4BDCA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
303
structure length
283
Chain Sequence
SVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 283
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdcA01
3NR9A 2XEZA 4YGAA 5CZHA 5L8JA 5GZAA 3HV6A 5HD7A 4JAIA 3E8DA 3QUDA 4BB4A 5KMJA 4L9IA 3ITZA 1FGKA 2C5NA 2Z02A 4O1PA 2JC6A 3OP5A 3O7LD 4XP0A 4TY1A 1H1SA 3RK7A 4FEXA 1ZMWA 3NDMA 3KMWA 1U4DA 4A07A 4ZLOA 1Q5KA 4IDVA 4KD1A 3UTOA 5JGBA 3UOHA 3LMIA 2HELA 3R9NA 4PMMA 1TQPA 3TEIA 3DXQA 5FM3A 1LEWA 3IDCA 4GK3A 3DK7A 3RZBA 5IEXA 2X8DA 5B2LA 2UV2A 4ITJA 1IAJA 5CALA 2A27A 2J4ZA 2W1CA 3C7QA 3LXKA 2JIVA 3FPQA 4E7WA 2VWZA 4UZDA 4UEUA 4CCUA 3FZ1A 4AGUA 3ORLA 1G8AA 3E92A 3UIUA 3DB6A 5ANEA 4AS0A 3HUBA 4MCVA 2XIYA 4U3ZA 2XJ1A 5M44A 2RKUA 5J79A 4J99A 4G3DA 1Y6AA 4FKRA 4OGRA 3TZMA 3AGMA 3ENHA 2Y4IB 2BFYA 3I7BA 5CEOA 3KCKA 4LYNA 4C36A 5HIEA 1F3MC 5E91A 5JQ8A 3CD3A 3CPCA 2UZNA 1NVSA 4LI5A 4RJ7A 3UPZA 2BZIB 3PIXA 4QP3A 2YIYA 4HVIA 3R8UA 4WSQA 3VUDA 3IS5A 3DTWA 2XK3A 4X6QC 3BWJA 3KXMA 3N51A 1ZAOA 3N4VA 2IW9A 3ZO3A 4DH8A 4EOOA 1FMKA 2AYPA 1MRUA 2WU7A 4PWNA 3QLFA 4F7LA 3E7VA 2W5HA 4ZTLA 5I9UA 4GJ3A 3GU6A 5DR6A 1PXIA 2CKQA 4HW7A 4DFZE 3TG1A 1WMKA 3E7OA 5J87A 4J53A 3O8UA 3RCDA 3VQUA 2BIYA 3AC4A 4KRCA 4RLKA 4YLJA 1U46A 3C9WA 4CRSA 5A14A 4QT1A 3MV5A 3KREA 2PSQA 4MK0A 4O7WA 4WNPA 5HG7A 3SVVA 4FG8A 2CGVA 4OUCA 5HG9A 3M11A 1R0PA 4DGNA 4J98A 2BFXA 4LG4A 4ALUA 3NYOA 4C62A 2GS2A 5J9YA 4EEVA 3R71A 4CKIA 2OFVA 4IANA 3F3WA 5EYMA 3RINA 2RL5A 3GC8A 3NX8A 4TYGA 3JUHA 1RDQE 4BCFA 4D2RA 3CKXA 3OHTA 4DH5A 1OECA 4I0RA 4AG8A 4AX8A 1OI9A 3OMVA 4GIHA 3PJCA 4J1RA 4C38A 5K5NA 5M4IA 1IA9A 1PYXA 5JRQA 4JT3A 5CQUA 1L3RE 3LFDA 5HGIA 3OTUA 4BF2A 4MD8E 3COHA 5LVOA 3ZH8A 5HE1A 4IAYA 3O23A 4IJ9A 3IONA 4QD6A 2P2IA 2YDJA 2UZEA 2P2HA 4A9YA 1M52A 5DWRA 4ZJIA 3RTPA 2OXDA 5CEIA 4BKJA 4LL0A 3LW0A 3WE4A 4FTQA 4IZYA 4WUAA 4RT7A 3HP5A 4C61A 2PPQA 4BTKA 4PMPA 2YIXA 1YXUA 3GUBA 1YXVA 4FTAA 4F63A 4WUNA 3BLRA 4AZFA 4W9XA 3C4XA 1RE8A 5KHXA 4KIPA 2GFSA 1DI8A 4A4LA 4FVQA 3LFEA 4OW8A 1XBCA 2EB2A 2VTIA 1HCLA 3EQCA 4KS8A 1JKLA 2YA9A 4H58A 3RM7A 5JFVA 4FSWA 3TTIA 2GFCA 1P14A 3M1SA 3R1QA 4GT5A 2ZV8A 2VWIA 3QX4A 2ZDUA 2BRMA 2Y9QA 3WZEA 4E73A 5AX9A 2PVHA 4PV0A 4B8MA 3DXPA 4KKGA 4JBQA 1TQIA 2CCHA 4RFMA 3R9HA 4ANNA 4D1ZA 1WBSA 4E5WA 2VX1A 4WRGA 2ZB0A 3I6WA 3ACKA 4BRXA 1W0XC 3QQGA 5J1VA 5E4HA 2X1NA 4R3CA 5EYCA 1M7NA 2FSMX 2X39A 3PP0A 3ZZWA 4DITA 4ZXTA 2R7IA 1PXLA 1JKTA 2J0KA 3EQIA 3WZKA 3LLTA 2ZYBA 2Q0NA 3VUHA 4TYIA 4OAUC 2YITA 5F94A 3A4PA 2OF2A 5CNOA 4RVKA 2BDJA 2KTYA 3DQXA 2V62A 5AX3A 3VBYA 3TACA 1MQ4A 3ULIA 3QCYA 4ACHA 5A6OA 3Q9WA 3GC9A 3LFCA 3R8PA 3ZZEA 2CNQA 2ETKA 3L9PA 4E93A 4GG5A 3A4OX 4V0GA 5BVOA 3VVHA 4LGDA 2VWWA 3ORMA 4FV4A 3UO5A 3EQBA 4EH3A 3V04A 4GKIA 3ZO1A 5JFXA 1Q8ZA 5ANJA 3EQDA 4C7TA 4BIDA 2JITA 1KE9A 3L8SA 2EWAA 1X8BA 3HECA 3OC1A 4W4XA 4AQCA 4BC6A 3OBGA 4UV0A 3BWFA 5T6KA 3D14A 4IQ6A 2PE2A 3CIKA 3HRFA 4FT5A 4JBPA 2BHHA 3QD3A 5J7HA 3G15A 1J7IA 5FP6A 5BVFA 4X2KA 5DR9A 5IU2A 5FLFA 2EU9A 3R7YA 4AZSA 2C0TA 2O5KA 3QTXA 2G01A 4QMQA 2WMTA 5AP7A 3SV0A 3Q4TA 3WF5A 4CVAA 3EN6A 4FIEA 3T3VA 2X7OA 1YXXA 5CENA 2PE0A 4U0IA 1IRKA 1DM2A 5L8KA 5CLPA 4EJ7A 3BPRA 3F66A 2W4OA 2C6OA 3EB0A 4ALWA 4ZTNA 1NW1A 4DT9A 2DS1A 1WBNA 1YKRA 4PUZA 3NSZA 4ZS0A 3JY9A 1OIUA 4AW5A 3BGZA 4Y83A 3L8PA 5F9EA 1NXKA 2W1DA 4IB5A 5AUVA 5K3YA 2QURA 3PZEA 4S32A 2QOQA 3MDYA 2VTNA 2R0UA 5ITAA 3P7AA 4HPUE 5DMZA 4WNKA 4TW9A 2LAVA 3ZDUA 4EK4A 4FGBA 3TKUA 5ANDA 2AC5A 3OCTA 2BTRA 3VF8A 2W5AA 4CMTA 4QYFA 4NM7A 1RQQA 4IADA 1GJOA 2PMLX 4PDPA 1PXMA 1BKXA 2W06A 5KMMA 3QTUA 4NCTC 4M3QA 4CXAA 4O82A 4CV9A 3H9RA 3ZONA 3WIKA 3V5LA 4FV1A 4QYYA 4BGGA 3DKGA 4R7HA 3CE3A 3LXNA 5IQBA 1KV1A 3F82A 4DFYA 4HVGA 3PUPA 4NKAA 3CTQA 3IKAA 3JS2A 4CFMA 4DC2A 5JEBA 4M0YA 2QOFA 4DH3A 3DOGA 3NNUA 4EOMA 2PVYA 3FY2A 4AN3A 4FKSA 4AP7A 3U51A 4PPBA 2BTSA 4ZIMA 5KMIA 2FSLX 4MBIA 3F2AA 2CCIA 4I1ZA 3LMHA 5GJGA 3UZTA 4D2SA 1REJA 3P1AA 3V5TA 4EH6A 4TL0A 4EYMA 2GNHA 2OGVA 3KL8A 2J0LA 4LFIA 3I81A 2Y6OA 3RKBA 5KMOA 5GNKA 4ZY5A 2BIKB 1U54A 3VO3A 5HE0A 2E9VA 5ACKA 2WMUA 4ZTHA 4R1VA 4DLIA 4Q2AA 4CFFA 3GEQA 5L2SA 4I6BA 4BTMA 4R78A 5CY3A 5LVLA 3GU4A 5CEPA 5C8NA 1H27A 2F57A 4U3YA 4YHFA 2HAKA 5BNJA 1JQHA 4O38A 4L01A 5DYJA 4BCKA 2QG7A 4NIFA 4BYIA 3SRVA 5AEPA 4DEGA 5BUEA 3FZPA 3MI9A 5A46A 3CC6A 2XKEA 4FTJA 3R9OA 4FTIA 4I20A 3ZSHA 2PU8A 4JDIA 3JVRA 4F64A 3D0EA 3LQ8A 4UWYA 4DFUA 3QA8A 3UP2A 4O84A 4X7QA 4ONAA 1A9UA 3EMGA 3PSDA 1EH4A 4QYEA 4LUEA 2XIZA 5H8BA 4RJ5A 3G2FA 5DLSA 3MIYA 5E7RA 3SG8A 2WEIA 3A99A 3DBCA 4Y5QA 1GAGA 2CDZA 5TKDA 3VRZA 4O7TA 3DPKA 4FIIA 3MPMA 4AOTA 1XH8A 3OVVA 3GU7A 4DG2E 5LMAA 2UW5A 1Q97A 3PIYA 2HY81 2IJMA 2YM4A 3LFQA 3TUBA 4ACMA 2HZNA 5CXZA 1NVQA 4JX7A 3FZTA 4BBMA 4ZSEA 4PNKA 3MYGA 1JWHA 5CAPA 4LGGA 1P4OA 4JR3A 4X3FB 4YPDA 3QRIA 4E6CA 4CQGA 2Y8OA 1OPKA 4O96A 5IDNA 2YM3A 5B0XA 5IH6A 1Z9XA 4FZ7A 3KY2A 2JKMA 1WFCA 4J95A 3Q60A 5D9HA 4W9WA 5M53A 4BTJA 1JVPP 4CTBA 5AWMA 3ZU7A 4TTHB 3PZHA 4RQKA 5BMSA 3FE3A 1OB3A 5T68A 3KQ7A 4NU1A 3R1SA 4DH1A 4EOKA 2GQSA 4FZDB 5BMMA 5C4LA 3KVXA 2GSFA 3Q3BA 5M06A 4QMSA 5ETCA 2ITUA 3SXSA 2BDFA 4MVFA 5H8EA 4AW0A 3FZOA 3GCUA 4KS7A 5CSWA 5AJQA 5AUWA 4C3RA 4FOCA 3LE6A 1Q8YA 4P2KA 4G9CA 4FSTA 2P0CA 2CHLA 4ERKA 3CSVA 4OBPA 3TDVA 4YSJA 3OEFX 5HIDA 5D11A 4C34A 2ZM4A 3KF4A 3OZ6A 4UBAA 4O0WA 2C5XA 3PXZA 1M7QA 2ONLC 3F2NA 3FI4A 1PXNA 3FLWA 5AA8A 2YLFA 1OZ1A 3EL7A 3UJGA 3NIEA 3ZFXA 4DYMA 5BQ0A 3DDPA 3IW7A 4ZMEA 5C1QB 3RAWA 3TT0A 2ETMA 5CTPA 4UN0C 4O27B 4L43A 2ZV2A 1ZYCA 1Q99A 5CU6A 2WMVA 3ALNA 3MSSA 2XNPA 4A9TA 4EC8A 2JFMA 3N4UA 2XJ2A 5L3AA 4EK5A 5DT3A 2YABA 4FTRA 1YWNA 2IN6A 5A9UA 1Z57A 1V0OA 2VTOA 4F9BA 2C3KA 2WHBA 4CZYB 2J90A 2UW3A 2VTQA 2GNLA 5HCZA 4R5YA 4TRLA 1YHWA 2GCDA 3FUPA 4L67A 4QYHA 5AIKA 4GG7A 2V7OA 1ZZLA 3UP7A 3M42A 2YCSA 3Q32A 4MXOA 4ITHA 3FLQA 4BCPA 4PL5A 1XHAA 3AT3A 2O8YA 5L8LA 3EN5A 3E8CA 4RVLA 4TYJA 4BWPA 4A9SA 3R30A 5BVNA 4DA5A 5E8YA 3EOCA 4F99A 3AD6A 3ZTXA 2JAMA 3EQGA 4ZTSA 3PJ3A 4FMQA 4I92A 4DGLC 3R7GA 4IB3A 4JIKA 5ANIA 4P7EA 4YBJA 3QZHA 3FXXA 1JKSA 1H28A 4ZTMA 2C5YA 3Q96A 4AOJA 3HA6A 5B2MA 3L8XA 3ZRKA 4A06A 1Q8UA 3I79A 2PYWA 3PWYA 3QZIA 4K18A 4V0GB 3C0IA 4Q5EA 4RX8A 5LMBA 4O81A 3RVGA 3UIBA 3FL4A 3UO4A 3LLAA 4U7ZA 2A2AA 4PDYA 3FMMA 3GXLA 2C6EA 4L46A 2NRUA 3QRKA 2Z8CA 4BKZA 5HKMA 4D2WA 2B55A 3IG7A 1WBTA 1ZOGA 3QD0A 3EFKA 3KMMA 4FT7A 4YUQA 4IM2A 3FI8A 4I5MA 3ZDIA 5CSXA 4QQCA 3V8WA 3WILA 2WMXA 4BZDA 3POZA 4FTCA 5BYYA 5BYLA 5DE2A 5DH3A 4FZFB 3A7IA 4H1JA 4QMTA 4HZSA 3FAAA 4CNHA 2R4BA 4FGRA 3CJGA 4PP9A 2PVRA 5EYDA 4FL2A 3CXWA 3LPBA 3PYYA 5D7VA 4E6AA 5LCKA 5L2TA 4FKUA 3LJ2A 3ET7A 1P5EA 3HUCA 4FKTA 3GQLA 5FG8A 3AGLA 4EL9A 2UZDA 1UKIA 3CGFA 3GI3A 3POOA 4F0IA 2WQMA 4WT6A 3SXFA 4U81A 4EHEA 4RLLA 3PPZA 4XRLA 4K8AA 3R2BA 4E4NA 1BL7A 5A4QA 2WELA 5FDXA 3H9OA 4KIQA 1DS5A 1IR3A 4EBVA 4LM5A 2VO6A 1H0VA 3ORIA 3B2WA 3PTGA 3AT2A 3EL8A 3QTIA 1WVYA 3V5QA 3FEGA 3MVMA 3NUAA 2QOOA 2B53A 5AR8A 4DG3E 2BHEA 5M55A 3QYWA 4YHJA 4OBOA 3QXOA 5D1JA 4ZLZA 3F61A 4RIYA 4YSMA 2YIRA 4C2WA 4O1OA 3SOAA 2P3GX 4IAAA 2Y4PA 4A4OA 4Z3VA 3ZUTA 3R83A 4C0TA 4GFMA 4NFNA 5KKRC 2G1TA 4KKHA 3BI6A 2PE1A 2ZM3A 5EW8A 4PDSA 2CMWA 2HZ0A 3FMJA 3QALE 4YC6A 3G90X 3PSBA 1XWSA 2WMBA 2OZOA 4D2TA 3KVWA 3TIYA 1UWHA 2XH5A 3F7WA 2OK1A 5HNGA 5CF6A 4IWDA 3IK3A 4RJ6A 2YERA 4RVTA 3ORZA 3D7TA 2RFEA 3C50A 4CFVA 4W8DA 3R7OA 2BAJA 2RFNA 2XKFA 3CY3A 4KKEA 4XEYA 5ANGA 2FB8A 1BI7A 2I0HA 3SX9A 2UVYA 4YTFA 1ZY4A 4FKIA 5FDPA 4YJSA 3I0QA 2NO3A 3KN5A 1Q24A 3KF7A 3CKWA 5GZ9A 3QQKA 4TYEA 5EI8A 2PVKA 2YIQA 5HLPA 3FYKX 1JAMA 3MY1A 1PHKA 1LP4A 2VTRA 4NJDA 1G3NA 5L6WL 3UYSA 2GHMA 2GPHA 1OKYA 4N6ZA 4NFMA 3R63A 5AAEA 1P2AA 3ACJA 2WQBA 3CCNA 4JRNA 4TN6A 3QTWA 4KWPA 5CU3A 4FKQA 2UW7A 2ITWA 5CT7A 4AE6A 3GOPA 4D1XA 4RX5A 3U4UA 4XV9A 3DBEA 4L6QA 3HLLA 1UNGA 5LWMA 2Y4IC 4D28A 4OTFA 1XH5A 5AADA 4ACGA 4WRSA 3II5A 5EOBA 2XKCA 4IFGA 3D9VA 4NIFB 3SRVB 4XP2A 3OS3A 4FL1A 3TJCA 2I0EA 4KIOA 4FKVA 5AP6A 4FK6A 5CU0A 5AV1A 1J1BA 2YJSA 3U9NA 4PX6A 3GT8A 5DN3A 4FNXA 3SG9A 3ID6C 2QONA 4PL3A 1HOWA 3BE2A 2XUUA 3EKKA 5CVFA 5AV3A 2YCQA 3I5ZA 5HE2A 3ZO2A 3R9DA 4JNWA 2Z7LA 3AD4A 1VYZA 4FT9A 2XA4A 3P78A 4F6SA 3BRBA 3UIMA 3OXIA 2ACXA 3DDQA 3EQPA 4UMRA 2OICA 4QP9A 1TKIA 3UQFA 4CFWA 2ITPA 1VEBA 4GUBA 4NW6A 3A7FA 3Q6WA 1H01A 2UW8A 4XUFA 2X4ZA 4C4JA 3Q2JA 5CSVA 1JBPE 2QOLA 4RIXB 3PSCA 4I93A 2F7XE 4YZMA 1H08A 3R7VA 5J7BA 3E93A 4FIJA 1T45A 4XX9A 4ANSA 1VR2A 4MXXA 5BVDA 1ZRZA 5HO6A 1VJYA 4PL4A 1PXOA 3ZFMA 4QO9A 3EN9A 4ENYA 1AD5A 3PJ8A 4EOJA 4ZZNA 2B0QA 5I3RA 1YI3A 2BRNA 4D2VA 4F7JA 3W8QA 4PPAA 1NVRA 3AMAA 3FPMA 5CI7A 4CT1A 4L7SA 4EOIA 4H3BA 3PY3A 5FXSA 2VWVA 5CWZA 2EXCX 2X0GA 4E6DA 2O63A 3VF9A 3QQFA 1WCCA 2FUMA 3T3UA 4YJNA 3IQ7A 4CGAA 2JD5A 3G51A 4R8QA 2I40A 3LJ1A 5FP5A 4BHZA 4PP7A 1BUHA 2ITTA 4HGLA 4YPSA 4F4PA 3TV4A 3DAEA 3TL8A 4O0TA 3GU8A 3ZS5A 5DR2A 5E1EA 2VTJA 1XKKA 3LXLA 4FV0A 1W83A 4X2GA 4FTKA 3NVMB 1O6LA 4TYHB 4HYUA 4JX3A 5IQIA 3NCGA 3QQUA 1MRVA 3RK9A 5IQHA 1E1XA 3UOJA 1YWRA 2YISA 3FMDA 3HA8A 4FT0A 2O0UA 5I9XA 2OZAB 2BZKB 2GNFA 4BFMA 1AQ1A 3WE8A 3COKA 4XRJA 3R02A 5ETIA 2JFLA 3QF9A 3CTJA 4UY9A 3ZC5A 3T9TA 2GDOA 4RWJA 4PPCA 2KULA 3CTHA 2XNOA 4YZCA 4GFOA 5AR2A 2ESMA 3QFVA 3OT3A 4BDEA 4XBRA 3IGOA 2J51A 4FSRA 4HNFA 4MXAA 4TPTA 4X21A 4TWNA 4UALA 5DT4A 4I22A 2PZ5A 1CSNA 5EI6A 2OIBA 4TWCA 4CG8A 3FV8A 5DHJA 5EM6A 4ZMFA 3R8MA 3RPYA 1R78A 4IIRA 3PRFA 4XCUA 3QHRA 3VS0A 2JDOA 5EOLA 3S2PA 4RVMA 4BCMA 4GH2A 4I0TA 4DEEA 3PRIA 2HXLA 3HEGA 4X3JA 3WZJA 4E4LA 4QNYA 4FV9A 4XG8A 3VJNA 2E9NA 3KEXA 3RGFA 1U59A 3AMYA 1XH4A 3FMKA 4CZUA 4YMJA 2Y7JA 2EXEA 3DLSA 3MH2A 3ZRLA 5IEVA 4G16A 4KIKA 4EOLA 4M13A 2VWUA 3C4FA 1KWPA 2AC3A 3JXWA 4TWPA 1UV5A 4U45A 4W4YA 2J5EA 5AUXA 1QPDA 4YO4A 3WI6A 3ZXZA 4A7CA 5KZIA 4CKRA 2W0JA 2IZTA 2R3IA 2C4GA 4K33A 3MJ2A 4ANMA 5FEQA 1M2RA 5E8WA 1Q61A 3RCJA 4KB8A 2HWOA 2J0MB 4U8ZA 4GU6A 2VO7A 4Z7GA 4L45A 3RAHA 4HYHA 4DE4A 3I6UA 3K5UA 4RPVA 1IAHA 3P7CA 4IBMA 2BKZA 5IDPA 4Y95A 2XJ0A 3DY7A 4F6WA 1FOTA 1CTPE 4DEIA 3OXZA 3FZRA 4ZTQA 1PKGA 3QC9A 3V51A 3ZHPC 4QP6A 4E1ZA 4KSPA 1XBBA 2VGPA 2WNTA 2WTDA 2FA2A 4HGEA 3CGOA 3WYXA 5E8ZA 5H9BA 1SM2A 4MXZA 4B7TA 5AAGA 4O21A 3VC4A 5TT7A 3A8XA 4BY9E 2R3FA 3VUKA 3O96A 4XG7A 4U80A 2X7GA 3LKMA 5FTGA 1OPLA 4M8TA 5C9CA 1OITA 4GVJA 4MBLA 3W1FA 4AZEA 1KE6A 4E6QA 4ID7A 1WBVA 4YZNA 1WBPA 5AM7A 2X8IA 3BEAA 2CPKE 3DU8A 4ANOA 3R1YA 1XQZA 2JKOA 2YHVA 4K6ZA 2X8EA 3SHEA 3ZLWA 4OTGA 4BL1A 4QTEA 2FH9A 3EN4A 1YVJA 5E8UA 4AXAA 2YDIA 3AC5A 4AW1A 1LEZA 3FKOA 3UC3A 4DEAA 1PF8A 3COMA 3LM5A 4IX4A 4BCNA 2XF0A 3GENA 5IUGA 3LQ3A 3EKNA 1SVEA 4D4RA 5K0XA 3FQSA 3WF8A 4FEVA 4BDGA 4EHGA 5C03A 5ANOA 2WOUA 1ZYJA 2JDVA 3I5NA 3V01A 3ZLYA 1V0BA 5I9WA 3KXGA 4D4VA 5L4QA 2XMYA 3I0OA 3VBXA 5IH4A 3UNZA 3OUNB 3O17A 1B6CB 1TVOA 1UWJA 2VWXA 3GCQA 5HNBA 3UNKA 3AC2A 3CD8A 3HDNA 2OI4X 3CQEA 3FHIA 4GSBA 2YIWA 2X81A 3DXNA 2YM5A 1UNLA 4JIAA 3CP9A 3F9NA 4DCEA 3DNDA 2PMIA 2OSCA 5IA5A 4MBJA 3CY2A 4QMLA 4C4HA 4FTUA 2XIXA 1E1VA 3KXNA 3UC4A 3VS4A 4AA5A 1Q8WA 4GKHA 2B52A 5EHLA 4I94A 3KMUA 2W1ZA 2G2IA 2R64A 4JS8A 4HCVA 4O0UA 4GYIA 1OL2A 3QWJA 3R6XA 2WFYA 3QKKA 4YBKA 5HX6A 5F4NA 3O0GA 4PNIA 3EHAA 1XH9A 3UVPA 5DEWA 4M69B 3FKNA 4DG0E 4DF3A 1CKJA 5F95A 3MPTA 1UU7A 3VS3A 4G5JA 5L6PA 3C5IA 3S1HA 4G9RA 4GVAA 2YAAA 3DJ6A 1OL1A 2R7BA 4PY1A 2WTJA 2OO8X 2V0DA 1Q8TA 1W7HA 2ERKA 4I4EA 5G1XA 1ZYSA 2HY0A 3UODA 2ZJWA 4AW2A 3FL5A 3MB7A 3W2SA 2B9HA 4BBFA 2YM8A 3AG9A 4I4FA 4RC2A 4C4FA 3E62A 2Z7RA 3PXRA 3NIZA 3WOWA 4IW0A 4XV2A 3O7LB 1K9AA 3C5UA 4XG6A 4MNEA 4JG6A 5DA3A 4AF3A 2WAJA 2J2IB 1H26A 3BLQA 4WHZA 2BMCA 3GFWA 3R00A 4BCHA 2CN8A 3S00A 5IQEA 3S95A 4BIEA 4QTDA 2BRBA 3R8VA 3NCZA 2QR8A 4RIWA 2VAGA 2F2UA 5IG1A 3C0GA 2PVJA 2QOIA 4G3CA 5FEDA 5E8TA 4ASDA 5CSPA 4O7VA 2WB8A 1UU9A 2X6EA 4AGDA 3HNGA 3VAPA 3BU3A 5IF1A 3MTFA 3H10A 5HG8A 4MH7A 5BX0A 5DNRA 4MF0A 2UZOA 4NEUA 3MFRA 1VZOA 4X3FC 4RWLA 2E9OA 3ORPA 5CI6A 4G5PA 3G0FA 4MX9A 2VZ6A 5DOSA 1U5RA 4FTMA 3V8TA 2YZLA 2GHGA 3E3PA 1O9UA 3F6XA 3VWAA 1OKZA 3D7ZA 4FIHA 4IACA 4D0WA 3DBFA 3REPA 3Q6UA 4DT8A 1YOJA 4ZK5A 4DCAA 3VHEA 3A7JA 2J9MA 3R2YA 4JQEA 4ZLYA 4W4WA 3HL7A 2I0VA 4QPSA 3P4KA 1GY3A 1URWA 2YLEA 5I3OA 2CGXA 3CPBA 3QU0A 4P90A 5CZIA 5L2QA 3SXRA 4B0GA 4C33A 2PTKA 3FJQE 3DKCA 4CLIA 4YTHA 2EB3A 2ONLA 2ZOQA 3SC1A 4EOQA 4HZRA 4IAKA 1YOMA 3ORTA 5IUIA 3OOGA 5KBRA 2C6MA 2HZIA 4JDHA 1YXSA 3FZSA 1GZNA 1Z5MA 4FEWA 3RMFA 4EQMA 3PJ2A 4I5CA 2DQ7X 4FE2A 2B54A 2VWYA 1APME 1ZWSA 3GNIB 3HDMA 4Y85A 5IPJA 3IW6A 2RGPA 2X2MA 3HMMA 2R3QA 4XG2A 2JDRA 2JBOA 3JVSA 3KXZA 3QKMA 5HHWA 3A2CA 4FEQA 4KRDA 3TZ8A 5JFSA 1YWVA 5EQYA 1PMNA 3QTQA 4GRBA 4QMUA 2CGUA 5JRSA 5FGKA 2YCFA 3AC3A 4PTGA 4X2FA 4BCJA 2RSVA 2YWPA 4I3ZA 3IOPA 3VHKA 4QP4A 3RNYA 2IW8A 1IASA 3GVUA 1J7LA 2J50A 4C8BA 1UKHA 2Y0AA 4IVBA 3CLYA 3QQHA 2JKQA 3OTVA 4PMTA 3L9MA 3L1SA 3KC3A 2W4KA 3MN3A 4LOPA 3DTCA 3DT1A 3NRMA 4WSYA 5KCVA 1Y57A 4FIFA 2RFSA 2YZAA 3LFNA 4ZY6A 4G3FA 1CKIA 4DAWA 1S9JA 4MWHA 4DTBA 5E8XA 1ZMVA 1KE7A 4RWKA 3NUYA 3TDWA 2R0IA 3GC0A 2ZV7A 4OTQA 4R3RA 5KZ0A 2BRGA 2QOBA 5GJDA 4DFLA 2PZIA 1SNUA 2HK5A 3PXFA 1Y8YA 2VNWA 4LV8A 4DN5A 4KIKB 1REKA 2RIOA 4XLIA 4USEA 5LOHA 3UZRA 5IA3A 4BTFA 3HMNA 1Q3WA 2WGJA 3BQCA 3RP9A 1K3AA 4DTAA 3MVLA 5I5ZA 5AR3A 4QPMA 4ITIA 3NUSA 5HICA 3VUTA 5KMKA 1Y6BA 3N4TA 4N57A 3TNWA 4HOKA 4ZTRA 2X9EA 3HRBA 4N4SA 4FOBA 4RBLA 2ITZA 5EM5A 4N6YA 5G6VA 2NRYA 3W2RA 3BIZA 4ZZOA 4GUEA 2XK7A 2XK8A 3FQHA 5CXHA 3KXXA 4H1MA 4E8AA 3RALA 1QL6A 4JQ7A 1MQBA 4NH1A 3QHWA 4EH2A 2PVFA 4RFZA 4EQCA 3QCQA 4WBOA 3RI1A 4FT3A 4UXLA 2W99B 5JN2A 3AT4A 4OR5A 5EH0A 5C01A 3UOLA 5CVHA 3HYHA 5DBXA 4F9YA 4KSQA 4EH8A 3EYHA 3BYVA 3R8LA 2FVDA 3W2QA 4F1MA 5HD4A 2W1EA 3DA6A 4QQ5A 5FBNC 3VULA 4QMWA 1S9IA 1ZXEA 1H25A 3TKHA 4CRLA 5HBHA 3LFBA 4B4LA 2BALA 4OLIA 3VUMA 4U97A 3FSFA 3MWUA 3HVCA 4X6RA 2C6DA 2JKKA 4D9TA 5LWNA 3OF0A 5ACBC 3MFTA 1XBAA 3SLSA 2O65A 2GU8A 3HMPA 4NM3A 3QTSA 4FYOA 5H3QA 2A19B 2P55A 4O2PA 2QVSE 2YDKA 2RG5A 2QOKA 3BZ3A 3MJ1A 4BDBA 1ZMUA 2BZJA 4WIHA 4G1WA 2JLDA 4ZOGA 4O7ZA 3GCVA 3FC1X 3PIZA 4M7IA 4MNFA 5EQPA 5DI1A 3ORNA 1W84A 2UVZA 5AUYA 4EONA 3OW3A 1JNKA 5IQDA 4NYEA 4JJRA 3ZLXA 5IQCA 3OOMA 5LJJA 3U8WA 4RIOA 4ANLA 3R04A 4OT5A 3Q4ZA 4AGCA 3D5XA 5BUJA 4FKPA 3TWJA 3THBA 4ZP5A 1H24A 1SMHA 4D2PA 3VNTA 4ZSAA 3TUCA 3PVGA 2QKRA 3VRYA 4CYIA 3ETAA 3BBTB 2XK4A 4DHFA 4DTKA 3NMUF 3HAVA 1ATPE 3D5UA 3QXPA 3O50A 3U9CA 4NTTA 1B39A 3RHXA 2ETRA 3DK3A 4FVPA 2ZM1A 1NA7A 3TM0A 2XP2A 4D1SA 1XH7A 3MH1A 4X0MA 5HQ0A 3K54A 5HO7A 4IM0A 4EKLA 4C4GA 1OIQA 1WZYA 5EG3A 1YI6A 2W1IA 4WA9A 3HV4A 3DLZA 4B6LA 4DEBA 2VGOA 3KK8A 1QCFA 4MYGA 4BWXA 3LCKA 2WEVA 4O86A 5I0BA 2C6KA 5C27A 1H8FA 4N70A 3Q9XA 4O7SA 5AUTA 2XIRA 3MS9A 5EHOA 1CDKA 3ATSA 2QCSA 4OTPA 3P0MA 2PVLA 5HG5A 5M07A 5CU2A 3HP2A 4QMOA 4K77A 4HNIA 3VUIA 3MTLA 3QCXA 4UB7A 1QPJA 2I0YA 3BELA 1CKPA 3SW4A 2YWVA 3R22A 4K2RA 3ROCA 1OIYA 4V04A 1WBWA 2OJ9A 1R39A 2YN8A 3NNVA 3U87A 4TT7A 1UU8A 1H00A 5H8GA 3W16A 4QP1A 5IEYA 5A6NA 5HORA 1KV2A 3GFEA 1Y8GA 3MA6A 3NW7A 3PVUA 5M4CA 2ZDTA 5K5XA 2C6TA 4FICA 2YM6A 4EZ7A 4EZ5A 2A4LA 3R28A 5JT2A 2PUNA 5HEZA 3K5VA 1YOLA 4DH7A 3QTRA 4XLVA 4DINA 2REIA 4IC8A 1J91A 2UZVA 3H0ZA 4S34A 4V01A 1XO2B 5HZNA 4RJ8A 4ZAUA 3JYAA 2V5QA 4C4EA 5J5TA 5L6OA 1RW8A 1ZYDA 2C1AA 2QLUA 2OJJA 4NL0A 3FXZA 4BWKA 3P79A 4NM5A 4DBNA 3W18A 4YR8A 4IFCA 4OTRA 4JBOA 3EYGA 2YACA 5D10A 4ACDA 4H05A 4G6NA 2JIUA 3EZRA 5EM7A 4RIWB 2Z7SA 3KRLA 4IAIA 4DEDA 3LCDA 4CZTA 2VN9A 3S4QA 4H36A 2QC6A 2YAKA 1YQJA 3DBDA 3OCSA 4UX9A 4K0YA 3I60A 4FZAB 3R8ZA 2Q83A 4QPAA 2PZYA 2G9XA 3OXTA 2H34A 3TN8A 3SGCA 5LMKA 3O8PA 4IMYA 2YJRA 3LJ0A 4I0SA 3DKFA 4E26A 1GZ8A 4IVDA 4OAVB 1V0PA 4J8NA 4MWIA 2CKOA 1JSUA 4L52A 2QKWB 4ARKA 4CD0A 5FXRA 1PXPA 3ORKA 2UZUE 3QKLA 5HCXA 5HE3A 3UPXA 4TXCA 1W8CA 3D15A 4ZEGA 4WOVA 2WQEA 4J71A 4X2NA 3P5KA 1A48A 1T46A 4G31A 3RAKA 1M14A 3KXHA 3BQRA 5A4CA 4PTCA 4L44A 5CAVA 4NJ3A 4BZNA 2J7TA 3TI1A 4D4SA 4BHNA 3O2MA 2UZTA 1WVXA 4GL9A 5HTIA 4AACA 3V5JA 4NKSA 4WKQA 3G6GA 3TKIA 5IUHA 3ANRA 3PWDA 3G33A 2JEDA 4OTWA 5EKOA 2C69A 5BVEA 1OM1A 3EFLA 4QTBA 3MESA 1NT2A 2GHLA 3BYOA 4P5QA 3ERKA 1NY3A 3D5VA 4IX3A 4L42A 3ZFYA 4YURA 1H07A 4UWBA 5I9YA 1G5SA 3QQLA 5CYIA 1Q3DA 5I4NA 2SRCA 3G9LX 2WO6A 2WXVA 5CU4A 4Z7HA 4O0RA 1H1PA 3TV6A 3E3BX 4IWPA 4IJPA 5EW3A 3NYNA 4BGHA 5IQAA 1U54B 3C4CA 2BUJA 3UMXA 4EK6A 2XM9A 3D4QA 4GT3A 2CLQA 4QNAA 1OIRA 3IDBA 3NYVA 4EYJA 5HLNA 4A9RA 4EUTA 3AD5A 3TZ7A 4GK4A 4R6VA 3VS5A 2QHMA 2XB7A 3NUUA 4JVGA 2WMSA 4QMMA 5HOAA 5LVNA 3A8WA 4X2JA 2GNJA 4W8EA 3E8EA 4O83A 1TQMA 4FEUA 3QD2B 5HNIX 1G8SA 5HU3A 2OG8A 4U44A 4F9WA 3P9JA 4TNDA 4PTEA 2HIWA 2XS0A 2XRWA 5DT0A 4F9AA 1QPEA 3SKCA 5LVMA 4F1TA 3DJ7A 2ITXA 1R1WA 5DGZA 3V6SA 4BCOA 2XK9A 3HX4A 3IDPA 3UVRA 4YLLA 4MXCA 4C37A 4AN2A 3Q4UA 2BDWA 1KUTA 3CQWA 2QODA 1URCA 4Z55A 3U6IA 4FBXA 5B2KA 4AFJA 5I9ZA 2QNJA 2WIHA 4L53A 4KUJA 3QCSA 5D12A 4GMYA 4N0SA 2OKRA 5IH5A 4ANBA 2FO0A 3DB8A 2QHNA 4FTNA 5AAFA 4APPA 3OG7A 5IQFA 1KOAA 2OIQA 1JKKA 3KULA 3RNIA 2GQGA 4F7NA 3E88A 3SOCA 3V8SA 3D5WA 4V05A 2J6MA 2E9UA 3UGCA 3UE4A 1YI4A 3QUEA 4R7BA 4OBQA 2IZUA 4GT4A 4LRKA 2HZ4A 4O0XA 4EK8A 4FV3A 4RA5A 3GB2A 3PA3A 1Q62A 3LVPA 3BU6A 2RFDA 3IO7A 3PG3A 2AUHA 3OT8A 4MF1A 4OT6A 4R7IA 4BR3A 3HAMA 3RPSA 1PKDA 3PPJA 4HVHA 1OVEA 3NUPA 1GIIA 2X6DA 4BCGA 3S3IA 3VW6A 5EFQA 2FYSA 4EKKA 1XJDA 4Q9ZA 1OUYA 3IOKA 2H8HA 3V6RA 3O51A 4XNEA 2XRUA 4J7BA 3PFQA 2V55A 3EIDA 1WBOA 4M15A 4O0VA 5AUZA 3HKOA 2VX0A 4UZHA 4BDFA 5JKGA 5A4LA 5GINE 2C1BA 4BDHA 4AZWA 4FV5A 4MAOA 3AXWA 3DK6A 2W1GA 2E9PA 3O8TA 1FINA 3NEWA 1B38A 3IW4A 4XP3A 5BPYA 2WKMA 4KBAA 2B9JA 1FMOE 2EXMA 3F5UA 4M0ZA 4TKSA 3HV5A 2WQOA 3ODYX 4AUAA 3QGYA 4F08A 2C0IA 4U40A 2OFUA 3FYJX 2OXYA 3L8VA 4A9UA 3EZVA 4E5BA 5M08A 4NM0A 4GS6A 4IZ7A 2VTHA 3KU2A 4XOZA 3UVQA 3ZSIA 2WMWA 5AR4A 1BYGA 2DWBA 3HRCA 4GV1A 4AAAA 4M67A 3KN6A 4KAOA 3MVHA 3E87A 3U6JA 3F3ZA 4O7LA 2PVMA 2ZV9A 1H1RA 4IWOA 3ZEPA 5DG5A 5C26A 4NWMA 3V5PA 3QRTA 4YJRA 2F49A 2I6LA 3ZOSA 4AN9A 2R3PA 1J3HA 2WPAA 3OCGA 3OBJA 3VS2A 5HLWA 3LM0A 1OL6A 4BIBA 3C1XA 3G9NA 2GTNA 4C4IA 4YTCA 4ASXA 3PY1A 2PMOX 4RFYA 3C13A 3ZLSA 3F7ZA 4U5JA 2QO9A 4F7SA 4FVRA 4AOIA 2H9VA 2CKEA 2WMRA 4RGJA 5HCYA 3MH0A 3ZRMA 4BDIA 4I6QA 3CJFA 2W5BA 4I23A 4IB0A 3R01A 3ZYAA 3TNHA 3NS9A 1KSWA 4G3GA 4LMNA 4RSSA 3BU5A 3QRUA 4ZSJA 4EH4A 1PY5A 4FUYA 4HCUA 1GZKA 2QO7A 4D9UA 4FK3A 4I21A 4EORA 5E8SA 2W96B 3R9RA 4J96A 2XIKA 3UNJA 5CSHA 5EYKA 5AIRA 5GIOE 4O7NA 3I1AA 3F5XA 2ZMCA 4O91A 4AT3A 3CR0A 3F3VA 2HENA 3ZBFA 3UO6A 1YRPA 1OUKA 4MXYA 2VTTA 4EJNA 4TWOA 5BVWA 4BCQA 4QQJA 2XNGA 4F0FA 4IEBA 4LQMA 4IE9A 4NSTA 3VS6A 1FGIA 3KRJA 4EH5A 3PE2A 3IECA 4FG7A 4Y73A 5FBOA 5JGAA 2B9FA 4EI4A 5M4FA 3SA0A 1W82A 4HJOA 4YP8A 4FSMA 3R73A 4ZJJA 5CF4A 4JG7A 1JSVA 2RG6A 3ULZA 4L3JA 4PQNA 2DUVA 2W05A 4JLCA 4KABA 4NK9A 2VO3A 5J8IA 3QZFA 4X3FA 4BDDA 3G0EA 3NW6A 3V3VA 3RWQA 2XNMA 2HYYA 2VTLA 4QRCA 1L8TA 3NYXA 2C3LA 3UQGA 2OU7A 4QOXA 4IM3A 4ANQA 5KMNA 4RX9A 4Y5HA 4C3PA 4R77A 4CLJA 3AMBA 2UW9A 3OROA 5KBQA 1ZOHA 5AP2A 5HX8A 3E63A 2QOHA 3BGQA 2ZB1A 4EC9A 3NAXA 3FC2A 5IA1A 3LCTA 5B7VA 3FBVA 3QGWA 4C3FA 5E1SA 4HPTE 4K9YA 2UW4A 1ZYLA 5TR6A 3TUDA 3JR1A 4GW8A 4NCTA 2PHKA 3W8LA 2VV9A 4KINA 4I6HA 5FRIA 2WTKB 5EK7A 1OBGA 3H30A 3A62A 2VTSA 4FI1A 2WQNA 4MHAA 4F65A 1SNXA 4FNZA 3E64A 3VBVA 1QPCA 5FTQA 4PDOA 4AA4A 4FV8A 3P7BA 5JH6A 2UZLA 3MA3A 3MFSA 2GS7A 2GMXA 3Q5IA 4EQUA 1BL6A 2ERZE 2G15A 5IISA 5CVGA 4RIYB 1LUFA 2HXQA 1WAKA 4ERWA 5H2UA 5EDPA 3BYSA 3FLZA 2IPXA 3C4ZA 2W9FB 2ZVAA 4AA0A 5CNNA 4CFUA 3BV2A 2NP8A 2BPMA 2QLQA 3OCBA 5K9IA 2QU5A 2PZRA 3LQ5A 3NW5A 2YEXA 3OEZA 5M09A 4EHVA 1UVRA 2F9GA 4XG9A 3WF7A 4BDAA 4FKOA 3U4WA 3UDBA 4O22A 3KA0A 5DIAA 3D7TB 4C02A 5HVKA 1HCKA 1YDTE 2Z2WA 3FMHA 4XV3A 5IKWA 4D4YA 3GBZA 3DGKA 4C2VA 2GQRA 5DPVA 3F5PA 4FYNA 4NT4A 2JAVA 4WNOA 4CEGA 4FV7A 2XKDA 1KE5A 2OJGA 4M84A 4F0GA 1YHVA 3QD4A 3QAME 1XR1A 4FSZA 3H9FA 5IMXA 4EWHA 5E8VA 3COIA 2F7ZE 4F09A 1OBDA 3SQQA 4WO5A 2B4SB 1A06A 3MY0A 4NUSA 4BYJA 5M57A 4QTCA 4RMZA 3LFAA 3QLGA 5AM6A 4XBUA 4RC4A 2GNIA 5AUUA 4AT4A 4S30A 4H3PA 4DFNA 2XYNA 5E90A 4XHKB 4BCIA 4ASEA 4MD7E 3GQIA 5HI2A 3VW8A 1H0WA 4CTCA 1VYWA 2C30A 3MW1A 1UNHA 3ZUUA 4BKYA 1OKWA 2UUEA 3BHUA 4G6LA 3BHTA 5AR7A 3OWPA 3SDJA 4QMZA 4HGTA 4FTTA 3A7GA 4R1YA 3R0TA 4GFGA 3IW5A 4J97A 3DKOA 4BI0A 1U5QA 1WVWA 5J5SA 5LVPA 4ZSGA 1K2PA 2OBJA 4FSUA 3WZDA 5LCJA 1V1KA 5EI2A 3ZCLA 3UOKA 4YNOA 1XH6A 1ZARA 3K3JA 5CEQA 3WARA 5CF5A 3QQJA 5AP1A 2GS6A 4DBXA 2HOGA 4Z9LA 4JDJA 4ZZMA 3T8OA 4EOPA 3OW4A 2BKKA 3G5DA 1CMKE 3IGGA 3HMIA 3R1NA 4EH9A 4HVSA 4XMOA 3FXWA 1JSTA 2PL0A 2F7EE 2WTCA 3AQVA 1FQ1B 5HTCA 2IG7A 3KULB 3ZXTA 4E4XA 3OY3A 5BVKA 3DZQA 2R3NA 2R3OA 4RQVA 4CSVA 3DFAA 5L2IA 1CM8A 4IVCA 3BHVA 3BBWA 2R3LA 3NPCA 4HYIA 4MQ2A 5HO8A 3W10A 1FVVA 5GHVA 3LMGA 4J52A 3ZEWA 1H1QA 2ITVA 3EWHA 5FM2A 3ZC6A 4M12A 5CEKA 2B1PA 1GNGA 3RM6A 4Q5HA 3GOKA 4U41A 4JRVA 4WG4A 2O2UA 4IC7A 4PF4A 2R3RA 4QP8A 4CFNA 1SVGA 4CMUA 1F5QA 2HCKA 3F3TA 3OWKA 3PA5A 5AP4A 3WF9A 2C6IA 3KCFA 1YW2A 2QI8A 2OJFE 2R2PA 4DGGA 4QMVA 3W2CA 3DV3A 4O6LA 2B9IA 4M14A 5J95A 4Z16A 3SD0A 4APCA 3BX5A 1IEPA 4I5PA 4DEHA 3C51A 4LV5A 2WIPA 4UMPA 3K3IA 3VIDA 3PXKA 2W9ZB 3BKBA 3ORXA 3QL8A 5HTBA 1O6YA 3PVBA 4PMSA 4RG0A 2XBJA 2W17A 3KB7A 1SYKA 4FIGA 4F6UA 5IMEA 3BHYA 4Y46A 5LQFA 4QTAA 3A61A 1GIHA 3AC8A 2QOCA 2WTVA 3DBQA 3DQWA 4BBEA 3E8NA 4YU2A 4FV2A 5K4IA 2OLCA 4FODA 4FF8A 3ZUVA 1J1CA 2UZBA 2J5FA 3W2PA 1YHSA 3KGAA 4LGHA 3UBDA 4HVDA 3E5AA 4U9AA 5AP5A 4FSQA 4CT2A 1BMKA 3C4EA 4CKJA 3Q9ZA 2J0JA 3PDTA 3UMWA 3ZSGA 1ERKA 3TTJA 5FEEA 2F2CB 2ZMDA 5KHWA 4IX5A 4WG5A 4NZWB 5F1ZA 4EK3A 1UU3A 3GGFA 2PVNA 2PY3A 3BCEA 3TV7A 1SZMA 3R7EA 4YC3A 3W32A 3UIXA 4CCBA 3SW7A 2UW0A 3RPVA 2OIDA 4BDKA 4CMOA 1IG1A 3PLSA 2VTPA 4CG9A 5F20A 5CAQA 1KOBA 3RBWA 3UQCA 1Q41A 3CEKA 3PJ1A 4YJVA 1BI8A 3NNWA 3PE1A 2XBAA 4BI1A 3Q4CA 2V22A 5CEMA 5KX8A 1Q4LA 1PMVA 4IZ5A 5TO8A 5A4TA 5CX9A 4E3CA 3PXYA 3Q9YA 3MB6A 2ZAZA 1DAWA 3IW8A 3NLBA 2BAKA 1O6KA 5CANA 5J1WA 3R7UA 3H3CA 5CQWA 4I41A 3DCVA 3MFUA 4FTOA 4LMUA 4BDJA 5FD2A 2IW6A 5EKNA 2CKPA 3F2RA 3KRRA 4EHZA 2LGCA 3HZTA 4G34A 3B2TA 4WG3A 5IA2A 3RZFA 2CLXA 3UZPA 1JOWB 5FUTA 4NTSA 1OKVA 3FLYA 3WBLA 3ANQA 2IZSA 5GJFA 2XZSA 3V5WA 5AFVA 2CSNA 3OUKA 5ETAA 3LAUA 4LRJA 1IA8A 2WMQA 5T3QA 2VWBA 3TNIA 2BZHB 4RIXA 4DGMA 3A7HA 4R5SA 1H4LA 3ATTA 5GIPE 4GYGA 2JDSA 3NAYA 4YJPA 4YNEA 2IO6A 4MKCA 4P4CA 5L2WA 3VBWA 3N9XA 4O7YA 2G2FA 3EQFA 3QZGA 1ND4A 4UYAA 3FHRA 5I9VA 4QP2A 3QYZA 5A54A 4FR4A 3VBTA 3PVWA 2PUIA 3RPRA 1PXKA 4B9DA 2JIIA 2OW3A 2PWLA 3L9LA 2VD5A 1FPUA 2XEYA 4XH6A 1PJKA 5A3XA 4DGOA 3CBLA 3HV3A 2R3MA 2UVXA 5BYZA 4NW5A 4L8MA 2GTMA 5JSMA 1PRYA 2IWIA 3QTZA 3OWLA 4KA3A 3RJCA 4YO6A 1YDRE 2QQ7A 4ENXA 2Y6MA 4FSYA 3VQHA 2BCJA 4LRMA 3PXQA 3WIGA 5D7AA 2CGWA 1ZZ2A 3F88A 3U54A 2PMNX 3R7IA 1I09A 4W4VA 4XYFA 4G3EA 4I6FA 4KNBA 4TZRA 3KK9A 3DAKA 4GU9A 4QYGA 4TYHA 1KE8A 2WZJA 2PULA 2WTWA 5DRBA 4UWCA 3CS9A 5HVJA 3LHJA 2OZAA 3VJOA 2I7QA 1PMEA 4IWQA 3GC7A 4IVAA 1PW2A 2UW6A 4C58A 1DAYA 3S0OA 1R3CA 4U42A 2NNWB 3LIJA 3I4BA 3EQHA 2H6DA 2X2LA 3BHHA 3NNXA 4JG8A 4JQ8A 4K11A 5CAOA 3LOKA 3ELJA 2E2BA 4O2ZA 4RJ3A 3G6HA 5JK3A 3F69A 4A4XA 2VUWA 1GOLA 1OL5A 2C3IB 2NPQA 1P4FA 4USDA 3RWPA 3RAIA 2CN5A 4G2FA 4C59A 4FNWA 4FUXA 3PA4A 2EVAA 4GIIA 3RK5A 5E9EA 3BE9A 4BZOA 3UYTA 4I5HA 5ETFA 4ACCA 4AU8A 4E4MA 3BYUA 5TE0A 5KO1A 3QC4A 3C4WA 2R3GA 2W1FA 4O0SA 1E9HA 3F3UA 5CAUA 3MIAA 5E92A 3ZBXA 4O6EA 1R0EA 4EUUA 4AFEA 5M51A 2VRXA 4MD9E 3NUNA 3MY5A 2A1AB 3FY0A 3W55A 2WTIA 4XG3A 4AGWA 4CYJA 2IVTA 4D55A 4JXFA 4FKWA 5EHYA 2VO0A 5JZNA 5JGDA 3HV7A 2HWPA 3D83A 5IA0A 4D58A 4HYSA 1I44A 4LOOA 1ZOEA 3KFAA 4M68A 2OJIA 5LARA 1MRYA 4Y72A 3DJ5A 3KRWA 4RC3A 4YZ9A 3TXOA 4DFBA 3FLNC 2X9FA 1FVTA 4R3PA 1FVRA 1OL7A 2R3HA 1ZLTA 3D2KA 3UG1A 4MNEB 1LPUA 2BAQA 4YHTA 2QU6A 3FI2A 4IH8A 3PLAE 3VBQA 4L3LA 3FMEA 2FSTX 3Q52A 2RF9A 3LFSA 2F4JA 3LXPA 4GK2A 4JDKA 5HIBA 3TNQB 3FQEA 5K4JA 1BLXA 4O0YA 4ZSLA 1QMZA 3BYMA 3R21A 3WF6A 3FSKA 3O71A 5EDQA 4QMYA 4ZS4A 4IX6A 4LL5A 2BR1A 4LUDA 2R3JA 3NUXA 5J9LA 3D2IA 1M2QA 2EUFB 3VS7A 2Z7QA 3GCPA 4QQTA 4USFA 4EBWA 4YJUA 1H1WA 3PP1A 1ZY5A 5IZFA 5LXMA 4XJ0A 4RJ4A 4QMXA 3LZBA 2OWBA 2YFXA 2PZPA 2BRHA 2PUUA 2OH0E 4MEDA 3RPOA 4IHPA 4F70A 5KUPA 5AR5A 4PRJA 4L00A 5HBEA 3TIZA 3LCSA 4MQ1A 3UG2A 2XNNA 4ALVA 4CFXA 2VX3A 4YJQA 5IA4A 4FSNA 2C0OA 1PMUA 2IZRA 5AA9A 5HU9A 2WOTA 3GU5A 5ICPA 4L3PA 3AC1A 3VS1A 4ASZA 1GIJA 1M17A 4II5A 2PK9A 2QO2A 5HESA 3HMOA 2Z60A 1MP8A 2W4JA 2X7FA 4HGSA 4JI9A 3U55A 2VU3A 3SAYA 1Y91A 2BILB 4EOSA 1RJBA 5HVYA 5AP0A 2B7AA 4U43A 3ALOA 5JQ5A 3NGAA 2XVDA 4KBCA 4BI2A 2C6LA 1OGUA 4FKGA 4HCTA 4IAFA 5TF9A 5DVRA 3ZO4A 5C8KA 2CNUA 3KKVA 5CF8A 3OD6X 3EQRA 4U6RA 2QR7A 2R5TA 1OPJA 4UYNA 4YTIA 4GCJA 3P86A 3T9IA 4ZY4A 4FA2A 3EFWA 1FBNA 3MGYA 1YXTA 4XV1A 3ZM4A 4AZVA 2VTMA 4IZAA 4JR7A 2WU6A 3FLSA 2BROA 3EFJA 2ITNA 3DFCB 2P33A 4AE9A 4AT5A 5KNJA 3IPHA 3RHKA 4B99A 2H96A 4QMPA 2JDTA 2OXXA 2QG5A 2UZWE 3L9NA 3MH3A 4RRVA 3VN9A 5DEYA 3TCPA 3W33A 2JGZA 5FWKK 3BLHA 3MPAA 3BGPA 2OH4A 3I7CA 3F5GA 4QP7A 5AMNA 3BEGA 4XG4A 3GCSA 2W7XA 5DRDA 3Q53A 3DZOA 5CT0A 3LFFA 4RX7A 4O7RA 3NVKI 5D41A 2OF4A 4J8MA 4D5KA 3DNEA 3VUGA 3H0YA 3QX2A 4RWIA 1AGWA 2XK6A 4FZ6A 4IXPA 4UMQA 1STCE 4FV6A 4RZVA 5BUIA 5KE0A 4XS2A 2O3PA 4P5ZA 2XNBA 5FTOA 2A0CX 3KRXA 5AV2A 3C0HA 2X4FA 3DAJA 5C4KA 3FKLA 3FDNA 3Q5ZA 4JOAA 2I1MA 4M69A 3K2LA 3FMNA 1M2PA 3TJDA 3MBLA 5C8MA 3PY0A 3WZUA 2YM7A 5TOZA 4Y8DA 4OTIA 2ITOA 5A4EA 4FC0A 3EJ1A 4C35A 3B8RA 1JPAA 1SVHA 5J9ZA 3P23A 5FQDC 4FX3A 5EQEA 4YZBA 4ORKA 3OWJA 5GZ8A 4KBKA 4YZDA 4AWIA 4H39A 3Q2MA 1PYEA 4FL3A 5JZJA 5IQGA 3QBNA 3TNPC 3P08A 4FG9A 4FNYA 2W1HA 4L7FA 2G2HA 3ZM9A 3AOXA 3W2OA 4GJ2A 3NZ0A 3BV3A 2FSOX 2R3KA 4YC8A 4C57A 4F9CA 4IB1A 4IAZA 1BX6A 1W98A 4OTHA 2Q0BA 4E20A 3PPKA 5EM8A 4G17A 2DYLA 3WYYA 4DFXE 5M56A 2ITQA 4YLKA 3Q04A 2XNEA 4TNBA 1OMWA 1YDSE 4G6OA 3EN7A 2QD9A 4QMNA 1F0QA 3OFMA 4JBVA 3OY1A 1PXJA 4E5AX 1MUOA 2JBPA 4YJOA 3FWQA 3EH9A 5KMLA 4S33A 4LOQA 4MTAA 4WBBB 3ODZX 4EZ3A 3QWKA 2XM8A 4DLJA 2XYUA 2IVSA 3QUPA 3H4JA 3DS6A 4BICA 4IDTA 2BVAA 3FI3A 4L68A 4CV8A 1LR4A 4RZWA 4ZJVA 4BVUA 5AV0A 4Q9SA 4M97A 2WMAA 2ITYA 4H3QA 2WD1A 4EH7A 2CNVA 2VTAA 4UXQA 4WD5A 4I24A 4EWQA 4F1OA 2VNYA 2V7AA 2C5VA 2CJMA 4S2ZA 5CASA 5M4UA 3CQUA 4JAJA 5ANKA 4WNMA 2GNGA 5HBJA 2R9SA 4CQEA 3A60A 2FGIA 2X2KA 3HGKA 4M66A 4OTDA 5EW9A 4UMTA 4D5HA 5EDRA 5CS6A 3ZMMA 3D94A 3MVJA 3QRJA 4BGQA 4S31A 3LCOA 3NWWA 3QA0A 4D0XA 5AV4A 3FMLA 4FKLA 4YJTA 4UMUA 3GP0A 4JL9A 1J7UA 5AP3A 5K0KA 5LMKC 2P4IA 5DFPA 2WTKC 2C47A 4U79A 5FXQA 1DI9A 3JY0A 4BDCA 2XCHA 2C5OA 2PUPA 1JLUE 2J0IA 3B8QA 1GZOA 4BN1A 4FKJA 3M2WA 4B8LA 2XCKA 2IVUA 2YCRA 2C68A 2IVVA 2O64A 4K1BA 5KKRB 3ROYA 2C3JA 3U6HA 1UA2A 3ENMA 5JFWA 4RA4A 5JMSA 2HW7A 3JPVA 2HW6A 4XOYA 4GEOA 4AZTA 3TZ9A 4FTLA 3PG1A
chains in the Genus database with same CATH superfamily
3NR9A 2XEZA 4YGAA 5CZHA 5L8JA 5GZAA 3HV6A 5HD7A 1W2DA 3E8DA 3QUDA 4JAIA 4BB4A 5KMJA 4L9IA 3ITZA 1FGKA 2C5NA 2Z02A 4O1PA 2JC6A 3OP5A 3O7LD 4XP0A 4TY1A 1H1SA 3RK7A 4FEXA 1ZMWA 3NDMA 3KMWA 1U4DA 4A07A 4ZLOA 1Q5KA 4IDVA 4KD1A 3UTOA 5JGBA 3UOHA 3LMIA 2HELA 3R9NA 4PMMA 1TQPA 3TEIA 3DXQA 5FM3A 1LEWA 3IDCA 4GK3A 3DK7A 3RZBA 5IEXA 2X8DA 5B2LA 2UV2A 4ITJA 1IAJA 5CALA 2A27A 2J4ZA 2W1CA 3C7QA 3LXKA 2JIVA 3FPQA 4E7WA 2VWZA 4UZDA 4UEUA 4CCUA 3FZ1A 4AGUA 3ORLA 1G8AA 3E92A 3UIUA 3DB6A 3W0OA 5ANEA 4AS0A 3HUBA 4MCVA 2XIYA 4U3ZA 2XJ1A 5M44A 2RKUA 5J79A 4J99A 4G3DA 1Y6AA 4FKRA 4OGRA 3TZMA 3AGMA 3ENHA 2Y4IB 2BFYA 3I7BA 5CEOA 3KCKA 4LYNA 4C36A 5HIEA 1F3MC 5E91A 5JQ8A 3CD3A 3CPCA 2UZNA 1NVSA 4LI5A 4RJ7A 3UPZA 2BZIB 3PIXA 4QP3A 2YIYA 4HVIA 3R8UA 4WSQA 2XALA 3VUDA 3IS5A 3DTWA 2XK3A 4X6QC 3BWJA 3KXMA 1OGYA 3N51A 1ZAOA 3N4VA 2IW9A 3ZO3A 4DH8A 4EOOA 1FMKA 2AYPA 1MRUA 2WU7A 4PWNA 3QLFA 4F7LA 3E7VA 2W5HA 4ZTLA 5I9UA 4GJ3A 3GU6A 5DR6A 1PXIA 2CKQA 4HW7A 4DFZE 3TG1A 1WMKA 3E7OA 5J87A 4J53A 3O8UA 3RCDA 3VQUA 2BIYA 3AC4A 4KRCA 4RLKA 4YLJA 1U46A 3C9WA 4CRSA 5A14A 4QT1A 3MV5A 3KREA 2PSQA 4MK0A 4O7WA 4WNPA 5HG7A 3SVVA 4FG8A 2CGVA 4OUCA 5HG9A 3M11A 1R0PA 4DGNA 4J98A 2BFXA 4LG4A 4ALUA 3NYOA 4C62A 2GS2A 5J9YA 4EEVA 3R71A 4CKIA 2OFVA 4IANA 3F3WA 5EYMA 3RINA 2RL5A 3GC8A 3NX8A 4TYGA 3JUHA 1RDQE 4BCFA 4D2RA 3CKXA 3OHTA 4DH5A 1OECA 4I0RA 4AG8A 4AX8A 1OI9A 3OMVA 4GIHA 3PJCA 4J1RA 4C38A 5K5NA 5M4IA 1IA9A 1PYXA 5JRQA 4JT3A 5CQUA 1L3RE 3LFDA 5HGIA 3OTUA 4BF2A 4MD8E 3COHA 5LVOA 3ZH8A 5HE1A 4IAYA 3O23A 4IJ9A 3IONA 4QD6A 2P2IA 2YDJA 2UZEA 2P2HA 4A9YA 1M52A 5DWRA 4ZJIA 3RTPA 2OXDA 5CEIA 4BKJA 4LL0A 3LW0A 3WE4A 4FTQA 4IZYA 4WUAA 4RT7A 3HP5A 4C61A 2PPQA 4BTKA 4PMPA 2YIXA 1YXUA 3GUBA 1YXVA 4FTAA 4F63A 4WUNA 3BLRA 4AZFA 4W9XA 3C4XA 1RE8A 5KHXA 4KIPA 2GFSA 1DI8A 4A4LA 4FVQA 3LFEA 4OW8A 1XBCA 2EB2A 2VTIA 1HCLA 3EQCA 4KS8A 1JKLA 2YA9A 4H58A 3RM7A 5JFVA 4FSWA 3TTIA 2GFCA 1P14A 3M1SA 3R1QA 4GT5A 2ZV8A 2VWIA 3QX4A 2ZDUA 2BRMA 2Y9QA 3WZEA 4E73A 5AX9A 2PVHA 4PV0A 4B8MA 3DXPA 4KKGA 4JBQA 1TQIA 2CCHA 4RFMA 3R9HA 4ANNA 4D1ZA 1WBSA 4E5WA 2VX1A 4WRGA 2ZB0A 3I6WA 3ACKA 4BRXA 1W0XC 3QQGA 5J1VA 5E4HA 2X1NA 4R3CA 5EYCA 1M7NA 2FSMX 2X39A 3PP0A 3ZZWA 4DITA 4ZXTA 2R7IA 1PXLA 1JKTA 2J0KA 3EQIA 3WZKA 3LLTA 2ZYBA 2Q0NA 3VUHA 4TYIA 4OAUC 2YITA 5F94A 3A4PA 2OF2A 5CNOA 4RVKA 2BDJA 2KTYA 3DQXA 2V62A 5AX3A 3VBYA 3TACA 1MQ4A 3ULIA 3QCYA 4ACHA 5A6OA 3Q9WA 3GC9A 3LFCA 3R8PA 3ZZEA 2CNQA 2ETKA 3L9PA 4E93A 4GG5A 3A4OX 4V0GA 5BVOA 3VVHA 4LGDA 2VWWA 3ORMA 4FV4A 3UO5A 3EQBA 4EH3A 3V04A 4GKIA 3ZO1A 5JFXA 1Q8ZA 5ANJA 3EQDA 4C7TA 4BIDA 2JITA 1KE9A 3L8SA 2EWAA 1X8BA 3HECA 3OC1A 4W4XA 4AQCA 4BC6A 3OBGA 4UV0A 3BWFA 5T6KA 3D14A 4IQ6A 2PE2A 3CIKA 3HRFA 4FT5A 4JBPA 2BHHA 3QD3A 5J7HA 3G15A 1J7IA 5FP6A 5BVFA 4X2KA 5DR9A 5IU2A 5FLFA 2EU9A 3R7YA 4AZSA 2C0TA 2O5KA 3QTXA 2G01A 4QMQA 2WMTA 5AP7A 3SV0A 3Q4TA 3WF5A 4CVAA 3EN6A 2A98A 4FIEA 3T3VA 2X7OA 1YXXA 5CENA 2PE0A 4U0IA 1IRKA 1DM2A 5L8KA 5CLPA 4EJ7A 3BPRA 3F66A 2W4OA 2C6OA 3EB0A 4ALWA 4ZTNA 1NW1A 4DT9A 2DS1A 1WBNA 1YKRA 4PUZA 3NSZA 3BL9A 4ZS0A 3JY9A 1OIUA 4AW5A 3BGZA 4Y83A 3L8PA 5F9EA 1NXKA 2W1DA 4IB5A 5AUVA 5K3YA 2QURA 3PZEA 4S32A 2QOQA 3MDYA 2VTNA 2R0UA 5ITAA 3P7AA 4HPUE 5DMZA 4WNKA 4TW9A 2LAVA 3ZDUA 4EK4A 4FGBA 3TKUA 5ANDA 2AC5A 3OCTA 2BTRA 3VF8A 2W5AA 4CMTA 4QYFA 4NM7A 1RQQA 4IADA 1GJOA 2PMLX 4PDPA 1PXMA 1BKXA 2W06A 5KMMA 3QTUA 4NCTC 4M3QA 4CXAA 4O82A 4CV9A 3H9RA 3ZONA 3WIKA 3V5LA 4FV1A 4QYYA 4BGGA 3DKGA 4R7HA 3CE3A 3LXNA 3BLAA 1KV1A 3F82A 4DFYA 4HVGA 5IQBA 3PUPA 4NKAA 3CTQA 3IKAA 3JS2A 4CFMA 4DC2A 5JEBA 4M0YA 2QOFA 4DH3A 3DOGA 3NNUA 4EOMA 2PVYA 3FY2A 4AN3A 4FKSA 4AP7A 3U51A 4PPBA 2BTSA 4ZIMA 5KMIA 3KIOC 2FSLX 4MBIA 3F2AA 2CCIA 4I1ZA 3LMHA 5GJGA 3UZTA 4D2SA 1REJA 3P1AA 3V5TA 4EH6A 4TL0A 4EYMA 2GNHA 2OGVA 3KL8A 2J0LA 4LFIA 3I81A 2Y6OA 3RKBA 5KMOA 5GNKA 4ZY5A 2BIKB 1U54A 3VO3A 5HE0A 2E9VA 5ACKA 2WMUA 4ZTHA 4R1VA 4DLIA 4Q2AA 4CFFA 3GEQA 5L2SA 4I6BA 4BTMA 4R78A 5CY3A 5LVLA 3GU4A 5CEPA 5C8NA 1H27A 2F57A 4U3YA 4YHFA 2HAKA 5BNJA 1JQHA 4O38A 4L01A 5DYJA 4BCKA 2QG7A 4NIFA 4BYIA 3SRVA 5AEPA 4DEGA 5BUEA 3FZPA 3MI9A 5A46A 3CC6A 2XKEA 4FTJA 3R9OA 4FTIA 4I20A 3ZSHA 2PU8A 4JDIA 3JVRA 4F64A 3D0EA 3LQ8A 4UWYA 4DFUA 3QA8A 3UP2A 4O84A 4X7QA 4ONAA 1A9UA 3EMGA 3PSDA 1EH4A 4QYEA 4LUEA 2XIZA 5H8BA 4RJ5A 3G2FA 5DLSA 3MIYA 5E7RA 3SG8A 2WEIA 3A99A 3DBCA 4Y5QA 1GAGA 2CDZA 5TKDA 3VRZA 4O7TA 3DPKA 4FIIA 3MPMA 4AOTA 1XH8A 3OVVA 3GU7A 4DG2E 5LMAA 2UW5A 1Q97A 3PIYA 2HY81 2IJMA 2YM4A 3LFQA 3TUBA 4ACMA 2HZNA 5CXZA 1NVQA 4JX7A 3FZTA 4BBMA 4ZSEA 4PNKA 3MYGA 1JWHA 5CAPA 4LGGA 1P4OA 4JR3A 4X3FB 4YPDA 3QRIA 4E6CA 4CQGA 2Y8OA 1OPKA 4O96A 5IDNA 2YM3A 5B0XA 5IH6A 1Z9XA 4FZ7A 3KY2A 2JKMA 1WFCA 4J95A 3Q60A 5D9HA 4W9WA 5M53A 4BTJA 1JVPP 4CTBA 5AWMA 3ZU7A 4TTHB 3PZHA 4RQKA 5BMSA 3FE3A 1OB3A 5T68A 3KQ7A 4NU1A 3R1SA 4DH1A 4EOKA 2GQSA 4FZDB 5BMMA 5C4LA 3KVXA 2GSFA 3Q3BA 5M06A 4QMSA 5ETCA 2ITUA 3SXSA 2BDFA 4MVFA 5H8EA 4AW0A 3FZOA 3GCUA 4KS7A 5CSWA 5AJQA 5AUWA 4C3RA 4FOCA 3LE6A 1Q8YA 4P2KA 4G9CA 4FSTA 2P0CA 2CHLA 4ERKA 3CSVA 4OBPA 3TDVA 4YSJA 3OEFX 5HIDA 5D11A 4C34A 2ZM4A 3KF4A 3OZ6A 4UBAA 4O0WA 2C5XA 3PXZA 1M7QA 2ONLC 3F2NA 3FI4A 1PXNA 3FLWA 5AA8A 2YLFA 1OZ1A 3EL7A 3UJGA 3NIEA 3ZFXA 4DYMA 5BQ0A 3DDPA 3IW7A 4ZMEA 5C1QB 3RAWA 1G8JA 3TT0A 2ETMA 5CTPA 4UN0C 4O27B 4L43A 2ZV2A 1ZYCA 1Q99A 5CU6A 2WMVA 3ALNA 3MSSA 2XNPA 4A9TA 4EC8A 2JFMA 3N4UA 2XJ2A 5L3AA 4EK5A 5DT3A 2YABA 4FTRA 1YWNA 2IN6A 5A9UA 1Z57A 1V0OA 2VTOA 4F9BA 2C3KA 2WHBA 4CZYB 2J90A 2UW3A 2VTQA 2XANA 2X0PA 2GNLA 5HCZA 4R5YA 4TRLA 1YHWA 2GCDA 3FUPA 4L67A 4QYHA 5AIKA 4GG7A 2V7OA 1ZZLA 3UP7A 3M42A 2YCSA 3Q32A 4MXOA 4ITHA 3FLQA 4BCPA 4PL5A 1XHAA 3AT3A 2O8YA 5L8LA 3EN5A 3E8CA 4RVLA 4TYJA 4BWPA 4A9SA 3R30A 5BVNA 4DA5A 5E8YA 3EOCA 4F99A 3AD6A 3ZTXA 2JAMA 3EQGA 4BJJB 4ZTSA 3PJ3A 4FMQA 4I92A 4DGLC 3R7GA 4IB3A 4JIKA 5ANIA 4P7EA 4YBJA 3QZHA 3FXXA 1JKSA 1H28A 4ZTMA 2C5YA 3Q96A 4AOJA 3HA6A 5B2MA 3L8XA 3ZRKA 4A06A 1Q8UA 3I79A 2PYWA 3PWYA 3QZIA 4K18A 4V0GB 3C0IA 4Q5EA 4RX8A 5LMBA 4O81A 3RVGA 3UIBA 3FL4A 3UO4A 3LLAA 4U7ZA 2A2AA 4PDYA 3FMMA 3GXLA 2C6EA 4L46A 2NRUA 3QRKA 2Z8CA 4BKZA 5HKMA 4D2WA 2B55A 3IG7A 1WBTA 1ZOGA 3QD0A 3EFKA 3KMMA 4FT7A 4YUQA 4IM2A 3FI8A 4I5MA 3ZDIA 5CSXA 4QQCA 3V8WA 3WILA 2WMXA 4QDVA 4BZDA 3POZA 4FTCA 5BYYA 5BYLA 5DE2A 5DH3A 4FZFB 3A7IA 4H1JA 4QMTA 3VONA 4HZSA 3FAAA 4CNHA 2R4BA 4FGRA 3CJGA 4PP9A 2PVRA 5EYDA 4FL2A 3CXWA 3LPBA 3PYYA 5D7VA 4E6AA 5LCKA 5L2TA 4FKUA 3LJ2A 3ET7A 1P5EA 3HUCA 4FKTA 3GQLA 5FG8A 3AGLA 4EL9A 2UZDA 1UKIA 3CGFA 3GI3A 3POOA 4F0IA 2WQMA 4WT6A 3SXFA 4U81A 4EHEA 4RLLA 3PPZA 4XRLA 4K8AA 3R2BA 4E4NA 1BL7A 5A4QA 2WELA 5FDXA 3H9OA 4KIQA 1DS5A 1IR3A 4EBVA 4LM5A 2VO6A 1H0VA 3ORIA 3B2WA 3PTGA 3AT2A 3EL8A 3QTIA 1WVYA 3V5QA 3FEGA 3MVMA 3NUAA 2QOOA 2B53A 5AR8A 4DG3E 2BHEA 5M55A 3QYWA 4YHJA 4OBOA 3QXOA 5D1JA 4ZLZA 3F61A 4RIYA 4YSMA 2YIRA 4C2WA 4O1OA 3SOAA 2P3GX 4IAAA 2Y4PA 4A4OA 4Z3VA 3ZUTA 3R83A 4C0TA 4GFMA 4NFNA 5KKRC 2G1TA 4KKHA 3BI6A 2PE1A 2ZM3A 5EW8A 4PDSA 2CMWA 2HZ0A 3FMJA 3QALE 4YC6A 3G90X 3PSBA 1XWSA 2WMBA 2OZOA 4D2TA 3KVWA 3TIYA 1UWHA 2XH5A 3F7WA 2OK1A 5HNGA 5CF6A 4IWDA 3IK3A 4RJ6A 2YERA 4RVTA 3ORZA 3D7TA 2RFEA 3C50A 4CFVA 4W8DA 3R7OA 2BAJA 2RFNA 2XKFA 3CY3A 4KKEA 4XEYA 5ANGA 2FB8A 1BI7A 2I0HA 3SX9A 2UVYA 4YTFA 1ZY4A 4FKIA 5FDPA 4YJSA 3I0QA 2NO3A 3KN5A 1Q24A 3KF7A 3CKWA 5GZ9A 3QQKA 4TYEA 5EI8A 2PVKA 2YIQA 5HLPA 3FYKX 4MUQA 1JAMA 3MY1A 1PHKA 1LP4A 2VTRA 4NJDA 1G3NA 5L6WL 3UYSA 2GHMA 2GPHA 1OKYA 4N6ZA 4NFMA 3R63A 5AAEA 1P2AA 3ACJA 2WQBA 3CCNA 4JRNA 4TN6A 3QTWA 4KWPA 5CU3A 4DDGA 4FKQA 2UW7A 2ITWA 5CT7A 4AE6A 3GOPA 4D1XA 4RX5A 3U4UA 4XV9A 3DBEA 4L6QA 3HLLA 1UNGA 5LWMA 2Y4IC 4D28A 4OTFA 1XH5A 5AADA 4ACGA 4WRSA 3II5A 5EOBA 2XKCA 4IFGA 3D9VA 4NIFB 3SRVB 4XP2A 3OS3A 4FL1A 3TJCA 2I0EA 4KIOA 4FKVA 5AP6A 4FK6A 5CU0A 5AV1A 1J1BA 1G8KA 2YJSA 3U9NA 4PX6A 3GT8A 5DN3A 4FNXA 3SG9A 3ID6C 2QONA 4PL3A 1HOWA 3BE2A 2XUUA 3EKKA 5CVFA 5AV3A 2YCQA 3I5ZA 5HE2A 3ZO2A 3R9DA 4JNWA 2Z7LA 3AD4A 1VYZA 4FT9A 2XA4A 3P78A 4F6SA 3BRBA 3UIMA 3OXIA 2ACXA 3DDQA 3EQPA 4UMRA 2OICA 4QP9A 1TKIA 3UQFA 4CFWA 2ITPA 1VEBA 4GUBA 4NW6A 3A7FA 3Q6WA 1H01A 2UW8A 4XUFA 2X4ZA 4C4JA 3Q2JA 5CSVA 1JBPE 2QOLA 4RIXB 3PSCA 4I93A 2F7XE 4YZMA 1H08A 3R7VA 5J7BA 3E93A 4FIJA 1T45A 4XX9A 4ANSA 1VR2A 4MXXA 5BVDA 1ZRZA 5HO6A 1VJYA 4PL4A 1PXOA 3ZFMA 4QO9A 3EN9A 4ENYA 1AD5A 3PJ8A 4EOJA 4ZZNA 2B0QA 5I3RA 1YI3A 2BRNA 4D2VA 4F7JA 3W8QA 4PPAA 1NVRA 3AMAA 3FPMA 5CI7A 4CT1A 4FRFA 4L7SA 4EOIA 4H3BA 3PY3A 5FXSA 2VWVA 5CWZA 2EXCX 2X0GA 4E6DA 2O63A 3VF9A 3QQFA 3AKKA 1WCCA 2FUMA 3T3UA 4YJNA 3IQ7A 4CGAA 2JD5A 3G51A 4R8QA 2I40A 3LJ1A 5FP5A 4BHZA 4PP7A 1BUHA 2ITTA 4HGLA 4YPSA 4F4PA 3TV4A 3DAEA 3TL8A 4O0TA 4LDTA 3GU8A 3ZS5A 5DR2A 5E1EA 2VTJA 1XKKA 3LXLA 4FV0A 1W83A 4X2GA 4FTKA 3NVMB 1O6LA 4TYHB 4HYUA 4JX3A 5IQIA 3NCGA 3QQUA 1MRVA 3RK9A 5IQHA 1E1XA 3UOJA 1YWRA 2YISA 3FMDA 3HA8A 4FT0A 2O0UA 5I9XA 2OZAB 2BZKB 2GNFA 4BFMA 2X0QA 1AQ1A 3WE8A 3COKA 4XRJA 3R02A 5ETIA 2JFLA 3QF9A 3CTJA 4UY9A 3ZC5A 3T9TA 2GDOA 4RWJA 4PPCA 2KULA 3CTHA 2XNOA 4YZCA 4GFOA 5AR2A 2ESMA 3QFVA 3OT3A 4BDEA 4XBRA 3IGOA 2J51A 4FSRA 4HNFA 4MXAA 4TPTA 4X21A 4TWNA 4UALA 5DT4A 4I22A 2PZ5A 1CSNA 5EI6A 2OIBA 4TWCA 4CG8A 3FV8A 5DHJA 5EM6A 4ZMFA 3R8MA 3RPYA 1R78A 4IIRA 3PRFA 4XCUA 3QHRA 3VS0A 2JDOA 5EOLA 3S2PA 4RVMA 4BCMA 4GH2A 4I0TA 4DEEA 3PRIA 2HXLA 3HEGA 4X3JA 3WZJA 4E4LA 4QNYA 4FV9A 4XG8A 3VJNA 2E9NA 3KEXA 3RGFA 1U59A 3AMYA 1XH4A 3FMKA 4CZUA 4YMJA 2Y7JA 2EXEA 3DLSA 3MH2A 3ZRLA 5IEVA 4G16A 4KIKA 4EOLA 4M13A 2VWUA 3C4FA 1KWPA 2AC3A 3JXWA 4TWPA 1UV5A 4U45A 4W4YA 2J5EA 2NYAA 5AUXA 1QPDA 4YO4A 4AXFA 3WI6A 3ZXZA 4A7CA 5KZIA 4CKRA 2W0JA 2IZTA 2R3IA 2C4GA 4K33A 3MJ2A 4ANMA 5FEQA 1M2RA 5E8WA 1Q61A 3RCJA 4KB8A 2HWOA 2J0MB 4U8ZA 4GU6A 2VO7A 4Z7GA 4L45A 3RAHA 4HYHA 4DE4A 3I6UA 3K5UA 4RPVA 1IAHA 3P7CA 2X0OA 4IBMA 2BKZA 5IDPA 4Y95A 2XJ0A 3DY7A 4F6WA 1FOTA 1CTPE 4DEIA 3OXZA 3FZRA 4ZTQA 1PKGA 3QC9A 3V51A 3ZHPC 4QP6A 4E1ZA 4KSPA 1XBBA 2VGPA 2WNTA 2WTDA 2FA2A 4HGEA 3CGOA 3WYXA 5E8ZA 5H9BA 1SM2A 4MXZA 4B7TA 5AAGA 4O21A 3VC4A 5TT7A 3A8XA 4BY9E 2R3FA 3VUKA 3O96A 4XG7A 4U80A 2X7GA 3LKMA 5FTGA 1OPLA 4M8TA 5C9CA 1OITA 4GVJA 4MBLA 3W1FA 4AZEA 1KE6A 4E6QA 4ID7A 1WBVA 4YZNA 1WBPA 5AM7A 2X8IA 3BEAA 4AQKA 2CPKE 3DU8A 4ANOA 3R1YA 1XQZA 2JKOA 2IEWA 2YHVA 4K6ZA 2X8EA 3SHEA 3ZLWA 4OTGA 4BL1A 4QTEA 2FH9A 3EN4A 1YVJA 5E8UA 4AXAA 2YDIA 3AC5A 4AW1A 1LEZA 3FKOA 3UC3A 4DEAA 1PF8A 3COMA 3LM5A 4IX4A 4BCNA 2XF0A 3GENA 5IUGA 3LQ3A 3EKNA 1SVEA 4D4RA 5K0XA 3FQSA 3WF8A 4FEVA 4BDGA 4EHGA 5C03A 5ANOA 2WOUA 1ZYJA 2JDVA 3I5NA 3V01A 3ZLYA 1V0BA 5I9WA 3KXGA 4D4VA 5L4QA 2XMYA 3I0OA 3VBXA 5IH4A 3UNZA 3OUNB 3O17A 1B6CB 1TVOA 1UWJA 2VWXA 3GCQA 5HNBA 3UNKA 3AC2A 3CD8A 3HDNA 2OI4X 3CQEA 3FHIA 4GSBA 3W0PA 2YIWA 2X81A 3DXNA 2YM5A 1UNLA 4JIAA 3CP9A 3F9NA 4DCEA 3DNDA 2PMIA 2OSCA 5IA5A 4MBJA 3CY2A 4QMLA 4C4HA 4FTUA 2XIXA 1E1VA 3KXNA 3UC4A 3VS4A 4AA5A 1Q8WA 4GKHA 2B52A 5EHLA 4I94A 3KMUA 2W1ZA 2G2IA 2R64A 4JS8A 4HCVA 4O0UA 4GYIA 1OL2A 3QWJA 3R6XA 2WFYA 3QKKA 4YBKA 5HX6A 5F4NA 3O0GA 4PNIA 3EHAA 1XH9A 3UVPA 5DEWA 4M69B 3FKNA 4DG0E 4DF3A 1CKJA 5F95A 3MPTA 1UU7A 3VS3A 4G5JA 5L6PA 3C5IA 3S1HA 4G9RA 4GVAA 2YAAA 3DJ6A 1OL1A 2R7BA 4PY1A 2WTJA 2OO8X 2V0DA 1Q8TA 1W7HA 2ERKA 4I4EA 5G1XA 1ZYSA 2HY0A 3UODA 2ZJWA 4AW2A 3FL5A 3MB7A 3W2SA 2B9HA 4BBFA 2YM8A 3AG9A 4I4FA 4RC2A 4C4FA 3E62A 2Z7RA 3PXRA 3NIZA 3WOWA 4IW0A 4XV2A 3O7LB 1K9AA 4UMPA 3C5UA 4XG6A 4MNEA 4JG6A 5DA3A 4AF3A 2WAJA 2J2IB 1H26A 3BLQA 4WHZA 2BMCA 3GFWA 3R00A 4BCHA 2CN8A 3S00A 5IQEA 3S95A 4BIEA 4QTDA 2BRBA 3R8VA 3NCZA 2QR8A 4RIWA 2VAGA 2F2UA 5IG1A 3C0GA 2PVJA 2QOIA 4G3CA 5FEDA 5E8TA 4ASDA 5CSPA 4O7VA 2WB8A 1UU9A 2X6EA 4AGDA 3HNGA 3VAPA 3BU3A 5IF1A 3MTFA 3H10A 5HG8A 4MH7A 5BX0A 5DNRA 4MF0A 2UZOA 4NEUA 3MFRA 1VZOA 4X3FC 4RWLA 2E9OA 3ORPA 5CI6A 4G5PA 3G0FA 4MX9A 2VZ6A 5DOSA 1U5RA 4FTMA 3V8TA 2YZLA 2GHGA 3E3PA 1O9UA 3F6XA 3VWAA 1OKZA 3D7ZA 4FIHA 4IACA 4D0WA 3DBFA 3REPA 3Q6UA 4DT8A 1YOJA 4ZK5A 4DCAA 3VHEA 3A7JA 2J9MA 3R2YA 4JQEA 4ZLYA 1TFFA 4W4WA 3HL7A 2I0VA 4QPSA 3P4KA 1GY3A 1URWA 2YLEA 5I3OA 2CGXA 3CPBA 3QU0A 4P90A 5CZIA 5L2QA 3SXRA 4B0GA 4C33A 2PTKA 3FJQE 3DKCA 4CLIA 4YTHA 2EB3A 2ONLA 2ZOQA 3SC1A 4EOQA 4HZRA 4IAKA 1YOMA 3ORTA 5IUIA 3OOGA 5KBRA 2C6MA 2HZIA 4JDHA 1YXSA 3FZSA 1GZNA 1Z5MA 4FEWA 3RMFA 4EQMA 3AKJA 3PJ2A 4I5CA 2DQ7X 4FE2A 2B54A 2VWYA 1APME 1ZWSA 3GNIB 3HDMA 4Y85A 5IPJA 3IW6A 2RGPA 2X2MA 3HMMA 2R3QA 4XG2A 2JDRA 2JBOA 3JVSA 3KXZA 3QKMA 5HHWA 3A2CA 4FEQA 4KRDA 3TZ8A 5JFSA 1YWVA 5EQYA 1PMNA 3QTQA 4GRBA 4QMUA 2CGUA 5JRSA 5FGKA 2YCFA 3AC3A 4PTGA 4X2FA 4BCJA 2RSVA 2YWPA 4I3ZA 3IOPA 3VHKA 4QP4A 3PFYA 3RNYA 2IW8A 1IASA 3GVUA 1J7LA 2J50A 4C8BA 1UKHA 2AEGA 2Y0AA 4IVBA 3CLYA 3QQHA 2JKQA 3OTVA 4PMTA 3L9MA 3L1SA 3KC3A 2W4KA 3MN3A 4LOPA 3DTCA 3DT1A 3NRMA 4WSYA 5KCVA 1Y57A 4FIFA 2RFSA 2YZAA 3LFNA 4ZY6A 4G3FA 1CKIA 4DAWA 1S9JA 4MWHA 4DTBA 5E8XA 1ZMVA 1KE7A 4RWKA 3NUYA 3TDWA 2R0IA 3GC0A 2ZV7A 4OTQA 4R3RA 5KZ0A 2BRGA 2QOBA 5GJDA 4DFLA 2PZIA 1SNUA 2HK5A 3PXFA 1Y8YA 2VNWA 4LV8A 4DN5A 4KIKB 1REKA 2RIOA 4XLIA 4USEA 5LOHA 3UZRA 5IA3A 4BTFA 3HMNA 1Q3WA 2WGJA 3BQCA 3RP9A 1K3AA 4DTAA 3MVLA 5I5ZA 5AR3A 4QPMA 3UDTA 4ITIA 3NUSA 5HICA 3NFFB 3VUTA 5KMKA 1Y6BA 3N4TA 4N57A 3TNWA 4HOKA 4ZTRA 2X9EA 3HRBA 4N4SA 4FOBA 4RBLA 2ITZA 5EM5A 4N6YA 5G6VA 2NRYA 3W2RA 3BIZA 4ZZOA 4LV7A 4GUEA 2XK7A 2XK8A 3FQHA 5CXHA 3KXXA 4H1MA 4E8AA 3RALA 1QL6A 4JQ7A 1MQBA 4NH1A 3QHWA 4EH2A 2PVFA 4RFZA 4EQCA 3QCQA 4WBOA 3RI1A 4FT3A 4UXLA 2W99B 5JN2A 3AT4A 3W0MA 4OR5A 5EH0A 5C01A 3UOLA 5CVHA 3HYHA 5DBXA 4F9YA 4KSQA 4EH8A 3EYHA 3BYVA 3R8LA 2FVDA 3W2QA 4F1MA 5HD4A 2W1EA 3DA6A 4QQ5A 5FBNC 3VULA 4QMWA 1S9IA 1ZXEA 1H25A 3TKHA 4CRLA 5HBHA