXA 4XG7A 3AGMA 5DRBA 4BWKA 5CASA 4HCTA 2G2FA 5FEDA 3LVPA 4F6WA 5DWRA 4ZSJA 2A0CX 5HU3A 2F2UA 1FGKA 1SZMA 4AZVA 4YC8A 4WIHA 1BI7A 4FK6A 3OW3A 3WZUA 4BDDA 3F61A 1WCCA 2R3LA 3C0IA 3PFQA 1KV2A 1ZAOA 5E1EA 3TT0A 4CZYB 2HIWA 3HA6A 4CG9A 4RWJA 3VQHA 1JLUE 3TNHA 2BILB 3D7ZA 3QQLA 2XBJA 1PYEA 3O50A 4HVHA 4BKZA 4O0UA 1SYKA 3GCPA 2KULA 3ZBFA 3QQJA 5M53A 3FY2A 3OOMA 1K9AA 4U40A 4BF2A 4XV2A 2BMCA 3U6JA 4MYGA 2GS2A 1YDSE 4AFJA 5BUJA 4AN2A 3PDTA 3MJ1A 3R7GA 4ITIA 4M69A 5BYZA 5CI6A 4B9DA 3Q4TA 3D5UA 4QMUA 3NNVA 2X7OA 5ETCA 4AW1A 5EKNA 3BIZA 2VO7A 4QQ5A 3UDBA 1QCFA 4HYSA 3DKGA 2HENA 2XIKA 4XCUA 3VS4A 2GSFA 3O2MA 3QTXA 3ZRMA 4DHFA 4FEUA 3ZS5A 4IB1A 3GFWA 4L01A 4FSRA 1ZMWA 3WZEA 3RWPA 2WHBA 4MNFA 3FMDA 5EHOA 3FYJX 4IC7A 2GHMA 3QTRA 4GV1A 4BDEA 2R3RA 1PXOA 3ORLA 2XBAA 3W2CA 1P4FA 1O6KA 5AA9A 4LYNA 3K54A 4FIJA 4KBKA 3NPCA 4FZ7A 5ANOA 3OWLA 3LM0A 2Z7QA 3ORXA 5E7RA 3MTFA 2BPMA 1JPAA 4RMZA 1AGWA 4CVAA 3E64A 3EIDA 1GZOA 3LQ8A 4HYIA 4QNAA 4WRSA 2W9ZB 3O8UA 2WIHA 2R3QA 4XG8A 3QUDA 4V05A 3EKKA 5DR6A 4YZ9A 4X2FA 3UIBA 3PPJA 3U4UA 5J7HA 1MQ4A 4KBCA 3P23A 3HMIA 5KMNA 3VS0A 4FTMA 2QNJA 3EL8A 4WBOA 4ZTMA 4ANSA 5FD2A 3SQQA 4JG6A 4DEIA 4BFMA 2OF2A 2C5OA 5KHWA 2CGWA 2J0LA 4LOOA 4QP3A 4O7TA 3PY0A 3QQKA 2I0EA 3NW6A 3PG1A 5T6KA 1XH4A 3PY3A 3QCXA 5EQPA 3N4VA 4QP6A 3BHTA 4L00A 2RSVA 4OUCA 1Z9XA 3EYGA 4MXXA 2EXEA 3KF7A 4L42A 3FQSA 3FZSA 4O1PA 2F7XE 3VBTA 4EOSA 3NUYA 4ACGA 3ROYA 1BI8A 3KMWA 3MY5A 4H3PA 4I92A 4NEUA 2VTIA 1ND4A 3LZBA 1A06A 3VRYA 4UMRA 3LFNA 5LCKA 3N51A 1L8TA 2HY0A 1XQZA 4USFA 5DA3A 2HCKA 1PXKA 1Z5MA 4BDBA 4H05A 2OICA 3A61A 4FEQA 3D7TB 4DF3A 4RGJA 3FAAA 3R2YA 5CYIA 4EH7A 4FKJA 3KXXA 4WA9A 5IISA 5DMZA 3BHVA 4GJ2A 3QC4A 3R7EA 3UIMA 2W9FB 3MB7A 4FZ6A 4QTDA 2XCKA 3T3UA 4R3PA 4O7RA 5LWNA 2IG7A 4WNPA 4G9CA 4R5YA 4YC6A 3NYXA 4FIFA 4HNFA 1TQIA 1GY3A 1F0QA 3FMMA 2J51A 4FKUA 4I5MA 2YWVA 3EB0A 3MGYA 4U5JA 4XNEA 2OIBA 4DEAA 5AUVA 5IEVA 2Y6MA 3R22A 3Q4CA 5AAEA 4C61A 4J53A 4HPUE 1ZRZA 2ITYA 3BGZA 1I44A 2ZB1A 4WG3A 3MH2A 4FTRA 3FLYA 4KSQA 3GGFA 4ZJJA 5JGAA 1DM2A 1YI3A 4AU8A 5EDQA 2ZDUA 4BIEA 1U54A 3O8PA 2IVSA 4U0IA 4EYMA 4KRCA 3BWFA 4Y83A 4NYEA 4EQCA 4EL9A 3TNIA 3RALA 5EI8A 4F7NA 2WAJA 5F9EA 3QALE 5IEYA 2XIRA 3QF9A 2Q0NA 2R3HA 3DQWA 3LJ0A 3QHWA 4LG4A 4CGAA 2XVDA 3OXZA 1JQHA 4FG8A 3UG1A 2JFMA 3KMMA 3BU5A 5AUXA 5C1QB 5CU0A 5DE2A 5AP5A 3FC2A 4U8ZA 1UNLA 2IO6A 4FSUA 1YHWA 3QZIA 3JPVA 4Y73A 4B8LA 2C5VA 3IQ7A 3PXYA 4MXZA 1H1WA 2PYWA 2UZWE 1XHAA 3CR0A 5CWZA 3DZOA 3QWKA 4X7QA 3E5AA 3AD4A 5T3QA 3O7LD 3VQUA 3OG7A 1XH7A 4FKVA 4UX9A 2BROA 5EM7A 3SX9A 2QVSE 1U54B
chains in the Genus database with same CATH superfamily
4TNBA 3WE4A 2XF0A 3ORIA 3DLSA 5KMJA 4D1SA 3NZ0A 1Y6AA 3AT2A 5E92A 4DT9A 1KSWA 4OTIA 3UZTA 1W7HA 4I1ZA 3NR9A 1URCA 4E73A 3ZSGA 2YCQA 2Z2WA 3NIZA 1ZWSA 3MIYA 1ZYLA 3ORMA 3QD0A 5KBRA 3DJ6A 4IVCA 1XBAA 4PPBA 2WQOA 2ITNA 4LL0A 3NSZA 4R6VA 5D10A 4S31A 4NK9A 4CCBA 3L9PA 3W0OA 4CYIA 5KMIA 1KE8A 3LQ5A 4EBWA 3OWKA 2C5YA 2E9NA 5KKRC 3EQDA 3LFAA 3ZRLA 4DLJA 3UNZA 3NFGB 4WG5A 4TXCA 2RL5A 2XK8A 3TNQB 4WKQA 1JKTA 4FRFA 3FKLA 3AC8A 2OXYA 4CTBA 4WD5A 4L7SA 2PUUA 4F63A 3ZH8A 3H0ZA 5CSVA 4ACMA 4ENXA 3V5WA 5CSPA 5HORA 3PG3A 5GZ9A 3EN4A 4BJJA 4RWIA 4IFGA 4E5WA 1YOJA 5J5SA 2OW3A 4NUSA 5CEIA 3UODA 2E9UA 4QTEA 1PXPA 4A9RA 4IVAA 2GHLA 5D9HA 4DTAA 2PVRA 4IH8A 1V0BA 5HO7A 1K2PA 1ZYDA 3OEZA 3PJ2A 1A9UA 3P1AA 4FMQA 4HYUA 4TYHA 1R78A 5H9BA 2X9EA 4FIHA 3AC2A 3MY0A 3JS2A 5FEQA 1ZY5A 3HAVA 3DBEA 2ZYBA 4CFXA 3FC1X 4E5AX 4F7SA 1LR4A 1F5QA 2C68A 3QUPA 4RJ5A 3ZO3A 2YERA 2C6IA 4LOPA 1DAWA 1ST0A 2PUPA 1VLRA 4MXAA 3EZVA 4B0GA 3PVGA 2QKWB 2X8IA 3AOXA 3PJ1A 3OF0A 3R8LA 3PJ3A 2XH5A 3MWUA 2BRMA 2PZ5A 4DC2A 3GBZA 3PIXA 4BICA 3R2BA 2X2KA 3KKVA 5HIDA 2IPXA 4HNIA 2XNPA 2UW8A 3MS9A 4TZRA 3V6SA 4BCOA 5ACBC 3THBA 2UVZA 3PFYA 4D2PA 2GFSA 3VW8A 3OBJA 2JAMA 1IAJA 4KD1A 4JDJA 2XP2A 5AMNA 5A14A 3GU7A 1FINA 5AP7A 3IOPA 5FGKA 3QLGA 4ZSLA 1WZYA 2BFXA 3GU6A 3QTSA 4HGLA 4TYHB 3E62A 3R9HA 3HL7A 5TF9A 5JN2A 5E4HA 2VWYA 2GNGA 3S00A 1MRUA 1G5SA 2UZUE 4GVAA 3SVVA 1XO2B 2FSOX 2RGPA 3K5UA 3SA0A 4FEWA 4IAIA 3ENMA 3PZHA 3BKBA 4PP7A 3ZEWA 2YZAA 3GXLA 1Q8ZA 4X3JA 2V62A 2ZV9A 2YDJA 3ACJA 3CJFA 2VTSA 2ITZA 2V7OA 4LV8A 3E92A 3EL7A 1H27A 1UA2A 4EOIA 2UZVA 4G6LA 3SRVA 4FTKA 4M0ZA 3LFCA 4O22A 3MESA 3GEQA 4IZYA 4QMVA 4YTFA 5IUGA 3OTVA 3QX4A 1MRYA 4ACCA 5AAGA 1PMNA 4RX5A 2W1IA 3TACA 3TJCA 2BHEA 3ELJA 4A7CA 4C4GA 4UMTA 4TL0A 1SNUA 5F1ZA 5AR3A 4F1TA 2ITXA 4L8MA 4RJ4A 4N57A 5AP3A 1AD5A 2A4LA 2PSQA 3HA8A 1XH6A 1FMKA 2OJ9A 3HECA 4MF1A 4NTTA 4QPSA 4YP8A 3RPRA 3V01A 4PMSA 2IWIA 3ZM9A 3P7AA 2JKMA 3CJGA 3KXZA 2FSMX 3E7OA 1Q62A 5H3QA 2QU6A 4F9YA 4ZP5A 5M44A 3NIEA 2PULA 4AOJA 3AC3A 3VF9A 4QP8A 2PVMA 3Q4ZA 3QZHA 3LMHA 3DZQA 3CKWA 5JFWA 3UYSA 4HVIA 3AKJA 1ERKA 1WBWA 2V55A 2QODA 4PDOA 5BVEA 3QKMA 3FZRA 4FF8A 2ZV8A 3UVQA 2Z7LA 1V0PA 4DFNA 3OW4A 2YM6A 1SVHA 2ZOQA 3QWJA 4FK3A 3AKKA 3QQGA 4QMXA 4BZNA 4C02A 3Q9ZA 4YJRA 1OL1A 2XKCA 2QR8A 3KN6A 2JDVA 4S34A 5AUTA 3RPOA 5CEPA 5KUPA 4BI0A 2VWWA 4YJPA 3U6HA 3FE3A 3VN9A 4AT4A 4D0WA 3PVWA 4O0VA 3EFLA 3NRMA 2OFVA 4BHZA 5C26A 1IR3A 4GT5A 2YWPA 5HHWA 4JMQA 5TOZA 3TM0A 2BAKA 4BIBA 1OIRA 3V5TA 1NXKA 4ZLZA 5JQ5A 3L8VA 4HGEA 4D5HA 4DG2E 3OTUA 4NKSA 4EUTA 4DH3A 5ETIA 2YM8A 3DS6A 5E91A 3EZRA 4N6ZA 5HKMA 3GI3A 2QKRA 3TDVA 3CD3A 1HCKA 3LXKA 3P0MA 5CVFA 1OIQA 2R3KA 3QD4A 4KWPA 3UQGA 1M14A 4BI1A 3P86A 1GIHA 5LMKC 2PVFA 2V5QA 5GNKA 1P5EA 3F3TA 5FXSA 4F78A 3C51A 2W06A 4IX6A 4BC6A 1Q3DA 1XWSA 1YWVA 4O38A 3DJ5A 3WYYA 4GYGA 3H4JA 4U97A 4U9AA 5CLPA 4FSZA 4ITJA 2R3JA 1YWRA 5KMOA 2VWZA 3M2WA 1XBBA 1YXVA 3OT3A 4K2RA 2W99B 1W2CA 4MEDA 4I24A 4BGGA 1PYXA 1IAHA 1XH9A 4GYIA 4JLCA 2OJGA 4M14A 4CMOA 4F9CA 3TUBA 3HYHA 4XEYA 3R6XA 3D2IA 2IZSA 4MD7E 1YI4A 2AC5A 3FI4A 2ETKA 3LCOA 2I40A 3A4PA 4BYJA 5B2LA 3NW5A 4ALVA 3DDPA 5CXZA 1RDQE 2GNLA 1B6CB 4S32A 2BAQA 3AGLA 3BI6A 3EQCA 4IAFA 4YTHA 3ZRKA 3KRJA 4AA4A 2GCDA 5GINE 2IW8A 3EN7A 2XIYA 4R5SA 3H9OA 3ZO4A 1UNGA 1ATPE 5IF1A 3AMAA 3KF4A 2ITTA 4QTBA 2IEWA 3PSCA 3KGAA 1G8JA 3WOWA 4O7WA 3C4WA 4YJTA 5AV3A 5M56A 2DS1A 2XNBA 3FXXA 3OY3A 2P0CA 4QMSA 3UIXA 2WMVA 3OS3A 3TTJA 1Q5KA 4MBJA 3BLQA 4E4XA 1EH4A 5IA1A 3QKKA 5HG7A 4GU6A 4IAYA 3Q53A 4OTQA 3A8XA 2G01A 2WTKB 4YNEA 2CKEA 4IEBA 5TE0A 5G6VA 1S9IA 3CS9A 2C6EA 3O8TA 3GVUA 5CU2A 5AFVA 5KNJA 4FKRA 5C4KA 4Q2AA 4I0SA 3V5PA 4DYMA 2R3MA 2PMIA 2X9FA 4F64A 5AR7A 5AV4A 3P4KA 5HX6A 5EM6A 3F6XA 3KVXA 3LW0A 3QQHA 4E93A 3ZO1A 4CFVA 2YEXA 4NJ3A 3AD6A 4OTWA 3UOKA 4AWIA 3RM7A 2BVAA 4NIFA 3TMOA 2WMUA 1TKIA 4FVQA 4UV0A 3ZMMA 3F7WA 3R7VA 3ATSA 1UV5A 4HOKA 3COHA 1GZ8A 3PXRA 4L46A 3RK9A 4AE9A 3CTQA 1U59A 3G6HA 2UW5A 4FUXA 4UZHA 3PP0A 4JI9A 3R1NA 5DPVA 2J5FA 3OZ6A 4BTFA 2F7EE 2Y0AA 1W8CA 2OZAA 2V22A 2IF8A 3BX5A 4BCMA 4EZ5A 3PY1A 2A1AB 4IDTA 3QQUA 3P5JC 1GAGA 2OK1A 1O6LA 2UW9A 4J1RA 4FKPA 2WTVA 5C03A 3KREA 5CU3A 3I6WA 1WBPA 2YM7A 4XJ0A 5LVLA 4IXPA 4NU1A 4QP9A 3W55A 2SRCA 3QL8A 4CQEA 1R3CA 5AUUA 2UW0A 1VYWA 3DBDA 4K0YA 4MXCA 2JDOA 2I7QA 1ZZ2A 1ZYSA 4NIFB 4CRLA 4IX5A 5M55A 5DR9A 3T9IA 4BGQA 3R8UA 3QYZA 3V8SA 1QL6A 4NM7A 4X0MA 4MX9A 2DYLA 2XYNA 3RCDA 3A62A 4E5BA 1PXJA 4XLVA 3R1YA 4FBXA 3CLYA 4L45A 4XG9A 3U87A 5DBXA 5I9VA 3ORPA 4FA2A 5BNJA 4I6QA 4AXDA 3IDCA 4KIKA 1OIUA 4DT8A 1J1BA 1OPKA 3MH0A 4HCUA 4YLLA 2YLEA 5DT4A 3FMHA 1RJBA 4RC2A 2F4JA 3LFBA 4Q9SA 1GNGA 4V04A 1GIIA 2G2HA 1L3RE 4PNIA 2VWIA 5GJFA 3MW1A 4EOPA 5AAFA 1YOLA 4M8TA 3NYNA 4GK3A 2IZRA 5HD7A 2E9VA 3HV5A 4MBIA 2WD1A 2C0OA 3HKOA 2W17A 4XH6A 3ORZA 1QMZA 1BMKA 3EMGA 2O8YA 3BV2A 2VGOA 3NS9A 1ZYJA 4YJQA 5KMKA 5AWMA 5IH6A 4ZLOA 2RIOA 2X6DA 3RZBA 4J97A 3FI3A 4R1VA 4B99A 3W16A 4R78A 2CCIA 1BUHA 4O4FA 4S2ZA 3IDPA 2BDWA 3OUKA 3MPMA 4M67A 3OEFX 3ZHPC 1Z57A 2WMSA 4FG9A 2H9VA 4AX8A 1OL5A 3TV6A 2RG6A 2AYPA 4FZFB 3EFJA 4IZ5A 4YJSA 4KIKB 4CFNA 4OAVB 3UZPA 2PUNA 5K5XA 1JVPP 2IJMA 2J0MB 3HV7A 5BVDA 2HWOA 4M0YA 5ANJA 3DXPA 3KXHA 2OSCA 4O4DA 4UMQA 4JQ8A 2PPQA 3E8CA 3RPYA 3ERKA 4ACDA 2X8EA 3GQIA 4NFMA 5CALA 1G8SA 3EQHA 3TN8A 2OXDA 2J5EA 4KAOA 2C5XA 2YLFA 3ZUVA 4EOQA 5IH4A 5KKRB 3RMFA 2P33A 5E8TA 3KRXA 4O2ZA 3HP5A 4FTAA 3LJ2A 4NFNA 4ZTNA 4LDTA 1WBOA 2HZ4A 4TNDA 1MP8A 3BCEA 2XK3A 4O27B 2R5TA 3Q9YA 1YDTE 4PUZA 1ZLTA 4JIAA 2BIYA 3E87A 4LGDA 1HOWA 2CGUA 3PUPA 2J7TA 3E88A 4EK3A 4D4VA 2BRNA 1BL7A 1WVWA 1GJOA 2BZKB 2C6TA 5HNGA 3R9DA 2WQBA 5LOHA 2UW6A 3E3PA 1FVTA 1T45A 3PIYA 4FKOA 4LRMA 4XP3A 4YJOA 5J9LA 1ZOEA 4QPAA 5ICPA 4YBJA 4BWXA 4C59A 4FE2A 4FICA 2EXMA 3CKXA 5FQDC 1J7IA 4PV0A 5LVMA 4MBLA 4MXYA 4G3FA 1UNHA 4WG4A 4U79A 3E63A 3R8PA 3TEIA 4E4MA 4FNYA 4EKKA 4EQMA 3D14A 4E1ZA 5HOAA 2JGZA 2OKRA 2JBPA 2ZV7A 2PMNX 3F66A 4H3QA 4I93A 4DH8A 4DE4A 3F7ZA 2UVXA 3NUNA 2QOLA 5BUIA 4WSYA 3BYMA 3GCVA 3BGQA 4CZTA 5BX0A 3GUBA 3EYHA 2RFSA 4FNZA 2QOKA 1WVYA 2CNUA 4U42A 5M09A 3DK3A 3ZXZA 5A4EA 4DGOA 4O0XA 4DLIA 3AMBA 3PLSA 2XKEA 4C0TA 1Q24A 5B2MA 3NX8A 4CFFA 2PE2A 3G5DA 4BDCA 1PRYA 5FDXA 5EYCA 3QZGA 4YMJA 4IWPA 4JOAA 3A2CA 5HE2A 2ZM3A 4ANOA 5ITAA 3A4OX 4D4RA 3CQUA 4I0RA 4HVDA 4RIWA 3ATTA 4WUNA 4JBQA 3R63A 3CTJA 3W2RA 1H08A 3FPMA 4WUAA 3WE8A 4PL3A 5EW3A 2HOGA 3WF7A 2FSTX 4USEA 4IJ9A 2CKPA 2HK5A 4ZTHA 2WIPA 3QXPA 2BTSA 1KE9A 3C4ZA 4WBBB 3VRZA 4QMNA 4TKSA 4HZSA 3H10A 3MH3A 4LMNA 3ZTXA 1J7LA 5AADA 2J90A 3D94A 4V01A 4L3JA 2XARA 2C6KA 4QMOA 3CPBA 3TKUA 2J9MA 1IG1A 5IQCA 3DLZA 2YJRA 5HVYA 4BL1A 5EW9A 3L9NA 3ZOSA 3TV7A 1GZNA 1W84A 4TN6A 3ODYX 4RIXA 3BLAA 1JOWB 4BRXA 2R3OA 2XEZA 1LUFA 1WFCA 4FG7A 3VUGA 4Y95A 3FLZA 5CI7A 5HI2A 3ZFXA 4CKIA 3AQVA 3UVPA 1BKXA 1QPCA 3R71A 4PX6A 3NWWA 2GNHA 4Q5EA 5A9UA 4APPA 4IB0A 2WTWA 2HW7A 2XZSA 3D5WA 2AQXA 5AA8A 4PRJA 2X4ZA 5IQHA 2W4OA 4AXCA 4RX8A 2C69A 5J1VA 3MH1A 2C30A 2C6OA 3NNXA 4K77A 4BGHA 3FMEA 2LAVA 3DAJA 3HEGA 4G6OA 5M06A 5M51A 3R8ZA 3DNEA 4RFYA 2JDTA 4GFMA 4RVTA 1DI9A 4LGHA 5AR5A 4FTQA 4YHJA 5LMKA 4DAWA 4RIXB 3I5ZA 2YCFA 4FKIA 2AC3A 3H3CA 2EXCX 2WQMA 4AZTA 4EC8A 4QYYA 4IAZA 4KB8A 2QOHA 4IZAA 4TWOA 2WMRA 3ORTA 4J99A 2HZIA 4BBEA 3PXZA 3G0EA 4X21A 1PXNA 2OO8X 3IS5A 3C9WA 2QOIA 4CXAA 2XK4A 3PYYA 4W4WA 4W8DA 2WPAA 3V8TA 4X2GA 3VONA 3QCQA 5I9WA 2BR1A 1OB3A 2YIQA 3EQFA 3IECA 4FIGA 4H1MA 3UC3A 5FWKK 1NVSA 4M84A 2X0OA 5F4NA 1S9JA 4RJ6A 4IZ7A 3C0GA 1PMVA 3DK6A 3FLSA 5B2KA 5T68A 3VUTA 2YA9A 2FH9A 4KSPA 1OZ1A 3U9NA 3VO3A 4QYFA 4D2TA 5KMMA 2QOFA 2ZMCA 4AT5A 1PJKA 4FL2A 3RI1A 3LLTA 3TZ8A 4D5KA 3UP7A 3I79A 2REIA 4M69B 2ERKA 5HTCA 4EK5A 4ZY5A 3DKCA 4IJPA 2OG8A 5DIAA 2W1HA 4G3GA 5ETAA 5AR4A 3CBLA 4YZDA 3VBYA 4LL5A 4EYJA 2WEIA 4RLKA 4FVRA 3KMUA 4NW6A 4FTLA 5EHYA 1Y6BA 2HZNA 2OXXA 5D7VA 4QRCA 5J7BA 2JFLA 3BBTB 1H4LA 3F9NA 1H26A 4KA3A 2Z7RA 5IMEA 4EUUA 4JQ7A 5GZAA 4JRNA 3LQ3A 3C4FA 3FDNA 4XV3A 4PDPA 3TG1A 3OCSA 4K8AA 3PTGA 5FTOA 2QD9A 4ID7A 2YAAA 2ITQA 5IA4A 3EWHA 2J0JA 4IIRA 3DKFA 1V1KA 2FUMA 1OKZA 4FKQA 2YAKA 1NT2A 1STCE 3PA4A 4PL4A 3FI2A 1VEBA 2WMBA 4AGWA 4CNHA 4QYEA 4J8MA 1Q3WA 3ZC5A 2J0KA 4F6UA 5HLNA 3COIA 2R3FA 4KRDA 2ZJWA 3ZCLA 2P2IA 2HWPA 4AZFA 4RX7A 1H1QA 1KE7A 3UOLA 4XLIA 4ASZA 1E1VA 3FQHA 5DLSA 3FV8A 2VZ6A 3CP9A 4BR3A 4GU9A 5HGIA 4ZZMA 3NUAA 3AXWA 1JAMA 2CKOA 3B2WA 3SV0A 2WEVA 2W1DA 3IONA 4AZWA 2R3IA 5K3YA 5FP5A 2BFYA 4U6RA 4O6EA 2IW6A 3KFAA 4IDVA 4ALWA 4F0GA 5IPJA 4EZ7A 1DI8A 4F4PA 2W5BA 3O5AA 1OL6A 4BDAA 1FQ1B 2CMWA 4D58A 3FZTA 4DEGA 1H28A 5CF4A 4YJUA 4C4JA 3NUSA 4RWKA 2VX0A 5EYDA 4EJ7A 2RFDA 5AP4A 1AQ1A 2IVUA 5H8EA 3UVRA 5LVPA 4QT1A 3HRCA 3LFDA 4F9AA 4EH6A 5GZ8A 2CKQA 4M97A 4U44A 1ZMUA 4FL1A 3O71A 2XIXA 3UGCA 4AGUA 4D2VA 2H34A 5IH5A 1J1CA 3JY9A 3Q96A 2GNIA 4FL3A 5AUYA 3W1FA 3ZLXA 3ZO2A 3Q9XA 5J87A 3UOHA 3ZUUA 5HCYA 5BMMA 4JT3A 4U43A 3LFQA 2RKUA 2Y6OA 1YXSA 4XG2A 4FKGA 4JAIA 4BTJA 2BALA 3DPKA 2PZYA 5LMAA 4CG8A 3OMVA 2A2AA 1M17A 2WOUA 3ZM4A 1Q8UA 5A4TA 4MH7A 2WGJA 1ZARA 4E6CA 2FO0A 4D28A 3F5XA 1XKKA 2VTAA 3ID6C 3TJDA 5L6OA 2VD5A 3BQCA 2C0TA 4CKRA 4EOJA 1OUYA 4NW5A 5HESA 5EQYA 3KVWA 3QTZA 4QO9A 2VTOA 1E1XA 1JKSA 3CY2A 3FKOA 4IB3A 3VS1A 3DFAA 4FTJA 2XK6A 4EONA 4BN1A 4C4HA 5DRDA 4O7ZA 4RIYA 3IGGA 5CAQA 3PPKA 3LAUA 2O64A 4GSBA 5IQBA 3EQBA 4MCVA 1QPJA 3KCFA 3SDJA 3TNWA 4BKJA 4E26A 5HTIA 2QOBA 5LJJA 3PXQA 5HNIX 4HGSA 2ERZE 5K4JA 4BCNA 1BX6A 4FT7A 3UO5A 4QD6A 4TTHB 3BHYA 2BZJA 5AIKA 3AT3A 4FZDB 4FV0A 4ZAUA 4GFOA 1WBTA 3UO6A 4FT3A 3TDWA 1P4OA 3M11A 3R1SA 4QPMA 4WHZA 4C7TA 4G5PA 4BDKA 4I6HA 2EVAA 2H6DA 2IZTA 4AACA 2PE1A 2VO6A 4J7BA 2C6LA 4PMPA 3L8SA 4ZSAA 1R0EA 4MUQA 4OR5A 4RVMA 4IM2A 2OWBA 4ZY6A 2C3LA 3GOKA 4W9XA 1MRVA 1YXUA 4FNWA 4DGNA 3L1SA 4GUEA 4MAOA 4YTCA 4OAUC 2GTMA 5KCVA 3QCSA 1RW8A 4QMWA 2BCJA 2EU9A 3RZFA 4H39A 5HG5A 3I0QA 3I4BA 3A7JA 4OW8A 5FDPA 3F3VA 3NUXA 4KKEA 2HXLA 4FT9A 4I6LA 4EQUA 3AMYA 3E93A 3R00A 3U51A 3DU8A 4FV8A 1F3MC 3LCSA 4BJJB 5IA0A 2WXVA 4XP0A 3SW4A 4ZOGA 4UWYA 2ITVA 5CT0A 2QURA 4GG7A 3Q5ZA 2W05A 3CQEA 2VTQA 3RPVA 4ZTQA 3BBWA 4EZ3A 4WOVA 3PPZA 4V0GA 2I1MA 4CRSA 3VBXA 4UALA 5TKDA 5AX3A 3KU2A 4CD0A 3NVKI 4DEHA 4AA5A 4YZNA 3JR1A 3FZOA 4GK4A 4AW0A 4C38A 2ZB0A 2ZM1A 3MFTA 4KKHA 4C8BA 3QA8A 3BPRA 3RNYA 3O0GA 3VWAA 2C5NA 2PZPA 4FSTA 4LQMA 5DR2A 3FL5A 4R3RA 1DAYA 3W32A 2XJ0A 4LFIA 3QD3A 2BRBA 2DWBA 4UMUA 3UTOA 2ZFYA 4QTCA 3IPHA 1NY3A 1M7NA 1NVRA 4FODA 3EFKA 2WO6A 2YM4A 2Y4IC 5FM2A 4HCVA 3B8QA 4ONAA 4OTFA 3GFEA 3GCUA 4EHZA 4WNMA 5IQDA 3MPAA 4YPSA 5GHVA 4L43A 2JIVA 4RJ3A 2VNYA 3FBVA 4V0GB 3C50A 3BU3A 3D5VA 4RG0A 2E9OA 4D4SA 5AR8A 4K6ZA 1KE6A 4OTPA 3GCSA 1NVQA 5HQ0A 4KUJA 3O51A 3TYKA 4K1BA 1W82A 3KB7A 3MVLA 4QNYA 5KO1A 1IA9A 1O6YA 4H58A 3BL9A 3G51A 3RK7A 3RPSA 4O7VA 4NSTA 3R9RA 4Q5HA 1YHVA 4W9WA 4WNKA 1URWA 1JKKA 3SLSA 3R7UA 4OTHA 2CDZA 5KBQA 3PP1A 5HEZA 4O7YA 4FEVA 4EK8A 5IQGA 1PHKA 3MPTA 1H00A 5L8JA 3QHRA 5L4QA 3PVBA 3SRVB 4DCAA 3VUHA 1PXIA 3BRBA 2WMAA 5ETFA 3P5KA 3ANRA 3OUNB 4ASXA 4RIOA 3CD8A 3IKAA 4I21A 4APCA 3LXPA 2YIYA 4L3LA 2VWBA 3OCTA 4HYHA 4B8MA 5H8BA 4F9WA 3H30A 5HIBA 1W0XC 4RC4A 5IZFA 5FM3A 1YI6A 3E8EA 5ANGA 2DQ7X 3VS2A 4G34A 2GQSA 4C4EA 4HVSA 3P08A 4FGBA 4ASDA 1BLXA 2F49A 1XH5A 2UVYA 4FT5A 3R8MA 2QQ7A 3K2LA 4YNOA 5KZ0A 4AQCA 4GVJA 4DGGA 2NRYA 4A9UA 3IDBA 1U4DA 3V04A 3SKCA 4WRGA 5F94A 3ZZEA 3AC5A 5E8WA 4GT4A 2YDIA 3OWPA 4DG0E 1IA8A 5HTBA 2YIXA 2UZNA 2ZVAA 1CKPA 2JKKA 3MI9A 3PWDA 4B4LA 3F88A 3LXNA 4G2FA 3HUBA 3NAYA 3H0YA 4MNEA 4XYFA 3CQWA 4U41A 4O0SA 3O96A 4AP7A 3UO4A 2F2CB 2QO7A 5DT0A 3SXRA 3RCJA 1JKLA 4DA5A 2JKOA 5H2UA 3ZDUA 3OBGA 4A9SA 1OVEA 4GS6A 4QP4A 2W1GA 1YRPA 3D2KA 5E8VA 2R7IA 3OT8A 3QA0A 1H25A 3G15A 4LM5A 3WF8A 4BDGA 3K3IA 5AIRA 4YLJA 4A07A 4A06A 1BYGA 4D4YA 3DA6A 2ETRA 2JC6A 5DOSA 5BVKA 5EG3A 2OJIA 1SMHA 3NYOA 3E7VA 3ZC6A 5I4NA 3UNKA 2C4GA 3MDYA 4PF4A 4GUBA 5C9CA 5E90A 4KABA 3KRLA 4K9YA 4QMZA 1W83A 4BDIA 2BKKA 4K18A 4X3FC 4EOOA 3DFCB 2PVYA 3EJ1A 4EHGA 4AQKA 1CMKE 1UVRA 2Y7JA 5F95A 4JNWA 5LQFA 2UZEA 5L2TA 2XANA 3W0QA 4D2SA 3W0SA 5GJDA 4O0RA 1W2FA 2GNFA 4YLKA 5HNBA 4N6YA 3HDMA 3UG2A 2WMQA 3G90X 5AP6A 3C4CA 3HMPA 3LIJA 5A4QA 4TYJA 1H24A 1YXTA 5IA3A 3P7BA 3QXOA 4UBAA 3R73A 4GKHA 2UW3A 4DBNA 3E3BX 2CLXA 3Q04A 2XIZA 5IUIA 2QR7A 2OZOA 3NGAA 4YJVA 2B9HA 2WKMA 4FI1A 3PJ8A 2Y9QA 4KNBA 1SVGA 1YOMA 5L2SA 3ET7A 3O7LB 1GIJA 4FOCA 3U54A 2XK7A 3LOKA 2F9GA 4KKGA 2QG5A 1Y8YA 1TZDA 1IRKA 3P9JA 1ZMVA 4TWNA 2W1FA 3OVVA 4XMOA 3WZKA 3FEGA 1P2AA 3OCGA 3QCYA 2GDOA 2VU3A 3F3ZA 2G1TA 4BI2A 4FTNA 4FV4A 4WSQA 2BTRA 1YW2A 4Y8DA 2W5HA 4LGGA 2OI4X 4KIQA 3SD0A 2W4JA 4CT1A 3L9LA 5JRSA 4NL0A 3FZ1A 5HO8A 2OH4A 4ACHA 5CNOA 4AZEA 2X2LA 5M4IA 4HW7A 4DHZA 4GKIA 4GCJA 3RM6A 1XMMA 3R9OA 4ZIMA 4EH4A 2CHLA 2CN5A 3KULA 3LPBA 4DTKA 5AUWA 2O63A 3I6UA 4DTBA 1RQQA 4FEXA 2ITWA 4QMPA 5CVGA 4ZTRA 1MQBA 3Q32A 4TW9A 3ZBXA 4O1OA 3IO7A 4Y5HA 2B9JA 5HLWA 4UY9A 5IDNA 4IB5A 5FBNC 4A4OA 1OMWA 3BEAA 3SAYA 3KL8A 3GC7A 4MHAA 1YWNA 5HX8A 2X0GA 1OL2A 5FXQA 4F09A 1LP4A 3TZ7A 4O83A 4XUFA 3BZ3A 3VC4A 2E2BA 1OM1A 2PWLA 3BL7A 2WB8A 4IM3A 2XUUA 5AP0A 1H8FA 2R3GA 2UZLA 4U45A 3FY0A 4CKJA 4DEDA 3KULB 2PHKA 4YZBA 4E20A 2VWVA 3AG9A 4C58A 5EYKA 3NFFB 2NPQA 4IACA 3RWQA 4RLLA 4F0FA 4I94A 3OOGA 5TR6A 3UDSA 4AOTA 2OZAB 4HZRA 4J52A 3TNPC 3DXQA 1FVVA 3NVMB 4UB7A 2CLQA 3S2PA 4P5ZA 2P3GX 2X81A 1G8KA 3MVHA 4UWBA 4JAJA 3O17A 3V5QA 4J8NA 1REJA 1YVJA 4M15A 1WVXA 3II5A 4CV9A 1E9HA 2PZRA 3QU0A 3FKNA 2B54A 4F7LA 4PPCA 4EOLA 5E8ZA 3DBCA 4IX4A 4JR7A 5CF5A 4AE6A 2R0UA 3F5UA 3ITZA 2C3IB 4JBVA 4LUDA 2NNWB 1PKGA 2HY81 2QONA 1YHSA 1Y8GA 3UOJA 3SHEA 4UYNA 4DH7A 4L68A 4E8AA 4ZZNA 5HZNA 4QQCA 1ZOHA 3PSBA 3NCGA 4FC0A 4BDJA 2QG7A 4C57A 2QLUA 4NM0A 3ZFMA 5ANIA 1CTPE 5E8UA 1OKVA