2ZB1A

Crystal structure of p38 in complex with biphenyl amide inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
345
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Biphenyl amide p38 kinase inhibitors 1: Discovery and binding mode
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 113
structure length 345
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2zb1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2zb1A01
4A4OA 2NNWB 4H1JA 5A4LA 2X7OA 3A4PA 3KF4A 4FC0A 3R8ZA 3Q9YA 3ZM9A 3H4JA 1H25A 4DGMA 4ZTHA 2FSLX 5IUIA 4BDHA 4TN6A 1A9UA 3IDCA 3AC1A 3IOKA 3NUPA 3C0HA 4R7BA 2BZJA 3VJNA 4R6VA 2Z7LA 3OCTA 3FZPA 3R2BA 4FSWA 3BZ3A 3GC9A 4HVSA 5JGBA 4FSUA 3I7BA 4FSRA 3RVGA 4FKUA 4GT3A 4IBMA 2R3OA 5CVFA 1Y57A 4CEGA 5B2KA 5I9YA 3CY3A 1J91A 2G2IA 4EHZA 4DH7A 4D1XA 3FUPA 4PMPA 4EC8A 5LOHA 2BMCA 3C51A 4CV9A 5HQ0A 4FV3A 4F6SA 3PIZA 2C4GA 4O6LA 1KE9A 3BEAA 3CGFA 4WA9A 5KMNA 5AA9A 3Q3BA 1FVVA 3MA6A 5CVHA 3GU5A 4QO9A 4AXAA 4X2FA 5AUZA 5HE2A 5IKWA 2JFMA 1UNGA 4FKIA 3OTVA 4D4YA 4RWIA 3EZRA 1Q8WA 3NRMA 3EFLA 4WNKA 1W82A 3QA0A 4ERWA 5FEEA 3TZ9A 4TKSA 1H1RA 3JUHA 2YJRA 4ZSGA 3CIKA 4F09A 2HYYA 2XP2A 3Q04A 4FV9A 4XBUA 1G3NA 3T9TA 3HMMA 3WYYA 3GQLA 5AAFA 2Q0NA 4OW8A 3DXNA 4PDOA 1SMHA 4R5YA 5H3QA 4IHPA 4DGLC 4HPTE 3VQUA 3CBLA 3HV3A 4FZAB 3LMIA 3U4UA 4BDJA 1MRYA 4O7VA 2O2UA 4GKIA 3GENA 4YJTA 1S9JA 3MFTA 2IW8A 3UJGA 4D2TA 3OXIA 3R04A 4Y72A 4DG3E 3EN5A 3B8QA 3TDVA 3A7JA 4LYNA 3ULIA 2VTRA 2XNGA 3OBGA 3LFDA 4NTSA 2IZUA 4WKQA 4U80A 1BUHA 3FI2A 4JNWA 4MXYA 3TZMA 1JAMA 3UNJA 3VUHA 3UIUA 4FL2A 3ZRLA 3MIYA 1LEWA 3K54A 5LJJA 3GCUA 2OFUA 4WNMA 3HRBA 3VIDA 3PLSA 3ZO3A 4G6OA 1JOWB 2CGWA 1OB3A 2JD5A 5EW9A 1YXVA 4O21A 5AR5A 3EZVA 3TUCA 4L7FA 2QLQA 3R6XA 3AQVA 2B9HA 3DNDA 4MX9A 4DFBA 2ONLA 3LPBA 4A9RA 3RPSA 4A07A 4C2WA 1IR3A 4QPAA 3FWQA 4Y5HA 3RNYA 1XJDA 1XO2B 4EH6A 5IMEA 5EG3A 2WPAA 3W2CA 3KXGA 3T3UA 4QMPA 5DE2A 3K2LA 2W1FA 3TWJA 2OJIA 4I94A 1K9AA 2C3KA 5DRBA 4C33A 4CD0A 5H2UA 4F9AA 2GNGA 3AC3A 1ZYLA 2FGIA 1CDKA 3BYVA 1PF8A 4MNEB 4OTPA 4F1MA 1PYXA 4QNAA 4FTLA 1Q8UA 5E1SA 2JDTA 4C0TA 5CF5A 3SVVA 2E2BA 3H9RA 2QI8A 3FZOA 3BV3A 5AP3A 4IM3A 3WIKA 4DFXE 4YJOA 4F9BA 3IW4A 5G6VA 2NP8A 2C6DA 4DT9A 3FMMA 3W55A 5K5XA 3NNWA 3BWFA 5AUTA 3VS0A 3W2SA 5CAQA 1Y6BA 3NNUA 2VZ6A 2UW3A 2ZMDA 4O81A 1WCCA 1JLUE 2QO9A 3LFAA 4PL5A 2UZBA 4BCKA 5A14A 2PVYA 5FD2A 4EK8A 5CAPA 5HU9A 2GS2A 3L9PA 4YJNA 3P4KA 3QX4A 4EOIA 4G31A 2WMTA 3EHAA 3HMOA 3FI3A 4NFMA 5TO8A 3FPQA 1YKRA 3MIAA 1U46A 4CMTA 4EHGA 2WZJA 3QUDA 2VTLA 3LCKA 1P2AA 4L53A 5JEBA 3KCFA 4LI5A 1PXMA 3PWYA 2CKQA 3ZH8A 5C8NA 4BGGA 3CE3A 4IAZA 4ZTSA 4MQ1A 2O0UA 2YIWA 1OIQA 4G3EA 5HG5A 3D7TB 3D7ZA 5LMBA 4FTMA 5ANJA 4IX5A 2WELA 4V0GA 5C27A 4GFMA 3GQIA 1HOWA 3VRZA 3ZO4A 1YHVA 2E9NA 2R5TA 2PVNA 4ZJIA 3PSCA 4YTFA 4FZ7A 2ACXA 2BRGA 3R00A 4D2WA 4PWNA 3SG8A 4IM2A 3UC3A 3QXOA 3GC0A 4IAFA 2BTSA 1UU8A 5H9BA 2R0UA 3VS7A 4F7LA 3PG3A 1H28A 3OWJA 3DJ6A 4AN2A 1ZMUA 2OJFE 2QOBA 5DVRA 5ANOA 4P2KA 1YXUA 2OO8X 4CFNA 4YUQA 3EL7A 3JPVA 4GVJA 4NM3A 3FSKA 3P79A 5BVOA 3PP0A 3V8WA 2YAAA 2PL0A 4F99A 5KHWA 4RQKA 5A4CA 5L2SA 3FMNA 5KKRC 4RPVA 2G01A 4IMYA 4WUAA 3CY2A 2EU9A 4JBPA 2OJGA 4BBEA 2QONA 3NCZA 4O7SA 5ETIA 4FGRA 3MVHA 5IDNA 2VNYA 5FXQA 4TNBA 5HO7A 5HI2A 3ERKA 3G5DA 5BUEA 3GP0A 5C01A 1OUYA 3S4QA 4Z55A 3EQGA 1B38A 4EYJA 3A7FA 2REIA 3ORTA 4EJ7A 5K4JA 4CSVA 2VWYA 3DK7A 1H8FA 4HZSA 3FKNA 4M68A 2ETKA 4K11A 3V01A 2RSVA 4L7SA 2ITOA 4I5HA 4MD9E 2WTIA 3F5GA 4D2PA 3KEXA 3OOGA 4U9AA 1TQPA 1NT2A 3BGQA 1XH9A 5IPJA 3N4UA 2XUUA 4IVAA 3SQQA 2RF9A 3MVMA 3AD4A 2BRMA 2PZPA 4M14A 4FKWA 1XHAA 4EOJA 5EK7A 4IJPA 2HXLA 4MEDA 4YJUA 2FVDA 3FSFA 4BC6A 3HX4A 4C62A 5AFVA 2X2MA 4X3JA 4MXAA 4FTOA 5EDQA 1URWA 3NGAA 3ZZEA 4PNKA 3A8XA 3QF9A 2BAQA 4I20A 3ZO1A 2R3MA 1LUFA 2XMYA 3KULA 3O8TA 4I23A 2C6OA 4L67A 4X2NA 5DH3A 2XJ2A 5AR7A 4A06A 3QKKA 3ZFXA 3DZQA 5KNJA 5CZHA 5I3OA 3U4WA 4BCOA 5GIPE 4XCUA 3NS9A 4YZNA 2R3HA 4XLVA 2H8HA 4JDIA 4E6CA 3EQRA 4OLIA 2WFYA 2X2LA 1ZOEA 3FAAA 1M7NA 5F1ZA 4BZDA 5F94A 1LR4A 4G3GA 3TUDA 2WU7A 4RMZA 4ORKA 4UWCA 5DT0A 4GFOA 1FINA 5GZ8A 3NYOA 4MHAA 4O2PA 4OTQA 2W4KA 2OI4X 4X6QC 1Y8GA 4TWNA 4CLJA 3TV6A 3LW0A 4IAIA 4IB0A 3QUPA 3LFFA 3P7AA 5LMKA 5M53A 2V22A 2G2HA 2JDSA 4DH3A 2BDWA 5AUXA 2UUEA 3OS3A 3RK7A 5I9WA 2ZV8A 3TN8A 2C0IA 3ALOA 4AGWA 3LXKA 3FY2A 5K3YA 3RPRA 5KBQA 5DWRA 3D2KA 3HYHA 3ZOSA 4TWPA 2I0HA 2HWOA 2C6IA 3FMLA 2WNTA 3KN6A 3DKCA 3NNVA 2RL5A 2NO3A 1QL6A 3F3TA 3R21A 3IGGA 4AU8A 4HYSA 1AD5A 5J5SA 3CD8A 4MBLA 4AGUA 2YISA 4OUCA 4F70A 3KK8A 2EWAA 2XNBA 4A9TA 5DR9A 5HKMA 3TG1A 5M4IA 2R4BA 2JKMA 2QD9A 3DDQA 4DTBA 2XIKA 1QCFA 3DJ5A 2A19B 2QOHA 4I22A 4UXQA 3ZMMA 4BDIA 3RM6A 1A48A 4J1RA 3D5WA 4AGCA 4JDKA 5EH0A 3FMKA 3IDPA 4UX9A 4QTCA 2XM8A 4ZZMA 4L01A 3O71A 4FNXA 4FSYA 5IUHA 4L3JA 2DYLA 3ZS5A 3PP1A 4PPCA 3TL8A 3IKAA 4L3PA 2BRHA 1H26A 4BFMA 1Z9XA 5HORA 4R3RA 4KBKA 4NM7A 4QYGA 3VAPA 2ITYA 2YERA 5D10A 4ZSEA 3OMVA 4ID7A 3KKVA 4GS6A 1OIRA 4FYNA 3VW8A 5JQ5A 4DCEA 4OBOA 4QQ5A 4ANLA 3CD3A 3CR0A 5J9ZA 4FL1A 2HY81 3OVVA 4FSZA 2XF0A 4D2RA 3E3BX 4BDAA 4HGLA 2CKOA 2OSCA 1ZMWA 4BTJA 5HO6A 4I5CA 3EKNA 2ZM4A 3PRIA 4TXCA 3R9RA 2G2FA 5LWMA 3AGMA 1S9IA 3BPRA 3UODA 1ZY4A 4YC6A 5A3XA 3GT8A 2PZYA 4FG9A 4Z16A 3KN5A 2YM3A 3F7WA 3FLZA 4EORA 3LFSA 5HBJA 1H4LA 5HCXA 3Q53A 3DB8A 4QTBA 2JBPA 2J7TA 3BQCA 3HZTA 3KK9A 1PXJA 1A06A 3NAXA 5CSPA 1MP8A 5FP5A 4WG3A 3DOGA 3BRBA 4ANBA 2W5BA 1H1SA 5HE3A 4AF3A 2SRCA 4FSMA 1ZYDA 3C1XA 2YCFA 2BHEA 1J1CA 3ORLA 3W2OA 1GNGA 4AWIA 4NWMA 4WNPA 3HV4A 3QL8A 5CXHA 2UZTA 5DR6A 1YVJA 3GU7A 3VVHA 4B8LA 2X9EA 2YA9A 3RHXA 3LFCA 5CAVA 5JH6A 1F5QA 1ZLTA 3PE1A 4MF0A 4Y73A 2XKEA 3MJ1A 4LL5A 5IF1A 2IPXA 2WTKB 3E92A 4BHNA 3Q52A 4ASZA 1YWNA 5KBRA 4FTUA 4G3DA 1J3HA 2IN6A 2ZVAA 4FIJA 3V5WA 3MY1A 3GFWA 1L8TA 4RVTA 2GCDA 3GU8A 5FTOA 1H27A 5AP5A 1GZKA 1QPJA 4QTEA 4LGGA 4ASDA 3NAYA 2WMAA 3LAUA 3I79A 4IJ9A 3L9NA 4K9YA 2F49A 5AV0A 2J2IB 4XV1A 2WEIA 2R2PA 4ALVA 4NKSA 4BCMA 4EZ5A 3FL5A 4HGTA 5M51A 3GOPA 4TNDA 3TEIA 3W2RA 4AP7A 3IW6A 4JL9A 2GMXA 3NX8A 3DTCA 3KF7A 5F9EA 4EUUA 5LVMA 2GFSA 2B9JA 2EXMA 3HECA 3HP2A 4AFEA 2W0JA 1GIHA 5D7VA 5CI6A 4CTCA 1Q8TA 3RK9A 1FBNA 3GCVA 3BGZA 3TJCA 5E8ZA 1G8AA 4KKHA 5JZNA 3QTQA 4BZNA 3OHTA 3RPOA 2Y4PA 3R7VA 5AEPA 1JQHA 3C50A 3Q2MA 5EOBA 4K77A 3UYTA 3V5JA 2YCSA 4IM0A 4CT1A 4CZUA 3TIYA 1H24A 4UMRA 5KMKA 2VWIA 5E9EA 2W1ZA 5JFWA 2W9ZB 4PTCA 5K4IA 5IG1A 4FTQA 4PPBA 5AR3A 2I40A 1Q41A 3NIEA 2WQNA 2XRWA 4V04A 4RFMA 3PTGA 4FF8A 4QMVA 4AW2A 2X81A 4Z9LA 2P4IA 4JQ8A 3A60A 4LRKA 2ZB0A 2VGOA 1GZ8A 4UYAA 3W1FA 4C59A 3M42A 4OBQA 1OPKA 4RVMA 3DLSA 3LQ3A 4F7SA 4IEBA 4DLIA 1ZYCA 1FMOE 5JFXA 4XHKB 4TZRA 3TKIA 3F2AA 3QTUA 4O91A 2P55A 4RJ6A 5E8YA 1H01A 3LFBA 3R22A 4OGRA 2XS0A 4CFVA 5J7HA 4FNWA 3DFAA 4KNBA 1Q8YA 5AP1A 3PA3A 2JEDA 2YEXA 4QMYA 2GHLA 3QCYA 3DAEA 4U0IA 4YJQA 3NUSA 5A4QA 2JC6A 3KXXA 3ZUTA 3PJ8A 3L8VA 4IDVA 5KX8A 2B1PA 4YZBA 4A7CA 2VU3A 1H1WA 2W4JA 3OCGA 4XG9A 4BCPA 4DEBA 4KBCA 1RJBA 2CCHA 5LCJA 3LXPA 5C9CA 4E6QA 2WTKC 3VBTA 4WG5A 5D1JA 4EK3A 1KV1A 2OIDA 4BI2A 4RJ5A 5A6NA 3VBYA 2CNQA 4FZDB 4TYHA 4DF3A 3RWPA 5IA3A 1YRPA 1WVYA 3OTUA 4BKZA 2PZIA 4NK9A 4ZSLA 2C6EA 2EUFB 1UWHA 3JY9A 3C0IA 2GU8A 1Y8YA 2VWBA 4ZZNA 2AC5A 3F88A 1SM2A 4LQMA 4O27B 4S34A 4ASEA 5M07A 3BE2A 3QZIA 4DG0E 4TTHB 4GUEA 3OUKA 2Y0AA 4IVDA 2ZB1A 1E9HA 3R8UA 5CANA 4RX8A 2CNUA 4D5HA 4B6LA 1YOLA 3LQ8A 3FLNC 2W9FB 2XEYA 4C4HA 2WXVA 4P5QA 4CGAA 1VJYA 5ANDA 3UNKA 2EXEA 3U54A 3FZ1A 3EH9A 3ZC5A 3DCVA 3QYZA 2VX1A 1U54B 3FE3A 4QYHA 4ALWA 5HTBA 3LCSA 4IWQA 4BHZA 4FA2A 2PZRA 2P3GX 4J97A 4P5ZA 4W8DA 4Q5HA 3DXQA 4BCHA 4S30A 4R8QA 4QYFA 3VUMA 4YURA 3U9CA 3T8OA 3PRFA 4DHFA 1PXPA 4V01A 5JKGA 5LXMA 4O84A 4RIYA 3ORPA 5J8IA 3ZO2A 5HNGA 1YDRE 4E4LA 2OLCA 3OBJA 5FXSA 3COHA 3EQHA 4M69A 4QOXA 2X9FA 5IA0A 5IQAA 5BVWA 2O64A 1M2RA 1FVRA 3F5XA 4W4XA 4U45A 1YDSE 1P14A 5L4QA 3QZHA 4TYIA 5HLWA 3ZSHA 3FQEA 1J7IA 3HRCA 2YFXA 2XIRA 5AWMA 3KRRA 3HLLA 4GCJA 4YMJA 2BR1A 4LV5A 4XJ0A 3ZHPC 4CFXA 5A54A 1FQ1B 2W1HA 3QALE 2XM9A 4J53A 5I9XA 3QCQA 2W96B 5AP0A 4L68A 2ITPA 4P7EA 4H3PA 1KSWA 4YLJA 4RWKA 3BBWA 2I0YA 2OJJA 5EW8A 3V5QA 3P7BA 5AR8A 4BY9E 1JVPP 4RWLA 4M66A 1R39A 2WMXA 4ZTMA 5HD7A 1M52A 3IW8A 1Q5KA 3MFSA 5HG8A 4X7QA 2J0JA 1J1BA 5CT0A 5TOZA 4D55A 5JMSA 4O7TA 1XQZA 4JG8A 4IFCA 4ENYA 2F7XE 1REJA 4F9WA 4USFA 4BCGA 3C4FA 3NUUA 4MKCA 4PTGA 4WT6A 5T6KA 3VF9A 4AZFA 4YTHA 2OG8A 3MYGA 4EOLA 4CKRA 5KO1A 2Y9QA 5CSWA 3WF5A 1XBCA 1Z57A 5HIEA 2YABA 3R0TA 3HAVA 3VUGA 2HIWA 4YU2A 5IISA 5IQEA 4EQMA 2ITTA 2PU8A 4L6QA 5CY3A 2WMVA 4K6ZA 4HCUA 1BX6A 5HIDA 5EOLA 3FHIA 4TW9A 5AX9A 5JRSA 3ZBXA 3ID6C 4J71A 3B2WA 3LQ5A 2BILB 2QOLA 4E6AA 5J9LA 1BL7A 1Q61A 5M06A 2QHNA 2RG6A 4F7NA 5IQIA 1OITA 2ITQA 2Z7SA 3O7LB 2WHBA 4E73A 1ND4A 3AXWA 5CAUA 5E8WA 4FKSA 3GU6A 4XG4A 4CYJA 4XG3A 3DK6A 1SZMA 3LJ2A 4GJ2A 4KIKA 1R0PA 2HWPA 3DS6A 4E20A 5FGKA 4R77A 3VUTA 4FVPA 3JY0A 4MF1A 2QO7A 4NTTA 3ODYX 2QC6A 4BCNA 3HDNA 2AYPA 1P4FA 3TJDA 3TNHA 4W8EA 4RIXB 3QD3A 4FL3A 3MPMA 5KHXA 2IZRA 4M3QA 4O0RA 3R30A 3HV6A 2W06A 3DGKA 4FT9A 4BICA 4ACHA 4O0UA 3UPXA 4LOOA 2NPQA 3G33A 4PMSA 4RBLA 4FNYA 3GCSA 2HW7A 2UZOA 3LZBA 3B2TA 3OT3A 4EK5A 3S00A 4HGSA 1SYKA 4XV9A 2I6LA 4AOJA 2VTMA 2YZLA 5FLFA 4GYGA 5LWNA 5EQEA 1IASA 4BZOA 3W33A 2GSFA 4WRGA 3SD0A 4GG7A 1ZZ2A 3QCXA 3NWWA 3F3VA 4JQEA 5LVOA 3QQLA 3PXRA 3G0FA 4ZS4A 4CRSA 2IZTA 3UQFA 5DT4A 4BTFA 5HBHA 2RFDA 4D1ZA 2XJ0A 2Z7QA 5CX9A 5ANKA 2OBJA 5T3QA 3AT2A 4YSJA 4DFYA 3UG2A 4UYNA 4DA5A 2HELA 3VF8A 4CKIA 4H36A 3LCDA 3MJ2A 4WD5A 3RAKA 1UWJA 3FHRA 4EK6A 1QPDA 4FUYA 4KRCA 3ZC6A 2W1CA 3HGKA 4J99A 2OZAB 5DBXA 2GQSA 2C6MA 1E1XA 2I1MA 5FWKK 3T9IA 4I41A 1WMKA 3BWJA 5HE1A 1RE8A 4RA5A 3WBLA 3SOAA 4YZCA 1V0OA 3HVCA 3EQCA 3ZDUA 1ZAOA 2QKWB 3GNIB 3KL8A 3ORMA 4MBJA 5B2LA 2ZAZA 2B52A 2VNWA 4PQNA 5ITAA 3TNQB 5HBEA 3WZKA 2EXCX 2R3IA 5JT2A 3ITZA 4G5JA 4S32A 4O7YA 4ACMA 1WVXA 4M97A 2QLUA 1GIJA 2VTHA 4BB4A 3FZRA 1OIUA 3HUCA 4EH9A 5J79A 3ZLYA 2CHLA 4DGGA 4DGNA 4DAWA 2QNJA 5F4NA 4AS0A 4EBVA 5TR6A 1BMKA 3AD5A 4QP8A 4UWBA 3C5IA 3DJ7A 1H0VA 2XKDA 4USDA 3RALA 3V5TA 3V5LA 4O86A 3R63A 2C30A 3CXWA 4ANMA 4AZVA 4U41A 3UIMA 2YIXA 4HW7A 5M09A 3FLWA 4MXCA 4LOQA 4NT4A 4DGOA 4YTIA 3VS2A 3TV7A 1M14A 3TZ8A 3H30A 3EN6A 5E8UA 4DEEA 1GIIA 3R1SA 3UIXA 4ZSAA 2EVAA 2LGCA 4QMNA 2AC3A 2W17A 3COIA 4QP7A 4JJRA 2GPHA 5LVNA 5TE0A 4IADA 4APPA 1AQ1A 2XK3A 4YJVA 4YC8A 5L2QA 3PXKA 4N70A 5CZIA 4H39A 4MWHA 4FTJA 4IH8A 2X7FA 4YNOA 4AW0A 3SG9A 2O5KA 2YAKA 2YZAA 4IZ7A 1MQBA 2YDIA 3OOMA 1O6KA 4GEOA 4RG0A 5AUYA 2CMWA 2W1EA 2JAVA 2Y6MA 2BFXA 3NNXA 2J50A 4IAAA 4UEUA 4XRJA 4GMYA 4X21A 3ZXTA 4AT5A 4FKTA 4CRLA 2CCIA 5EFQA 1OUKA 4AOTA 3G2FA 2J0LA 1UV5A 2ITWA 3EOCA 3NR9A 3C0GA 3W2QA 3PE2A 3C4CA 1Q8ZA 2OXDA 4ZAUA 5KKRB 4JOAA 2JAMA 1KUTA 2Z7RA 2ITUA 3A7HA 2C0TA 4FICA 3VS6A 2QG7A 5AV2A 1FGKA 2HZIA 4FKLA 3ZCLA 3I0OA 4BDGA 4E8AA 1YQJA 4M15A 1H0WA 1CKIA 2C5OA 4U97A 3ZUVA 3NSZA 2QU5A 3AT4A 1Q4LA 4ONAA 4RT7A 1STCE 4DITA 3PUPA 2VTTA 2BVAA 5BX0A 3O50A 4GK3A 5D7AA 5DNRA 3FBVA 3F9NA 4JIKA 5GNKA 4RJ3A 4DEAA 2HCKA 2GFCA 2QOQA 3LLTA 2XRUA 5J95A 1W8CA 2X0GA 2DWBA 4S33A 3QRTA 4IZ5A 4YHJA 3ZLWA 3ZRKA 3D5XA 5E8XA 3RK5A 4E1ZA 4C4FA 2YM4A 3HMNA 2UVXA 4FKPA 4XP3A 4XUFA 4FIIA 3BI6A 4XS2A 4GL9A 4QP1A 1OZ1A 3H9OA 2CGUA 5CNOA 4LGDA 1YHSA 3A7IA 2DS1A 2NRYA 3LFEA 4GIHA 4UALA 3CTJA 4XG2A 5CEQA 1Q3DA 4BCQA 4EZ7A 4YPSA 5HX6A 1O6LA 4L00A 4TYGA 5JQ8A 4P90A 2B54A 5HVKA 3EQBA 4BBFA 4M7IA 4JRVA 4MH7A 1ZWSA 3U9NA 4DEDA 4I0TA 4NU1A 5AV3A 2OKRA 3SXSA 3A2CA 4I5MA 5FEQA 4BWKA 3GU4A 4AFJA 3DBQA 3M11A 3RZFA 3JYAA 2PUUA 3AMBA 3CTQA 4WBOA 2IVUA 1UU3A 3PSDA 3KGAA 4O7WA 4O7NA 2CGVA 2W5HA 2GNIA 2B53A 5ETCA 3R8VA 1O6YA 2E9OA 3OZ6A 3KMUA 3DBFA 3SW7A 5K5NA 5HX8A 2QG5A 4JBQA 3N4VA 4MNEA 2XK4A 2RKUA 3TTJA 3PXZA 3PA5A 3G15A 4BTMA 4GH2A 5JFSA 5EYMA 4D9TA 4O96A 3V6SA 2JKOA 3BLRA 3SAYA 5ACBC 4C61A 3S2PA 5E7RA 5HTIA 3EQDA 4D0WA 2FSMX 5LARA 4PNIA 4YZDA 3FXWA 4CLIA 3OEZA 2YM8A 3POZA 2BDFA 4HNFA 4AUAA 5AIKA 3G0EA 4BDFA 3CS9A 3DLZA 4Y95A 4D58A 4D4RA 3DKFA 3VJOA 2XIXA 3UVPA 4P4CA 3VN9A 2O65A 2YWPA 3V8SA 1LEZA 5HO8A 4F7JA 3F82A 5EYKA 4MYGA 3R7OA 4NM0A 5DEWA 3WYXA 2BIKB 5DMZA 4I92A 2JLDA 4N0SA 3D7TA 3Q9XA 4KINA 4AA5A 1I44A 4TWCA 4A4LA 5DR2A 1MRUA 4L43A 3ZXZA 1VYZA 5M55A 3UZRA 4R7HA 2P2IA 2PSQA 4E4MA 2Q83A 3DT1A 2R9SA 4GIIA 3DV3A 3QGWA 4FR4A 2OF4A 4I24A 4HVIA 3GEQA 5A4EA 4MAOA 4NFNA 1GOLA 4FIEA 2WOTA 3AC8A 4EOQA 2CDZA 5D41A 2B9IA 4M67A 4CG8A 4NEUA 3FL4A 3WILA 1IAHA 2W1DA 2WQOA 5CENA 4B7TA 4RFYA 2PMNX 3PFQA 4FTCA 3GC7A 2Z2WA 3DNEA 1XWSA 3CPBA 2XBAA 1W84A 1UKIA 2XKCA 2R3LA 3VUKA 4NCTA 2QURA 3U6HA 4KA3A 1NVSA 4KWPA 3REPA 1R78A 2RIOA 2FH9A 3BEGA 4QMTA 3R7UA 3WOWA 5J9YA 1RDQE 4IVBA 3ZZWA 4W4WA 2HAKA 3D2IA 2C5YA 4R5SA 5BUIA 4WNOA 4PMTA 1UU7A 4C02A 2UW4A 5BVEA 1H1PA 1T46A 4K8AA 4ZLZA 3QQUA 4EK4A 4XG8A 3LHJA 1LPUA 3DBDA 1QPEA 2IVVA 4L44A 4DEIA 4C38A 4YGAA 4I6HA 4CTBA 4OT6A 3TT0A 4QP2A 5IQBA 1ZOHA 5C4KA 2FSOX 4NW5A 2UVYA 2XK6A 5HICA 2JDRA 5EI8A 4E93A 4DCAA 2UZLA 3UNZA 4HYUA 4EHEA 4NIFB 3OCBA 4IB1A 4G3FA 5BYZA 1JPAA 4IACA 3KRWA 4I6FA 4DG2E 4NJ3A 4CNHA 5KCVA 2BAJA 4YTCA 3BYSA 1JKTA 3ORIA 3FKLA 3GGFA 2XJ1A 3QYWA 1IA9A 2WMSA 5CU6A 3AT3A 3NYNA 1WVWA 2WD1A 4X3FB 3WZDA 4BI0A 2BFYA 3TTIA 3H10A 3MY5A 3R1NA 2CLXA 3BE9A 2R64A 1OBDA 4RIWB 5HVJA 3BU6A 3MB7A 1OL1A 2O63A 5AJQA 3MFRA 3E93A 4CFUA 3ZBFA 1CM8A 1QMZA 1Y91A 3C13A 5HCZA 2UW8A 4KAOA 4BKJA 5CEPA 2R0IA 4AZEA 5DG5A 1JWHA 3VRYA 2WTDA 3UG1A 1BL6A 4II5A 1WBOA 3U55A 3P1AA 5CF4A 4WSQA 3IECA 5CTPA 3QQHA 3QTXA 4PMMA 3SRVB 4LM5A 2ERZE 4RJ8A 3UVRA 3AC4A 3QUEA 3S1HA 3HV7A 3DZOA 3QFVA 4YHTA 3RJCA 3CC6A 1CKJA 3D4QA 3F3UA 4IWOA 2WMWA 4IDTA 3QKLA 3RI1A 5DIAA 3E3PA 1PKDA 2HK5A 3NPCA 5HHWA 4B9DA 3RCDA 4E6DA 3EFKA 4QMWA 4WIHA 3RGFA 3F2NA 3MS9A 4IW0A 1DI8A 2UZEA 3MY0A 5HOAA 3UVQA 4FZFB 2QOCA 1J7UA 4L8MA 4PDYA 4MQ2A 2WO6A 4PP7A 4BCJA 4HVHA 2YM5A 3DTWA 3NLBA 2IVTA 2YCRA 5AM7A 5AP2A 5BVKA 1GAGA 4QNYA 5CSHA 3S95A 4ZK5A 3P86A 4FV6A 4KSPA 2G15A 4BYIA 4O82A 4MK0A 3IO7A 2BAKA 3DFCB 4DN5A 2VO3A 2V62A 4BVUA 2X1NA 5AAGA 3QHWA 3OEFX 4OTGA 5AP6A 3PZHA 5LMKC 4EUTA 3L9MA 1URCA 5DLSA 4WBBB 4F63A 5H8BA 3AC2A 3WZEA 2W05A 4L42A 3PXQA 2Y7JA 2CKPA 1UVRA 3QRKA 5AA8A 3IONA 4IVCA 3AMAA 1Y6AA 3IG7A 2ETMA 1YXTA 2C1AA 4JT3A 1CTPE 5CASA 4ZY4A 2XIZA 4DYMA 4RC2A 3EKKA 5I0BA 5J5TA 3CTHA 4YZMA 3ETAA 1HCKA 3KVWA 4TYJA 4AA4A 3R73A 2IJMA 4X3FC 4G6NA 3ZSGA 4B4LA 2F9GA 3MH3A 3UOLA 4H1MA 3BBTB 3Q4UA 2UW0A 5IUGA 2VTPA 3QD2B 3QLFA 1KE8A 3HP5A 3ZTXA 1XR1A 2XB7A 4UV0A 5K9IA 3R9DA 3V04A 4RSSA 1PRYA 4DT8A 2C0OA 4O0XA 5AUVA 3MFUA 3VHEA 5FRIA 1ZYSA 5JK3A 2XNMA 3V3VA 4J95A 4U40A 1IRKA 2OF2A 1WBWA 2OK1A 3LIJA 3OWPA 1NVQA 5FTQA 4C3FA 3HAMA 4OAVB 3KVXA 1YWRA 4RQVA 5LQFA 2RG5A 2Y8OA 4U79A 4EI4A 5CYIA 2DQ7X 3KXZA 3R8LA 4FT3A 4E5AX 3BU5A 3ZEPA 4Y8DA 1IEPA 3QGYA 1XBAA 3FMHA 3TV4A 3KREA 2IWIA 1MQ4A 4FVRA 5JGAA 3G51A 3QCSA 3MBLA 4MCVA 2YN8A 4DFUA 4JAJA 4GUBA 4D2VA 1VR2A 4FK3A 3SKCA 3A99A 4EH8A 5K0XA 4NYEA 3R1QA 5EI2A 4GV1A 4FEXA 2ZV7A 2A27A 4QMXA 2W4OA 3CQWA 5AP4A 4EHVA 4O1PA 2GS6A 2VN9A 2R7IA 5L6PA 5KZIA 4CCUA 2XEZA 3SGCA 1JBPE 5EQPA 3EFJA 3ELJA 2C5VA 2OW3A 3KRXA 4ZEGA 3FY0A 4A9SA 3IW7A 3BV2A 4N4SA 4UMTA 3RKBA 4BDEA 4C3PA 4C4EA 3BYUA 1G8SA 4ANSA 2IG7A 3R1YA 3UC4A 3RZBA 2BDJA 3FZSA 3KXNA 4RZWA 4AG8A 4GU9A 3RPVA 4IB3A 3F5PA 3GFEA 1PHKA 4G3CA 4UB7A 4GVAA 5CSXA 3Q6UA 5KMIA 3QQGA 4L45A 4CFFA 1YW2A 5FXRA 2IVSA 2OGVA 4Y83A 1MRVA 3VC4A 4BCIA 5FBOA 3F3ZA 3AG9A 3BYMA 3C4EA 4O0TA 4Y46A 2CNVA 4LV8A 5GINE 5FM2A 1K3AA 5E90A 4R1VA 5HG7A 2ZOQA 2RFNA 4FTKA 2OJ9A 4UZDA 5CS6A 4I1ZA 4BKYA 3EN7A 4KKEA 4NW6A 4EKLA 2CPKE 2VV9A 2VWVA 2FUMA 2R3KA 4MTAA 4BDDA 5C4LA 5AR4A 5CEKA 2PWLA 3CP9A 3D94A 3JXWA 1PJKA 3RAWA 4CCBA 4BIDA 2J5EA 3ENMA 4FV7A 3WE8A 1KOBA 3QRUA 3P5KA 3PJ3A 3OD6X 1M7QA 1CSNA 4GJ3A 1KWPA 5J1VA 3KU2A 4QMZA 4FI1A 4L3LA 1OGUA 3MH1A 2I7QA 3ZLXA 4ZLYA 3NZ0A 3F3WA 1R1WA 3II5A 4AE6A 4F6UA 4DH8A 3FC1X 1ZOGA 4LRJA 4G1WA 3K3IA 4FNZA 4FX3A 2RFSA 3UZTA 2I0EA 1W0XC 5AMNA 4RA4A 2V7AA 3TNIA 3K5VA 4ERKA 5CT7A 4LMUA 3OXTA 5EHLA 2H6DA 3HA6A 3E87A 4FOCA 3BQRA 2ITXA 2F2UA 3Q6WA 2XYUA 4FMQA 4D28A 5M56A 1SVHA 5E8VA 4Y5QA 5JFVA 5M08A 2IO6A 4W9WA 4BGHA 4O7ZA 3SC1A 5EW3A 2PVHA 2X8EA 4WRSA 2BZIB 3NYVA 4FUXA 4NM5A 4EOKA 4HGEA 3DXPA 4ZTRA 3ZFMA 1WBPA 4YO6A 4AZSA 2QODA 2HENA 3VWAA 3RAIA 4D5KA 5L8LA 4E5WA 4FTNA 3GOKA 3Q9WA 4UBAA 4U8ZA 2JKKA 2CJMA 4YP8A 3KRJA 4MD7E 5ICPA 4U81A 2WB8A 4I4FA 4CKJA 5I5ZA 4JBVA 4C4JA 1OMWA 1L3RE 4QTDA 4ASXA 2WQMA 2XNEA 5DOSA 3H3CA 4A4XA 2YDJA 3A4OX 2WU6A 3E62A 4M0YA 4MVFA 1Q97A 2OZOA 4FT7A 5DN3A 3MH0A 2XCHA 3K5UA 3FPMA 5HTCA 2KTYA 3Q32A 1XH8A 3SXFA 1WAKA 4QMMA 5HCYA 3SOCA 3NYXA 4ITIA 2XK9A 4ARKA 5EM8A 5C8MA 4CXAA 2E9VA 4QMOA 5BQ0A 5HG9A 3FLSA 2C6KA 2X7GA 3OWKA 3QD0A 4XG7A 5DGZA 2X4ZA 2IW9A 1F0QA 1U54A 4TRLA 4ZSJA 4C8BA 5I9UA 1SNUA 3NMUF 3NVMB 4PTEA 4XH6A 5AR2A 5IA1A 1K2PA 2UW7A 3NCGA 3CEKA 4K33A 3WI6A 3WZUA 4UZHA 2W99B 4J7BA 3CPCA 3GXLA 3S3IA 2VTQA 1ZARA 4EH4A 3BIZA 3VS1A 4HPUE 3T3VA 2GTNA 5BUJA 1JSTA 1NW1A 1TQMA 1SNXA 3EQFA 3R7GA 4OTHA 4C58A 4O1OA 3EQIA 4RIOA 3I81A 5CF8A 4FEUA 4NJDA 5E8SA 4C36A 2JKQA 2WOUA 2FYSA 2YLEA 1LP4A 3OFMA 3OW3A 2B7AA 3RTPA 3O17A 5M4UA 1AGWA 2AUHA 3C9WA 3I4BA 1PMUA 5BYYA 3TACA 3PJCA 2X6EA 3A7GA 3QLGA 4FEWA 4H3QA 2W1IA 2OXXA 4QPMA 3SLSA 3UQGA 4C37A 4EWQA 2R7BA 4HVDA 1IAJA 3BKBA 3VQHA 3VUDA 5GZ9A 2HW6A 1FGIA 3QKMA 4ZZOA 3R7YA 4BBMA 5KMJA 5IH6A 3OCSA 2QO2A 4X2GA 4CQEA 2BUJA 3QTWA 4CT2A 3LJ0A 3FI8A 4NH1A 5IQDA 1ZMVA 3NUYA 4FV1A 3TUBA 5I9ZA 3RMFA 1KE6A 5A4TA 2YDKA 2VTNA 5C03A 2OXYA 3R9HA 5A6OA 2C6LA 1T45A 4JLCA 4GK4A 2BROA 4OTRA 4AZWA 4U42A 3ZU7A 3Q5ZA 3A62A 3KMWA 2VUWA 3QRJA 4DFNA 4K18A 4EZ3A 5IEVA 4Q5EA 4UY9A 4D1SA 5HD4A 3LE6A 3FI4A 3P7CA 5EYCA 4MWIA 3BYOA 4LUDA 5HESA 4KB8A 2GDOA 4YZ9A 3BHUA 4UMPA 5IQHA 3NW7A 2O3PA 2CN5A 3TNWA 3U6IA 3DA6A 3LJ1A 3RCJA 4DC2A 2W5AA 2XK7A 5F95A 4QD6A 2XNNA 3HUBA 3D5VA 2HXQA 4FTAA 5LCKA 4E7WA 3ZUUA 4Q9ZA 4Q9SA 5L2IA 2P0CA 4PRJA 5BMSA 3CGOA 4IQ6A 3SA0A 4JRNA 5GZAA 1PMEA 3VS5A 5IA4A 3UPZA 4M84A 1OIYA 3LFNA 3Q4ZA 4LL0A 4U43A 5EM6A 5HNIX 2PHKA 3FQHA 5EHOA 4BL1A 2HY0A 2R3PA 3K3JA 2WEVA 3MDYA 4BTKA 1OVEA 3GUBA 5C8KA 3KY2A 2OICA 3WE4A 1W7HA 2V5QA 3V5PA 2PE1A 1GZOA 2C6TA 2G1TA 3DK3A 3N51A 2ITVA 3QZFA 4M0ZA 3P08A 5CU3A 4AN9A 2UW9A 4EL9A 3BHYA 5AV4A 4RIXA 4WSYA 2C68A 4ZMFA 4UMUA 3SW4A 2YHVA 5M57A 3U6JA 2PUIA 3KMMA 4XRLA 3G90X 4DFLA 3Q96A 4EOOA 4DBNA 4E4NA 4DEGA 4OAUC 3PJ2A 4DLJA 3ODZX 4FOBA 2FB8A 3UGCA 3DBCA 2BKKA 3H9FA 3PSBA 2PYWA 4FE2A 5IZFA 4DEHA 4HVGA 1OBGA 4KBAA 1NXKA 3FJQE 3O8UA 2J0KA 3VW6A 4GU6A 1YOJA 3UDBA 5HU3A 4R3CA 2VAGA 3QWJA 4JR3A 4YR8A 5JGDA 3TKHA 4QMSA 4BWPA 2X39A 5IH5A 2YIRA 2BCJA 1YWVA 1GY3A 1XKKA 4AW1A 4JG6A 3AMYA 2X6DA 3I1AA 4XX9A 3QX2A 3RPYA 3PJ1A 3ULZA 5I4NA 4FG8A 1NY3A 5K0KA 4ZMEA 1YHWA 5IQGA 4CMOA 2OIBA 3ZEWA 1H1QA 3DPKA 4EYMA 3R71A 4YLLA 2FA2A 4AW5A 2OH4A 4UWYA 4O0WA 3G6GA 4I3ZA 2QR8A 3BU3A 2OZAA 3A61A 3MH2A 3ANRA 4OTWA 4ZP5A 3UIBA 5TT7A 4B99A 4O7RA 3UP7A 4PL4A 4FGBA 1OL7A 4J8NA 4U3YA 4WHZA 5EDPA 2XNOA 3KRLA 3IDBA 3MWUA 2UZDA 4CFWA 3JS2A 1H00A 1PXOA 5I3RA 4EOSA 3FMDA 3QBNA 5D9HA 4FG7A 1XH4A 4B8MA 3W10A 5IEXA 4FYOA 4PL3A 5CU2A 3CCNA 3JR1A 4Y85A 1PMVA 5DRDA 4QP3A 5B0XA 4XLIA 2R3NA 3DQWA 5FEDA 3QTSA 2ZV9A 4RX7A 2PVRA 2IW6A 4KRDA 4TWOA 2UZNA 2V7OA 2F57A 1JNKA 3MW1A 3TZ7A 4YJPA 4MBIA 2PVJA 5ANGA 4GG5A 4CZYB 3E8EA 4G6LA 3AOXA 3M1SA 2PMIA 4WG4A 1OKYA 4USEA 5BVFA 4K0YA 4E26A 3PLAE 3PVWA 5BVDA 5L6WL 4RGJA 5GJFA 3HDMA 4KIQA 5CU0A 2JIUA 1YI6A 3C5UA 1WFCA 2VO6A 3PPJA 4JVGA 4AOIA 3PVGA 3R9OA 4XOZA 2PUPA 3CQUA 3D0EA 3EQPA 2GNLA 3UQCA 1J7LA 3OY3A 1PW2A 1PYEA 2PVMA 4F64A 3I60A 3GI3A 4NZWB 4PDSA 3UO6A 4OTFA 3VBQA 5L3AA 4ANQA 2BTRA 3F6XA 4QYYA 5BNJA 2C5NA 3MPTA 5H8EA 3R9NA 3WF7A 3LMHA 4AAAA 4XOYA 3RNIA 4CZTA 4QMQA 5EQYA 3FV8A 3V51A 2J51A 4Z7HA 4N57A 4ZTQA 4LFIA 5AP7A 3IGOA 1JKKA 1FPUA 4V0GB 2VWWA 4ZS0A 3LFQA 2E9UA 5BMMA 4APCA 5J1WA 5DT3A 3QAME 4JXFA 4N6ZA 4JQ7A 2G9XA 4I0RA 5TF9A 1OL5A 4MNFA 5D11A 3L8PA 4JG7A 3DKGA 4OR5A 4X6RA 1I09A 4X2KA 3W32A 4TL0A 4DBXA 5EM5A 3VS3A 4ANOA 5IA2A 2UW5A 1APME 3OT8A 4F0FA 4W4VA 1ZYJA 5IQCA 3R02A 4FBXA 4FV0A 3O51A 4I5PA 4OTIA 1WBNA 4FVQA 5E8TA 2C3IB 2YM6A 5E91A 3NDMA 4PY1A 2X8DA 2R3JA 4A9YA 4RC3A 4CV8A 5ETAA 4RVLA 3C4ZA 1M2PA 2UVZA 3IQ7A 1REKA 2QOKA 3I6WA 4KIPA 5CI7A 2Y4IB 2YITA 4KKGA 4JBOA 4NL0A 1PXIA 4IZYA 2VTIA 2PZ5A 4YBJA 5BYLA 4DTKA 2J9MA 2EB3A 2GQGA 2WQBA 2ONLC 4XP0A 1OPLA 3FDNA 3LVPA 3TIZA 3F61A 4YBKA 3LCOA 4BGQA 3IW5A 1NA7A 4TT7A 1R0EA 4FKJA 2PK9A 2WAJA 4X0MA 1IA8A 1VEBA 4JI9A 4HYHA 3KC3A 4HYIA 2ZDUA 4W9XA 1JSVA 3Q4CA 4C4IA 5DHJA 2NRUA 1BYGA 3V6RA 4AT3A 5M44A 4YJSA 2XK8A 4IIRA 1E1VA 3HL7A 5ACKA 3VUIA 4BCFA 3FLYA 5AAEA 5L6OA 3F2RA 3EB0A 2GTMA 4R7IA 4XBRA 3W2PA 4C7TA 4D0XA 3LXLA 4HZRA 3R83A 5HVYA 5CAOA 3L9LA 5T68A 2W1GA 2Y6OA 1W98A 3BX5A 2E9PA 2I0VA 3HKOA 4IX4A 4ZY6A 4AA0A 5L8KA 4CFMA 3LOKA 5M4CA 3FMJA 3IOPA 3GVUA 4ACDA 4K1BA 1OKZA 2PMLX 4KABA 3MPAA 2UV2A 2QCSA 3KULB 4XYFA 4JIAA 4O0YA 2C5XA 2WTWA 3WIGA 2P33A 4PX6A 4ZTLA 3VO3A 5IDPA 3OY1A 4QP6A 3OUNB 3TM0A 2JDVA 5HLNA 5F20A 4G9CA 3ROYA 4IZAA 3WF8A 2HZ0A 1YDTE 3RP9A 3UYSA 4ALUA 2PVFA 3TNPC 1SVEA 4HOKA 2XKFA 2BHHA 4WOVA 4F1OA 4FTTA 5ANEA 4GKHA 5B2MA 5KMLA 2EB2A 1B6CB 4FTRA 3SHEA 4FV4A 4EKKA 4M8TA 4W4YA 4KUJA 5IEYA 1YXSA 4GT4A 4EBWA 4ANNA 3W8QA 4FEQA 4TYEA 4AT4A 1BLXA 2WMQA 1NVRA 1OKWA 1GZNA 4RWJA 2OFVA 2X2KA 3DB6A 4AX8A 3W8LA 3G9NA 4AN3A 1BKXA 1F3MC 2XCKA 3FZTA 3SV0A 4BN1A 3FEGA 2Y4IC 2VX3A 5CQUA 2B55A 4G2FA 3L8XA 2GHMA 2HZ4A 3HRFA 4ZIMA 3UZPA 4FKGA 2C69A 3EFWA 1OL6A 3IPHA 3E88A 3MN3A 3HMPA 3QQJA 1FMKA 2VX0A 4JX3A 3PZEA 3UBDA 2VTAA 4FKQA 4F1TA 5TKDA 2WTVA 2Q0BA 4KSQA 4YLKA 2QU6A 3QC9A 3L1SA 2ZM3A 3DAJA 4QRCA 1DS5A 3EYGA 4HCVA 4OTDA 3U8WA 4EH3A 2V55A 1UKHA 3M2WA 3B8RA 1HCLA 3PYYA 4H3BA 2UZWE 5GHVA 5CALA 3BLQA 1ERKA 4MD8E 4QT1A 3QWKA 4LMNA 3I6UA 2WTCA 4L52A 2FO0A 1Q99A 4A9UA 3CSVA 2JIIA 1H07A 4MXOA 2O8YA 4NIFA 3IS5A 4R3PA 4NCTC 4C35A 4E3CA 4BDKA 2ZV2A 1U59A 2VTSA 3O23A 4M12A 3ATTA 1W83A 3D9VA 4M13A 3QTIA 3FYJX 4FKVA 3ZYAA 4F0IA 2H96A 3ALNA 4ZJJA 1DM2A 3KXHA 4XMOA 4B0GA 4FODA 4X3FA 1ZY5A 4FV5A 3E8CA 4PP9A 4IX3A 4GSBA 3NIZA 4H58A 2A0CX 4EEVA 2JGZA 4L46A 3E8NA 3OP5A 4RIWA 2VO7A 3OXZA 4BIEA 4RFZA 4K2RA 3LXNA 3POOA 4GW8A 3GCQA 4KD1A 3CJFA 3DBEA 3MA3A 2WQEA 3FYKX 3R7IA 4FIFA 4O22A 4OBPA 4U6RA 4D2SA 4FIHA 1SVGA 2B0QA 5HIBA 4J96A 2WIHA 3VHKA 1OM1A 2UZUE 3I5ZA 3MGYA 2XNPA 5CSVA 1JSUA 3SX9A 2V0DA 4C4GA 3PWDA 4EJNA 2J0IA 1ATPE 2BALA 3SRVA 4DH1A 3KXMA 3PVUA 4NSTA 3TKUA 3MVLA 3VBVA 5EM7A 2GS7A 4J98A 4F4PA 1RQQA 4XNEA 2OWBA 4BF2A 2FSTX 3NEWA 3BHVA 4AQCA 4DH5A 2A4LA 3QQKA 4AE9A 1DAWA 3ROCA 2OU7A 2XIYA 1OI9A 3PXYA 5KMMA 1PMNA 3DU8A 3G6HA 1PY5A 3NUAA 4LRMA 4O0VA 4EH7A 1EH4A 2BKZA 2VWZA 2CSNA 1DI9A 4ACGA 4FT5A 1YOMA 3HEGA 2YJSA 4CVAA 5FP6A 4U5JA 2XA4A 4EOPA 4BDCA 2WIPA 2QHMA 3NUNA 3ANQA 4U3ZA 2GQRA 5FG8A 4QMUA 3R28A 2C3JA 3RHKA 3PPZA 4LUEA 3MVJA 1DAYA 4BIBA 4G16A 4YNEA 4F9YA 3NW6A 5KUPA 3FMEA 5FBNC 1O9UA 1B39A 2Z8CA 3HMIA 3KCKA 4KIOA 4LG4A 4IE9A 5I9VA 2J6MA 4R78A 5HZNA 4J8MA 3A8WA 4BDBA 5CEOA 1PXNA 3S0OA 4HJOA 2WMRA 3VS4A 4WO5A 4TY1A 3CLYA 3OC1A 3DDPA 4L9IA 3O8PA 2C1BA 3UOHA 3I7CA 4JX7A 3FLQA 2VTOA 4RX9A 5CXZA 2A1AB 1CKPA 3UE4A 3O96A 1YI4A 3BCEA 3EWHA 4FV8A 4JS8A 1M2QA 4I6BA 4JDHA 3ACKA 5EKOA 4RLLA 2R3GA 5BPYA 3FXXA 3QZGA 4FSTA 3ZFYA 4KS8A 4E5BA 3PPKA 2VD5A 3LLAA 1FVTA 3UOKA 4O83A 4C3RA 4RC4A 1Q62A 3Q9ZA 4UMQA 4R1YA 2GNHA 3ATSA 3QXPA 5AV1A 1OL2A 3EYHA 2J0MB 3G9LX 2J5FA 3O7LD 1KOAA 3TI1A 2ERKA 3COMA 4YPDA 5FUTA 3KA0A 4IB5A 4O0SA 4O6EA 5AUWA 4F65A 1PXKA 3AD6A 3KQ7A 4I21A 4J52A 3I5NA 2QOIA 5LMAA 3U87A 3PDTA 1CMKE 2JDOA 3OG7A 3BHTA 3UMWA 2HOGA 2BZHB 3ZRMA 3EN9A 3COKA 4FT0A 3PG1A 5FDXA 4BI1A 3MTLA 3W16A 5C26A 4CMUA 1ZZLA 2XBJA 5DYJA 1WBVA 2P2HA 5CNNA 5E1EA 5IU2A 4FK6A 5D12A 4BYJA 2ZDTA 4IWDA 2CKEA 5EHYA 2BPMA 4MXXA 3NUXA 3IK3A 4TYHB 5C1QB 1M17A 4IC8A 2F2CB 3VNTA 4CYIA 3U51A 5J87A 3FKOA 2DUVA 3WF9A 4F0GA 4ZY5A 2GHGA 3P9JA 4ZOGA 3RAHA 1XBBA 2BRNA 1G5SA 5JSMA 2R3QA 2ITNA 5HNBA 5EKNA 1WBSA 2B9FA 2WMBA 2XYNA 4UXLA 3SXRA 1OKVA 3PA4A 3EJ1A 4X2JA 3MESA 5FTGA 3GBZA 3GB2A 2R3FA 4NKAA 3LKMA 1TKIA 3GC8A 3PIYA 4UN0C 1YXXA 4D4SA 2YM7A 1U5RA 4G34A 5L2TA 4ENXA 2JITA 4YC3A 3GCPA 4V05A 4XV3A 5CLPA 4XEYA 4DFZE 1XH5A 4FSQA 3FC2A 4EH5A 4AACA 2ITZA 5HGIA 2ETRA 4U7ZA 5L2WA 3H0ZA 3OWLA 3TCPA 4RX5A 5KMOA 3Q5IA 2F4JA 3EL8A 5DA3A 2QQ7A 2IZSA 3ZDIA 4D4VA 4QYEA 4G17A 2JIVA 3O2MA 1TVOA 4PUZA 3WARA 4RIYB 4LOPA 4WUNA 1VZOA 5H8GA 3AGLA 2GNFA 3DKOA 2QOFA 4M69B 5DFPA 4ZLOA 3Q2JA 3R8PA 4JDJA 5ANIA 4QQTA 2PULA 4RLKA 2B4SB 2VGPA 4H05A 2PVKA 2VWXA 4U44A 1U4DA 2ZJWA 3BELA 4GFGA 1FOTA 3CKXA 2WKMA 3PY0A 5FQDC 3E8DA 3VBXA 3PY1A 2J4ZA 5KE0A 4O7LA 4G9RA 4G5PA 4NUSA 5FDPA 2WTJA 3AC5A 4PF4A 4QP9A 4ACCA 1WBTA 5JRQA 2X8IA 3LCTA 3E63A 3QC4A 3JVSA 3EN4A 5CQWA 5A9UA 1GJOA 1UU9A 4C34A 4EQCA 4QMLA 4ITHA 2ZM1A 2VRXA 5FM3A 5DI1A 5CEMA 3Q60A 2W7XA 3O0GA 4Z3VA 3EMGA 2XVDA 1X8BA 2GNJA 2X4FA 4EONA 5M4FA 4PV0A 3PY3A 3PXFA 2BRBA 1H08A 2Z60A 1U5QA 1ZRZA 3DAKA 4QQCA 5HLPA 3SDJA 4AGDA 4E4XA 1ZXEA 4EWHA 3L8SA 3N9XA 3UOJA 3ORNA 3TDWA 5IQFA 4RJ4A 3BHHA 2QKRA 3UO4A 3Q4TA 5IH4A 1OPJA 5ETFA 4DTAA 5G1XA 2H34A 2CN8A 4DE4A 3KB7A 4FV2A 2J90A 4RVKA 2F7ZE 5DPVA 3LMGA 3QTZA 1JKSA 2VO0A 3OW4A 3F66A 3PVBA 3QA8A 4IAYA 4KS7A 5AIRA 4GT5A 4N6YA 4IWPA 5EDRA 4ZXTA 3UTOA 4QP4A 4I6QA 4S31A 3R01A 4YO4A 4IXPA 2PMOX 4IANA 3H0YA 3D14A 3CKWA 1XH6A 3HNGA 3JVRA 3QU0A 3R2YA 2ZYBA 5AM6A 3WZJA 2C47A 2R3RA 2F7EE 4MXZA 2H9VA 5CU4A 5DEYA 5AX3A 4YSMA 3CJGA 5GIOE 3FQSA 4OT5A 4BR3A 3ENHA 3HV5A 3ET7A 3VULA 3P0MA 1RW8A 2BZKB 3ZONA 5A46A 1YI3A 3C4WA 3I0QA 5E92A 3BGPA 3VBWA 1UNLA 3ZLSA 2UZVA 2WMUA 4CQGA 2JBOA 2VTJA 4C57A 2JFLA 3TXOA 2PE2A 5JZJA 4GK2A 2PY3A 4KIKB 5IA5A 4IX6A 4PDPA 3THBA 3F7ZA 4GYIA 4ITJA 3W18A 1R3CA 4FKRA 1QPCA 1WZYA 5J7BA 1P4OA 2QR7A 1XH7A 3P78A 4O38A 2VWUA 4IC7A 5LVLA 3V8TA 5BVNA 5L8JA 5AUUA 2PTKA 3QHRA 2ESMA 3BLHA 4QQJA 4JAIA 2CLQA 1Q3WA 3RBWA 4EH2A 2PE0A 3EIDA 4BRXA 4I4EA 1PXLA 3UMXA 4Z7GA 2OIQA 4QTAA 4GRBA 4QPSA 3R8MA 2PUNA 3D15A 3OROA 3ORKA 2KULA 4EC9A 2YIQA 3ZSIA 2OH0E 3WF6A 3C4XA 3ACJA 2C3LA 4XG6A 4ZTNA 5HE0A 4LGHA 4RRVA 3RINA 3UP2A 4FTIA 4BWXA 4HCTA 5LVPA 1UA2A 4D9UA 4FSNA 2BIYA 2RFEA 4IAKA 3F69A 4Q2AA 5EYDA 4EQUA 5IMXA 2ZMCA 5CWZA 5JN2A 3NW5A 2XZSA 3MSSA 3MB6A 5AADA 2YWVA 3C7QA 3DQXA 4FEVA 4HNIA 2RGPA 4YHFA 4DINA 1V1KA 1Z5MA 4YJRA 2YLFA 3E64A 3E5AA 3F5UA 3ORXA 4PPAA 2YCQA 4FIGA 2YIYA 3FXZA 5GJDA 2Z02A 1V0BA 5CVGA 3MTFA 5B7VA 4RJ7A 4I93A 3NVKI 3E7OA 3MV5A 2QOOA 4RZVA 3QTRA 2LAVA 4F08A 1P5EA 1KE5A 1BI7A 4FZ6A 2YACA 3E7VA 4AZTA 5KZ0A 3MI9A 4TPTA 5E4HA 5GJGA 4O2ZA 5CF6A 3N4TA 3PIXA 2A2AA 3R7EA 4F6WA 4ZJVA 4F9CA 3UO5A 4CG9A 3P23A 3QRIA 3ORZA 3D5UA 4EOMA 2PVLA 3DY7A 5HEZA 1KV2A 1VYWA 2XH5A 1BI8A 3D83A 3LM5A 3HA8A 2CGXA 1V0PA 4S2ZA 3QQFA 2WGJA 2QVSE 4IFGA 4XV2A 1JKLA 3OF0A 2PPQA 1MUOA 3RWQA 1UNHA 1KE7A 3ZM4A 3QD4A 2HZNA 1PKGA 3LM0A 4XP2A 5CEIA 5EI6A 4FKOA 3RM7A 4I0SA 4JR7A 1Q24A 2UW6A 1IG1A 3KFAA 4C2VA 1TQIA 1OECA 3CQEA
chains in the Genus database with same CATH superfamily
4A4OA 2NNWB 4H1JA 5A4LA 2X7OA 3A4PA 3KF4A 4FC0A 3R8ZA 3Q9YA 3ZM9A 3H4JA 1H25A 4DGMA 4ZTHA 2FSLX 5IUIA 4BDHA 4TN6A 1A9UA 3IDCA 3AC1A 3IOKA 3NUPA 3C0HA 4R7BA 2BZJA 3VJNA 4R6VA 2Z7LA 3OCTA 3FZPA 3R2BA 4FSWA 3O5AA 3BZ3A 3GC9A 4HVSA 5JGBA 4FSUA 3I7BA 4FSRA 3RVGA 4FKUA 4GT3A 4IBMA 2R3OA 5CVFA 1Y57A 4CEGA 5B2KA 5I9YA 3CY3A 1J91A 2G2IA 4EHZA 4DH7A 4D1XA 3FUPA 4PMPA 4EC8A 5LOHA 2BMCA 3C51A 4CV9A 5HQ0A 4FV3A 4F6SA 3PIZA 2C4GA 4O6LA 1KE9A 3BEAA 3CGFA 4WA9A 5KMNA 5AA9A 3Q3BA 1FVVA 3MA6A 5CVHA 3GU5A 4QO9A 4AXAA 4X2FA 5AUZA 5HE2A 5IKWA 2JFMA 1UNGA 4FKIA 3OTVA 4O4BB 4D4YA 4RWIA 3EZRA 1Q8WA 3NRMA 3EFLA 4WNKA 1W82A 3QA0A 4ERWA 5FEEA 3TZ9A 4TKSA 1H1RA 3JUHA 2YJRA 4ZSGA 3CIKA 4F09A 2HYYA 2XP2A 3Q04A 4FV9A 4XBUA 1G3NA 3T9TA 3HMMA 3WYYA 3GQLA 5AAFA 2Q0NA 4OW8A 3DXNA 4PDOA 1SMHA 4R5YA 5H3QA 4IHPA 4DGLC 4HPTE 3VQUA 3CBLA 3HV3A 4FZAB 3LMIA 3U4UA 4BDJA 1MRYA 4O7VA 2O2UA 4GKIA 3GENA 4YJTA 1S9JA 3MFTA 2IW8A 3UJGA 4D2TA 3OXIA 3R04A 4Y72A 4DG3E 3EN5A 3B8QA 3TDVA 3A7JA 4LYNA 3ULIA 2VTRA 2XNGA 3OBGA 3LFDA 4NTSA 2IZUA 4WKQA 4U80A 1BUHA 3FI2A 4JNWA 4MXYA 3TZMA 1JAMA 3UNJA 3VUHA 3UIUA 4FL2A 3ZRLA 3MIYA 1LEWA 3K54A 5LJJA 3GCUA 2OFUA 4WNMA 3HRBA 3VIDA 3PLSA 3ZO3A 4G6OA 1JOWB 2CGWA 1OB3A 2JD5A 5EW9A 1YXVA 4O21A 5AR5A 3EZVA 3TUCA 4L7FA 2QLQA 3R6XA 3AQVA 2B9HA 3DNDA 4MX9A 4DFBA 2ONLA 3LPBA 4A9RA 3RPSA 4A07A 4C2WA 1IR3A 4QPAA 3FWQA 4Y5HA 4ZMFA 3RNYA 1XJDA 1XO2B 4EH6A 5IMEA 5EG3A 2WPAA 3W2CA 3KXGA 3T3UA 4QMPA 5DE2A 3K2LA 2W1FA 3TWJA 2OJIA 4I94A 1K9AA 2C3KA 1W2DA 5DRBA 4C33A 5H2UA 4CD0A 4F9AA 2GNGA 3AC3A 4FRFA 1ZYLA 2FGIA 1CDKA 3BYVA 1PF8A 4MNEB 4OTPA 4F1MA 1PYXA 4QNAA 4FTLA 1Q8UA 5E1SA 2JDTA 4C0TA 5CF5A 3SVVA 2E2BA 3H9RA 2QI8A 3FZOA 3BV3A 5AP3A 4IM3A 3WIKA 4DFXE 4YJOA 4F9BA 3IW4A 5G6VA 2NP8A 2C6DA 4DT9A 3FMMA 3W55A 5K5XA 3NNWA 3BWFA 5AUTA 3VS0A 3W2SA 5CAQA 1Y6BA 3NNUA 2VZ6A 2UW3A 2ZMDA 4O81A 1WCCA 1JLUE 2QO9A 3LFAA 4PL5A 2UZBA 4BCKA 5A14A 2PVYA 5FD2A 4EK8A 5CAPA 5HU9A 2GS2A 3L9PA 4YJNA 3P4KA 3QX4A 4EOIA 4G31A 2WMTA 3EHAA 3HMOA 3FI3A 4NFMA 5TO8A 3FPQA 1YKRA 3MIAA 1U46A 4CMTA 4EHGA 2WZJA 3QUDA 2VTLA 3LCKA 1P2AA 4L53A 5JEBA 3KCFA 4LI5A 1PXMA 3PWYA 2CKQA 3ZH8A 5C8NA 4BGGA 3CE3A 4IAZA 4ZTSA 4MQ1A 2O0UA 2YIWA 1OIQA 4G3EA 5HG5A 3D7TB 3D7ZA 5LMBA 4FTMA 5ANJA 4IX5A 2WELA 4V0GA 5C27A 4GFMA 3GQIA 1HOWA 3VRZA 3ZO4A 1YHVA 2E9NA 2R5TA 2PVNA 2NYAA 4ZJIA 3PSCA 4YTFA 4FZ7A 2ACXA 2BRGA 3R00A 1W2CA 4D2WA 4PWNA 4O4FA 3SG8A 4IM2A 3UC3A 3QXOA 3GC0A 4IAFA 2BTSA 1UU8A 5H9BA 2R0UA 3VS7A 4F7LA 3PG3A 1H28A 3OWJA 3DJ6A 4AN2A 1ZMUA 2OJFE 2QOBA 5DVRA 5ANOA 4P2KA 1YXUA 2OO8X 4CFNA 4YUQA 3EL7A 3JPVA 4GVJA 4NM3A 3FSKA 3P79A 5BVOA 3PP0A 3V8WA 2YAAA 2PL0A 4F99A 5KHWA 4RQKA 5A4CA 5L2SA 3FMNA 5KKRC 4RPVA 2G01A 4IMYA 4WUAA 3CY2A 2EU9A 4JBPA 2OJGA 4BBEA 2QONA 3NCZA 4O7SA 5ETIA 4FGRA 3W0NA 3MVHA 5IDNA 2VNYA 5FXQA 4TNBA 5HO7A 5HI2A 3ERKA 3G5DA 5BUEA 3GP0A 2XALA 5C01A 1OUYA 3S4QA 4Z55A 3EQGA 1B38A 4EYJA 3A7FA 2REIA 3ORTA 4EJ7A 5K4JA 4CSVA 2VWYA 3DK7A 1H8FA 4HZSA 3FKNA 4M68A 2ETKA 4K11A 3V01A 2RSVA 4L7SA 2ITOA 4I5HA 4MD9E 2WTIA 3F5GA 4D2PA 3KEXA 3OOGA 4U9AA 1TQPA 1NT2A 3BGQA 1XH9A 5IPJA 3N4UA 2XUUA 4IVAA 3SQQA 2RF9A 3MVMA 3AD4A 2BRMA 2PZPA 4M14A 4FKWA 1XHAA 4EOJA 5EK7A 4IJPA 4FJVA 2HXLA 4MEDA 4YJUA 2FVDA 3FSFA 4BC6A 3HX4A 4C62A 5AFVA 2X2MA 4X3JA 4MXAA 4FTOA 5EDQA 1URWA 3NGAA 3ZZEA 4PNKA 3A8XA 3QF9A 2BAQA 4I20A 3ZO1A 2R3MA 1LUFA 2XMYA 3KULA 3O8TA 4I23A 2C6OA 4L67A 4X2NA 5DH3A 2XJ2A 5AR7A 4A06A 3QKKA 3ZFXA 3DZQA 5KNJA 5CZHA 5I3OA 3U4WA 4BCOA 5BV3A 5GIPE 4XCUA 3NS9A 4YZNA 1XMLA 2R3HA 4XLVA 2H8HA 4JDIA 4E6CA 3EQRA 4OLIA 2WFYA 2X2LA 1ZOEA 3FAAA 3W0PA 1M7NA 5F1ZA 4BZDA 5F94A 1LR4A 4G3GA 3TUDA 2WU7A 4RMZA 4ORKA 4UWCA 5DT0A 4GFOA 1FINA 5GZ8A 3NYOA 4MHAA 4O2PA 4OTQA 2W4KA 2OI4X 4X6QC 1Y8GA 4TWNA 4CLJA 3TV6A 3LW0A 4IAIA 4IB0A 3QUPA 3LFFA 3P7AA 5LMKA 5M53A 2V22A 2G2HA 2JDSA 4DH3A 2BDWA 5AUXA 2UUEA 3OS3A 3RK7A 5I9WA 2ZV8A 3TN8A 2C0IA 3W0MA 3ALOA 4AGWA 3LXKA 3FY2A 5K3YA 3RPRA 5KBQA 5DWRA 3D2KA 3HYHA 3ZOSA 3PFYA 4TWPA 2I0HA 2HWOA 2C6IA 3FMLA 2WNTA 3KN6A 3DKCA 3NNVA 2RL5A 2NO3A 1QL6A 3F3TA 3R21A 3IGGA 4AU8A 4HYSA 1AD5A 5J5SA 3CD8A 4MBLA 4AGUA 2YISA 4OUCA 4F70A 3KK8A 2EWAA 2XNBA 4A9TA 5DR9A 5HKMA 3TG1A 5M4IA 2R4BA 2JKMA 2QD9A 3DDQA 4DTBA 2XIKA 1QCFA 3DJ5A 2A19B 2QOHA 4I22A 4UXQA 3ZMMA 4BDIA 3RM6A 1A48A 4J1RA 3D5WA 4AGCA 4JDKA 5EH0A 3FMKA 3IDPA 4UX9A 4QTCA 2XM8A 4ZZMA 4L01A 3O71A 4FNXA 4FSYA 5IUHA 4L3JA 2DYLA 3ZS5A 3PP1A 4PPCA 4I6LA 3TL8A 3IKAA 4O4DA 4L3PA 2BRHA 4QDEA 1H26A 4BFMA 1Z9XA 5HORA 4R3RA 4KBKA 4NM7A 4QYGA 3VAPA 2ITYA 2YERA 5D10A 4ZSEA 3OMVA 4ID7A 3KKVA 4GS6A 1OIRA 4FYNA 3VW8A 5JQ5A 4DCEA 4OBOA 4QQ5A 4ANLA 3CD3A 3CR0A 5J9ZA 3PUFC 4FL1A 2HY81 3OVVA 4FSZA 2XF0A 4D2RA 3E3BX 4BDAA 4HGLA 2CKOA 2OSCA 1ZMWA 4BTJA 5HO6A 4I5CA 3EKNA 2ZM4A 3PRIA 4TXCA 3R9RA 2G2FA 5LWMA 3AGMA 1S9IA 3BPRA 3UODA 1ZY4A 4YC6A 5A3XA 3GT8A 2PZYA 4FG9A 4Z16A 3KN5A 2YM3A 3F7WA 3FLZA 4EORA 3LFSA 5HBJA 1H4LA 5HCXA 3Q53A 3DB8A 4QTBA 2JBPA 2J7TA 3BQCA 3HZTA 3KK9A 1PXJA 1A06A 3NAXA 5CSPA 1MP8A 5FP5A 4WG3A 3DOGA 3BRBA 4ANBA 2W5BA 1H1SA 5HE3A 4AF3A 3P5JC 2SRCA 4FSMA 1ZYDA 3C1XA 2YCFA 2BHEA 1J1CA 3ORLA 3W2OA 1GNGA 4AWIA 4NWMA 4WNPA 3HV4A 3QL8A 5CXHA 2UZTA 5DR6A 1YVJA 3GU7A 3VVHA 4B8LA 2X9EA 2YA9A 3RHXA 3LFCA 5CAVA 5JH6A 1F5QA 1ZLTA 3PE1A 4MF0A 4Y73A 2XKEA 3MJ1A 4LL5A 5IF1A 1OGYA 2IPXA 2WTKB 3E92A 4BHNA 3Q52A 4ASZA 1YWNA 5KBRA 4FTUA 4G3DA 1J3HA 2IN6A 2ZVAA 4LDTA 4FIJA 3V5WA 3MY1A 3GFWA 1L8TA 4RVTA 2GCDA 3GU8A 5FTOA 1H27A 5AP5A 1GZKA 1QPJA 4QTEA 4LGGA 4ASDA 3NAYA 2WMAA 3LAUA 3I79A 4IJ9A 3L9NA 4K9YA 2F49A 5AV0A 2J2IB 4XV1A 2WEIA 2R2PA 4ALVA 4NKSA 4BCMA 4EZ5A 3FL5A 4HGTA 5M51A 3GOPA 4TNDA 3TEIA 3W2RA 4AP7A 3IW6A 4JL9A 2GMXA 3NX8A 3DTCA 3KF7A 5F9EA 4EUUA 5LVMA 2GFSA 2B9JA 2EXMA 3HECA 3HP2A 4AFEA 2W0JA 1GIHA 5D7VA 5CI6A 4CTCA 1Q8TA 3RK9A 1FBNA 3GCVA 3BGZA 3TJCA 5E8ZA 1G8AA 4KKHA 5JZNA 3QTQA 4BZNA 3OHTA 3RPOA 2Y4PA 3R7VA 5AEPA 1JQHA 3C50A 3Q2MA 5EOBA 4K77A 3UYTA 3V5JA 2YCSA 4IM0A 4CT1A 4CZUA 3TIYA 1H24A 4UMRA 5KMKA 2VWIA 5E9EA 2W1ZA 5JFWA 2W9ZB 4PTCA 5K4IA 5IG1A 4FTQA 4PPBA 5AR3A 2I40A 1Q41A 3NIEA 2WQNA 2XRWA 4V04A 4RFMA 3PTGA 4FF8A 4QMVA 4AW2A 2X81A 4Z9LA 2P4IA 4JQ8A 3A60A 4LRKA 2ZB0A 2VGOA 1GZ8A 4UYAA 3W1FA 4C59A 3M42A 4OBQA 1OPKA 4RVMA 3DLSA 3LQ3A 4F7SA 4IEBA 4DLIA 1ZYCA 1FMOE 5JFXA 4XHKB 4TZRA 3TKIA 3F2AA 3QTUA 4O91A 2P55A 4RJ6A 5E8YA 1H01A 3LFBA 3R22A 4OGRA 2XS0A 4CFVA 5J7HA 4FNWA 3DFAA 4KNBA 1Q8YA 5AP1A 3PA3A 2JEDA 2YEXA 4QMYA 2GHLA 3QCYA 3DAEA 4U0IA 4YJQA 3NUSA 5A4QA 2JC6A 3KXXA 3ZUTA 3PJ8A 3L8VA 4IDVA 5KX8A 2B1PA 4YZBA 4A7CA 2VU3A 1H1WA 2W4JA 3OCGA 4XG9A 4BCPA 4DEBA 4KBCA 1RJBA 2CCHA 5LCJA 3LXPA 5C9CA 4E6QA 2WTKC 3VBTA 4WG5A 5D1JA 4EK3A 1KV1A 2OIDA 4BI2A 4RJ5A 5A6NA 3VBYA 2CNQA 4FZDB 4TYHA 4DF3A 3RWPA 5IA3A 1YRPA 1WVYA 3OTUA 2XAOA 4BKZA 2PZIA 4NK9A 4ZSLA 2C6EA 2EUFB 1UWHA 3JY9A 3C0IA 2GU8A 1Y8YA 2VWBA 4ZZNA 2AC5A 3F88A 1SM2A 4LQMA 4O27B 4S34A 4ASEA 5M07A 3BE2A 3QZIA 4DG0E 4TTHB 4GUEA 3OUKA 2Y0AA 4IVDA 2ZB1A 1E9HA 3R8UA 5CANA 4DHJA 4RX8A 2CNUA 4D5HA 4B6LA 1YOLA 3LQ8A 3FLNC 2W9FB 2XEYA 4C4HA 2WXVA 4P5QA 4CGAA 1VJYA 5ANDA 3UNKA 2EXEA 3U54A 3FZ1A 3EH9A 3ZC5A 3DCVA 3QYZA 2VX1A 1U54B 3FE3A 4QYHA 4ALWA 5HTBA 3LCSA 4IWQA 4BHZA 4FA2A 2PZRA 2P3GX 4J97A 4P5ZA 4W8DA 4Q5HA 3DXQA 4BCHA 4S30A 4R8QA 4QYFA 3VUMA 4YURA 3U9CA 4BJJA 3T8OA 3PRFA 4DHFA 1PXPA 4V01A 5JKGA 5LXMA 4O84A 4RIYA 3ORPA 5J8IA 3ZO2A 5HNGA 1YDRE 4E4LA 2OLCA 3OBJA 4DHZA 5FXSA 3COHA 3EQHA 4M69A 4QOXA 2X9FA 5IA0A 5IQAA 5BVWA 2O64A 1M2RA 1FVRA 3F5XA 4W4XA 4U45A 1YDSE 1P14A 5L4QA 3QZHA 4TYIA 5HLWA 3ZSHA 3FQEA 1J7IA 3HRCA 2YFXA 2XIRA 5AWMA 3KRRA 3HLLA 4GCJA 4YMJA 2BR1A 4LV5A 4XJ0A 3ZHPC 4CFXA 5A54A 1FQ1B 2W1HA 3QALE 2XM9A 4J53A 5I9XA 3QCQA 4O4CA 2W96B 5AP0A 4L68A 2ITPA 4P7EA 4H3PA 1KSWA 4YLJA 4RWKA 3BBWA 2I0YA 2OJJA 5EW8A 3V5QA 3P7BA 5AR8A 4BY9E 1JVPP 4RWLA 4M66A 1R39A 2WMXA 4ZTMA 5HD7A 1M52A 3IW8A 1Q5KA 3MFSA 5HG8A 4X7QA 2J0JA 1J1BA 5CT0A 5TOZA 4D55A 5JMSA 4O7TA 1XQZA 4JG8A 4IFCA 4ENYA 2F7XE 1REJA 4F9WA 4USFA 4BCGA 3C4FA 3NUUA 4MKCA 4PTGA 4WT6A 5T6KA 3VF9A 4AZFA 4YTHA 2OG8A 3MYGA 4EOLA 4CKRA 5KO1A 2Y9QA 5CSWA 3WF5A 1XBCA 1Z57A 5HIEA 2YABA 3R0TA 3HAVA 3VUGA 2HIWA 4YU2A 5IISA 5IQEA 4EQMA 2ITTA 2PU8A 4L6QA 5CY3A 2WMVA 4K6ZA 4HCUA 1BX6A 5HIDA 5EOLA 3FHIA 4TW9A 5AX9A 5JRSA 3ZBXA 3ID6C 4J71A 3B2WA 3LQ5A 2BILB 2QOLA 4E6AA 5J9LA 1BL7A 1Q61A 5M06A 2QHNA 2RG6A 4F7NA 5IQIA 1OITA 2ITQA 2Z7SA 3O7LB 2WHBA 4E73A 1ND4A 3AXWA 5CAUA 5E8WA 4FKSA 3GU6A 4XG4A 4CYJA 4XG3A 3DK6A 1SZMA 3LJ2A 4GJ2A 4KIKA 1R0PA 2HWPA 3DS6A 4E20A 5FGKA 4R77A 3VUTA 4FVPA 3JY0A 4MF1A 2QO7A 4NTTA 3ODYX 2QC6A 4BCNA 3HDNA 2AYPA 1P4FA 3TJDA 3TNHA 4W8EA 4RIXB 3QD3A 4FL3A 3MPMA 5KHXA 2IZRA 4M3QA 4O0RA 3R30A 3HV6A 2W06A 3DGKA 4FT9A 4BICA 4ACHA 4O0UA 3UPXA 4LOOA 2NPQA 3G33A 4PMSA 4RBLA 4FNYA 3GCSA 2HW7A 2UZOA 3LZBA 3B2TA 3OT3A 4EK5A 3S00A 4HGSA 1SYKA 4XV9A 2I6LA 4AOJA 2VTMA 2YZLA 5FLFA 4GYGA 5LWNA 5EQEA 1IASA 4BZOA 3W33A 2GSFA 4WRGA 3SD0A 4GG7A 1ZZ2A 3QCXA 3NWWA 3F3VA 4JQEA 5LVOA 3QQLA 3PXRA 3G0FA 4ZS4A 4CRSA 2IZTA 3UQFA 5DT4A 4BTFA 5HBHA 2RFDA 4D1ZA 2XJ0A 2Z7QA 5CX9A 5ANKA 2OBJA 5T3QA 3AT2A 4YSJA 4DFYA 3UG2A 4UYNA 4DA5A 2HELA 3VF8A 4CKIA 4H36A 3LCDA 4AXFA 3MJ2A 4WD5A 3RAKA 2X0OA 1UWJA 3FHRA 4EK6A 1QPDA 4FUYA 4KRCA 3ZC6A 2W1CA 3HGKA 4J99A 2OZAB 5DBXA 2GQSA 2C6MA 3AKLA 1E1XA 2I1MA 5FWKK 3T9IA 4I41A 1WMKA 3BWJA 5HE1A 1RE8A 4RA5A 3WBLA 3SOAA 4YZCA 1V0OA 3HVCA 3EQCA 3ZDUA 1ZAOA 2QKWB 3GNIB 3KL8A 3ORMA 4MBJA 5B2LA 2ZAZA 2B52A 2VNWA 4PQNA 5ITAA 3TNQB 5HBEA 3WZKA 2EXCX 2R3IA 5JT2A 3ITZA 4G5JA 4S32A 4O7YA 4ACMA 1WVXA 4M97A 2QLUA 3UDSA 1GIJA 2VTHA 4BB4A 3FZRA 1OIUA 3HUCA 4EH9A 5J79A 3ZLYA 2CHLA 4DGGA 4DGNA 4DAWA 2QNJA 5F4NA 4AS0A 4EBVA 5TR6A 1BMKA 3AD5A 4QP8A 4UWBA 3C5IA 3DJ7A 1H0VA 2XKDA 4USDA 3RALA 3V5TA 3V5LA 4O86A 3R63A 2C30A 3CXWA 4ANMA 4AZVA 4U41A 3UIMA 1W2FA 2YIXA 4HW7A 5M09A 3FLWA 4MXCA 4LOQA 4NT4A 4DGOA 4YTIA 3VS2A 3TV7A 1M14A 3TZ8A 3H30A 3EN6A 5E8UA 4DEEA 1GIIA 3R1SA 3UIXA 4ZSAA 2EVAA 2LGCA 4QMNA 2AC3A 2W17A 3COIA 4QP7A 4JJRA 2GPHA 5LVNA 5TE0A 4IADA 4APPA 1AQ1A 2XK3A 4YJVA 4YC8A 5L2QA 3PXKA 4N70A 5CZIA 4H39A 4MWHA 4FTJA 4IH8A 2X7FA 4YNOA 4AW0A 3SG9A 2O5KA 2YAKA 2YZAA 4IZ7A 1MQBA 2YDIA 3OOMA 1O6KA 4GEOA 4RG0A 5AUYA 2CMWA 2W1EA 2JAVA 2Y6MA 2BFXA 3NNXA 2J50A 4IAAA 4UEUA 4XRJA 4GMYA 4X21A 3ZXTA 4AT5A 4FKTA 4CRLA 2CCIA 5EFQA 1OUKA 4AOTA 3G2FA 2J0LA 1UV5A 2ITWA 3EOCA 3NR9A 3C0GA 3W2QA 3PE2A 3C4CA 1Q8ZA 2OXDA 4ZAUA 5KKRB 4JOAA 2JAMA 1KUTA 2Z7RA 2ITUA 3A7HA 2C0TA 4FICA 3VS6A 2QG7A 5AV2A 1FGKA 2HZIA 4FKLA 3ZCLA 3I0OA 4BDGA 4E8AA 1YQJA 4M15A 1H0WA 1CKIA 2C5OA 4U97A 3ZUVA 3NSZA 2QU5A 3AT4A 1Q4LA 4ONAA 4RT7A 1STCE 4DITA 3PUPA 2VTTA 2BVAA 5BX0A 3O50A 4GK3A 5D7AA 5DNRA 3FBVA 3F9NA 4JIKA 5GNKA 4RJ3A 4DEAA 2HCKA 2GFCA 2QOQA 3LLTA 2XRUA 5J95A 1W8CA 2X0GA 2DWBA 4S33A 3QRTA 4IZ5A 4YHJA 3ZLWA 3ZRKA 3D5XA 5E8XA 3RK5A 4E1ZA 4C4FA 2YM4A 3HMNA 2UVXA 4FKPA 4XP3A 4XUFA 4FIIA 3BI6A 4XS2A 4GL9A 4QP1A 1OZ1A 3H9OA 2CGUA 5CNOA 4LGDA 1YHSA 3A7IA 2DS1A 2NRYA 3LFEA 4GIHA 4UALA 3CTJA 4XG2A 5CEQA 1Q3DA 4BCQA 4EZ7A 4YPSA 5HX6A 1O6LA 4L00A 4TYGA 5JQ8A 4P90A 2B54A 5HVKA 3EQBA 2XANA 4BBFA 4M7IA 4JRVA 4MH7A 1ZWSA 3U9NA 4DEDA 4I0TA 4NU1A 5AV3A 2OKRA 3SXSA 3A2CA 4I5MA 5FEQA 4BWKA 3GU4A 4AFJA 3DBQA 3M11A 3RZFA 3JYAA 2PUUA 3AMBA 3CTQA 4WBOA 2IVUA 1UU3A 3PSDA 3KGAA 4O7WA 4O7NA 2CGVA 2W5HA 2GNIA 2B53A 5ETCA 3R8VA 1O6YA 1ST0A 2E9OA 3OZ6A 3KMUA 3DBFA 3SW7A 5K5NA 5HX8A 2QG5A 4JBQA 3N4VA 4MNEA 2XK4A 2RKUA 3TTJA 3PXZA 3PA5A 3G15A 4BTMA 4GH2A 5JFSA 5EYMA 4D9TA 4O96A 3V6SA 2JKOA 3BLRA 3SAYA 5ACBC 4C61A 3S2PA 5E7RA 5HTIA 3EQDA 4D0WA 2FSMX 5LARA 4PNIA 4YZDA 3FXWA 4CLIA 3OEZA 2YM8A 3POZA 2BDFA 4HNFA 4AUAA 5AIKA 3G0EA 4BDFA 3CS9A 3DLZA 4Y95A 4D58A 4D4RA 3DKFA 3VJOA 2XIXA 3UVPA 4P4CA 3VN9A 2O65A 2YWPA 3V8SA 1LEZA 5HO8A 4F7JA 3F82A 5EYKA 4MYGA 3R7OA 4NM0A 5DEWA 3WYXA 2BIKB 5DMZA 4I92A 2JLDA 3UDTA 4N0SA 3D7TA 3Q9XA 4KINA 4AA5A 1I44A 4TWCA 4A4LA 5DR2A 1MRUA 4L43A 3ZXZA 1VYZA 5M55A 3UZRA 4R7HA 2P2IA 2PSQA 4E4MA 2Q83A 3DT1A 2R9SA 4GIIA 3DV3A 3QGWA 4FR4A 2OF4A 4I24A 4HVIA 3GEQA 5A4EA 4MAOA 4NFNA 1GOLA 3W0QA 4FIEA 2WOTA 3AC8A 4EOQA 2CDZA 5D41A 2B9IA 4M67A 4CG8A 4AXDA 4NEUA 3FL4A 3WILA 1IAHA 2W1DA 2WQOA 5CENA 4B7TA 4RFYA 2PMNX 3PFQA 4FTCA 3GC7A 2Z2WA 3DNEA 1XWSA 3CPBA 2XBAA 1W84A 1UKIA 2XKCA 2R3LA 3VUKA 4NCTA 2QURA 3U6HA 4KA3A 1NVSA 4KWPA 3REPA 1R78A 2RIOA 2FH9A 3BEGA 4QMTA 3R7UA 3WOWA 5J9YA 1RDQE 4IVBA 3ZZWA 4W4WA 2HAKA 3D2IA 2C5YA 4R5SA 5BUIA 4WNOA 4PMTA 1UU7A 4MUQA 4C02A 2UW4A 5BVEA 1H1PA 1T46A 4K8AA 4ZLZA 3QQUA 4EK4A 4XG8A 3LHJA 1LPUA 3DBDA 1QPEA 2IVVA 4L44A 4DEIA 2ZFYA 4C38A 4YGAA 4I6HA 4CTBA 4OT6A 3TT0A 4QP2A 5IQBA 1ZOHA 5C4KA 2FSOX 4NW5A 2UVYA 2XK6A 5HICA 2JDRA 5EI8A 4E93A 4DCAA 2UZLA 3UNZA 4HYUA 4EHEA 4NIFB 3OCBA 4IB1A 4G3FA 5BYZA 1JPAA 4IACA 3KRWA 4I6FA 4QDVA 4DG2E 4NJ3A 4CNHA 5KCVA 2BAJA 4YTCA 3BYSA 1JKTA 3ORIA 3FKLA 3GGFA 2XJ1A 3QYWA 1IA9A 2WMSA 5CU6A 3AT3A 3NYNA 1WVWA 2WD1A 4X3FB 3WZDA 4BI0A 2BFYA 3TTIA 3H10A 3MY5A 3R1NA 2CLXA 3BE9A 2R64A 1OBDA 4RIWB 5HVJA 3BU6A 3MB7A 1OL1A 2O63A 5AJQA 3MFRA 3E93A 4CFUA 3ZBFA 1CM8A 1QMZA 1Y91A 3C13A 5HCZA 2UW8A 4KAOA 4BKJA 5CEPA 2R0IA 4AZEA 5DG5A 1JWHA 3VRYA 2WTDA 3UG1A 1BL6A 4II5A 3W0RA 1WBOA 3U55A 3P1AA 5CF4A 4WSQA 3IECA 5CTPA 3QQHA 3QTXA 4PMMA 3SRVB 4LM5A 2ERZE 4RJ8A 3UVRA 3AC4A 3QUEA 3S1HA 3HV7A 3DZOA 3QFVA 4YHTA 3RJCA 3CC6A 1CKJA 3D4QA 3F3UA 4IWOA 2WMWA 4IDTA 3QKLA 3RI1A 5DIAA 3E3PA 1PKDA 2HK5A 3NPCA 5HHWA 4B9DA 3RCDA 4E6DA 3EFKA 4QMWA 4WIHA 3RGFA 3F2NA 3MS9A 4IW0A 1DI8A 2UZEA 3MY0A 5HOAA 3UVQA 4FZFB 2QOCA 1J7UA 4L8MA 4PDYA 4MQ2A 2WO6A 4PP7A 4BCJA 4HVHA 2YM5A 3DTWA 3NLBA 2IVTA 2YCRA 5AM7A 5AP2A 5BVKA 1GAGA 4QNYA 5CSHA 3S95A 4ZK5A 3P86A 4FV6A 4KSPA 2G15A 4BYIA