4BDCA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
303
structure length
283
Chain Sequence
SVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 283
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdcA01
1B39A 1STCE 4PTCA 3D2IA 5HKMA 3SDJA 3DQWA 4FV1A 4TTHB 2W5HA 3W2RA 2RG5A 3Q32A 1KV2A 4KIPA 3ZM4A 5KHWA 3C51A 4AOTA 3KXMA 2C5YA 3QTWA 3ZFYA 3GFEA 1F3MC 3ORLA 4S30A 3UIMA 5L2TA 5IQAA 5HGIA 4WA9A 3DPKA 3WBLA 3K2LA 4BCFA 3COHA 3MN3A 2UZEA 4YHFA 4R7BA 2GNJA 4IWQA 2OJIA 2QHNA 3MH2A 3QCXA 3GB2A 4M12A 4UMPA 3NIEA 2JKMA 3QLFA 4DFYA 5K5XA 1H1WA 4DLJA 3FDNA 4O82A 4HCTA 3R7YA 2R9SA 3OT3A 2XIXA 4OTDA 4FX3A 4JQ7A 4QO9A 2XK6A 3FMJA 5C26A 3U54A 3P86A 2X6DA 3DNDA 2BUJA 2VO6A 3NW6A 4LRJA 4Z16A 4ZZOA 3FI3A 2H34A 2W99B 1E1VA 3NUYA 1TKIA 3ZO3A 5CAUA 2XJ0A 2IVUA 4RVKA 2JITA 1BI7A 4W8DA 5E1EA 1Y6AA 2J5EA 3TZ9A 5EM6A 5HX8A 4I92A 2YIRA 3GI3A 3ORMA 3PSBA 2R3RA 3KULB 2DYLA 4RZWA 1XWSA 3FI4A 3DJ5A 3QXPA 1XH9A 4ASZA 4PY1A 4BDIA 2WTJA 4CKJA 4XV3A 3EFJA 5M06A 2C6DA 3I1AA 3QTUA 5IMEA 3DBFA 3NUNA 3ZMMA 4XJ0A 2BZKB 3NUSA 2EB2A 4C61A 4BCOA 5B2LA 3OS3A 4NJDA 4QMZA 1XO2B 4GEOA 4AZVA 3PIXA 4IACA 2YCRA 3NUUA 2GNIA 2O0UA 4BYJA 2I0VA 3II5A 4FIGA 4ENXA 3TWJA 1J1BA 1P14A 3Q4TA 1PXJA 4RJ6A 5BVNA 2W5BA 3C4FA 4O7SA 3KXGA 1Q97A 4GS6A 3UPXA 3V5PA 3R1YA 5B7VA 2Z7RA 3TIYA 3QX4A 4JOAA 2HXQA 4QP4A 4FTRA 4Y72A 2YM3A 4MYGA 3TT0A 4HVHA 1XH7A 5B0XA 3PPZA 3I5ZA 3QUEA 4LGGA 4YBJA 4EJ7A 4DH1A 3GENA 3AT2A 3RPRA 3CTJA 3UC3A 2VO7A 5M08A 4FSNA 1NVSA 1PXOA 3ORZA 4II5A 2ERKA 4PL3A 2HK5A 5FP5A 4IAFA 4F0IA 5IEVA 4IH8A 2VV9A 4JAIA 3PXFA 3CJFA 3F6XA 5G1XA 2WQNA 3SXRA 3LFSA 2R3KA 4YTCA 4G31A 4UMTA 4WG5A 5E8WA 2JFMA 1YHWA 2O63A 4HCUA 3TZMA 2VTIA 3EFWA 2JIIA 3D7TB 4BHNA 4O86A 2PK9A 2P3GX 2YITA 3DAKA 2C5OA 4QP9A 3JXWA 1JNKA 4DGOA 4UMUA 2IZSA 3OOGA 4QTEA 3OWPA 4IWOA 1R39A 3GFWA 3H9FA 3O7LD 1P4FA 3BHHA 3FJQE 3QKLA 2UW8A 4PDPA 4EOMA 5IQCA 2C69A 1DAWA 3V5JA 3C9WA 3NUXA 5AX3A 3O50A 4GW8A 5EFQA 4YO6A 3QTIA 5A4CA 4XYFA 4NK9A 1Q4LA 2OJFE 2BRNA 3HKOA 3ZLWA 3H0ZA 4JXFA 3UZPA 4X0MA 2SRCA 3OEFX 1H0WA 4IIRA 4RJ8A 3HMOA 4YLJA 5HVKA 2XB7A 4GG5A 3SQQA 3CY3A 4E4LA 5CU4A 4JQ8A 4AF3A 1PMVA 2PSQA 4FTOA 3T8OA 1Y6BA 3A8WA 3HMMA 3NR9A 4ACMA 2LGCA 3CP9A 4O7LA 4F6SA 4RC2A 1F5QA 1GZ8A 2W06A 3CBLA 2GSFA 1XH4A 2VWWA 4W8EA 2V7AA 3QC9A 3BIZA 4NYEA 2CLXA 4V04A 5CVHA 2X8EA 4B6LA 4CFUA 4HGSA 4HVSA 4NW5A 2J7TA 4XCUA 3HAMA 3UPZA 4YP8A 4O22A 4A4LA 1AQ1A 1MRYA 2F7ZE 4FNWA 2WMXA 2JDRA 4LUDA 2IZRA 2YHVA 3F82A 3JPVA 3M42A 3CJGA 5JH6A 2OK1A 3FLQA 3FY2A 5AP6A 2XIYA 4RJ7A 2QOCA 1JSTA 2PZPA 2XNMA 3MWUA 4G6LA 4I5HA 4WSQA 2IW6A 4G3CA 2VWVA 4IAYA 4F08A 4DFBA 4AA4A 4HPTE 4F7LA 1UNGA 2WO6A 1VR2A 3MH1A 3OCTA 1Q8ZA 4GJ2A 3RAIA 5M07A 4EWQA 2VTMA 3PIYA 4FV8A 5HG7A 4OAUC 4AAAA 2VWYA 1OIYA 3H3CA 2UZNA 3LFQA 4JVGA 3ALOA 4K1BA 4P5QA 4RIYB 3A8XA 5HLNA 5HTIA 3HP2A 2OF4A 1BLXA 4XV1A 3DK3A 4FSZA 4KIKA 2BKKA 2REIA 1GIHA 1URCA 1G5SA 4AQCA 4F6UA 1DAYA 1IASA 4FG8A 2PHKA 4UWCA 3B8QA 5FLFA 3POOA 5HE2A 4AT5A 4F9AA 5AV1A 4DBXA 2X8IA 1A06A 4YNOA 5AP4A 4BC6A 4JG7A 4L68A 2P2IA 4JR3A 4A9RA 3VBXA 3UODA 3U6IA 5GZ8A 4G3FA 4AN2A 1LEWA 4FZ6A 2XVDA 1UWHA 5CSVA 1I09A 4WG3A 3SG8A 5EDPA 4XOYA 4QT1A 4M66A 1W98A 3BYMA 4W4WA 4AN3A 4JDHA 3E88A 3K3JA 4GH2A 4F9WA 5LMKC 3NPCA 4IFCA 5EM7A 4KIKB 3W1FA 3OVVA 1CSNA 2O65A 5TO8A 4RC3A 3SC1A 4HGLA 3AC3A 4CV9A 5DG5A 2NO3A 2OF2A 3GCSA 5GIOE 3EQGA 4WD5A 3A99A 4AW0A 5FDXA 3R63A 4XBRA 3Q2JA 3QTXA 2R7BA 5A46A 3DZQA 2QOLA 4P4CA 5DR6A 3GCVA 3DTCA 2JDTA 4PQNA 3P5KA 1OIRA 4W4XA 4ASEA 4L42A 1WBSA 4AXAA 3E8DA 3H10A 3PXKA 4DFZE 2A4LA 2OGVA 3OP5A 3B8RA 1VJYA 2VWZA 4IC7A 4MKCA 4CT2A 4QYFA 5FG8A 3VUMA 3LKMA 5DWRA 5IEXA 4J53A 3ZC5A 1H1PA 1OL6A 2I1MA 3AD4A 5FEQA 4G6OA 5DE2A 3O7LB 3W16A 2YM5A 1ZYLA 4D1SA 3PSDA 5K3YA 4ZTLA 3QZIA 5E9EA 2JFLA 5AUVA 1K2PA 5AP0A 4EHZA 3Q3BA 5BPYA 4GUEA 2XK7A 2O5KA 3MVHA 4V0GA 4NCTA 3F2NA 3LM0A 4EH6A 4WT6A 4RSSA 5EM5A 3L9MA 4ANBA 4CGAA 4BVUA 4WSYA 3D83A 5E8VA 4UXQA 3RP9A 2ITTA 4TY1A 4YHJA 5A9UA 4I21A 3VC4A 3DLSA 4FV9A 5FXSA 3E5AA 1UNLA 5JK3A 3TM0A 3NVKI 4TW9A 5D7VA 3R73A 4WUAA 4AA5A 4FT3A 4BTFA 3FUPA 4KS7A 4PWNA 4N57A 4D2TA 4N6YA 3PJ2A 5HO8A 3KK8A 5JSMA 5IA1A 4V0GB 2HCKA 4ZY5A 3DK6A 4X6QC 4O0XA 4R5SA 4EYMA 5CU0A 1SNUA 3PVWA 4AW5A 3R21A 4FYOA 4AP7A 3LCOA 3ANQA 3CTHA 4EH4A 3BELA 1G8AA 3RCDA 3EIDA 4CMUA 2AUHA 2CN5A 3QKMA 5E92A 2NP8A 5HD7A 2VX0A 3ZSGA 3H9OA 3DKFA 3MFTA 3BEGA 4LG4A 5KMMA 3PTGA 4R77A 5KMOA 4FKQA 2FSTX 1CTPE 4JIKA 1CM8A 4FK3A 3RM7A 4I5PA 4HNFA 2B9IA 3NUPA 5IMXA 4J96A 4XBUA 4C3RA 2XJ1A 2V55A 2IJMA 3LCTA 4Z7HA 5AP2A 5CAPA 5HBJA 3V6SA 2GQGA 2H6DA 5E8TA 1DI9A 5LVNA 3MIYA 2ZYBA 3BV3A 2CKQA 3W2CA 4FNYA 3RAWA 3UGCA 3Q04A 3GCQA 2UV2A 4KB8A 4LV5A 4BBEA 5IH5A 3Q4CA 2PVKA 3WILA 3ZFMA 3B2WA 1BKXA 1JVPP 3P7AA 4IX5A 4LMUA 4EK4A 3FKLA 1Q5KA 3MSSA 3OROA 5T68A 5AA9A 3JR1A 5DOSA 2PVNA 3DKGA 3BQRA 5M4FA 1ZYJA 4MXCA 2EWAA 3PXZA 1YDSE 3C7QA 4FZ7A 4C4JA 3D5XA 3C4XA 2ZMDA 5LMKA 5GINE 3BGQA 4D0XA 3ZZWA 2XYNA 1LR4A 3S0OA 1FOTA 3PIZA 1M7QA 4K77A 2HW7A 4XG8A 4C4HA 3MTLA 5BVKA 1H1QA 5KO1A 3OWKA 3PY0A 4YC8A 5L3AA 3LM5A 2P2HA 3JVSA 3P78A 4HZSA 4HYSA 3ZLXA 2C0TA 2DUVA 2GTNA 2BIYA 3DB6A 4U41A 3R2BA 5AA8A 3OZ6A 5FD2A 3HV6A 1ZAOA 3R7GA 4HYUA 3FY0A 3LFNA 4A7CA 3BE9A 1Q3WA 3BYOA 3ENMA 3FMHA 2IN6A 4QPSA 4ZTQA 3UIBA 4DG2E 5CEMA 4QP2A 4J71A 4YPDA 4CFNA 4FG7A 5FBOA 3H30A 3QQLA 4CSVA 1U4DA 4BHZA 3I79A 1UU3A 4FV3A 2PVMA 4KRDA 2VU3A 3GP0A 4CFMA 2XA4A 2VAGA 4AGUA 3MY0A 3D4QA 3OWJA 2NRYA 3KF4A 5HQ0A 2HW6A 4FV4A 3WOWA 1ZOHA 3ZO1A 4PPBA 4OTHA 3TJDA 2XK4A 4X3FA 3KVXA 2E9NA 2YWVA 5CU2A 3CPCA 3V8TA 4FKWA 1PJKA 1QPDA 3CXWA 2WMUA 3AC2A 2P55A 2R5TA 3FLWA 4MXZA 4PDYA 5DFPA 3CQWA 4QMSA 3VBWA 3NYNA 4O2PA 5BVEA 1OL1A 4BTJA 5KMLA 5J1WA 5EQEA 1OKVA 4L45A 2ITXA 3UBDA 4LQMA 3UQGA 5CF8A 4X3FB 5A4EA 5IA2A 2PVFA 1UU8A 4RA5A 4FTCA 3HP5A 1SYKA 3QYWA 2JKOA 2QOIA 3UTOA 4IWDA 3HAVA 3I0OA 4JX3A 2FYSA 3LFEA 4J99A 5CEOA 3W32A 1O9UA 5M44A 4X21A 3Q9ZA 3WF7A 4ZAUA 2ITVA 4WG4A 3C0HA 4Q9ZA 4GVAA 4OTGA 3UIXA 1U59A 5IA5A 4F64A 2WMWA 2YDJA 4FYNA 5FTQA 5IA3A 3RK9A 1ZXEA 3EFLA 4QP7A 1A9UA 3WF5A 1ZWSA 3ZEPA 5DNRA 5JQ5A 1OUYA 3IW5A 3W10A 2XKCA 4XG4A 5IA0A 2VGPA 4MXOA 4WUNA 4Y5HA 3BHUA 3EZVA 3WF9A 5J9YA 3W2PA 3CTQA 2ZJWA 4O0WA 3AD6A 3ANRA 2XK3A 3RHXA 1J7LA 4YJUA 5FUTA 4ONAA 5F4NA 5HE1A 4O83A 4DTAA 1YI4A 4EL9A 4OUCA 4I93A 4M13A 1IG1A 3I0QA 5AFVA 3QTRA 3FPMA 2WFYA 4OBQA 1XR1A 5HBEA 5K0XA 3RALA 4DFUA 3MFUA 4L3LA 1ZZLA 2BVAA 4XV9A 5H2UA 1LEZA 1U5RA 1WVWA 3NRMA 4IVBA 4JI9A 2CKOA 5A54A 4EOLA 4EH7A 4GJ3A 1Q24A 2BRMA 2WNTA 3F2AA 4NM3A 1SM2A 4FSYA 4AT3A 5LMBA 1MP8A 2C6KA 2CGUA 1ZMWA 4NEUA 4RIXA 3VVHA 2JIVA 4AW2A 4C7TA 2HIWA 3HV4A 3TTIA 3LW0A 3F3VA 3NZ0A 4XS2A 4CTCA 3BGPA 5EI8A 4K6ZA 4ZTRA 5CEQA 2JBPA 3OXTA 4HVDA 3DQXA 2ITNA 4CFVA 5KCVA 4MBJA 5EM8A 5CAOA 3FI8A 3ACKA 3KMUA 3WIGA 4DINA 2BZJA 5CF5A 3T3UA 5CS6A 2QG5A 3FZPA 4DH3A 4GCJA 3PG3A 2YLFA 4GU9A 4E6DA 4IEBA 4K11A 2F57A 3R1SA 4FV5A 3C0IA 1ZYSA 4CMTA 5CNNA 5IQFA 4C57A 4ERWA 5ANKA 2C0IA 4CNHA 5HD4A 4M8TA 3VUHA 3ROYA 3HMIA 2WMRA 2WQMA 3HRFA 3OW3A 4WBBB 4S32A 4O1PA 2UW4A 3A2CA 3RNIA 4B8LA 4P5ZA 5E91A 5DMZA 5EOBA 3RI1A 3GU7A 3COIA 5CLPA 2YIYA 3VHEA 1CMKE 3ZDIA 3Q6UA 5BUIA 3FHRA 3LFCA 3GBZA 3IDBA 4HGTA 4WNPA 4O7ZA 5M55A 2CPKE 2RFNA 4CG9A 4YJOA 4MNEA 2YJSA 3JUHA 4F65A 2OH0E 3MY5A 3WYYA 4EYJA 4FTIA 2CNVA 4TWOA 2YACA 4NWMA 3VWAA 4A4XA 2WTKB 2YM7A 3GVUA 3N4TA 1CKJA 3O2MA 3TZ8A 4PMPA 4IB1A 4RWIA 1OGUA 2YIQA 4FL1A 4N4SA 4FNZA 3LMGA 3LXPA 3QHWA 5HCZA 4D4RA 3Q9YA 3HEGA 3R9NA 2GNLA 3F3UA 1X8BA 4MQ2A 2ZVAA 2IVSA 5FDPA 2R2PA 4MNEB 4DGNA 2OO8X 4BN1A 3KRXA 3NWWA 3I7CA 4ANNA 4D4SA 2IZTA 3BPRA 3OF0A 5J8IA 3CLYA 4B7TA 3CS9A 5M4CA 4KD1A 5J7BA 1PYEA 5TF9A 2I0YA 3E7VA 4IZYA 4D4VA 2H8HA 5BVFA 4GIHA 3LXLA 2VNYA 3OT8A 4FSTA 4KAOA 2PUUA 3TNHA 2I6LA 4CRLA 1XH5A 2VUWA 3ZXZA 4U9AA 3A7FA 2ACXA 2XCHA 4FKUA 4BDEA 4XOZA 3ORKA 3UDBA 3N4VA 3AT3A 3TCPA 4AW1A 1V0PA 3W18A 3ZSHA 4PPAA 3HV5A 5CVFA 3G9NA 3KXNA 2R3NA 4F70A 4I4FA 3R8UA 2GS7A 5ETFA 2PMLX 4FV6A 4EC8A 4UYNA 3TV6A 3NW7A 4BDDA 3MGYA 4BR3A 3F5UA 3VBQA 3P79A 4G9RA 4I3ZA 1YDTE 4CVAA 5H8BA 3ID6C 3KCFA 1XJDA 4B8MA 4DLIA 1PXKA 4RQVA 3VAPA 2X4FA 3VNTA 5CXHA 3L1SA 5AEPA 3ZS5A 3WIKA 5LWMA 1Q8WA 2XM8A 4I6BA 4QQJA 3TKUA 4EZ7A 5E8XA 2FGIA 3F3TA 4J95A 4O0TA 3PJ8A 3PJ1A 4BDGA 4R78A 1GJOA 4EC9A 3KKVA 4C4EA 2BRBA 4OR5A 5CNOA 3VS6A 2VTAA 2OWBA 3FKOA 1TVOA 4FT5A 4LGHA 5F95A 4CKRA 3DNEA 4R7IA 2YIXA 3GOPA 2QHMA 3MFSA 5E8SA 4ZTMA 4F7JA 2F9GA 4U42A 3C4CA 4IZ7A 4DE4A 1B38A 3OCBA 3Q5ZA 4YJSA 4EBVA 1BL6A 4GFMA 5AAFA 1YXTA 1OZ1A 4QMUA 4EH9A 2XIZA 3EOCA 3OY1A 5T3QA 4RBLA 3ZXTA 2CGXA 3GGFA 3GUBA 1GAGA 2W96B 4C37A 4D2VA 3QU0A 3G6HA 4NU1A 3OFMA 4KRCA 3BE2A 2B9FA 3NLBA 4DYMA 4C33A 3UNJA 2PWLA 4RC4A 2EXMA 2J90A 3OBGA 2GPHA 5DGZA 4O1OA 4O91A 3O8UA 4O6LA 1OKYA 4IX6A 2C30A 4E93A 3QD2B 4WO5A 4L3JA 5EKNA 5K4IA 5HCXA 3Q2MA 3TNWA 4D55A 5AWMA 1T46A 1XH8A 3G5DA 5LXMA 5AR2A 3G0EA 1Y91A 4QPMA 4ENYA 3AMAA 3H0YA 2RL5A 2IVTA 1WFCA 4S31A 4ZS4A 2B4SB 3OOMA 1PXIA 2CDZA 5TKDA 3EYGA 4D2PA 4ZZNA 1IR3A 5HTBA 1WVYA 4PNIA 1WBVA 3ERKA 4OBPA 4CCBA 4OTWA 2IWIA 2VTPA 1NVRA 2VWXA 3FLSA 5E8YA 3F5PA 2C68A 1GIIA 1R0EA 4E8AA 3KRWA 4IW0A 3D5UA 3SRVB 4MF0A 4BYIA 3SAYA 2GCDA 3A62A 3PA3A 4IDTA 2C3JA 3OG7A 3PXQA 5C8NA 5C01A 2X1NA 1SVEA 3HNGA 3IOKA 3NNVA 4IZ5A 4LMNA 2W4OA 4PMTA 5ANDA 4C2VA 3ROCA 3RM6A 3E8EA 4USEA 3HGKA 5CI6A 3GC0A 3V8SA 4J1RA 4X7QA 2JBOA 3KRLA 3PYYA 1PXPA 4DCEA 1GY3A 4YJRA 3TKHA 2F2UA 5JFVA 4R5YA 3KULA 4A06A 5GJFA 3ITZA 4QTDA 3CD3A 4KIQA 4IVCA 5T6KA 3WF8A 1ZMUA 2BHEA 2WOUA 3QXOA 5FEEA 3RK7A 5AADA 2OI4X 5L2SA 2W0JA 1QCFA 3CSVA 4GV1A 4TNDA 4EI4A 2FVDA 3ZLYA 3DTWA 4MXXA 5LQFA 3BWFA 4AOIA 3L8PA 5BUJA 2VWIA 4IJ9A 4L6QA 4RQKA 1SNXA 4BDCA 3DT1A 4ZTSA 4EUTA 3F61A 5ETCA 2AC3A 3Q5IA 4N6ZA 2BR1A 2RG6A 5IU2A 4AZFA 3LVPA 4AZTA 3UNZA 3HUBA 4GFOA 1XHAA 4Y95A 4LFIA 3E92A 2CNQA 3RPVA 4D5KA 1V1KA 4EZ5A 3PLAE 2PUNA 4JDKA 2IO6A 2VTNA 5CT7A 4ZOGA 3QRJA 4UV0A 5HEZA 2ZM1A 4BI2A 4KUJA 4NUSA 3MVMA 4FKGA 5JN2A 2YZLA 3LFFA 2BRGA 3LPBA 3LAUA 4PNKA 4IAZA 2BPMA 2Y6MA 5KZIA 4MNFA 2QNJA 1P5EA 5J5SA 3WI6A 3CE3A 4V05A 1B6CB 2W9FB 3FMEA 3WZEA 3PRFA 3DFCB 4C3FA 3BLQA 3D7TA 5TOZA 4OAVB 3VF8A 4IXPA 3D94A 3E7OA 1XKKA 4RJ4A 5ANOA 4YZNA 4HYHA 4XV2A 5E8ZA 3A7HA 3AMYA 3PUPA 2WZJA 4KKGA 1J7IA 3FZSA 5JEBA 4FVRA 2FSOX 3FHIA 2QKWB 3UOHA 3LQ5A 3BZ3A 4I20A 4K2RA 2BRHA 1M2RA 2VTHA 4LI5A 3SV0A 4AE6A 4C35A 4JLCA 1REKA 3JVRA 3LJ2A 5C03A 4Q5EA 3I81A 3VBVA 4EKLA 4AZWA 3M11A 4BBMA 2ETRA 5DBXA 3NUAA 1XBAA 2XIKA 2ITZA 2YDIA 2OIQA 4TPTA 4TL0A 5CASA 4DEGA 3FMNA 4YMJA 2W5AA 3QTZA 3G6GA 5K9IA 2X4ZA 3LJ0A 3WE8A 2XNPA 1Q99A 3OXZA 4FG9A 4RA4A 4I0SA 3NAXA 4L3PA 4QRCA 4QTBA 5FWKK 2R3IA 2YWPA 4OGRA 4BY9E 2I7QA 4BCIA 1O6KA 3DY7A 4IVAA 4NCTC 1M52A 3UZTA 3EQDA 2BZHB 4E1ZA 3TDWA 4WNOA 3IGGA 4IM2A 3DBEA 4EUUA 2R3FA 2YCSA 3T3VA 4QMXA 3UQCA 5ACBC 2YABA 4LOQA 4Q2AA 4CYIA 5ANJA 4FSWA 4W9WA 2CJMA 1HOWA 3TNIA 3HA6A 3UO4A 4DEDA 4EK6A 3DXQA 2W4JA 2HZ0A 4C8BA 5KMJA 5KKRB 2CCHA 5E7RA 2PE1A 2QO2A 3AQVA 3PJCA 4DEEA 4FT0A 4HGEA 4LV8A 3GEQA 5I3OA 1FMKA 4YURA 3SLSA 3HRCA 4GT5A 3PP1A 5IA4A 3R2YA 5DLSA 5KNJA 3AGMA 1WBPA 5EYMA 2VX3A 3FSFA 3R9HA 4MX9A 4TWNA 3MIAA 5EW3A 4ITHA 4RIYA 2B9HA 3PSCA 3R6XA 4DFNA 1OITA 3NNXA 4FK6A 4KBAA 1G3NA 4HW7A 3PVGA 1ZYDA 2ETMA 3OY3A 3R71A 4TKSA 3U55A 3BHVA 3F69A 1YDRE 2IZUA 4PL4A 5ETAA 3RHKA 4EJNA 3F66A 4IM0A 3T9TA 3ZDUA 1QPJA 5I4NA 5DI1A 3R7IA 3TN8A 3VUTA 2X9FA 2G2HA 4H3QA 5J87A 3L9NA 2IVVA 2VO3A 2XNGA 4WNMA 5JFWA 4FA2A 3LMIA 5FTGA 3SOCA 4RX7A 3UVPA 2QOFA 4N0SA 4F1TA 3N9XA 3O71A 3JYAA 4YSMA 3QZFA 4U44A 2NPQA 4PF4A 3H9RA 4L01A 4ZSAA 3N4UA 4CV8A 2C6OA 3HLLA 2WB8A 3JS2A 3TXOA 5J5TA 3RPOA 3NMUF 2QONA 3NW5A 3CR0A 2NRUA 4U3YA 4DTKA 3DAJA 4IAKA 4KINA 4BGQA 4FUYA 4ACDA 1OKWA 4S33A 4DG3E 5ITAA 5M4UA 3S4QA 5A4QA 4QMMA 3CGFA 2YM8A 3O51A 4QNYA 1DI8A 4C58A 2XBAA 3KXZA 4FKJA 4IANA 4WIHA 3POZA 3HUCA 1NVQA 1W83A 4RGJA 3KA0A 1JWHA 4EOOA 1PF8A 2X7GA 3QRIA 5ETIA 3UC4A 3VQHA 5AUYA 4BI0A 5KZ0A 4DN5A 4YZMA 3BEAA 3EH9A 1H27A 3R7VA 3TACA 3EWHA 1H08A 5CEPA 3MYGA 2GNHA 1VYZA 3BI6A 4O0VA 2J4ZA 5BMMA 1IAHA 2I0EA 3CKXA 4JIAA 4EH2A 4O7RA 2OW3A 5KMNA 5CEKA 4TNBA 2JKQA 2W1DA 2PMIA 3FLYA 3DAEA 3FWQA 4CCUA 5AMNA 3D14A 4ZY6A 3CEKA 3QQUA 4IBMA 3SX9A 1JAMA 4WKQA 3PLSA 4GIIA 4RJ5A 3ZYAA 1KUTA 4QP1A 4ZJVA 3DBCA 5DH3A 1MRUA 3VW8A 3SGCA 2Q0NA 2YLEA 4A4OA 2C3IB 5EKOA 3R7EA 5IQEA 3LIJA 4TYHA 2Y8OA 3K5VA 1P4OA 4PMMA 5CQWA 5KBQA 4AACA 4E4NA 3SW7A 2YIWA 3GXLA 4TWPA 4X3FC 2PZYA 1PKDA 5JGAA 1WMKA 2J0JA 4NJ3A 2UZUE 2JC6A 3AT4A 1J7UA 2R3HA 3FYJX 3K3IA 4R7HA 4CKIA 5LVPA 5DRBA 4XG7A 3ZO2A 4RFYA 3RINA 3OMVA 3R1NA 3MVLA 4X2NA 5IQHA 1JKLA 2VN9A 2QU5A 2XRWA 3OD6X 4HJOA 3ORPA 4TYHB 4U43A 4UEUA 4YJVA 5GJGA 2ZAZA 1R78A 4EBWA 1S9IA 3IDCA 2B1PA 2V22A 1Q8TA 5CI7A 2CSNA 3VUGA 4F0GA 1H0VA 3ORNA 4FIJA 2OJGA 4FV2A 4C4GA 1H4LA 1U46A 5I0BA 3KXXA 3OTUA 3QF9A 5HICA 1H25A 3C13A 3I7BA 3THBA 4EEVA 2Y9QA 4L7SA 3BLHA 4I41A 4CQEA 5CVGA 4FKOA 4G5JA 2A2AA 3FI2A 3QTQA 3PFQA 5KBRA 2WU7A 1FVRA 3N51A 5K0KA 2FUMA 2C6EA 5HLWA 2WPAA 3QQGA 4HPUE 5HLPA 1H07A 3DDPA 5C4KA 5CSHA 3DLZA 5DVRA 5AAGA 4O7TA 4XRJA 5M09A 4GK4A 4U3ZA 3QQFA 2WTVA 3QCQA 3LXKA 1E1XA 3PY3A 4M7IA 5CXZA 4GL9A 5HX6A 1YWNA 2XKDA 4LM5A 4RPVA 5D1JA 4C34A 4M69B 3G90X 4P7EA 2XEYA 2ONLA 2Y6OA 3DXNA 3DJ6A 1PW2A 1U5QA 1PHKA 2A0CX 4ZP5A 4AFJA 4PDSA 4IFGA 4JRNA 2GMXA 2VWUA 4KNBA 5ACKA 4FSRA 3OHTA 1R0PA 2E2BA 4OLIA 3MA3A 4C02A 3AGLA 3FZOA 2J0KA 3RWQA 2VGOA 4BCQA 3KREA 3MY1A 4FIIA 4H36A 3BCEA 1FINA 3TKIA 4BB4A 5J9ZA 3SKCA 4CZYB 4BDHA 4FEUA 4I6HA 5EHLA 5IZFA 2X0GA 4PP7A 4CRSA 4AG8A 4YR8A 5I9UA 4NTTA 2XBJA 5CTPA 4F9YA 1KE7A 5CAVA 3TNPC 5A4LA 2CNUA 2UZOA 2HZNA 2E9OA 2HWPA 4FC0A 5AUWA 4CYJA 5JQ8A 1OBGA 5LOHA 3E8NA 3FMKA 1MUOA 4BCJA 5IUHA 1H24A 5BMSA 3RKBA 5HIEA 2BAJA 3PXYA 4PDOA 3MV5A 4RX8A 4C59A 2PULA 5GNKA 2UZWE 1XBBA 3FZ1A 5FGKA 3TG1A 4DEHA 3PP0A 5BYZA 2BCJA 3MPTA 5CSWA 2VTJA 4FICA 5EH0A 2F7XE 3UP2A 5F94A 1PRYA 4YC6A 3RZBA 3RWPA 5AP7A 5JGDA 2BALA 3QD3A 4F9BA 3R01A 4J8MA 4YJTA 4IC8A 3NYVA 4U8ZA 3DKCA 3K54A 3MESA 2PPQA 4U81A 1JSUA 3OEZA 5CU6A 3RVGA 3D2KA 4UMQA 4EOJA 5JT2A 2R3MA 3F5XA 3CGOA 3L8SA 3QTSA 4EOPA 4HNIA 4MK0A 4X6RA 2JKKA 4AZEA 1Q3DA 4DH5A 3CQEA 3EN7A 3IW4A 4MTAA 2WAJA 4X2GA 2B52A 3EMGA 4XNEA 2WKMA 2WTKC 4H05A 5IG1A 4ZZMA 4DFLA 4NW6A 2EUFB 3R8MA 3Q4ZA 3HYHA 3LFDA 5M4IA 3LLAA 4JR7A 4J7BA 3S1HA 3VUKA 4ALUA 4Z3VA 4A9TA 4YUQA 3QQJA 2X2MA 5FQDC 1VYWA 1I44A 4AGDA 4QMTA 1DS5A 2JIUA 2B54A 4BCHA 2EU9A 1ATPE 4U0IA 2QLQA 2G15A 4WHZA 1KV1A 4XP2A 1K3AA 4C3PA 5IQBA 1QPCA 4UZDA 2GS6A 2OU7A 1PMEA 2Z7LA 4I5CA 2AYPA 2R0IA 2EB3A 5JZJA 1OM1A 4H39A 1OBDA 5FEDA 4I94A 4MBIA 3OUKA 2VO0A 1BUHA 4RWKA 1F0QA 5IQGA 4FI1A 1GIJA 1LPUA 3A7IA 4R3PA 2OLCA 2B0QA 4J97A 4TZRA 4XHKB 4BDKA 4CQGA 4ACHA 4IHPA 4CFXA 2VTLA 3FMLA 2XJ2A 3IPHA 4AU8A 2XNEA 3O96A 2X9EA 4I6QA 5FP6A 5CENA 3QL8A 5LVOA 2WEVA 2QOBA 5BUEA 4BZOA 3ALNA 3OC1A 5HCYA 5AR7A 4I23A 3OW4A 1Q8YA 3L9PA 3PZEA 4BFMA 4D4YA 2J2IB 4CFFA 5IPJA 4I4EA 4J52A 4BZNA 5DHJA 2JEDA 3PXRA 2J5FA 3A61A 4G3GA 5HESA 4ANQA 4CEGA 2YCFA 3A7JA 5H3QA 3QBNA 4YPSA 2PZ5A 2DS1A 4NM0A 3DA6A 1H00A 3RK5A 4AFEA 2ITYA 1AD5A 5A14A 3NNWA 4E5AX 5L6WL 4BWXA 2FSLX 3BV2A 3AG9A 4QQCA 1UU9A 5AR5A 4D58A 4IB5A 1SMHA 2QOQA 4FGBA 2OXXA 2XH5A 4Z9LA 2WELA 2HY81 3O17A 3R00A 5IDNA 2ITUA 5KUPA 4G9CA 2YN8A 2XUUA 3IGOA 1WBTA 3SA0A 3MJ2A 1WBOA 4FSUA 2BDFA 4G6NA 4EHGA 1OL7A 4FBXA 5E90A 5F1ZA 4CD0A 4FGRA 1MRVA 2JD5A 1JSVA 4ANSA 1GZKA 4FKVA 2QVSE 4FT7A 5K5NA 4RZVA 2YJRA 2QURA 3CPBA 3NYXA 2CHLA 1PMNA 3F7ZA 4TN6A 3ZCLA 5AAEA 2LAVA 5GZ9A 2BFYA 4M67A 4NIFB 4DCAA 3JY9A 5B2KA 3P0MA 3QQKA 3LJ1A 4UBAA 3BWJA 4E3CA 4I1ZA 2XMYA 4FTLA 4F99A 4L9IA 2WMQA 4YTIA 3TEIA 2OZAB 3HX4A 3NGAA 4GU6A 3RAKA 4ZJJA 5HG8A 1H8FA 3FMMA 2JDSA 3NCGA 2OIBA 3NCZA 3R83A 4IADA 5M56A 3KRJA 4L52A 1YKRA 1XH6A 2B53A 2R3PA 2YCQA 4TWCA 2V7OA 3F9NA 4O7VA 4U97A 4TYIA 5G6VA 1IA9A 2V5QA 1BI8A 1PMUA 4CXAA 5IH4A 5LCJA 5J9LA 2GU8A 1Z5MA 2C6MA 4J8NA 4MF1A 5GHVA 4U79A 4EOQA 1XBCA 5I9YA 4QMOA 3HL7A 3KCKA 1ND4A 2XP2A 3C50A 2C3KA 3UOKA 4M0ZA 4R6VA 4NKSA 1PXNA 3VW6A 1PKGA 2CKEA 1P2AA 4DAWA 3KL8A 4IMYA 5AM6A 3UO5A 2EXCX 1RDQE 3GU8A 2UW9A 3O0GA 3GC8A 4KKEA 4QTCA 4EWHA 3JY0A 2FSMX 3QWKA 4OW8A 4EHVA 2EVAA 4ZEGA 3WE4A 3IDPA 2Y4IB 4DA5A 4RMZA 2BKZA 2VX1A 1DM2A 2PZIA 4E5WA 4FL2A 5HIDA 4NM5A 3C0GA 1H28A 4RFZA 3R9DA 2GHMA 4DGLC 3RGFA 4JBOA 2YM6A 2PVHA 5HO6A 3FL4A 3U87A 4ORKA 4KABA 1KOAA 1YQJA 2ITWA 1UKHA 4GKIA 4NFMA 2ZM3A 1HCKA 2W1IA 3QA0A 1JPAA 1O6YA 2WMBA 3DOGA 3QWJA 5CWZA 2XEZA 4Y73A 5AUXA 3TV4A 3I4BA 4GKHA 3KEXA 1OVEA 2OH4A 4C36A 4E6CA 2XK8A 2WMAA 2R7IA 5EQPA 5I3RA 3P23A 2BMCA 1FVVA 2UZDA 2QU6A 5DT4A 5JMSA 4XLIA 1R3CA 2OKRA 4H3PA 3NVMB 1KWPA 4O7YA 3S3IA 2G1TA 3UVQA 4FTKA 4FTJA 4O0YA 1UU7A 4ZXTA 1TQPA 4U6RA 3KFAA 3PPJA 4IAIA 1KOBA 2J0MB 3MBLA 5BYLA 4ZJIA 2HYYA 3T9IA 5C9CA 2XM9A 1WBNA 3FQSA 3MPAA 2C6LA 4RWLA 3R8ZA 1PXMA 2Y0AA 4PV0A 5IF1A 5HG5A 3CC6A 2WTCA 3KN6A 4FKIA 3BBTB 1JBPE 4RRVA 3FZRA 4X2KA 5HG9A 2YA9A 2C3LA 1QMZA 2VD5A 3HV7A 4AT4A 4G16A 5CT0A 4ASDA 3IW6A 2CKPA 3ZU7A 5J79A 2X8DA 3IG7A 2Z60A 3VRZA 4P90A 2HAKA 4Y5QA 3LE6A 4HYIA 3L9LA 5K4JA 4X2FA 1WCCA 3QYZA 1OL5A 3UYTA 2JDVA 3LXNA 1RQQA 1NW1A 3BHYA 1IEPA 3Q52A 2XCKA 4YZBA 4O0SA 3AOXA 2F49A 2ITOA 5L6OA 4H1JA 4F0FA 2E9VA 3VS0A 2PZRA 5KX8A 1UKIA 4RIOA 2O8YA 2YDKA 3EN4A 3FXXA 4S2ZA 1T45A 5A4TA 2XF0A 3R8VA 1YXSA 4KBKA 3MTFA 3QAME 4CLIA 2Y4PA 1LP4A 4U80A 5EW9A 5AJQA 3V6RA 4KA3A 4O81A 3ORTA 1UA2A 5HHWA 3V5WA 4C0TA 3KRRA 4FKLA 4JQEA 4YLKA 4ZLYA 5CSXA 5AR4A 3ZONA 4V01A 3AC4A 2ZDTA 4I24A 3SXSA 3UOJA 5TE0A 1R1WA 1U54A 3LLTA 4FODA 2RFSA 5EW8A 3SRVA 2WXVA 3HV3A 5KKRC 1PYXA 3O23A 2QKRA 3VF9A 3LQ3A 3PDTA 5LVMA 3FQEA 4MAOA 3I6UA 5I9VA 4BI1A 4D5HA 4E6QA 3U4WA 3OTVA 3CIKA 3IW8A 5E8UA 4WRSA 3QKKA 1NY3A 2QR8A 4EK5A 1W84A 2WTIA 1IA8A 1URWA 4RLKA 4EH8A 3VQUA 5BVDA 3ZUTA 2C5VA 2QOOA 2BAKA 4IDVA 4NM7A 4EZ3A 1U54B 3PPKA 4FV7A 4O6EA 3E64A 4TYGA 2PVYA 3ZOSA 5BVOA 5J1VA 4C4FA 3C4WA 4K0YA 3UO6A 1Y57A 2JDOA 3E63A 1YOLA 4DEBA 3EHAA 4O27B 4ERKA 2W17A 4BBFA 3LZBA 2OFUA 1IAJA 2EXEA 4OTIA 2BDJA 3UOLA 2PTKA 3EB0A 1OPJA 2V62A 4JAJA 4KKHA 2AC5A 4M97A 3TV7A 2R64A 3PE2A 4DF3A 2OJJA 3HZTA 2KULA 2R3JA 3QUPA 4YZCA 5EQYA 3LCSA 3ATTA 1L8TA 3HVCA 3IK3A 4U40A 4EQMA 3VULA 4XG9A 2VNWA 5CZHA 3ULIA 4ZY4A 2A1AB 1APME 1MQ4A 3BU3A 5I9WA 4NH1A 4WRGA 3D7ZA 2RIOA 4L00A 2W4KA 4D0WA 2VTQA 4L8MA 2ETKA 4Q9SA 3B2TA 3FBVA 4M14A 3A7GA 3OCSA 3WZKA 1WBWA 3EN6A 5I9ZA 4QMLA 5AM7A 4TXCA 1KE5A 1H26A 2G01A 3RAHA 3V8WA 4MD9E 4KWPA 2A27A 2QD9A 4G17A 2WTDA 1FQ1B 2B7AA 5CY3A 2HWOA 2Z7QA 3U51A 4BCKA 4FTTA 3ZHPC 2WQBA 1ZZ2A 3MA6A 5HI2A 4K9YA 4XG3A 3PVUA 4IB3A 3P7CA 4L46A 4L7FA 2J51A 2PMNX 3GCUA 3V3VA 3AC1A 3M2WA 3U4UA 5AIKA 4ANOA 3FEGA 3FC1X 4QP6A 4O0RA 3COKA 2PVRA 3R9OA 3PWDA 2HZIA 3ZUUA 5IUIA 5FM2A 3KMWA 4DGMA 3IO7A 4OTPA 4RLLA 3D0EA 4DT9A 3CCNA 2XKFA 3LCDA 4JRVA 1TQIA 4AOJA 4Y85A 4MD7E 2WGJA 5BYYA 3ZZEA 3VS7A 1KE6A 4XP3A 3RCJA 5L8JA 1RJBA 1TQMA 4LRKA 4EH3A 3A4OX 3MS9A 4W4VA 3OUNB 4M84A 4ACGA 4AGWA 5M53A 1QPEA 2BDWA 5C27A 3W33A 4IZAA 1AGWA 5E4HA 4I5MA 3R02A 4MVFA 3LFAA 3QRKA 4EONA 3I60A 1YI3A 4QYHA 1K9AA 5DT0A 4ZTHA 2WMVA 3BQCA 3BX5A 4KBCA 1L3RE 3KY2A 3MJ1A 3KB7A 2GFSA 2JAVA 3GOKA 4YU2A 4A9UA 3OWLA 1RW8A 4L44A 4O38A 4QYGA 4F1MA 4DH8A 5F9EA 2YERA 1YWRA 4JJRA 3Q6WA 3RZFA 4EHEA 1HCLA 4R8QA 4IE9A 2Z7SA 1SVGA 5GIPE 2WD1A 4QOXA 3E87A 3FE3A 4I0TA 3C5UA 3C5IA 2HELA 2J0LA 2ZV7A 2NNWB 5FRIA 4NSTA 2WIHA 5AUZA 4O7NA 3PWYA 1GZOA 3TI1A 3DXPA 4QMNA 2WMSA 3IW7A 4XG6A 4FNXA 1KE9A 4EKKA 3EFKA 4PUZA 1YRPA 5M51A 4BDFA 3R04A 4APPA 4E73A 2X39A 4DG0E 3FLZA 3UNKA 2PUIA 3FKNA 2ZB1A 2PE2A 1OMWA 1OIQA 5IKWA 2QI8A 3DS6A 3V01A 1XQZA 5AX9A 3REPA 2W9ZB 1W0XC 3QZHA 3Q60A 4RVLA 3UVRA 1JKKA 4ZMFA 2BTRA 3ZBFA 2YISA 1H01A 3S00A 2ITQA 4L43A 3SVVA 2CCIA 2C1AA 3G33A 4FR4A 2QODA 4PMSA 2WQEA 3DU8A 4E5BA 2I40A 2VTTA 4TYJA 4MD8E 2R4BA 4NTSA 4ITIA 2X7FA 4PX6A 4BGHA 1J1CA 2I0HA 4YJPA 2R3QA 3LOKA 3Q53A 4RT7A 2FB8A 4QD6A 4YC3A 2WOTA 5FBNC 4BIBA 4DH7A 3TUBA 3RNYA 3CKWA 1RE8A 4UZHA 4R1YA 4PRJA 1IRKA 3PJ3A 4AWIA 4JT3A 3TIZA 4A9YA 1NT2A 3CD8A 3FC2A 2GQRA 5CU3A 1YXVA 2ONLC 2DQ7X 4FKPA 3EYHA 4LGDA 4GT4A 4JG6A 4R3CA 2J0IA 4BKZA 3UG1A 4HVIA 3ORIA 2JLDA 3QGWA 2GS2A 3TUCA 3PE1A 3KF7A 4Y8DA 4GT3A 5L2IA 4WNKA 2FO0A 3SD0A 4YO4A 3ZM9A 3F3ZA 4R1VA 5CYIA 4YNEA 3QRTA 4BWKA 4XMOA 5AP5A 3UMXA 3P1AA 5KHXA 3IQ7A 5DN3A 4JDJA 3E3PA 2RSVA 3D9VA 3F7WA 2PU8A 4GK2A 3DFAA 4MXAA 3NIZA 1UWJA 4DGGA 2BAQA 3KC3A 3SXFA 4GVJA 4F09A 3LQ8A 2F7EE 2OBJA 3AXWA 5HIBA 4ALWA 3ULZA 4UY9A 1Y8YA 3IKAA 1UV5A 2G9XA 4O0UA 3VUDA 3WYXA 4OT6A 5GZAA 3HMPA 1H1SA 4ZLOA 3VJOA 2WIPA 4CZTA 4BCPA 4WBOA 4NZWB 4D2RA 3GCPA 4UXLA 3QHRA 1OIUA 2GNFA 3EZRA 4BTMA 4U45A 1YHSA 3ENHA 3S2PA 4ANLA 4YLLA 5CANA 2HENA 2UW7A 4O2ZA 1E9HA 4LOOA 4AX8A 3L8XA 4FSQA 4RIWA 4Y83A 4D9UA 5EI6A 2Q83A 3ATSA 2ZM4A 1BL7A 4ARKA 4ID7A 5GJDA 3PY1A 2XZSA 2UVYA 2ESMA 4LL5A 2J9MA 3MB6A 5L4QA 1YWVA 3IS5A 2W1EA 1FVTA 4FSMA 1OPLA 4YHTA 5CX9A 3HA8A 4RWJA 5JGBA 5HBHA 5ANGA 3FAAA 2BIKB 2XKEA 3FLNC 2BZIB 4EOKA 3NSZA 5ANIA 2VTOA 4LUEA 5LJJA 2BILB 2ZV8A 3BYVA 4D9TA 2PYWA 5I5ZA 2QG7A 2XK9A 4OT5A 4DEAA 4G2FA 3R8PA 2VZ6A 3G9LX 1Z57A 4MBLA 3UP7A 4Z55A 4RIWB 1WVXA 2UW5A 3QA8A 2OSCA 4YSJA 2C1BA 4FZAB 2OFVA 5EOLA 2YM4A 3C1XA 4FOBA 5FXQA 5JZNA 3FXZA 3W55A 4BCMA 4EQUA 1O6LA 3EQPA 5HE0A 4OTFA 3W8LA 2VWBA 3ZLSA 4BDJA 3E3BX 5H8EA 3TDVA 3AC5A 3GNIB 3F3WA 1QL6A 3GU5A 4ANMA 3DGKA 3KGAA 4CMOA 5A6OA 5HNIX 5JRQA 3UZRA 3QC4A 4FEVA 2VTSA 3EQBA 3MFRA 4F6WA 2XRUA 4PL5A 4E4MA 4F9CA 1SZMA 3V5QA 5IQIA 2UUEA 4BWPA 2HXLA 3HDMA 5CQUA 4KSPA 4EOSA 5AR8A 5LVLA 4Q5HA 3VBYA 5B2MA 4B9DA 3QFVA 5IISA 2ZOQA 5EG3A 4FEQA 4EOIA 3GT8A 5C8MA 3TZ7A 5DYJA 1W7HA 3G0FA 1FPUA 3C4EA 3QX2A 3IECA 4M69A 2IG7A 3VO3A 2RFEA 4OTRA 4LYNA 1YOMA 2XS0A 4QMYA 1BYGA 2GQSA 3ZTXA 4MH7A 3EKKA 4DITA 3C4ZA 1V0OA 2GTMA 3K5UA 4JBVA 2GNGA 2P33A 4JS8A 1W82A 1ZOGA 3R0TA 3ORXA 2OZOA 3ZFXA 3G51A 5TT7A 5AUUA 3V04A 2DWBA 5DIAA 3TUDA 3F5GA 2QOKA 3FZTA 4IVDA 2ZV2A 4XUFA 5KMKA 4C4IA 1Y8GA 3DV3A 3ODZX 4YJNA 2Q0BA 4GRBA 4PPCA 3FYKX 3W8QA 2W05A 4NL0A 5HU9A 4UB7A 5EK7A 4I6FA 1JOWB 1CDKA 4RJ3A 3VHKA 4EH5A 5IDPA 5AV3A 4MWIA 4UYAA 3U6JA 4B0GA 2CGVA 2G2FA 4AS0A 2C5NA 3GU6A 3KVWA 4QMWA 4GFGA 5BQ0A 4NFNA 1BMKA 4TT7A 4C38A 3W2SA 4ITJA 4E4XA 4EK3A 4ZSEA 3PA5A 4JNWA 4IB0A 3R30A 3BBWA 4TYEA 3SG9A 3IONA 4R3RA 5EDQA 4W9XA 1YVJA 3W2QA 3O8TA 5EHOA 4L67A 4FF8A 5HU3A 3BYSA 5AV0A 3MPMA 3UE4A 1ERKA 4D2WA 5J95A 2CN8A 3TNQB 4ZSLA 3FMDA 4CZUA 3RPYA 3QGYA 2GHLA 2HZ4A 2QQ7A 4H58A 3Q96A 4AGCA 3PZHA 3U9NA 2O2UA 2B9JA 5IEYA 1FBNA 2JGZA 2WEIA 4FE2A 3GC7A 4XLVA 4BGGA 4UX9A 3LHJA 4RFMA 3DBQA 4I22A 4ZMEA 3TTJA 5CF4A 2FH9A 2JAMA 4FTMA 4G1WA 2UVXA 3HDNA 3OBJA 3KQ7A 3KXHA 1YXXA 5CEIA 3VS1A 3R1QA 4DBNA 4FIHA 1ZARA 3KU2A 3R7UA 3SOAA 3ZRLA 4OTQA 3MW1A 4QQ5A 4BRXA 2ZDUA 3ETAA 4FTAA 3AMBA 2OJ9A 2R3LA 3BLRA 4D28A 2Y4IC 4KSQA 3I6WA 3MH0A 2YAKA 2J50A 4DC2A 4CLJA 3LFBA 1M2PA 5ANEA 3EQHA 2UZLA 3Q9XA 4D1ZA 4K33A 5HE3A 3R8LA 2X2LA 4HCVA 3VIDA 3QLGA 2XIRA 3DCVA 4IAAA 4GK3A 4IQ6A 3UYSA 5IUGA 4N70A 4FL3A 3FV8A 3UMWA 2H96A 2HOGA 1ZYCA 2R0UA 1JQHA 5AIRA 4G34A 3D5WA 3QZGA 5DR2A 4UWBA 3ZO4A 5TR6A 4GYGA 3R7OA 2YEXA 4RVMA 4UWYA 5D9HA 2W1ZA 4Z7GA 4FOCA 4W4YA 2QC6A 5LARA 3BKBA 4ZLZA 4B4LA 3QD4A 3UJGA 2PVJA 2P0CA 5AP3A 4BKJA 5DT3A 4YBKA 5FM3A 2XNNA 2H9VA 4CTBA 3FSKA 4PTGA 4GG7A 2CLQA 1J91A 2C4GA 2F2CB 4G3EA 4L53A 5JRSA 5JKGA 5HTCA 2PVLA 3EQFA 3SHEA 2YZAA 4XX9A 2GDOA 1Q8UA 5LMAA 4FZFB 2Z8CA 3DJ7A 3E93A 3EN9A 3KN5A 4AN9A 2QR7A 2Y7JA 5AV4A 3V5LA 4YTHA 1GOLA 3NEWA 4F4PA 2CGWA 3AC8A 5HVJA 5CALA 2XYUA 3QQHA 5BVWA 1PY5A 2VRXA 4CT1A 5AR3A 1BX6A 4FVPA 4CG8A 1VZOA 4I0RA 2QO9A 3GQIA 5D10A 5DPVA 2UZVA 4NT4A 4ZSJA 4BIEA 3U6HA 3WARA 2J6MA 3MB7A 4FTQA 3EKNA 2CMWA 1Z9XA 4XRLA 4XH6A 3CY2A 3I5NA 4APCA 1UVRA 5KE0A 4O21A 5AP1A 4YZDA 3LMHA 3NDMA 3SW4A 3VS4A 2BTSA 1WAKA 2OICA 1UNHA 1KE8A 3S95A 4FMQA 5H8GA 3U8WA 4DT8A 2O64A 3E62A 2RGPA 4EORA 2XNOA 3FL5A 4YJQA 3QUDA 5DRDA 4NIFA 3U9CA 4QQTA 1J3HA 2X7OA 2W1FA 1MQBA 4BDBA 3F2RA 1JKTA 4FV0A 1REJA 2OZAA 3DBDA 4FUXA 4GUBA 4IX3A 1FMOE 1ZOEA 4UMRA 4ZS0A 3AD5A 2VTRA 2WTWA 3P08A 4ZSGA 3BRBA 3PVBA 4HVGA 4ASXA 5I9XA 5L8KA 2F4JA 1OKZA 1Q62A 2Z2WA 4XG2A 2R3OA 4IWPA 1S9JA 1W8CA 2PMOX 1OPKA 3P7BA 3VS2A 5A6NA 4X3JA 2W1CA 3MI9A 5EYCA 4E7WA 4MQ1A 4WOVA 4BIDA 5M57A 1OUKA 4ZK5A 1GNGA 5BX0A 2ZMCA 5DEYA 3DDQA 2IW8A 3DKOA 4HOKA 4E20A 2B55A 4E6AA 3EJ1A 3NS9A 5CSPA 5HO7A 4JL9A 4JX7A 3GU4A 3G2FA 3PG1A 3ZUVA 4RX5A 4O84A 4FEXA 4UN0C 3CQUA 4E26A 2ITPA 3DB8A 5E1SA 4EK8A 1M14A 5AV2A 2PY3A 3OXIA 4QMPA 3RJCA 1ZLTA 5DR9A 3VBTA 4GMYA 1YW2A 3D15A 4H1MA 3Q9WA 5JFXA 4RX9A 5L6PA 3DK7A 2PL0A 4O7WA 5C4LA 4LRMA 4U5JA 1M17A 5FXRA 2OIDA 2W1GA 3PA4A 4O96A 3ZSIA 5CF6A 1WZYA 3VRYA 3BGZA 3UG2A 5HNBA 4RIXB 3V5TA 5JFSA 4AE9A 4AZSA 3QRUA 1ZRZA 4ACCA 3UIUA 3ACJA 4P2KA 3WZJA 4AUAA 2A19B 5HNGA 1G8SA 4BF2A 3H4JA 3GC9A 2RFDA 4HZRA 3WF6A 4BCNA 1Q41A 5L8LA 3UQFA 1EH4A 3RTPA 5D11A 3ODYX 2UZTA 1GZNA 3MH3A 3PRIA 4MXYA 2QOHA 4EQCA 5KMIA 4M0YA 4JDIA 4C62A 3MVJA 2OG8A 4D2SA 4RG0A 4FKTA 1M7NA 3ZC6A 4JBPA 3P9JA 2IPXA 1JKSA 3MDYA 5EDRA 4RVTA 2IW9A 1OECA 5IH6A 3L8VA 2C6IA 3NYOA 3EQIA 2UZBA 1LUFA 2O3PA 3KMMA 2UW6A 4GYIA 4ZTNA 5HZNA 2YAAA 1NXKA 5ICPA 3QCSA 3BU6A 3HMNA 1YHVA 5D12A 2WMTA 3R9RA 4DTBA 3HECA 4H3BA 1JLUE 5BNJA 2QLUA 4MWHA 4F1OA 1NA7A 4XP0A 1OI9A 4FIEA 1M2QA 2C6TA 4U7ZA 4A07A 4BDAA 5DEWA 3A4PA 3GQLA 4QNAA 2XNBA 4QTAA 3RPSA 4LL0A 2WQOA 4QMVA 3R28A 5EYDA 5IQDA 1YXUA 5EYKA 5EHYA 2RF9A 4JG8A 3BHTA 2BROA 2WHBA 3VS5A 4A9SA 3ELJA 1FGIA 4KS8A 5HVYA 3COMA 3F88A 4G3DA 5C1QB 4FVQA 3G15A 3FPQA 2FA2A 3P4KA 3Q4UA 1PXLA 5LWNA 4M68A 4BKYA 4FKSA 3EQRA 1V0BA 4QP8A 4QMQA 3KK9A 1OL2A 4JBQA 5DA3A 4F63A 1YOJA 1SVHA 2QCSA 1VEBA 1CKPA 3OCGA 3VN9A 1FGKA 5EI2A 5F20A 3RBWA 3VJNA 4K8AA 4QP3A 2WU6A 4DFXE 3EQCA 2PE0A 2UVZA 4G5PA 4M3QA 3QD0A 2YFXA 3TJCA 4IX4A 2BFXA 2P4IA 3BYUA 4QYEA 4QPAA 3HRBA 2UW3A 2R3GA 4C2WA 4CFWA 5CZIA 2Z02A 4BICA 4BZDA 2HY0A 4KIOA 4LOPA 4S34A 3EL7A 4BCGA 2W1HA 4IM3A 4YTFA 4TRLA 2X81A 5FTOA 4K18A 2ERZE 4J98A 4USDA 2OXYA 2G2IA 5L2QA 3ZBXA 2UW0A 3ZH8A 3ZEWA 1A48A 3FQHA 4MHAA 2OXDA 3ZRKA 2W7XA 4FIFA 4D1XA 4YZ9A 3TL8A 5HORA 2C0OA 4GSBA 5C8KA 1KSWA 4OBOA 4B99A 4ALVA 4YGAA 4ZIMA 3FXWA 4F7NA 2ZB0A 3WZUA 4PTEA 4UALA 4DEIA 1Q61A 5D7AA 1ZMVA 3W2OA 4USFA 1H1RA 1ZY5A 3M1SA 3O8PA 4DHFA 2E9UA 4FTNA 3NX8A 5J7HA 3A60A 3LCKA 4PP9A 2E9PA 2ZV9A 2KTYA 3NAYA 1OB3A 3VS3A 4AA0A 2X6EA 3VUIA 3ET7A 5D41A 3ZRMA 1CKIA 3IOPA 3EN5A 4MEDA 5LCKA 2GFCA 2QO7A 2C5XA 5AUTA 5HOAA 2C47A 4M15A 4F7SA 5L2WA 1YI6A 3E8CA 3D5VA 3V51A 3NNUA 3DZOA 4Y46A 2RKUA 4BTKA 3R22A 4FT9A 4XEYA 3BU5A 4X2JA 3WZDA 4FTUA 4QYYA 3EL8A 4MCVA 1ZY4A 4NKAA 2X2KA 5CAQA 2V0DA 4FKRA 2PUPA 4FEWA 5A3XA 4FZDB 2GHGA 5H9BA 3RMFA 3QCYA 2BHHA 3QALE 4BL1A 4IJPA
chains in the Genus database with same CATH superfamily
1B39A 1STCE 4PTCA 3D2IA 5HKMA 3SDJA 3DQWA 4FV1A 4TTHB 2W5HA 3W2RA 2RG5A 4DHJA 3Q32A 1KV2A 4KIPA 3ZM4A 5KHWA 3C51A 4AOTA 3KXMA 2C5YA 3QTWA 3ZFYA 3GFEA 1F3MC 3ORLA 4S30A 3UIMA 5L2TA 4LV7A 5IQAA 5HGIA 4WA9A 3DPKA 3WBLA 3K2LA 4BCFA 3COHA 3MN3A 2UZEA 4YHFA 4R7BA 2GNJA 4IWQA 2OJIA 2QHNA 3MH2A 3QCXA 3GB2A 4M12A 4UMPA 3NIEA 2JKMA 3QLFA 4DFYA 5K5XA 1H1WA 4DLJA 3FDNA 4O82A 4HCTA 3R7YA 2R9SA 3OT3A 2XIXA 4OTDA 4FX3A 4JQ7A 4QO9A 2XK6A 3FMJA 5C26A 3U54A 3P86A 2X6DA 3DNDA 2BUJA 2VO6A 3NW6A 4LRJA 4Z16A 4ZZOA 3FI3A 2H34A 2W99B 1E1VA 3NUYA 1TKIA 3ZO3A 5CAUA 4AXCA 2XJ0A 2IVUA 4RVKA 2JITA 1BI7A 4W8DA 5E1EA 1Y6AA 2J5EA 3TZ9A 5EM6A 5HX8A 4I92A 2YIRA 3GI3A 3ORMA 3PSBA 2R3RA 3KULB 2DYLA 4RZWA 1XWSA 3FI4A 3DJ5A 3QXPA 1XH9A 4ASZA 4PY1A 4BDIA 2WTJA 4CKJA 4XV3A 3EFJA 5M06A 2C6DA 3I1AA 3QTUA 5IMEA 3DBFA 3NUNA 3ZMMA 4XJ0A 3TYKA 2BZKB 3NUSA 2EB2A 4C61A 4BCOA 5B2LA 3OS3A 4NJDA 4QMZA 1XO2B 4GEOA 4AZVA 3PIXA 4IACA 2YCRA 3NUUA 2GNIA 2O0UA 4BYJA 2I0VA 3II5A 4FIGA 4ENXA 3TWJA 1J1BA 1P14A 3Q4TA 1PXJA 4RJ6A 5BVNA 2W5BA 3C4FA 4O7SA 3KXGA 1Q97A 4GS6A 3UPXA 3V5PA 3R1YA 5B7VA 2Z7RA 3TIYA 3QX4A 4JOAA 2HXQA 4QP4A 4FTRA 4Y72A 2YM3A 4MYGA 3TT0A 4HVHA 1XH7A 5B0XA 3PPZA 3I5ZA 3QUEA 4LGGA 4YBJA 4EJ7A 4DH1A 3GENA 3AT2A 3RPRA 3CTJA 3UC3A 2VO7A 5M08A 4FSNA 1NVSA 1PXOA 3ORZA 4II5A 2ERKA 4PL3A 2HK5A 5FP5A 4IAFA 4F0IA 5IEVA 4IH8A 2VV9A 4JAIA 3O5AA 3PXFA 3CJFA 3F6XA 5G1XA 2WQNA 3SXRA 3LFSA 2R3KA 4YTCA 4G31A 4UMTA 4WG5A 5E8WA 2JFMA 1YHWA 2O63A 4HCUA 3TZMA 4BJJA 2VTIA 3EFWA 2JIIA 3D7TB 4BHNA 4O86A 2PK9A 2P3GX 2YITA 3DAKA 2C5OA 4QP9A 3JXWA 2X0PA 1JNKA 4DGOA 4UMUA 2IZSA 3OOGA 4QTEA 3OWPA 4IWOA 1R39A 3GFWA 3H9FA 3O7LD 1P4FA 3BHHA 3FJQE 3QKLA 2UW8A 4PDPA 4EOMA 5IQCA 2C69A 1DAWA 3V5JA 3C9WA 3NUXA 5AX3A 3O50A 4GW8A 5EFQA 4YO6A 3QTIA 5A4CA 4XYFA 4NK9A 1Q4LA 2OJFE 2BRNA 3HKOA 3ZLWA 3H0ZA 4JXFA 3UZPA 4BJJB 4X0MA 2SRCA 3OEFX 1H0WA 4IIRA 4RJ8A 3HMOA 4YLJA 5HVKA 2XB7A 4GG5A 3SQQA 3CY3A 4E4LA 5CU4A 4JQ8A 4AF3A 1PMVA 2PSQA 4FTOA 3T8OA 1Y6BA 3A8WA 3HMMA 3NR9A 4ACMA 2LGCA 3CP9A 4O7LA 4F6SA 4RC2A 1F5QA 4AQKA 1GZ8A 2W06A 3CBLA 2GSFA 1XH4A 2VWWA 4W8EA 2V7AA 3QC9A 3BIZA 4NYEA 2CLXA 4V04A 5CVHA 2X8EA 4B6LA 4CFUA 4HGSA 4HVSA 4NW5A 2J7TA 4XCUA 3HAMA 3PFYA 3UPZA 4YP8A 4O22A 4A4LA 1AQ1A 1MRYA 2F7ZE 4FNWA 2WMXA 2JDRA 4LUDA 2IZRA 2YHVA 3F82A 3JPVA 3M42A 3CJGA 5JH6A 2OK1A 3FLQA 3FY2A 5AP6A 2XIYA 4RJ7A 2QOCA 1JSTA 2PZPA 2XNMA 3MWUA 4G6LA 4I5HA 4WSQA 2IW6A 4G3CA 2VWVA 4IAYA 4O4EA 4F08A 4AA4A 4HPTE 4F7LA 4DFBA 1UNGA 2WO6A 1VR2A 3MH1A 3OCTA 1Q8ZA 4GJ2A 3RAIA 5M07A 4EWQA 2VTMA 3PIYA 4FV8A 5HG7A 4OAUC 4AAAA 2VWYA 1OIYA 3H3CA 2UZNA 3LFQA 4JVGA 3ALOA 4K1BA 4P5QA 4RIYB 3A8XA 5HLNA 5HTIA 3HP2A 2OF4A 1BLXA 4XV1A 3DK3A 4FSZA 4KIKA 2BKKA 2REIA 1GIHA 1URCA 1G5SA 4AQCA 4F6UA 1DAYA 1IASA 4FG8A 2PHKA 4UWCA 3B8QA 5FLFA 3POOA 5HE2A 4AT5A 4F9AA 5AV1A 4DBXA 2X8IA 1A06A 4YNOA 5AP4A 4BC6A 4JG7A 4L68A 2P2IA 4JR3A 4A9RA 3VBXA 3UODA 3U6IA 5GZ8A 4G3FA 4AN2A 1LEWA 4FZ6A 2XVDA 1UWHA 5CSVA 1I09A 4WG3A 3SG8A 5EDPA 4XOYA 4QT1A 4M66A 1W98A 3BYMA 4W4WA 4AN3A 4JDHA 3E88A 3K3JA 4GH2A 4F9WA 5LMKC 3NPCA 4IFCA 5EM7A 4KIKB 3W1FA 3OVVA 1CSNA 2O65A 5TO8A 4RC3A 3SC1A 4HGLA 3AC3A 4CV9A 5DG5A 2NO3A 2OF2A 3GCSA 5GIOE 3EQGA 4WD5A 3A99A 4AW0A 5FDXA 3R63A 4XBRA 3Q2JA 3QTXA 2R7BA 5A46A 3DZQA 2QOLA 4P4CA 5DR6A 5BV3A 3GCVA 3DTCA 2JDTA 4PQNA 3P5KA 1OIRA 4W4XA 4ASEA 4L42A 1WBSA 4AXAA 3E8DA 3H10A 3PXKA 4DFZE 2A4LA 2OGVA 3OP5A 3B8RA 1VJYA 2VWZA 4IC7A 4MKCA 4CT2A 4QYFA 5FG8A 3VUMA 3LKMA 5DWRA 5IEXA 4J53A 3ZC5A 1H1PA 1OL6A 2I1MA 3AD4A 5FEQA 4G6OA 5DE2A 3O7LB 3W16A 2YM5A 1ZYLA 4D1SA 3PSDA 5K3YA 4ZTLA 3QZIA 1VLRA 2JFLA 5AUVA 1K2PA 5AP0A 4EHZA 3Q3BA 5BPYA 4GUEA 2XK7A 2O5KA 3MVHA 4V0GA 4NCTA 3F2NA 3LM0A 4EH6A 4WT6A 4RSSA 5EM5A 3L9MA 4ANBA 4CGAA 4BVUA 4WSYA 3D83A 5E8VA 4UXQA 3RP9A 2ITTA 4TY1A 4YHJA 5A9UA 4I21A 3VC4A 3DLSA 4FV9A 5FXSA 3E5AA 1UNLA 5JK3A 3TM0A 3NVKI 4TW9A 5D7VA 3R73A 4WUAA 4AA5A 1TFFA 4FT3A 4BTFA 3FUPA 4KS7A 4PWNA 4N57A 4D2TA 4N6YA 3PJ2A 5HO8A 3KK8A 5JSMA 5IA1A 4V0GB 2HCKA 4ZY5A 3DK6A 4X6QC 4O0XA 4R5SA 4EYMA 5CU0A 1SNUA 3PVWA 4AW5A 3R21A 4FYOA 4AP7A 3LCOA 3ANQA 3CTHA 4EH4A 3BELA 1G8AA 3RCDA 3EIDA 4CMUA 2AUHA 2CN5A 3QKMA 5E92A 2NP8A 5HD7A 2VX0A 3ZSGA 3H9OA 3DKFA 3MFTA 3BEGA 4LG4A 5KMMA 3PTGA 4R77A 5KMOA 4FKQA 2FSTX 1CTPE 4JIKA 1CM8A 4FK3A 3RM7A 4I5PA 4HNFA 2B9IA 3NUPA 5IMXA 4J96A 4XBUA 4C3RA 2XJ1A 2V55A 2IJMA 3LCTA 4Z7HA 4AXFA 5AP2A 5CAPA 5HBJA 3V6SA 2GQGA 2H6DA 5E8TA 1DI9A 5LVNA 4LDTA 3MIYA 2ZYBA 3BV3A 2CKQA 3W2CA 4FNYA 3RAWA 3UGCA 3Q04A 3GCQA 2UV2A 4KB8A 4LV5A 4BBEA 5IH5A 3Q4CA 2PVKA 3WILA 3ZFMA 3AKKA 3B2WA 1BKXA 1JVPP 3P7AA 4IX5A 4LMUA 4EK4A 3FKLA 1Q5KA 3MSSA 3OROA 5T68A 5AA9A 3JR1A 5DOSA 2PVNA 3DKGA 3BQRA 5M4FA 1ZYJA 4MXCA 2EWAA 3PXZA 1YDSE 3C7QA 4FZ7A 4C4JA 3D5XA 3C4XA 2ZMDA 5LMKA 5GINE 3BGQA 4D0XA 3ZZWA 2XYNA 1LR4A 3S0OA 1FOTA 3PIZA 1M7QA 4K77A 2HW7A 4XG8A 4C4HA 3MTLA 5BVKA 1H1QA 5KO1A 3OWKA 3PY0A 4YC8A 5L3AA 3LM5A 2P2HA 3JVSA 3P78A 4HZSA 4HYSA 3ZLXA 3W0RA 2C0TA 2DUVA 2GTNA 2BIYA 3DB6A 4U41A 3R2BA 5AA8A 3OZ6A 5FD2A 3HV6A 1ZAOA 3R7GA 4HYUA 3FY0A 2ZFYA 3LFNA 4A7CA 3BE9A 1Q3WA 3BYOA 3ENMA 3FMHA 2IN6A 4QPSA 4ZTQA 3UIBA 4DG2E 5CEMA 4QP2A 4J71A 4YPDA 4CFNA 4FG7A 5FBOA 3H30A 3QQLA 4CSVA 1U4DA 4BHZA 3I79A 1UU3A 4FV3A 2PVMA 4KRDA 2VU3A 3GP0A 4CFMA 2XA4A 2VAGA 4AGUA 3MY0A 3D4QA 3PUFC 3OWJA 2NRYA 3KF4A 5HQ0A 2HW6A 4FV4A 3WOWA 1ZOHA 3ZO1A 4PPBA 4OTHA 3TJDA 2XK4A 4X3FA 3KVXA 2E9NA 2YWVA 5CU2A 3CPCA 3V8TA 4FKWA 1PJKA 1QPDA 3CXWA 2WMUA 3AC2A 2P55A 2R5TA 3FLWA 4MXZA 4PDYA 5DFPA 3CQWA 4QMSA 3VBWA 3NYNA 4O2PA 5BVEA 1OL1A 4BTJA 5KMLA 5J1WA 5EQEA 1OKVA 4L45A 2ITXA 3UBDA 4LQMA 3UQGA 5CF8A 4X3FB 5A4EA 5IA2A 2PVFA 1UU8A 4RA5A 4FTCA 1XMMA 3HP5A 1SYKA 3QYWA 2JKOA 2QOIA 4DHIB 3UTOA 4IWDA 3HAVA 3I0OA 4JX3A 2FYSA 3LFEA 4J99A 5CEOA 3W32A 1O9UA 5M44A 4X21A 3Q9ZA 3WF7A 4ZAUA 2ITVA 4WG4A 3C0HA 4Q9ZA 4GVAA 4OTGA 3UIXA 1U59A 5IA5A 4F64A 2WMWA 2YDJA 4FYNA 5FTQA 5IA3A 3RK9A 1ZXEA 3EFLA 4QP7A 1A9UA 3WF5A 1ZWSA 3ZEPA 5DNRA 5JQ5A 1OUYA 3IW5A 3W10A 2XKCA 4XG4A 5IA0A 2VGPA 4MXOA 4WUNA 4Y5HA 3BHUA 3EZVA 3WF9A 5J9YA 3W2PA 3CTQA 2ZJWA 4O0WA 3AD6A 3ANRA 2XK3A 3RHXA 1J7LA 4YJUA 5FUTA 4ONAA 5F4NA 5HE1A 4O83A 4DTAA 1YI4A 4EL9A 4OUCA 4I93A 4M13A 1IG1A 3I0QA 5AFVA 3QTRA 3FPMA 2WFYA 4OBQA 1XR1A 5HBEA 5K0XA 3RALA 4DFUA 3MFUA 4L3LA 1ZZLA 2BVAA 4XV9A 5H2UA 1LEZA 1U5RA 1WVWA 3NRMA 4IVBA 4JI9A 2CKOA 5A54A 4EOLA 4EH7A 4GJ3A 1Q24A 2BRMA 2WNTA 3F2AA 4NM3A 1SM2A 4FSYA 4AT3A 5LMBA 1MP8A 2C6KA 2CGUA 1ZMWA 4NEUA 4RIXA 3VVHA 2JIVA 4AW2A 4C7TA 2HIWA 3HV4A 3TTIA 3LW0A 3F3VA 3NZ0A 4XS2A 4CTCA 3BGPA 5EI8A 4K6ZA 4ZTRA 5CEQA 2JBPA 2X0OA 3OXTA 4HVDA 3DQXA 2ITNA 4CFVA 4DDGA 5KCVA 4MBJA 5EM8A 5CAOA 3FI8A 3ACKA 3KMUA 3WIGA 4DINA 2BZJA 5CF5A 3T3UA 5CS6A 2QG5A 3FZPA 4DH3A 4GCJA 3PG3A 2YLFA 4GU9A 4E6DA 4IEBA 4K11A 2F57A 3R1SA 4FV5A 3C0IA 1ZYSA 4CMTA 5CNNA 5IQFA 4C57A 4ERWA 5ANKA 2C0IA 4CNHA 5HD4A 4M8TA 4O4DA 3VUHA 3ROYA 3HMIA 2WMRA 2WQMA 3HRFA 3OW3A 4WBBB 4S32A 4O1PA 2UW4A 3A2CA 3RNIA 4B8LA 4P5ZA 5E91A 5DMZA 5EOBA 3RI1A 3GU7A 3COIA 5CLPA 2YIYA 3VHEA 1CMKE 3ZDIA 3Q6UA 5BUIA 3FHRA 3LFCA 3GBZA 3IDBA 4HGTA 4WNPA 4O7ZA 5M55A 2CPKE 2RFNA 4CG9A 4YJOA 4MNEA 2YJSA 3JUHA 4F65A 2OH0E 3MY5A 3WYYA 4EYJA 4FTIA 2CNVA 4TWOA 2YACA 4NWMA 3VWAA 4A4XA 2WTKB 2YM7A 3GVUA 3N4TA 1CKJA 3O2MA 3TZ8A 4PMPA 4IB1A 4RWIA 1OGUA 2YIQA 4FL1A 4N4SA 4FNZA 2AQXA 3LMGA 3LXPA 3QHWA 5HCZA 4D4RA 3Q9YA 3HEGA 3R9NA 2GNLA 3F3UA 1X8BA 4MQ2A 2ZVAA 2IVSA 5FDPA 2R2PA 4MNEB 4DGNA 2OO8X 4BN1A 3KRXA 3NWWA 3I7CA 4ANNA 4D4SA 2IZTA 3BPRA 3OF0A 5J8IA 3CLYA 4B7TA 3CS9A 5M4CA 4KD1A 5J7BA 1PYEA 5TF9A 2I0YA 3E7VA 4IZYA 4D4VA 2H8HA 5BVFA 4GIHA 3LXLA 2VNYA 3OT8A 4FSTA 4KAOA 2PUUA 3TNHA 2I6LA 4CRLA 1XH5A 2VUWA 3ZXZA 4U9AA 3A7FA 2ACXA 2XCHA 4FKUA 4BDEA 4XOZA 3ORKA 3UDBA 3N4VA 3AT3A 3TCPA 4AW1A 1V0PA 3W18A 3ZSHA 4PPAA 3HV5A 5CVFA 3G9NA 3KXNA 2R3NA 4F70A 4I4FA 3R8UA 2GS7A 5ETFA 2PMLX 4FV6A 4EC8A 4UYNA 3TV6A 3NW7A 4BDDA 3MGYA 4BR3A 3F5UA 3VBQA 3P79A 4G9RA 4I3ZA 1YDTE 4CVAA 5H8BA 3ID6C 3KCFA 1XJDA 4B8MA 4DLIA 1PXKA 4RQVA 3VAPA 2X4FA 3VNTA 5CXHA 3L1SA 5AEPA 3ZS5A 3WIKA 5LWMA 1Q8WA 2XM8A 4I6BA 4QQJA 3TKUA 4EZ7A 4JMQA 5E8XA 2FGIA 3F3TA 4J95A 4O0TA 3PJ8A 3PJ1A 4BDGA 4R78A 1GJOA 4EC9A 3KKVA 4C4EA 2BRBA 4OR5A 5CNOA 3VS6A 2VTAA 2OWBA 3FKOA 1TVOA 4FT5A 4LGHA 5F95A 4CKRA 3DNEA 4R7IA 2YIXA 3GOPA 2QHMA 3MFSA 5E8SA 4ZTMA 4F7JA 2F9GA 4U42A 3C4CA 4IZ7A 4DE4A 1B38A 3OCBA 3Q5ZA 4YJSA 4EBVA 1BL6A 4GFMA 5AAFA 1YXTA 1OZ1A 4QMUA 4EH9A 2XIZA 3EOCA 3OY1A 5T3QA 4RBLA 3ZXTA 2CGXA 3GGFA 3GUBA 1GAGA 2W96B 4C37A 4D2VA 3QU0A 3G6HA 4NU1A 3OFMA 4KRCA 3BE2A 2B9FA 3NLBA 4DYMA 4C33A 3UNJA 2PWLA 4RC4A 2EXMA 2J90A 2X0QA 2GPHA 3OBGA 5DGZA 4O1OA 4O91A 3O8UA 4O6LA 1OKYA 4IX6A 2C30A 4E93A 3QD2B 4WO5A 4L3JA 5EKNA 5K4IA 5HCXA 3Q2MA 3TNWA 4D55A 5AWMA 1T46A 1XH8A 3G5DA 5LXMA 5AR2A 3G0EA 1Y91A 4QPMA 4ENYA 3AMAA 3H0YA 2RL5A 2IVTA 1WFCA 4S31A 4ZS4A 2B4SB 3OOMA 1PXIA 2CDZA 5TKDA 3EYGA 4D2PA 4ZZNA 1IR3A 5HTBA 1WVYA 4PNIA 1WBVA 3ERKA 4OBPA 4CCBA 4OTWA 2IWIA 2VTPA 1NVRA 2VWXA 3FLSA 5E8YA 4QEBA 3F5PA 2C68A 1GIIA 1R0EA 4E8AA 3KRWA 4IW0A 3D5UA 3SRVB 4MF0A 4BYIA 3SAYA 2GCDA 3A62A 3PA3A 4IDTA 2C3JA 3OG7A 3PXQA 5C8NA 5C01A 2X1NA 1SVEA 3HNGA 3IOKA 3NNVA 4IZ5A 4LMNA 2W4OA 4PMTA 5ANDA 4C2VA 3ROCA 3RM6A 3E8EA 4USEA 3HGKA 5CI6A 3GC0A 3V8SA 4J1RA 4X7QA 2JBOA 3KRLA 3PYYA 1PXPA 4DCEA 1GY3A 4YJRA 3TKHA 2F2UA 5JFVA 4R5YA 3KULA 4A06A 5GJFA 3ITZA 4QTDA 3CD3A 4KIQA 4IVCA 5T6KA 3WF8A 1ZMUA 2BHEA 2WOUA 3QXOA 5FEEA 3RK7A 5AADA 2OI4X 5L2SA 2W0JA 1QCFA 3CSVA 4GV1A 4TNDA 4EI4A 2FVDA 3ZLYA 3DTWA 4MXXA 5LQFA 3BWFA 4AOIA 3L8PA 5BUJA 2VWIA 4IJ9A 4L6QA 4RQKA 1SNXA 4BDCA 3DT1A 4ZTSA 4EUTA 3F61A 5ETCA 2AC3A 3Q5IA 4N6ZA 2BR1A 2RG6A 5IU2A 4AZFA 3LVPA 4AZTA 3UNZA 3HUBA 4GFOA 1XHAA 4Y95A 4LFIA 3E92A 2CNQA 3RPVA 4D5KA 1V1KA 4EZ5A 3PLAE 2PUNA 4JDKA 2IO6A 2VTNA 5CT7A 4ZOGA 3QRJA 4UV0A 5HEZA 2ZM1A 4BI2A 4KUJA 4NUSA 3MVMA 4FKGA 5JN2A 2YZLA 3LFFA 2BRGA 3LPBA 3LAUA 4PNKA 4IAZA 2BPMA 2Y6MA 5KZIA 4MNFA 2QNJA 1P5EA 5J5SA 3WI6A 3CE3A 4V05A 1B6CB 2W9FB 3FMEA 3WZEA 3PRFA 3DFCB 4C3FA 3BLQA 3D7TA 5TOZA 4OAVB 3VF8A 4IXPA 3D94A 3E7OA 1XKKA 4RJ4A 5ANOA 4YZNA 4HYHA 4XV2A 5E8ZA 3A7HA 3AMYA 3PUPA 2WZJA 4KKGA 1J7IA 3FZSA 5JEBA 4FVRA 2FSOX 3FHIA 2QKWB 3UOHA 3LQ5A 3BZ3A 4I20A 4K2RA 2BRHA 1M2RA 2VTHA 4LI5A 3SV0A 4AE6A 4C35A 4JLCA 3P5JC 1REKA 3JVRA 3LJ2A 5C03A 4Q5EA 3I81A 3VBVA 4EKLA 4AZWA 3M11A 4BBMA 2ETRA 5DBXA 3NUAA 1XBAA 2XIKA 2ITZA 2YDIA 2OIQA 4TPTA 4TL0A 5CASA 4DEGA 3FMNA 4YMJA 4AXDA 2W5AA 3QTZA 3G6GA 5K9IA 2X4ZA 3LJ0A 3WE8A 2XNPA 1Q99A 3OXZA 4FG9A 4RA4A 4I0SA 3NAXA 4L3PA 4QRCA 4QTBA 5FWKK 2R3IA 2YWPA 4OGRA 3NFGB 4BY9E 2I7QA 4BCIA 1O6KA 3DY7A 4IVAA 4NCTC 1M52A 3UZTA 3EQDA 2BZHB 4E1ZA 3TDWA 4WNOA 3IGGA 4IM2A 3DBEA 1W2DA 4EUUA 2R3FA 2YCSA 3T3VA 4QMXA 3UQCA 5ACBC 2YABA 4LOQA 4Q2AA 4CYIA 5ANJA 4FSWA 4W9WA 2CJMA 1HOWA 3TNIA 3HA6A 3UO4A 4DEDA 4EK6A 3DXQA 2W4JA 2HZ0A 4C8BA 5KMJA 5KKRB 2CCHA 5E7RA 2PE1A 2QO2A 3AQVA 3PJCA 4DEEA 4FT0A 4HGEA 4LV8A 3GEQA 5I3OA 1FMKA 4YURA 3SLSA 3HRCA 4GT5A 3PP1A 5IA4A 3R2YA 5DLSA 5KNJA 3AGMA 1WBPA 5EYMA 2VX3A 3FSFA 3R9HA 2XARA 4MX9A 4TWNA 3MIAA 5EW3A 4ITHA 4RIYA 2B9HA 3PSCA 3R6XA 4DFNA 1OITA 3NNXA 4FK6A 4KBAA 1G3NA 4HW7A 3PVGA 1ZYDA 2ETMA 3OY3A 3R71A 4TKSA 3U55A 3BHVA 3F69A 2XALA 1YDRE 2IZUA 4PL4A 5ETAA 3RHKA 4EJNA 3F66A 4IM0A 3T9TA 3ZDUA 1QPJA 5I4NA 3W0OA 5DI1A 3R7IA 3TN8A 3VUTA 2X9FA 2G2HA 4H3QA 5J87A 3L9NA 2IVVA 2VO3A 2XNGA 4WNMA 5JFWA 4FA2A 3LMIA 5FTGA 3SOCA 4RX7A 3UVPA 2QOFA 4N0SA 4F1TA 3N9XA 3O71A 3JYAA 4YSMA 3QZFA 4U44A 2NPQA 4PF4A 3H9RA 4L01A 4ZSAA 3N4UA 4CV8A 2C6OA 3HLLA 2WB8A 3JS2A 3TXOA 5J5TA 3RPOA 3NMUF 2QONA 3NW5A 3CR0A 2NRUA 4U3YA 4DTKA 3DAJA 4IAKA 4KINA 4BGQA 4FUYA 4ACDA 1OKWA 4S33A 4DG3E 5ITAA 5M4UA 3S4QA 1ST0A 5A4QA 4QMMA 3CGFA 2YM8A 3O51A 4QNYA 1DI8A 4C58A 2XBAA 3KXZA 4FKJA 4IANA 4WIHA 3POZA 3HUCA 1NVQA 1W83A 4RGJA 3KA0A 1JWHA 4EOOA 1PF8A 2X7GA 3QRIA 5ETIA 3UC4A 3VQHA 5AUYA 4BI0A 5KZ0A 4DN5A 4YZMA 3TMOA 3BEAA 3EH9A 1H27A 3R7VA 3TACA 3EWHA 1H08A 5CEPA 3MYGA 2GNHA 1VYZA 3BI6A 4O0VA 2J4ZA 5BMMA 1IAHA 2I0EA 3CKXA 4JIAA 4EH2A 4O7RA 2OW3A 5KMNA 5CEKA 4TNBA 2JKQA 2W1DA 2PMIA 3FLYA 3DAEA 3FWQA 4CCUA 5AMNA 3D14A 4ZY6A 3CEKA 3QQUA 4IBMA 3SX9A 1JAMA 4WKQA 3PLSA 4GIIA 4RJ5A 3ZYAA 1KUTA 4QP1A 4ZJVA 3DBCA 5DH3A 1MRUA 3VW8A 3SGCA 2Q0NA 2YLEA 4A4OA 2C3IB 5EKOA 3R7EA 5IQEA 3LIJA 4TYHA 2Y8OA 3K5VA 1P4OA 4PMMA 5CQWA 5KBQA 4AACA 4E4NA 3SW7A 2YIWA 3GXLA 4TWPA 4X3FC 2PZYA 1PKDA 5JGAA 1WMKA 2J0JA 4NJ3A 2UZUE 2JC6A 3AT4A 1J7UA 2R3HA 3FYJX 3K3IA 4R7HA 4CKIA 5LVPA 5DRBA 4XG7A 3ZO2A 4RFYA 3RINA 3OMVA 3R1NA 3MVLA 4X2NA 5IQHA 1JKLA 2VN9A 2QU5A 2XRWA 3OD6X 4HJOA 3ORPA 4TYHB 4U43A 4UEUA 4YJVA 5GJGA 2ZAZA 1R78A 4EBWA 1S9IA 3IDCA 3NFFB 2B1PA 2V22A 1Q8TA 5CI7A 2CSNA 3VUGA 4F0GA 1H0VA 3ORNA 4FIJA 2OJGA 4FV2A 4C4GA 1H4LA 1U46A 5I0BA 3KXXA 3OTUA 3QF9A 5HICA 1H25A 3C13A 3I7BA 3THBA 4EEVA 2Y9QA 4L7SA 1W2FA 3BLHA 4I41A 4CQEA 5CVGA 4FKOA 4G5JA 2A2AA 3FI2A 3QTQA 3PFQA 5KBRA 2WU7A 1FVRA 3N51A 5K0KA 2FUMA 2C6EA 5HLWA 2WPAA 3QQGA 4HPUE 5HLPA 1H07A 3DDPA 5C4KA 5CSHA 3DLZA 5DVRA 5AAGA 4O7TA 4XRJA 5M09A 4GK4A 4U3ZA 3QQFA 2WTVA 3QCQA 3LXKA 1E1XA 3PY3A 4M7IA 5CXZA 4GL9A 5HX6A 1YWNA 2XKDA 4LM5A 4RPVA 5D1JA 4C34A 4M69B 3G90X 4P7EA 2XEYA 2ONLA 2Y6OA 3DXNA 3DJ6A 1PW2A 1U5QA 1PHKA 2A0CX 4ZP5A 4AFJA 4PDSA 4IFGA 4JRNA 2GMXA 2VWUA 4KNBA 5ACKA 4FSRA 3OHTA 1R0PA 2E2BA 4OLIA 3MA3A 4C02A 3AGLA 3FZOA 2J0KA 3RWQA 2VGOA 4BCQA 3KREA 3MY1A 4FIIA 4H36A 3BCEA 1FINA 3TKIA 4BB4A 5J9ZA 3SKCA 4CZYB 4BDHA 4FEUA 4I6HA 5EHLA 5IZFA 2X0GA 4PP7A 4CRSA 4AG8A 4YR8A 5I9UA 4NTTA 2XBJA 5CTPA 4F9YA 1KE7A 5CAVA 3TNPC 5A4LA 2CNUA 2UZOA 2HZNA 2E9OA 2HWPA 4FC0A 5AUWA 4CYJA 5JQ8A 1OBGA 5LOHA 3E8NA 3FMKA 1MUOA 4BCJA 5IUHA 1H24A