2ZB1A

Crystal structure of p38 in complex with biphenyl amide inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
345
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Biphenyl amide p38 kinase inhibitors 1: Discovery and binding mode
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 345
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2zb1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2zb1A01
2BZIB 2IZRA 4IADA 4IXPA 4IJ9A 2ZAZA 4QMTA 4DC2A 4YSJA 3BBWA 5J5SA 1JOWB 3QFVA 2VWIA 4BDCA 1URCA 3MI9A 5KMOA 3QD0A 3PFQA 3K5VA 4IFGA 4IM0A 4C62A 3PE1A 3FZSA 3NUSA 2JBPA 3TUBA 2R7BA 3LLTA 2JIVA 5A4EA 2UZOA 4BYJA 4MBIA 3ZO1A 5BX0A 3VUIA 4U3ZA 3GU5A 3R04A 1ATPE 2AC5A 2YCFA 4O0RA 1H4LA 5KHWA 2FA2A 3G6HA 3GQLA 2UW7A 3E62A 1KWPA 3QD3A 4L3PA 4NW5A 2EWAA 4E3CA 1A48A 1ERKA 2QU5A 4EH3A 4BKYA 1Z9XA 3QKLA 4Y8DA 3NYOA 4YO4A 5DWRA 5GZ8A 2J0KA 4FYNA 2YM7A 2RL5A 3FZPA 4I5CA 2XK8A 4FOBA 4KA3A 4QMZA 3I0QA 2Y4IB 4QYEA 2R2PA 4IANA 4RLLA 2CNVA 3BBTB 4DFYA 4DN5A 5CU0A 2ITXA 5KNJA 4ZMEA 2J9MA 1UU3A 2BZHB 3B8RA 4RFZA 5AUYA 2QOOA 3JVRA 5HZNA 3F5PA 5E8WA 5AUTA 3UC3A 4C2VA 1PRYA 5LVMA 2X6EA 5HD7A 5DRDA 1GZKA 5IU2A 3E7OA 3VC4A 4RA5A 3KXXA 4BI2A 2QHNA 5LCKA 5CAPA 4CFMA 3QQKA 4N4SA 5CU6A 3BWJA 2X7FA 1SNUA 4M12A 3H0ZA 4EH5A 4OLIA 4EOKA 4R8QA 4O2PA 5IQEA 3DKGA 3CE3A 3BX5A 1YWVA 4RJ3A 5B2LA 1KE5A 3I6WA 3PVBA 5J8IA 3PJCA 3DNEA 4BICA 2VTOA 4IB1A 3NEWA 5CASA 4M68A 4RRVA 4NIFB 4RG0A 3IW7A 5FDPA 4RX8A 3GB2A 4AN3A 4ERKA 5HICA 4D2SA 2W1HA 4K18A 2YCSA 4EJNA 4RLKA 5J9ZA 3DBEA 2WO6A 3BI6A 3QKKA 2R3RA 2W5AA 3M42A 2HZ4A 2Z7LA 3IK3A 3PJ8A 4HYHA 4XS2A 3VBXA 3MY1A 1KE8A 3UYSA 4KABA 4O6LA 4ZZMA 3R71A 3PY0A 3RM7A 3FPMA 3KU2A 3F69A 2YHVA 3D83A 3IDPA 3FWQA 2XNMA 2PY3A 3MB7A 3VNTA 1RJBA 4AN2A 3C0GA 4PQNA 4NM7A 4UB7A 4EI4A 4CKJA 1JVPP 4IC8A 2XNBA 3D7TA 4IAAA 1XKKA 4C59A 3HKOA 2SRCA 1XH7A 3V01A 4MVFA 5C03A 4D2VA 2YIRA 2QR7A 5ACKA 3L8VA 3DFAA 2OI4X 3R7UA 2Z7SA 4QP8A 3CXWA 3U55A 1ZYDA 3QALE 4RVMA 2O64A 3BV3A 5E8YA 3EFKA 4O2ZA 4XG6A 2OW3A 3HMMA 3SW4A 4IAIA 3V5JA 3FBVA 2VTLA 4ANSA 4HVIA 4CXAA 3EN4A 2NRYA 3CQWA 4QP4A 1W8CA 2QOLA 5AP4A 3OT3A 4QOXA 4WSYA 4EOLA 5HLNA 1Q62A 3POOA 4WG3A 3UIUA 4QNYA 3JYAA 1TQIA 2OIDA 3HRBA 4ZTLA 3NYXA 4F99A 4YLJA 5ACBC 3F3TA 4OAUC 4IDTA 3ZO3A 4XUFA 5AR3A 4LQMA 5ANJA 3PE2A 4J8MA 1JSTA 2HXQA 2VWZA 2WTDA 3NW6A 5CENA 4F6SA 3FL5A 2CLQA 4KIKB 5CEMA 1QCFA 3JS2A 2Y9QA 4MKCA 4L44A 2VWBA 4X3JA 4AACA 4UMRA 1B6CB 5IH5A 1OIRA 2R9SA 4V0GA 5LXMA 5AR7A 3U9CA 4CFVA 2VGPA 3V6RA 1OMWA 3OCTA 3PXYA 4TYEA 4EOIA 2PPQA 3QC4A 3ZLYA 4I0RA 2KTYA 3P86A 3S0OA 3PDTA 4NTTA 2GSFA 2BFXA 2B1PA 1YHSA 3D7ZA 2IVSA 5HIDA 3WF5A 1RQQA 3PTGA 3ZU7A 3KF4A 4HGTA 4YZ9A 3PLAE 4CMOA 4ACCA 3ORPA 4K9YA 4I6BA 3P79A 3QCXA 4I4FA 4ZSEA 5E4HA 3MGYA 4UWYA 3BGQA 4U97A 3TNHA 1J7LA 3F9NA 5D10A 3RKBA 3FAAA 2VNWA 3V8TA 3T3VA 2BVAA 2GNFA 3KVXA 3QTQA 4O22A 3QTXA 1CDKA 3KRXA 1U54A 3PJ3A 1Q4LA 2BRBA 1JSUA 1M14A 2FH9A 3DFCB 4R3RA 4YHJA 4ITHA 5DT0A 4RX9A 5JGBA 5AADA 3EFJA 2WIHA 4U79A 4WT6A 4B4LA 4B8MA 3DLSA 4DFNA 4U42A 2C47A 3RWQA 3TV6A 5BVOA 2Q83A 2RFEA 3VUKA 3U6IA 4V05A 2GTMA 2CGWA 5BUJA 1HCLA 4KUJA 2PUUA 4QP2A 4GK3A 4FIJA 4F1TA 4NSTA 4HYIA 2FUMA 2X1NA 3KCKA 5DG5A 5KZIA 1O6YA 5L4QA 3VQUA 4QO9A 1SYKA 1P5EA 4I22A 3FMKA 2ZYBA 4XBRA 3F82A 4ZXTA 5AP7A 5IA0A 2I40A 2IO6A 2W99B 2J50A 4ITJA 4WBBB 2CSNA 4EOSA 4A7CA 4GV1A 2OZAB 2VWUA 3KREA 3FQHA 2GQRA 4BB4A 3R21A 4IM3A 4O0WA 1V0PA 3HVCA 4XG2A 3ERKA 1ZYSA 2FGIA 1Y8GA 2KULA 3F66A 4FG9A 3R8PA 3SXFA 5I9VA 2C30A 2G2IA 2X2LA 4G5JA 1YQJA 4HPUE 2ESMA 4ID7A 5EOLA 4OBPA 2GHLA 5DN3A 4MEDA 2R3GA 3UP2A 1MRVA 3T9IA 3NUXA 2CCIA 4CMUA 1I09A 3FLSA 4L53A 1RDQE 4NJDA 3OZ6A 3MH3A 5LWMA 2WMTA 3TM0A 3I1AA 5CANA 4YJRA 1NXKA 3FPQA 4CGAA 3TL8A 4A06A 3E64A 2I1MA 3QTRA 4MXCA 3QA0A 2WMXA 3QUDA 5ETCA 3UODA 1OGUA 3QHWA 3CTHA 4FL3A 2PMOX 2VWXA 3DB6A 3PIZA 1URWA 2X7GA 3QHRA 4OTDA 3SX9A 2OFVA 4LM5A 5C4LA 2RF9A 5HQ0A 3EN7A 4EH6A 4TWNA 3FMLA 4GH2A 1WBWA 4BHNA 4C58A 3P5KA 5L2SA 4U6RA 2GNIA 4G9CA 3L9PA 5H2UA 5KMJA 1PXKA 3W2OA 4RX5A 3HNGA 3G33A 4WNKA 2YA9A 4OTIA 4FGRA 3CJFA 4YHFA 1SVGA 4AW1A 4D28A 3FHIA 1H26A 3Q4CA 4O7VA 3SGCA 2ITPA 2PVMA 3AMYA 3BHVA 3VS4A 3LHJA 4P7EA 2EXMA 4RIXB 3Q9XA 5H8GA 2A2AA 3Q4ZA 4F6UA 5DMZA 4O7WA 3ZC6A 3UTOA 4M13A 5DR6A 2PVKA 3QQGA 2GQSA 3Q60A 1YXUA 3UVQA 4BCFA 3MW1A 4C33A 4OTGA 3OWJA 3TEIA 2E9OA 5AAFA 5BVNA 1FQ1B 3BRBA 5G6VA 3WILA 4ENXA 2QG7A 4F9WA 2RGPA 4A9TA 5EHLA 3KEXA 5HGIA 4FE2A 3MB6A 4C0TA 4ZMFA 3WZJA 4FTQA 3AC8A 4ANOA 2X4FA 1BI7A 4D0WA 3ANQA 4BCIA 5A4LA 3PP1A 2XP2A 5BMMA 3TIYA 2ZM3A 5J9LA 5A4CA 4AA5A 2ZV7A 2Z8CA 5ANGA 3DTCA 2XNGA 2CGXA 2HY0A 5D7VA 2JITA 3IGOA 2PSQA 3ATSA 3ZXZA 3PXKA 4WG5A 3W8QA 2WTKB 4J7BA 1J1BA 5EYCA 5IKWA 4F65A 2IW9A 3Q6UA 3BYOA 4YJUA 4FSYA 4TWPA 3QTIA 2VTAA 4PWNA 2ONLA 4USDA 4BVUA 5A46A 1SZMA 2YWPA 1XH4A 3P4KA 3GCQA 4G34A 3RINA 4FVRA 3OW3A 4PNKA 1WVYA 3SHEA 4AS0A 4FKRA 5F9EA 4QPMA 3GOKA 3QRJA 4ZTSA 3W32A 5J79A 4FKGA 4ZSGA 5I4NA 1F3MC 3ZFMA 2XKCA 3L9LA 3LIJA 3LAUA 3QZFA 3WE8A 2XF0A 3LCOA 1RW8A 3KXGA 4F70A 1UNLA 5IEYA 3EH9A 3EWHA 4X2GA 3VHKA 3AGMA 5AR2A 4EH9A 3EOCA 4EH8A 2CPKE 4MNEB 4E6QA 3C0IA 4CFNA 5BYZA 4L8MA 4ACGA 2OBJA 1DAWA 1DS5A 4F9CA 3O7LD 3R00A 3WZDA 2PVNA 5HIBA 1YOMA 5LVOA 3ZSIA 1P4FA 1V1KA 1OI9A 4S33A 3BEAA 5DRBA 4M69A 3FZTA 3OEFX 4EEVA 4DCAA 3ORLA 4PMPA 2A1AB 3TTJA 4D1SA 3I7BA 4NIFA 3I6UA 4IHPA 4O0TA 2ITQA 4W8DA 4XV3A 4ZJVA 4IIRA 2PTKA 4BWXA 1KSWA 1XR1A 1YHWA 3NW7A 2ZM1A 1ZZLA 5AV0A 2OXYA 4FTRA 3QU0A 1ND4A 3GFEA 4FG8A 3DAKA 4GU6A 3HV4A 2R3JA 4LYNA 2H8HA 4P2KA 5AUXA 2OSCA 4UV0A 4PDOA 3OHTA 4EZ3A 5HBJA 3FUPA 2XJ1A 4XV1A 1J91A 3WF7A 3A2CA 4I0SA 4C37A 4PTCA 4F6WA 1H0VA 3MN3A 4E4NA 5IA2A 5HHWA 4EQUA 3BIZA 4AT5A 3CBLA 4KBCA 4O0YA 2YM4A 3OS3A 4FIGA 1TQMA 3GGFA 1J3HA 4JAIA 2C5NA 4YO6A 3KC3A 3O2MA 3VBWA 4XOYA 4TKSA 2QI8A 4GJ2A 4AGCA 2JDVA 4NK9A 3CY2A 2R5TA 2X2KA 4UXLA 4FZ7A 2NP8A 4ZS0A 4AGWA 4MXAA 2PE2A 1NY3A 4RMZA 4GKIA 3H9OA 5E8VA 5K0KA 4DGMA 2J5EA 3UOKA 4HVSA 3NUNA 2WMQA 2WTJA 3K54A 5HIEA 4AA0A 5FTQA 4CV8A 3UNKA 4I5MA 3AMAA 3MFTA 3VS2A 3Q2MA 4CSVA 4BCPA 4BI0A 1OIQA 5LARA 1LR4A 2UZUE 2XVDA 3RK7A 3R01A 5C4KA 3HRCA 3WOWA 5FQDC 5BVKA 4PNIA 4RIOA 3VS6A 3C0HA 4MNFA 1FMOE 2BDWA 2F9GA 2V62A 4DTBA 2VTMA 2CKEA 1K3AA 3UG1A 3F3UA 3ORZA 3PVWA 3OUNB 2YM6A 4WSQA 5EDRA 4CYIA 4N0SA 5EM6A 2CDZA 4F7LA 3FXWA 1H1WA 1W84A 3TV7A 2RG5A 4G16A 4ZZNA 5EDPA 1Q24A 5CNNA 1H00A 2QR8A 3O71A 2PVYA 5M08A 3RPVA 1ZARA 2QURA 4BIBA 3TJCA 3L8PA 3VBQA 1NVQA 4O7YA 4FKWA 3V5WA 2YM5A 3O8TA 5K5XA 3TUDA 4FV2A 5CEQA 2PZPA 1XH5A 3GENA 3LFEA 2PUIA 4O1OA 4X6QC 3R7IA 5AP2A 2XBJA 4YMJA 4PL3A 3UNJA 3IKAA 4NT4A 5JN2A 5BYYA 2V5QA 3D5WA 3QTWA 1CKJA 4BYIA 5AEPA 4FKIA 4PDSA 2LGCA 3UVRA 3PVGA 2YZLA 1P14A 4IX4A 3CR0A 3UOHA 3GCPA 3QYWA 4Z7GA 3VULA 3CY3A 3DA6A 3ZLXA 1YDSE 1O6LA 2CLXA 4IZYA 4I6FA 4RC3A 4ZP5A 2P2HA 4ZY5A 4ZSJA 4X6RA 5HTBA 5E9EA 3PXZA 4RVTA 4WOVA 4KRCA 4FSUA 3RAWA 5E90A 1YWRA 3DV3A 3OF0A 4ZY4A 2EUFB 3NCZA 5JGAA 1OL7A 1V0OA 4GCJA 3W2QA 2QOCA 3ZLWA 3DDPA 3UBDA 3UZRA 2EB2A 3NW5A 4I20A 4ZLOA 3TZ7A 3O23A 3K3IA 4LV5A 4MYGA 3UJGA 2GDOA 5BVWA 2GS7A 5JFSA 2E9PA 2OFUA 3SOAA 4BL1A 3ENHA 3IG7A 5F1ZA 4YJNA 4KKEA 2B7AA 4J98A 2BCJA 4IB3A 4ONAA 4UXQA 4XG3A 4TNBA 3CIKA 4YC8A 5ANIA 3RPYA 4APPA 4LGGA 3DJ6A 3OTUA 4ZS4A 4PMSA 1UKIA 2CHLA 4JR3A 3GP0A 1Z57A 2OZAA 3MVHA 5H3QA 3SA0A 4EKLA 2VAGA 4BCKA 1G3NA 4BZNA 2IPXA 3MA3A 4JR7A 3SRVA 4DFLA 4DBXA 3C4XA 3PPKA 3BQCA 5M06A 5TE0A 3KA0A 4MHAA 5EYMA 5CF5A 3NNXA 2ZOQA 5TR6A 3Q04A 3LCSA 3G9LX 4MD7E 5AA8A 4AAAA 4X21A 1XH9A 5FTOA 3G5DA 5CSXA 5JFXA 4ANBA 2VNYA 4Z9LA 3FI3A 2W06A 5IF1A 3BCEA 2JFMA 3R9HA 3ZEPA 4IC7A 3QUEA 3MIYA 3R1SA 4R5YA 5BPYA 5M4IA 3AG9A 4WHZA 3QX4A 4XOZA 3V51A 3TZ8A 4EOQA 2F49A 3QXPA 4U44A 5LMAA 3MS9A 1OKZA 2P33A 1JBPE 2QOHA 4BDIA 3N4TA 2OJIA 2ZVAA 3PYYA 3NS9A 4WUNA 3ORMA 2GU8A 2BRNA 4K0YA 2J0LA 3ZONA 3VIDA 4EK3A 4YUQA 3ORTA 1YRPA 3VS3A 4ZAUA 3RCDA 3DU8A 3KXNA 5EG3A 3RPSA 5A6NA 3TDVA 1REJA 2W05A 4ZJIA 5HI2A 2IWIA 3AD6A 1JKTA 3QGYA 3FY2A 2XJ2A 1WBVA 2X9FA 4FG7A 2J4ZA 3BGZA 4G9RA 4JLCA 2BALA 2WELA 4H58A 2R3MA 4IWQA 4U45A 4BBFA 3RM6A 2V22A 3UMXA 4RPVA 4E6DA 5EKNA 3U6HA 4AF3A 3KRWA 2C6OA 4ASXA 4R78A 4RIXA 1UU7A 4MD9E 3TNWA 2WAJA 4FV3A 1MUOA 3R83A 3QTSA 3TNPC 5ICPA 2HIWA 5KKRB 3BQRA 4UMUA 2Y0AA 3V8SA 3VS0A 4PDPA 4KS8A 4P5ZA 1K9AA 2BTSA 4CTBA 1BKXA 1FOTA 3EFWA 3PRIA 2BRHA 4FT3A 4Y95A 4FKOA 1ZYLA 5K5NA 1G8SA 1Q41A 2BTRA 3NGAA 4K2RA 4QMUA 5CAOA 1PXOA 3S4QA 4EH7A 2VTIA 3CKWA 2AC3A 3RI1A 3FE3A 2F7EE 3Q53A 4RWJA 4W4VA 3LXNA 2XIRA 4A9RA 3DAJA 3ZHPC 4BDFA 3VUMA 2ZM4A 2OK1A 5I9YA 2YJSA 5DOSA 2JKOA 2WD1A 5JKGA 4XG4A 3A8WA 4O7RA 3LXKA 4XHKB 3A4OX 3BYVA 4D1ZA 4V04A 2JAMA 3BLQA 3UOLA 2OWBA 3C51A 4C4HA 3S00A 4JG6A 4LI5A 1P2AA 4BGQA 3FI2A 4LG4A 4MAOA 1W0XC 5JQ8A 1AD5A 4NEUA 2Q0NA 4FEWA 1GAGA 2WQNA 4TYHB 1U4DA 5G1XA 1QPCA 3E3PA 4HZRA 3A61A 2PVJA 5TT7A 1JKSA 2OXDA 4KKGA 5FM3A 3MFSA 4YJVA 4GW8A 5CF4A 4CQEA 2I7QA 4EBVA 4FZFB 5B0XA 4DEIA 2YERA 3QTUA 1KOAA 4K6ZA 5CS6A 3QZHA 1U59A 3M11A 4BBMA 3LFBA 4MQ1A 1YDTE 5DR2A 3R8VA 2XS0A 1ZOGA 3N4UA 2UW4A 2W1FA 3DJ7A 4EJ7A 2WIPA 3EQDA 2BFYA 4HGLA 4DF3A 1ZY4A 1OUYA 2DQ7X 4FTCA 3RCJA 2BZJA 4O27B 5M4UA 3TI1A 4DEHA 2JKQA 4NCTA 2OJFE 2VO0A 4WBOA 3OD6X 1VEBA 4E93A 4OTQA 3PRFA 3PSCA 3P7CA 4RVLA 3LCDA 4MWHA 1ZLTA 3JPVA 4C8BA 5GIOE 1ZZ2A 4JS8A 3FKNA 1U5RA 3OVVA 5DIAA 1WMKA 1RE8A 2B4SB 5AUWA 4IMYA 5KO1A 1JKLA 1ZYCA 2PZRA 3UOJA 3TV4A 4FEUA 1O9UA 4KINA 3VS1A 3GU8A 3THBA 3MDYA 2WQBA 4KB8A 3VUHA 4WNOA 4A9YA 2XK3A 4FIIA 4IWPA 2WGJA 4KS7A 3UGCA 4FTNA 2UZDA 4XLIA 5BUEA 2P55A 2QO9A 3O0GA 4QD6A 4XG9A 2JFLA 3DT1A 1A9UA 4I93A 5DA3A 3DS6A 5HG8A 1JPAA 1XWSA 2OKRA 5IUHA 2BIYA 2QOQA 3TIZA 4AW0A 2QCSA 4Q5HA 4TPTA 5HLPA 5EM7A 1Y6BA 2I0EA 3CS9A 1Q3WA 3PPZA 4UYAA 5CQUA 5IZFA 2BIKB 4JRVA 1SMHA 4GT4A 5F94A 3VRYA 3LMIA 3FMEA 3MV5A 2R3KA 4JIKA 2W1GA 5CT0A 3W55A 2Z7QA 4KNBA 3WZEA 2R3OA 4WG4A 4F0IA 3AC1A 1ZWSA 4L42A 2YN8A 5E1SA 5F4NA 4P5QA 3CP9A 4M97A 4OTHA 4I24A 3PVUA 2UVXA 3BYUA 2WTVA 3UP7A 4IB0A 1Q8ZA 2B54A 4TYGA 3R8MA 3UMWA 2PE1A 2PUPA 3K3JA 2OJGA 1LPUA 2YAKA 3OTVA 5T6KA 3HMPA 2XZSA 4I4EA 5HG5A 4QTCA 1O6KA 1YOLA 4QMWA 4FSQA 3KRJA 2VGOA 4KIQA 5AUVA 4F09A 4Z7HA 5CEKA 3AC4A 3UIBA 4JG7A 4FTTA 1PYEA 4TXCA 1UKHA 1KUTA 2W5BA 5FM2A 4HNIA 2JC6A 2V55A 5JZJA 4RC4A 4CFUA 3P23A 3RP9A 3NNUA 4BTKA 4EHZA 4HCUA 5I9XA 3V5TA 3HUBA 3PP0A 4G6LA 5HVYA 4J96A 4J99A 3RGFA 4AP7A 3FEGA 3OFMA 2YACA 4O0UA 5CSWA 5IG1A 3A8XA 3KN5A 2QU6A 4XH6A 2WTIA 5CZIA 4HNFA 3JVSA 3CCNA 4WA9A 4YJTA 5EDQA 4QNAA 4EC9A 3R1QA 3H0YA 5A4TA 3Q32A 3EQPA 4MD8E 1OKWA 4JBOA 2IN6A 1BYGA 3MPMA 3P1AA 4FSTA 4FK3A 3MVMA 2PZ5A 3K5UA 4ANNA 5E8TA 4CFXA 1PXJA 3O51A 5BVFA 4IZAA 3V8WA 2XUUA 2HAKA 5AP0A 3RTPA 2VZ6A 4RT7A 3HA6A 2YCQA 3AT2A 1W98A 5HU9A 5D9HA 3HMIA 4J8NA 2R64A 3BKBA 3NAXA 4R3CA 5HKMA 3R7GA 2ITTA 4G3EA 3MTLA 3SAYA 1J7UA 2A27A 3DPKA 4MH7A 1PY5A 2RFNA 3BE9A 2IZSA 3TNQB 1KE9A 4X0MA 4QP3A 4ZSLA 3VAPA 3GC8A 4R1VA 5EW3A 5H9BA 3CKXA 5DYJA 3SG8A 1YWNA 4QYFA 1MP8A 3TXOA 1BX6A 5FBNC 4YTHA 4FSMA 3W2SA 4C57A 2C69A 4FV4A 3K2LA 3S1HA 3MWUA 4C4JA 5IQGA 4HOKA 3TNIA 4JI9A 5CEPA 3PSDA 3E8NA 1ZOHA 3E3BX 3WIKA 5JEBA 1R78A 5IQFA 4G6NA 5DBXA 4HGSA 4U40A 2V7OA 4I0TA 4KSPA 5KBRA 2ITNA 1X8BA 2HZ0A 1OBDA 4X3FA 5FG8A 2VWYA 3AGLA 4MF1A 3KULB 3OBGA 3SLSA 4FSNA 1YOJA 2OF4A 3WF6A 4BKJA 2WTKC 2PE0A 5L6PA 3TUCA 3S3IA 4O0SA 4FEQA 4WIHA 2DWBA 2C6DA 3DK7A 5IQAA 1GOLA 4DINA 4BCMA 4XX9A 1DI9A 5DFPA 3DZOA 3TWJA 2O5KA 3Q9ZA 4ERWA 5I5ZA 3LJ1A 1STCE 4R7IA 2HENA 4DH8A 1F0QA 2QNJA 5DHJA 2CN8A 3KXZA 3PA4A 2HYYA 3IO7A 4MTAA 5IQBA 4WNMA 2YCRA 4E5WA 5L3AA 5HBEA 3N4VA 4YZNA 4G3DA 3LQ5A 4UALA 1T45A 4CT1A 4G3GA 3C4ZA 2F4JA 3R7OA 4AFEA 3FLWA 3MY5A 4L52A 3GCVA 5CI6A 5CNOA 2WZJA 1W82A 3RK5A 3CTQA 5GHVA 3OT8A 1IRKA 2VTTA 2R3LA 4O1PA 5C9CA 2BR1A 4JQEA 2WU7A 1WZYA 5AR8A 3B2TA 4NCTC 4FTJA 2G2HA 3FV8A 4QQJA 1JQHA 3BWFA 1V0BA 4XCUA 1PMUA 3ROCA 4WD5A 5CVFA 3LFSA 2B9IA 5EOBA 2I0VA 4FNZA 2BRGA 3HA8A 4AOJA 1YXTA 4QYGA 2OJ9A 3MFRA 4LUDA 1ZOEA 1L3RE 3R7YA 4AN9A 5CVHA 3I0OA 4NM0A 4EL9A 4IFCA 4Q9ZA 4NUSA 3DKOA 3NUUA 4G5PA 4I5HA 4YBKA 3EHAA 4BDBA 1ZMWA 4O7SA 3N9XA 4A4XA 3MJ2A 3DBDA 3ATTA 3WF9A 3DKFA 3ETAA 1Y57A 4RFYA 2Y7JA 2A19B 5HX8A 5DT3A 3KB7A 3PXFA 2JIIA 4EH4A 5A14A 2ERZE 4PTEA 3HMOA 1EH4A 2FSMX 3BPRA 5TO8A 4C4IA 1Y8YA 4FSRA 5J7HA 4O86A 3S95A 4LV8A 3CGFA 5EHYA 3AC5A 1FVRA 1JSVA 2GHGA 2NPQA 1JNKA 1SVEA 3E63A 5CXZA 1UWHA 3PA3A 4QQ5A 3EQCA 4YTCA 2C0TA 5D41A 1MRUA 2BILB 3PXQA 2OJJA 4QP1A 4QMPA 2BPMA 2JEDA 4I1ZA 1Q8UA 1P4OA 2GTNA 4AGDA 4NJ3A 2H96A 4ACDA 1XHAA 4OBQA 4EOJA 2DUVA 4Q5EA 4U43A 5GJFA 2VWVA 3Q6WA 3NNVA 5HESA 4DYMA 3AXWA 5CY3A 3OWLA 4HYSA 3B8QA 4B0GA 4ANMA 2W9FB 2R3HA 4PPBA 4TWOA 4X2NA 3RJCA 4D0XA 3WI6A 2W1ZA 2C5VA 3NDMA 4DEDA 4TYIA 3Q5IA 3ZYAA 3HUCA 4RFMA 4TYHA 5IUIA 2XCKA 1OKVA 2DYLA 2J90A 3KXHA 3OC1A 4IX3A 4CKRA 3R1YA 5HNIX 1WBNA 2ZMDA 4F0GA 5E8SA 5JFWA 1Z5MA 4BIDA 4OTRA 5AMNA 4YR8A 3KMWA 1FVTA 4GU9A 3WZUA 3R0TA 4ZOGA 3IECA 4BWPA 2Z02A 1PXNA 5EM5A 4ACMA 3HV6A 2C68A 1H8FA 4F64A 5L8JA 4RZVA 3F5UA 3VBYA 4RA4A 2PYWA 2XIXA 4BKZA 2F7ZE 4O0XA 4AZVA 3ULZA 4TL0A 4RIYA 4FEVA 3R28A 3TZ9A 3AD4A 3EYGA 4LGDA 3U54A 2YEXA 3QBNA 4YSMA 4FKUA 5AA9A 4YTFA 3CC6A 3Q3BA 4ANLA 4OR5A 4BFMA 3COIA 5CT7A 4N6ZA 4Y85A 4D4YA 4AOIA 4FNWA 4FA2A 1E1VA 1PXIA 3NYVA 3EYHA 1PKGA 5ETFA 4JX3A 4CQGA 2X4ZA 3EZVA 3FMHA 3QRUA 4KAOA 3R2YA 3Q2JA 4XJ0A 1OPJA 2YIYA 3GUBA 2OIQA 2GNHA 1UV5A 4GK4A 4EYJA 2OO8X 5BNJA 4BR3A 4YPDA 5HCYA 5A9UA 3F5GA 5IDPA 3SVVA 2EXCX 2UW0A 2QODA 3W2CA 4BZOA 3AOXA 3QX2A 4JX7A 4ZIMA 2GMXA 3PLSA 4OTPA 5HCZA 5CAVA 4DTAA 1QMZA 2HZIA 1M7QA 5T3QA 3GOPA 4DEAA 4K33A 4C36A 4IZ5A 3PG1A 4GYGA 4JDKA 4U3YA 4QTBA 4E73A 3R9OA 2CNUA 3VF9A 4C7TA 3FC1X 4AW2A 4C02A 1UVRA 4CKIA 3IPHA 3DGKA 2JDTA 2IW6A 1HCKA 4IWOA 4YURA 4S31A 3DXQA 4NM3A 4YZMA 3VQHA 2PMNX 5CU2A 5KMNA 3FI8A 5J1WA 5D12A 3TDWA 4X3FC 4D4SA 3UYTA 4BCJA 3DB8A 3FZOA 5HU3A 1OL6A 3FL4A 5GIPE 4U8ZA 3RAKA 5FEQA 4L3JA 4RWKA 4B6LA 3QA8A 4C38A 3NSZA 1YDRE 2XK9A 5TOZA 3QTZA 4Y83A 3E8DA 2CMWA 4RSSA 3G51A 1IASA 2EU9A 2B9HA 5L2IA 4D9UA 3MIAA 4FV9A 3P7AA 4CZTA 4XV2A 3GU6A 3KMUA 4XRJA 2OG8A 4KRDA 2CKPA 2JDSA 2XEZA 3II5A 3VF8A 3Q5ZA 2F2CB 3DY7A 3BLRA 3UIMA 2O2UA 3IOKA 5HD4A 4GEOA 2QVSE 3CPBA 4QTAA 4M0YA 1Q8YA 3KVWA 3P0MA 4AZTA 2WNTA 2FO0A 3OCGA 4TT7A 4GYIA 5H8EA 4YPSA 3E5AA 5AM7A 2GFSA 4MXYA 3FXZA 4ASZA 3F2NA 1PXMA 1SNXA 3IW4A 3TKHA 5ETIA 3C50A 3NRMA 4BIEA 5IQDA 3AT3A 2WHBA 5ANKA 2YZAA 3FHRA 2Z60A 5HNGA 3QLFA 2WXVA 3R63A 4AXAA 3E8CA 2V0DA 4FBXA 3MJ1A 1H1QA 4YZBA 5ANDA 2GHMA 3UC4A 1NT2A 4DLIA 1VYZA 3EB0A 2B55A 4OGRA 4FVPA 4FNXA 1F5QA 2ERKA 3CEKA 4XG8A 5AWMA 3W2PA 4JXFA 2UZVA 2W1CA 1ZY5A 2PWLA 4BWKA 5IA3A 3HV3A 3RNIA 1ZAOA 4IZ7A 2X7OA 3OBJA 4OT5A 4MK0A 2WMVA 1R3CA 2UW9A 1QPDA 4XP2A 3HAMA 4FR4A 5EM8A 3DTWA 2C6MA 3ALNA 5M57A 5EYKA 3TT0A 4XV9A 2QKRA 2YIXA 4I92A 3I5ZA 3LFQA 4G3CA 3P78A 4ZEGA 4C4FA 5JSMA 2OXXA 3D9VA 4Z16A 4Z55A 4MCVA 1GJOA 3F3ZA 5HCXA 5M4CA 4EONA 5JGDA 5E8ZA 3VBVA 2WB8A 4UBAA 4AZSA 2PVFA 2WPAA 2ZV9A 4QMOA 3OROA 5BMSA 3COKA 4A9UA 4FT0A 2I0HA 2CGVA 4GT3A 5AX9A 5BYLA 4ZLZA 4KIKA 4BDDA 3T8OA 5BQ0A 3ZUTA 3MH0A 5HO6A 3GI3A 2UV2A 1BI8A 4GFOA 4GS6A 4WRGA 1YI4A 4NL0A 2C1BA 3IW8A 4CRSA 5LVNA 4D1XA 2B0QA 3A7IA 3GFWA 4GRBA 5LMKA 3RPRA 5LWNA 3F2RA 2IW8A 2XB7A 3SD0A 1OL5A 4OT6A 1IAHA 4G6OA 4JL9A 4AZFA 1ZXEA 3QRKA 2YM8A 4G31A 5HOAA 2R4BA 1OECA 4QTEA 1AQ1A 3BHYA 3SQQA 5JH6A 4JRNA 4A07A 4QMMA 4ZK5A 5IMEA 1UNHA 3BLHA 4W4WA 2YDKA 3FLQA 4WUAA 4BI1A 5M51A 2X39A 4M84A 3KL8A 1Q8TA 4B99A 1PMEA 5E8XA 4GFMA 5FEEA 3ZH8A 5LQFA 3H4JA 2W1IA 4H39A 4L9IA 4CRLA 5GNKA 4YNEA 4QQTA 2BROA 3U4UA 4BY9E 1XH6A 4E4XA 2W1EA 2VO3A 4WO5A 3UIXA 4E5BA 4C4GA 2WMBA 5CF8A 5L2QA 4J52A 4BF2A 4HJOA 4RZWA 4BTMA 4UYNA 4AZEA 3F61A 4R77A 4EZ7A 3CJGA 4ENYA 5ANOA 4DT8A 3WARA 4FT7A 1Y6AA 1WBTA 3GQIA 2ITVA 2XIKA 3QAME 4XEYA 1E9HA 3ZEWA 3UPXA 4E1ZA 2IVUA 3VS5A 4IX6A 3F2AA 4FIFA 4FZAB 2OZOA 2PL0A 4FIEA 5M55A 4D2RA 3DAEA 3IDBA 2F57A 3V04A 3FYKX 4O96A 5C01A 4E5AX 3LMHA 1BL6A 3CD3A 5AJQA 4UMTA 4EQCA 3ZS5A 3V6SA 1I44A 3ZDUA 4W9WA 4RJ4A 2Y4IC 4S32A 4FF8A 2WU6A 2I6LA 4TRLA 3NUAA 1PYXA 2BAQA 4YJQA 4BDJA 3LJ0A 1VZOA 5AR4A 5CSPA 3UZTA 4DA5A 3KK9A 5J7BA 2WEIA 4ACHA 4GIHA 3ZFXA 4QMXA 4S30A 4BTJA 4R7BA 5BVEA 2B52A 2C6LA 3HYHA 3DBQA 5GZ9A 4CT2A 4LL5A 4QT1A 5FXRA 2W9ZB 3HLLA 4R5SA 4V0GB 5M4FA 5KBQA 5CU4A 5J9YA 2G01A 4BN1A 3ET7A 2BDJA 4AWIA 3WYYA 4O6EA 2XKFA 4DFZE 2OIBA 4F4PA 2BRMA 5DEWA 1UU9A 1BMKA 4FKLA 4D2WA 3VW8A 1T46A 3QRTA 4L45A 1J1CA 3D4QA 3LVPA 4FNYA 1OL1A 3GXLA 1R1WA 4GMYA 3MVJA 4A4LA 3LQ8A 5CLPA 3PIXA 3LXPA 4ZTQA 3ZCLA 3LMGA 2J6MA 4F08A 3KQ7A 5ANEA 5I9UA 2QC6A 5TKDA 2BHHA 3C4CA 2ZMCA 4M7IA 4KIPA 4XYFA 3PWDA 2FSOX 3U51A 3ZSGA 3KRLA 4FT5A 5JRQA 2JGZA 2YIQA 3KN6A 5EQPA 2JDRA 4E7WA 2VTJA 4DFUA 4H3PA 2IVTA 5EQYA 1GNGA 1MQBA 3C4WA 2G9XA 4FV5A 3HP2A 4RJ5A 3Q9YA 4FMQA 3DKCA 4FV1A 3NLBA 2H6DA 4RWIA 4AU8A 3UG2A 4GUEA 1FINA 3E8EA 3FI4A 5IH6A 4E4MA 3ITZA 3UQFA 4XG7A 1Q8WA 5CWZA 3DK6A 3OCSA 4YLKA 4GKHA 3ODZX 4FTOA 2QLQA 5HG9A 3FQEA 3L8SA 4LFIA 4C35A 1FVVA 4IVDA 3LM0A 3LFDA 4BDEA 4D5KA 3FMNA 2HK5A 4M8TA 4QPSA 4X7QA 2V7AA 5JQ5A 1VR2A 3R6XA 3UO6A 2PUNA 4DEGA 2W0JA 2XJ0A 3EL7A 3DQXA 3RPOA 3ZRLA 2AUHA 2JAVA 3A4PA 4LRJA 5E8UA 4GG7A 2XNNA 3HL7A 3NCGA 2HW7A 4LOOA 1ZRZA 5B7VA 4R3PA 1SVHA 2AYPA 2ZB0A 2UVZA 4W8EA 2GPHA 3EJ1A 4KSQA 4NU1A 3EQRA 3COMA 3Q52A 2B9FA 2O65A 3CTJA 3H9RA 3WZKA 4YHTA 4AZWA 2JIUA 3HRFA 4DAWA 2HW6A 3KCFA 2XCHA 1WVWA 4GK2A 1CTPE 1UU8A 2W4OA 4JOAA 4QQCA 4QPAA 2X0GA 4W9XA 2Y8OA 1E1XA 4EORA 5CAUA 1YKRA 3ZC5A 2VX0A 3ACJA 1Q5KA 3BU3A 4FV6A 3RAHA 4H3QA 3MBLA 3ZO2A 5I3RA 4IVBA 2C5YA 3F88A 3ZO4A 4QP7A 1YXXA 4E4LA 4ZJJA 4RBLA 3VO3A 1Y91A 2C5OA 2IJMA 3OCBA 3NYNA 3BHUA 4UZDA 2O8YA 4YC3A 3VW6A 4HVGA 5LMKC 4O82A 3EQHA 5FLFA 4MNEA 4FICA 5J5TA 5E92A 5L2WA 2JKMA 3Q9WA 4IVAA 5HBHA 4AGUA 2YM3A 5CI7A 1YI3A 2F7XE 2G2FA 2XK7A 2XNOA 5DGZA 2XRWA 3NZ0A 4I94A 2YJRA 3O50A 5AM6A 4BC6A 4CLIA 4F7NA 3V5LA 5A6OA 3CGOA 2ZJWA 3U9NA 4G17A 4ASEA 5KCVA 4HW7A 2IZTA 4FUYA 2C0IA 4IDVA 2XA4A 5IUGA 2W7XA 4OBOA 4JJRA 4NKAA 4IE9A 2HXLA 4W4YA 2YITA 1GIIA 5DI1A 3TZMA 4W4XA 3GC0A 1FPUA 3KXMA 3UO4A 5AV4A 4EWHA 5C8NA 4EKKA 3NPCA 3G0EA 5DVRA 2YWVA 2B53A 2C3JA 2XBAA 3DNDA 3F7ZA 3GT8A 4FIHA 2UW5A 3R9NA 4CMTA 1OIUA 4QP9A 2VUWA 4JNWA 1BUHA 4O81A 3G6GA 3JY0A 4JBPA 3ZUVA 2XMYA 4APCA 5EI2A 3BHTA 4II5A 3QYZA 5KX8A 1VJYA 3GNIB 4J1RA 5AP6A 3MSSA 3OEZA 2X81A 2GCDA 3MTFA 3QCQA 3GC7A 4FL1A 4PY1A 3TG1A 2WQMA 3FY0A 4ZTHA 4CV9A 4JAJA 5AIKA 5K9IA 3GCSA 5DR9A 3L8XA 4J53A 3HEGA 5GZAA 2ETKA 1H28A 3V5PA 4AOTA 2CN5A 3PXRA 2QQ7A 3UQGA 4L68A 4DCEA 5JK3A 2JKKA 3Q4TA 4NKSA 5KHXA 4WKQA 1R0PA 4MF0A 3GCUA 3EMGA 3OXTA 4IBMA 3IGGA 3W2RA 3FSKA 4ZTNA 5L8LA 2PULA 4FT9A 4AQCA 3RZFA 4FZDB 4DT9A 1FBNA 4I6QA 3EIDA 4EK6A 4AX8A 4HZSA 3R02A 4E20A 3OG7A 5IA1A 2OH4A 3R30A 4YLLA 3D2IA 5DE2A 5IQIA 2F2UA 5JMSA 2WMWA 4FI1A 2J51A 3GVUA 4CLJA 3EKNA 3LOKA 2GNGA 1XQZA 4U7ZA 4FV8A 3C13A 3PPJA 4ZZOA 3U6JA 5ETAA 4DH5A 5CEOA 2JD5A 5EHOA 3ANRA 2PZYA 4MBLA 3A7HA 4FEXA 3OMVA 3DXNA 3A7GA 4L3LA 5J87A 2E9VA 1DI8A 2CCHA 3WYXA 1BLXA 4UN0C 4ARKA 3LQ3A 3ENMA 3L9MA 5AP5A 3HX4A 5B2MA 1PJKA 3KGAA 2FB8A 2REIA 5CXHA 3IS5A 1H0WA 4MWIA 4XMOA 4I21A 4YJPA 3ZRMA 3ID6C 3LFNA 2E2BA 4IX5A 4TN6A 4DBNA 4F63A 4HVDA 2HCKA 4M69B 2XK4A 4ALUA 3KK8A 3DBCA 3G90X 4FKTA 4HPTE 4JBQA 4IJPA 1HOWA 4CFWA 3ORNA 4IAZA 4WRSA 1LEWA 3H10A 4FX3A 2WEVA 4PX6A 1NVSA 3H9FA 1SM2A 2IZUA 4JIAA 4R7HA 3W1FA 1PKDA 3AQVA 5LCJA 1OB3A 4EOMA 4G3FA 4M15A 5JFVA 1WBOA 4QP6A 4UEUA 4OW8A 3ULIA 4BCOA 4QMQA 3A62A 1MRYA 2WOUA 4M0ZA 3UVPA 3D94A 3F6XA 3AC2A 3V5QA 2VO6A 3D15A 1W83A 3F5XA 5DT4A 4YGAA 3M1SA 3R9DA 4PUZA 3ZLSA 5FBOA 2WOTA 3MVLA 2XH5A 1GIHA 5HE1A 4BCHA 2BAKA 2C0OA 3PJ2A 5DNRA 1OIYA 2G1TA 4NYEA 5B2KA 5HLWA 3CSVA 3H30A 4PDYA 3DBFA 4IAYA 4Q2AA 3I81A 3WBLA 5H8BA 4BCGA 4LGHA 4O7TA 4HCTA 5IPJA 3QQJA 5FP6A 1OZ1A 2R3QA 4FV7A 2WMUA 1CMKE 1M52A 3GEQA 3SOCA 3BE2A 3ODYX 2C3KA 2ITYA 5A3XA 4EBWA 3TKUA 3NVMB 1CKPA 3C1XA 5AV1A 2ACXA 3DZQA 5HE3A 3OOGA 4AUAA 2VTNA 1CSNA 1QPEA 3V3VA 3G2FA 4GG5A 2BMCA 4RIWB 4H3BA 4FODA 5K4JA 4J97A 2XYNA 4DH3A 5FTGA 2RSVA 3FSFA 4B7TA 2QKWB 3R8UA 4F0FA 3LLAA 3EN5A 5FXSA 2C6TA 3QWJA 3IOPA 2O63A 4QMLA 5AAGA 2QOFA 3QD4A 4FK6A 5JZNA 4EK4A 3UE4A 4QMVA 3A7JA 3ORXA 4YP8A 3ORIA 1W7HA 4L00A 4FGBA 3MA6A 2WKMA 4PV0A 4XP0A 2C1AA 2O3PA 4AT3A 2QOIA 4EZ5A 1H08A 5J95A 3FXXA 3QZGA 3GU7A 1IAJA 5KMLA 3FMJA 2UUEA 2OU7A 3NUYA 3JXWA 5LJJA 5CALA 4AW5A 5AP3A 3MFUA 5ITAA 3FLYA 1S9JA 3FJQE 3ZFYA 3QQFA 4L46A 3OUKA 2IVVA 3VWAA 4DGNA 4JVGA 5A4QA 3RVGA 3D2KA 5FP5A 4IW0A 3MYGA 4PP9A 1NA7A 2XYUA 2R0IA 4PL4A 4P90A 1LUFA 1FMKA 2BUJA 3LKMA 5EQEA 3R8LA 5DLSA 1YW2A 3LM5A 4FZ6A 3QCSA 4U41A 4CZYB 3UO5A 3C4FA 5AAEA 3DOGA 1XJDA 4DE4A 3R22A 4NM5A 3SG9A 1AGWA 3AT4A 3EQIA 3NR9A 3MESA 4O83A 2XNPA 2W1DA 3WE4A 3T3UA 3DCVA 1PHKA 4UZHA 4Y72A 2YDJA 4AFJA 3ZMMA 2Y6OA 1H1PA 1A06A 4L6QA 2OLCA 3DXPA 1KOBA 5FEDA 4QRCA 3F3WA 4LOQA 3UNZA 3DQWA 3FKOA 2BZKB 5IA4A 2Z2WA 3EFLA 4D55A 5CF6A 2R0UA 5C8MA 2H9VA 3G15A 2GNLA 2ZB1A 4IAKA 4MXXA 4AG8A 3O17A 4O0VA 5BVDA 4K11A 2P3GX 2XM9A 4I6HA 4UMQA 2QO2A 3VUGA 2YLEA 5LOHA 3OXIA 4FKSA 3O96A 1U5QA 3BHHA 1H24A 2ITUA 2RIOA 4AE9A 3ZM9A 5KUPA 1OL2A 4H05A 3F3VA 3EZRA 2J0IA 4LUEA 3I5NA 4FYOA 2QO7A 5HG7A 5HNBA 4Z3VA 3SRVB 4RVKA 3HDNA 3HDMA 4BDKA 3GC9A 3PA5A 4NW6A 5D1JA 5EFQA 1JAMA 2YISA 5AIRA 4YZDA 2FYSA 4ASDA 4H1MA 4CCBA 4DTKA 4H36A 4EOOA 4NH1A 3LXLA 4G1WA 3G0FA 4IH8A 2OGVA 5DEYA 2RG6A 2B9JA 3I79A 4A4OA 3LZBA 4AT4A 5IH4A 4G2FA 2PU8A 1BL7A 5CQWA 3MH2A 4XLVA 2WTCA 2XRUA 3FKLA 4KD1A 2W5HA 4PF4A 2IG7A 2PVHA 2ITZA 2WMSA 4ZTMA 1QPJA 3ZZEA 4DG0E 3JUHA 3RWPA 2X8DA 3IW6A 5HE0A 2W4JA 4CD0A 1Q61A 3TKIA 3DDQA 4O21A 4FOCA 2LAVA 4UMPA 1XH8A 3AC3A 3QKMA 3EKKA 5LMBA 4GVAA 4M3QA 5M53A 2JLDA 4RJ8A 4BTFA 3PIYA 5CU3A 2Z7RA 1M2RA 3ZBXA 1REKA 3M2WA 3FLNC 5D7AA 4EQMA 3KY2A 3PZEA 4PRJA 3OP5A 4F9AA 2BAJA 3D5UA 4I23A 1YXVA 2YFXA 4UY9A 4D4VA 4D9TA 4D4RA 3WF8A 4O91A 2YABA 4D5HA 1OPLA 4MXOA 1U46A 3VRZA 4FTLA 4YNOA 3EQGA 5FGKA 4XNEA 4D2TA 4DH7A 1R39A 3CLYA 4TWCA 3BYMA 4EHGA 4EK8A 2EB3A 2HOGA 3RZBA 4DEEA 4ALWA 1GZNA 4B8LA 4KBKA 1OVEA 4JT3A 4QTDA 2R3PA 4N6YA 4YTIA 2WMRA 3DLZA 1Q3DA 2VO7A 2R7IA 3D14A 3PZHA 2ITOA 4BDHA 3QUPA 4CZUA 5I9WA 2Q0BA 4L67A 5AR5A 2CJMA 5JRSA 3REPA 2GQGA 3FYJX 4NZWB 5FRIA 3EQFA 1VYWA 2W96B 3HV7A 3OWPA 5JT2A 1DAYA 1H1RA 4OTFA 4C3RA 5IA5A 2BHEA 3JR1A 2UW8A 4YU2A 3QQLA 1H07A 2C3IB 2X8IA 3W16A 4A9SA 4JDHA 3KKVA 4JDIA 2DS1A 3S2PA 4ANQA 4YZCA 5CTPA 3NIZA 3RMFA 2VN9A 2H34A 4XBUA 2R3NA 4DG3E 4ZY6A 1TQPA 5FUTA 2CKOA 1UWJA 2BKZA 3EN9A 4KWPA 2UZEA 5L6WL 3KRRA 2P0CA 4PL5A 4IACA 3ZXTA 2HY81 4IAFA 4J71A 4RJ7A 2CGUA 2I0YA 2WQOA 3BU6A 4QMSA 5HTIA 2XNEA 3U87A 3HV5A 4K8AA 4ZTRA 2XM8A 3VUDA 2VRXA 4D2PA 5A54A 5IQHA 5DH3A 4CG8A 2RFDA 3PWYA 3D5XA 1XBCA 3OY3A 3HZTA 5CX9A 4AA4A 2CNQA 4EHEA 1B39A 1TKIA 4N70A 5IISA 1H1SA 5M07A 4LRMA 2VTHA 4CVAA 3CPCA 3HECA 4OUCA 3ZRKA 3L9NA 1FGKA 2GFCA 4R6VA 4EOPA 3QLGA 4K77A 3QZIA 3OW4A 1OITA 4IEBA 3LW0A 3OY1A 4QMYA 3R8ZA 1LP4A 3R7EA 4GSBA 3TACA 4JBVA 3HP5A 2ZV2A 3NUPA 3LJ2A 4EYMA 3ZSHA 1L8TA 2XIYA 3BU5A 1PMVA 1KE6A 4C34A 1M2PA 3ZTXA 5GINE 2FSLX 3E7VA 1WBPA 5FD2A 5HE2A 4FKQA 3W18A 4EWQA 5K4IA 1YVJA 4F9YA 5HTCA 1CM8A 3EQBA 3H3CA 2GS6A 3QL8A 2NNWB 2RFSA 4QMNA 5I9ZA 2QG5A 4ZSAA 3QQHA 2P4IA 4MQ2A 5EI8A 4YBJA 4GFGA 1OPKA 4KIOA 4IM2A 2R3IA 3E93A 3ELJA 2R3FA 4DLJA 5KKRC 1APME 1B38A 4DG2E 2BKKA 2XIZA 2C3LA 3L1SA 5DPVA 3GBZA 4BHZA 1GZ8A 1H01A 3VJOA 2XKEA 3RHKA 2HZNA 4PP7A 1NVRA 4X2KA 4LL0A 5HO8A 3W10A 5GJGA 3U4WA 2VD5A 1YXSA 4DFXE 5HO7A 4D58A 3ZOSA 3RBWA 3TTIA 2ITWA 4J95A 4JG8A 5EKOA 4FTKA 4BBEA 3W8LA 3WIGA 2WMAA 2VTPA 3QRIA 1S9IA 3P7BA 4MXZA 3C4EA 4TNDA 4M67A 4C3PA 4V01A 4FUXA 2VV9A 4FV0A 2HELA 1IA8A 3D0EA 3A99A 1R0EA 2VX3A 2A4LA 3NIEA 4U5JA 5E91A 5HVJA 4E8AA 4CNHA 4E6CA 3NAYA 4EK5A 4JQ7A 4CCUA 5AUUA 3Q4UA 3VS7A 1WAKA 3KULA 3LCTA 1XBAA 3E88A 3FZRA 4C2WA 4CEGA 2NRUA 1KV2A 3SXRA 3A60A 3LPBA 2HWOA 5AP1A 5M44A 4L43A 3RK9A 4RIWA 1TVOA 2O0UA 1IEPA 4F7SA 1OBGA 1GIJA 1UNGA 4BRXA 4RWLA 4CG9A 3NMUF 4OTWA 3A7FA 4QYYA 3N51A 3LE6A 2X9EA 4ORKA 2VTQA 4EUTA 5EI6A 2UZTA 4IVCA 5AV3A 4O84A 4WNPA 4HGEA 4LOPA 3U8WA 1GY3A 2JDOA 2QHMA 3E87A 3PY3A 2BDFA 2WQEA 3SDJA 1ZMVA 3LFFA 5T68A 4AE6A 4DEBA 2WTWA 5K0XA 4EHVA 3C5IA 3FMMA 2EXEA 2UW6A 1WVXA 3KF7A 4BDAA 3LFCA 3GU4A 4XP3A 3VN9A 4NWMA 3E92A 3C5UA 3FDNA 4QYHA 5HX6A 3COHA 4F7JA 5KMMA 1M17A 1JLUE 5FWKK 4F1OA 3TJDA 4S2ZA 1UA2A 5D11A 3EL8A 5C27A 1JWHA 2QLUA 4UWCA 4Y46A 4FVQA 3D7TB 4LMNA 3PJ1A 3ALOA 3I7CA 3IW5A 4L7FA 3MY0A 5CSHA 1YI6A 4PPCA 3R7VA 1H27A 1ZYJA 1Q99A 3QQUA 3IDCA 5C1QB 3UQCA 4O7LA 2YIWA 1IR3A 1GZOA 4LMUA 3CQUA 3BYSA 3MH1A 5HVKA 2UZBA 2ZV8A 4ZLYA 1IA9A 4M66A 1XBBA 3PG3A 5KMIA 3UPZA 3C7QA 5GJDA 3DK3A 4BGGA 2FVDA 2GNJA 2J0MB 4X2FA 2PMLX 3FQSA 3PSBA 4RX7A 4IB5A 5CSVA 4DITA 2OH0E 3I60A 4GUBA 4B9DA 2UVYA 2W17A 2C4GA 2QD9A 2G15A 3PY1A 3O8UA 4TZRA 3W33A 1LEZA 4FSZA 4TTHB 5CZHA 4NTSA 2PZIA 3MPAA 1FGIA 4K1BA 5F20A 3SXSA 2OF2A 2ZDTA 3AMBA 5FXQA 4F9BA 4FTAA 3O7LB 4X2JA 5CAQA 2VX1A 2JBOA 3KMMA 4I3ZA 5K3YA 1H25A 2PVRA 5KMKA 2ETMA 3ZDIA 1OUKA 5J1VA 1YHVA 3BELA 5IEXA 2PHKA 2QONA 4RGJA 4JDJA 4X3FB 3UZPA 4H1JA 4BCNA 4P4CA 3CQEA 1PXPA 1OM1A 2VTRA 5I3OA 1J7IA 4DGLC 5EYDA 3IQ7A 2ETRA 1KV1A 5AFVA 3RHXA 2ONLC 2W4KA 4Y5HA 2C6KA 4EC8A 3QD2B 3CD8A 3FZ1A 4UWBA 3RNYA 2Y4PA 2YDIA 4FKJA 4C61A 5L6OA 3I4BA 3IONA 2J2IB 3SC1A 1NW1A 2HWPA 1DM2A 3NX8A 4FTMA 4BCQA 2QOBA 4E6AA 3LFAA 2XEYA 1WCCA 3KFAA 3R1NA 3NVKI 3QF9A 1WFCA 2UZNA 2XKDA 4U80A 4HYUA 5AUZA 4DFBA 4BZDA 1ZMUA 2E9UA 3ZUUA 2XK6A 4C4EA 2UZWE 4L01A 5L8KA 3BZ3A 5EH0A 3VUTA 2A0CX 4PMMA 3HGKA 5CVGA 1Q97A 4FKPA 5E7RA 4O7ZA 4FTIA 4PMTA 2VU3A 4IWDA 4Y73A 1U54B 1PXLA 3T9TA 4CTCA 5IQCA 5HEZA 1WBSA 5EK7A 4Q9SA 5HORA 3D5VA 2E9NA 2J5FA 5L2TA 3R9RA 3ZZWA 5LVPA 4PPAA 1JKKA 4O38A 4I5PA 2VTSA 4XRLA 3JY9A 4GJ3A 4LRKA 4U9AA 2VWWA 3FLZA 4GL9A 3SW7A 4MBJA 3ACKA 2YAAA 2X6DA 4OAVB 3QGWA 4KBAA 1PMNA 3SKCA 2QOKA 4IQ6A 4YJSA 4DHFA 3TCPA 4U0IA 3P08A 4CYJA 1QL6A 1MQ4A 3Q96A 3OOMA 4RQKA 3R73A 4USFA 3VJNA 4EH2A 4F1MA 4DGOA 3AD5A 3SV0A 3DJ5A 2X2MA 3BEGA 3F7WA 3NWWA 3QC9A 4NFNA 5AV2A 4USEA 4FTUA 5C26A 3HMNA 4C3FA 2PK9A 3BGPA 3QWKA 4FC0A 4ITIA 3ZM4A 5E1EA 5BUIA 5M09A 5C8KA 4RC2A 4MX9A 1K2PA 3FMDA 3PUPA 2ZDUA 4TYJA 4YJOA 4HVHA 4RQVA 1OKYA 4KKHA 2X8EA 4L7SA 4S34A 3QXOA 3VVHA 1KE7A 3ORKA 5IMXA 5KZ0A 5TF9A 2Y6MA 3FC2A 3HAVA 4CFFA 2UZLA 4RJ6A 3ZBFA 1PW2A 2C6EA 1CKIA 4M14A 5FDXA 4DGGA 3BV2A 2GS2A 2WFYA 5EW8A 3P9JA 5AX3A 4NFMA 3OWKA 4Y5QA 3G9NA 3QCYA 3UDBA 3OXZA 3RALA 2RKUA 4YC6A 4I41A 4BDGA 3RAIA 3EN6A 3VHEA 5IEVA 2UW3A 1G5SA 5EW9A 5IDNA 3NNWA 2FSTX 4GIIA 3POZA 3TN8A 5LVLA 4PTGA 4GT5A 4GVJA 2P2IA 4FKVA 3R2BA 4HCVA 5F95A 4UX9A 5CEIA 2C6IA 1G8AA 5M56A 4N57A 2C5XA 3LCKA 4TY1A 4FL2A 5KE0A 2PVLA 2YLFA 3VBTA 1XO2B 3ROYA 2CKQA 4O7NA 4JQ8A 2J0JA 4EUUA 2J7TA 1PF8A 3C9WA 4R1YA 2NO3A 4DH1A 4FSWA 5I0BA 1IG1A 5CYIA 2OICA 4TW9A 1M7NA 2EVAA 4E26A 1M2QA 3MPTA 2PMIA 4ALVA 3B2WA 3O8PA 4RIYB 4BGHA 4U81A
chains in the Genus database with same CATH superfamily
2BZIB 2IZRA 4IADA 4IXPA 4IJ9A 2ZAZA 4QMTA 4DC2A 4YSJA 3BBWA 5J5SA 1JOWB 3QFVA 2VWIA 4BDCA 1URCA 3MI9A 5KMOA 3QD0A 3PFQA 3K5VA 4IFGA 4IM0A 4C62A 3PE1A 3FZSA 3NUSA 2JBPA 3TUBA 2R7BA 3LLTA 2JIVA 5A4EA 2UZOA 4BYJA 4MBIA 3ZO1A 5BX0A 3VUIA 2XAOA 4U3ZA 3GU5A 3R04A 1ATPE 2AC5A 2YCFA 4O0RA 1H4LA 5KHWA 2FA2A 3G6HA 3GQLA 2UW7A 3E62A 1KWPA 3QD3A 4L3PA 4NW5A 2EWAA 4E3CA 1A48A 1ERKA 2QU5A 4EH3A 4BKYA 1Z9XA 3QKLA 1XMLA 4Y8DA 3NYOA 4YO4A 5DWRA 5GZ8A 2J0KA 4FYNA 2YM7A 3O5AA 2RL5A 3FZPA 4I5CA 2XK8A 4FOBA 4KA3A 4QMZA 3I0QA 2Y4IB 4QYEA 2R2PA 4IANA 4RLLA 2CNVA 3W0PA 3BBTB 4DFYA 4DN5A 5CU0A 2ITXA 3PUFC 5KNJA 4ZMEA 2J9MA 1UU3A 2BZHB 3B8RA 4RFZA 5AUYA 2QOOA 3JVRA 5HZNA 3F5PA 5E8WA 5AUTA 3UC3A 4C2VA 1PRYA 5LVMA 2X6EA 5HD7A 5DRDA 1GZKA 5IU2A 3E7OA 3VC4A 4RA5A 3KXXA 4BI2A 2QHNA 5LCKA 5CAPA 4CFMA 3QQKA 4N4SA 5CU6A 3BWJA 2X7FA 1SNUA 4M12A 3H0ZA 4EH5A 4OLIA 4EOKA 4R8QA 4O2PA 5IQEA 3DKGA 3CE3A 3BX5A 1YWVA 4RJ3A 5B2LA 1KE5A 3I6WA 3PVBA 5J8IA 3PJCA 3DNEA 4BICA 2VTOA 4IB1A 3NEWA 5CASA 4M68A 4RRVA 4NIFB 4RG0A 3IW7A 5FDPA 4RX8A 3GB2A 4AN3A 4ERKA 5HICA 4D2SA 2W1HA 4K18A 2YCSA 4EJNA 4RLKA 5J9ZA 3DBEA 2WO6A 3BI6A 3QKKA 2R3RA 2W5AA 3M42A 2HZ4A 2Z7LA 3IK3A 3PJ8A 4HYHA 4XS2A 3VBXA 3MY1A 1KE8A 3UYSA 4KABA 4O6LA 4ZZMA 3R71A 3PY0A 3RM7A 3FPMA 3KU2A 3F69A 2YHVA 3D83A 3IDPA 3FWQA 2XNMA 2PY3A 3MB7A 3VNTA 4DDIA 1RJBA 4AN2A 3C0GA 4PQNA 4NM7A 4UB7A 4EI4A 4CKJA 1JVPP 4IC8A 2XNBA 3D7TA 4IAAA 1XKKA 4C59A 3HKOA 2SRCA 1XH7A 3V01A 4MVFA 5C03A 4D2VA 2YIRA 2QR7A 5ACKA 3L8VA 3DFAA 2OI4X 3R7UA 2Z7SA 4QP8A 3CXWA 3U55A 1ZYDA 3QALE 4RVMA 2O64A 3BV3A 5E8YA 3EFKA 4O2ZA 4XG6A 2OW3A 3HMMA 3SW4A 4IAIA 3V5JA 3FBVA 2VTLA 4ANSA 4HVIA 4CXAA 3EN4A 2NRYA 3CQWA 4QP4A 1W8CA 2QOLA 5AP4A 3OT3A 4QOXA 4WSYA 4EOLA 5HLNA 1Q62A 3POOA 4WG3A 3UIUA 4QNYA 3JYAA 1TQIA 2OIDA 3W0OA 3HRBA 4AAYA 4ZTLA 3NYXA 4F99A 4YLJA 5ACBC 3F3TA 4OAUC 4IDTA 3ZO3A 4XUFA 5AR3A 4LQMA 5ANJA 3PE2A 4J8MA 1JSTA 2HXQA 2VWZA 2WTDA 3NW6A 5CENA 4F6SA 3FL5A 4AXEA 2CLQA 4KIKB 5CEMA 1QCFA 3JS2A 2Y9QA 4MKCA 4L44A 2VWBA 4X3JA 4AACA 4UMRA 1B6CB 5IH5A 1OIRA 2R9SA 4V0GA 5LXMA 5AR7A 3U9CA 4CFVA 2VGPA 3V6RA 1OMWA 3OCTA 3PXYA 4TYEA 4EOIA 2PPQA 3QC4A 3ZLYA 4I0RA 2KTYA 3P86A 3S0OA 3PDTA 4NTTA 2GSFA 2BFXA 2B1PA 1YHSA 3D7ZA 2IVSA 5HIDA 3WF5A 1RQQA 3PTGA 3ZU7A 3KF4A 4HGTA 4YZ9A 3PLAE 4CMOA 4ACCA 3ORPA 4K9YA 4I6BA 3P79A 3QCXA 4I4FA 4ZSEA 5E4HA 3MGYA 4UWYA 3BGQA 4U97A 3TNHA 1J7LA 3F9NA 5D10A 3RKBA 3FAAA 2VNWA 3V8TA 3T3VA 2BVAA 2GNFA 3KVXA 3QTQA 4O22A 3QTXA 1CDKA 3KRXA 1TZDA 1U54A 1Q4LA 2BRBA 1JSUA 1M14A 2FH9A 3DFCB 3PJ3A 4R3RA 4ITHA 4YHJA 4RX9A 5DT0A 5AADA 5JGBA 3EFJA 2WIHA 4U79A 4WT6A 4B4LA 4B8MA 3DLSA 4DFNA 3UDSA 4U42A 2C47A 3RWQA 3TV6A 5BVOA 2Q83A 2RFEA 3VUKA 3U6IA 4V05A 2GTMA 2CGWA 5BUJA 1HCLA 4KUJA 2PUUA 4QP2A 4GK3A 4FIJA 4F1TA 4NSTA 4HYIA 1VLRA 2FUMA 2X1NA 3KCKA 5DG5A 5KZIA 1O6YA 5L4QA 3VQUA 4QO9A 1SYKA 1P5EA 4I22A 3FMKA 2ZYBA 4XBRA 3F82A 4ZXTA 5AP7A 5IA0A 2I40A 2IO6A 2W99B 2J50A 4ITJA 4WBBB 2CSNA 4EOSA 4A7CA 4GV1A 2OZAB 2VWUA 3KREA 3FQHA 2GQRA 4BB4A 3R21A 4IM3A 4O0WA 1V0PA 3HVCA 4XG2A 3ERKA 1ZYSA 2FGIA 1Y8GA 2KULA 3F66A 4FG9A 3R8PA 3SXFA 5I9VA 2C30A 2G2IA 2X2LA 4G5JA 1YQJA 4HPUE 2ESMA 4ID7A 5EOLA 4OBPA 2GHLA 5DN3A 3NFFB 4MEDA 2R3GA 3UP2A 1MRVA 3T9IA 3NUXA 2CCIA 4CMUA 1I09A 3FLSA 4L53A 1RDQE 4NJDA 3OZ6A 3MH3A 5LWMA 2WMTA 2XANA 3I1AA 3TM0A 5CANA 4YJRA 1NXKA 3FPQA 4CGAA 3TL8A 4A06A 3E64A 2I1MA 3QTRA 4MXCA 3QA0A 2WMXA 3QUDA 5ETCA 3UODA 1OGUA 3QHWA 3CTHA 4FL3A 2PMOX 2VWXA 3DB6A 3PIZA 1URWA 2X7GA 3QHRA 4OTDA 3SX9A 2OFVA 4LM5A 5C4LA 2RF9A 5HQ0A 4O4EA 3EN7A 4EH6A 4TWNA 3FMLA 4GH2A 1WBWA 4BHNA 4C58A 3P5KA 5L2SA 4U6RA 2GNIA 4G9CA 3L9PA 5H2UA 5KMJA 1PXKA 3W2OA 4RX5A 3HNGA 3G33A 4WNKA 2YA9A 4OTIA 4FGRA 3CJFA 4YHFA 1SVGA 4AW1A 4D28A 3FHIA 1H26A 3Q4CA 4O7VA 3SGCA 2ITPA 2PVMA 3AMYA 3BHVA 3VS4A 3LHJA 4P7EA 2EXMA 4RIXB 3Q9XA 5H8GA 2A2AA 3Q4ZA 4F6UA 5DMZA 4O7WA 3ZC6A 3UTOA 4M13A 5DR6A 2PVKA 4QDVA 3QQGA 2GQSA 3Q60A 1YXUA 3UVQA 4BCFA 3MW1A 4C33A 4OTGA 3OWJA 3TEIA 2E9OA 5AAFA 5BVNA 1FQ1B 3BRBA 5G6VA 3WILA 4ENXA 2QG7A 4F9WA 2RGPA 4A9TA 5EHLA 3KEXA 5HGIA 4FE2A 3MB6A 4C0TA 4ZMFA 3WZJA 4FTQA 3AC8A 4ANOA 2X4FA 1BI7A 4D0WA 3ANQA 4BCIA 5A4LA 3PP1A 2XP2A 5BMMA 3TIYA 2ZM3A 5J9LA 5A4CA 4AA5A 2ZV7A 2Z8CA 5ANGA 3DTCA 2XNGA 2CGXA 2HY0A 5D7VA 2JITA 3IGOA 2PSQA 3ATSA 3ZXZA 3PXKA 4WG5A 3W8QA 2WTKB 4J7BA 1J1BA 5EYCA 5IKWA 4F65A 2IW9A 3Q6UA 3BYOA 4YJUA 4FSYA 4TWPA 3QTIA 2VTAA 4PWNA 2ONLA 4USDA 4BVUA 5A46A 1SZMA 2YWPA 1XH4A 3P4KA 3GCQA 4G34A 3RINA 4FVRA 3OW3A 4PNKA 1WVYA 3SHEA 4AS0A 4FKRA 5F9EA 4QPMA 3GOKA 3QRJA 4ZTSA 3W32A 5J79A 4FKGA 4ZSGA 5I4NA 1F3MC 3ZFMA 2XKCA 3L9LA 3LIJA 3LAUA 3QZFA 3WE8A 2XF0A 3LCOA 4E93A 1RW8A 3KXGA 4F70A 1UNLA 5IEYA 4MUQA 3EH9A 3EWHA 4X2GA 3VHKA 3AGMA 5AR2A 4EH9A 3EOCA 4EH8A 2CPKE 4MNEB 4E6QA 1TFFA 3C0IA 4CFNA 5BYZA 4L8MA 4ACGA 2OBJA 1DAWA 1DS5A 4F9CA 3O7LD 3R00A 3WZDA 2PVNA 5HIBA 1YOMA 5LVOA 3ZSIA 1P4FA 1V1KA 1OI9A 4S33A 3BEAA 5DRBA 4M69A 3FZTA 3OEFX 4EEVA 4DCAA 3ORLA 4PMPA 2A1AB 3TTJA 4D1SA 3I7BA 4NIFA 3I6UA 4IHPA 4O0TA 2ITQA 4W8DA 4XV3A 4ZJVA 4BJJB 4IIRA 2PTKA 4BWXA 1KSWA 1XR1A 1YHWA 3NW7A 2ZM1A 1ZZLA 5AV0A 2OXYA 4FTRA 3QU0A 1ND4A 3GFEA 4FG8A 3DAKA 4GU6A 3HV4A 2R3JA 4LYNA 2H8HA 4P2KA 5AUXA 2OSCA 4UV0A 4PDOA 3OHTA 4EZ3A 5HBJA 3FUPA 2XJ1A 4XV1A 1J91A 3WF7A 3A2CA 4I0SA 4C37A 4PTCA 4F6WA 1H0VA 3MN3A 4E4NA 5IA2A 5HHWA 4EQUA 3BIZA 2NYAA 4AT5A 3CBLA 4KBCA 4O0YA 2YM4A 3OS3A 1G8JA 4FIGA 1TQMA 3GGFA 1J3HA 4JAIA 2C5NA 4YO6A 3KC3A 3O2MA 3VBWA 4XOYA 4TKSA 2QI8A 4GJ2A 4AGCA 2JDVA 4NK9A 3CY2A 2R5TA 2X2KA 4UXLA 4FZ7A 2NP8A 4ZS0A 4AGWA 4MXAA 2PE2A 1NY3A 4RMZA 4GKIA 3H9OA 5E8VA 5K0KA 4DGMA 2J5EA 3UOKA 4HVSA 3NUNA 2WMQA 2WTJA 3K54A 5HIEA 4AA0A 5FTQA 4CV8A 3UNKA 4I5MA 3AMAA 3MFTA 3VS2A 3Q2MA 4CSVA 4BCPA 4BI0A 1OIQA 5LARA 1LR4A 2UZUE 2XVDA 3RK7A 3R01A 5C4KA 3HRCA 3WOWA 5FQDC 5BVKA 4PNIA 4RIOA 3VS6A 3C0HA 4MNFA 1FMOE 2BDWA 2F9GA 2V62A 4DTBA 2VTMA 2CKEA 1K3AA 3UG1A 3F3UA 3ORZA 3PVWA 3OUNB 2YM6A 4WSQA 5EDRA 4CYIA 4I6LA 4N0SA 5EM6A 2CDZA 4F7LA 4DDGA 3FXWA 1H1WA 1W84A 3TV7A 2RG5A 4G16A 4ZZNA 5EDPA 1Q24A 5CNNA 3BLAA 3W0MA 1H00A 2QR8A 3O71A 2PVYA 5M08A 3RPVA 1ZARA 2QURA 4BIBA 3TJCA 3L8PA 3VBQA 1NVQA 4O7YA 4FKWA 3V5WA 2YM5A 3O8TA 5K5XA 4QDEA 3TUDA 4FV2A 5CEQA 2PZPA 1XH5A 3GENA 3LFEA 2PUIA 4O1OA 4X6QC 3R7IA 5AP2A 2XBJA 4YMJA 4PL3A 3UNJA 3IKAA 4NT4A 5JN2A 5BYYA 2V5QA 3D5WA 3QTWA 1CKJA 4BYIA 5AEPA 4FKIA 4PDSA 2LGCA 3UVRA 3PVGA 2YZLA 1P14A 4IX4A 3CR0A 3UOHA 3GCPA 3QYWA 4Z7GA 3VULA 3CY3A 3DA6A 3ZLXA 1YDSE 1O6LA 2CLXA 4IZYA 4I6FA 4RC3A 4ZP5A 2P2HA 4ZY5A 4ZSJA 4X6RA 5HTBA 5E9EA 3PXZA 4RVTA 4WOVA 4KRCA 4FSUA 3RAWA 5E90A 1YWRA 3DV3A 3OF0A 4ZY4A 2EUFB 3NCZA 5JGAA 1OL7A 1V0OA 4GCJA 3W2QA 2QOCA 3ZLWA 3DDPA 3UBDA 3UZRA 2EB2A 3NW5A 4I20A 4ZLOA 3TZ7A 3O23A 3K3IA 4LV5A 4MYGA 3UJGA 2GDOA 5BVWA 2GS7A 5JFSA 2E9PA 2OFUA 3SOAA 4BL1A 3ENHA 3IG7A 5F1ZA 4YJNA 4KKEA 2B7AA 4J98A 2BCJA 4IB3A 4ONAA 4UXQA 4XG3A 4TNBA 3CIKA 4YC8A 5ANIA 3RPYA 4APPA 4LGGA 3DJ6A 3OTUA 4ZS4A 4PMSA 1UKIA 2CHLA 4JR3A 3GP0A 1Z57A 2OZAA 3MVHA 5H3QA 3SA0A 4EKLA 2VAGA 4BCKA 1G3NA 4BZNA 2IPXA 3MA3A 4JR7A 3SRVA 4DFLA 4DBXA 3C4XA 3PPKA 3BQCA 5M06A 5TE0A 3KA0A 4MHAA 5EYMA 5CF5A 3NNXA 2ZOQA 5TR6A 3Q04A 3LCSA 3G9LX 4MD7E 5AA8A 4AAAA 4X21A 1XH9A 5FTOA 3G5DA 5CSXA 5JFXA 4ANBA 2VNYA 4Z9LA 3FI3A 2W06A 5IF1A 3BCEA 2JFMA 3R9HA 3ZEPA 4IC7A 3QUEA 3MIYA 3R1SA 4R5YA 5BPYA 5M4IA 3AG9A 4WHZA 3QX4A 4XOZA 3V51A 3TZ8A 4EOQA 2F49A 3QXPA 4U44A 5LMAA 3MS9A 1OKZA 2P33A 1JBPE 2QOHA 4BDIA 3N4TA 2OJIA 2ZVAA 3PYYA 3NS9A 4WUNA 3ORMA 2GU8A 2BRNA 4K0YA 2J0LA 3ZONA 3VIDA 4EK3A 4YUQA 3ORTA 1YRPA 3VS3A 4ZAUA 3RCDA 3DU8A 3KXNA 5EG3A 3RPSA 5A6NA 3TDVA 1REJA 2W05A 4ZJIA 5HI2A 2IWIA 3AD6A 1JKTA 3QGYA 3FY2A 2XJ2A 1WBVA 2X9FA 4FG7A 2J4ZA 3BGZA 4G9RA 4JLCA 2BALA 2WELA 4H58A 2R3MA 4IWQA 4U45A 4BBFA 3RM6A 2V22A 3UMXA 4RPVA 4E6DA 5EKNA 3U6HA 4AF3A 3KRWA 2C6OA 4ASXA 4R78A 4RIXA 1UU7A 4MD9E 3TNWA 2WAJA 4FV3A 1MUOA 3R83A 3QTSA 3TNPC 3ML1A 5ICPA 2HIWA 5KKRB 3BQRA 4UMUA 2Y0AA 3V8SA 3VS0A 4PDPA 4KS8A 4P5ZA 1K9AA 2BTSA 4CTBA 1BKXA 1FOTA 3EFWA 3PRIA 2BRHA 4FT3A 4Y95A 4FKOA 1ZYLA 5K5NA 1G8SA 1Q41A 2BTRA 3NGAA 4K2RA 4QMUA 5CAOA 1PXOA 4AQKA 3S4QA 4EH7A 2VTIA 3CKWA 2AC3A 3RI1A 4QEBA 2IF8A 3FE3A 2F7EE 3Q53A 4RWJA 4W4VA 3LXNA 2XIRA 4A9RA 3DAJA 3ZHPC 4BDFA 3VUMA 3W0NA 2ZM4A 2OK1A 5I9YA 2YJSA 5DOSA 2JKOA 2WD1A 5JKGA 4XG4A 3A8WA 4O7RA 3LXKA 4XHKB 3A4OX 3BYVA 4D1ZA 3TYKA 4V04A 2JAMA 3BLQA 3UOLA 2OWBA 3C51A 4C4HA 3S00A 4JG6A 4LI5A 1P2AA 4BGQA 3FI2A 4LG4A 4MAOA 1W0XC 5JQ8A 1AD5A 4NEUA 2Q0NA 4FEWA 1GAGA 2WQNA 4TYHB 1U4DA 5G1XA 1QPCA 3E3PA 4HZRA 3A61A 2PVJA 5TT7A 1JKSA 2OXDA 4KKGA 5FM3A 3MFSA 4YJVA 4GW8A 5CF4A 4CQEA 2I7QA 4EBVA 4FZFB 5B0XA 4DEIA 2YERA 3QTUA 1KOAA 4K6ZA 5CS6A 3QZHA 1U59A 3M11A 4BBMA 3LFBA 4MQ1A 1YDTE 5DR2A 3R8VA 2XS0A 1ZOGA 3N4UA 2UW4A 2W1FA 3DJ7A 4EJ7A 2WIPA 3EQDA 2BFYA 4HGLA 4DF3A 1ZY4A 1OUYA 2DQ7X 4FTCA 3RCJA 2BZJA 4O27B 5M4UA 3TI1A 4DEHA 2JKQA 4NCTA 2OJFE 2VO0A 2X0PA 3OD6X 1VEBA 4WBOA 4OTQA 3PRFA 3PSCA 3P7CA 4RVLA 3LCDA 4MWHA 1ZLTA 3JPVA 4C8BA 5GIOE 1ZZ2A 4JS8A 3FKNA 1U5RA 3OVVA 5DIAA 1WMKA 1RE8A 2B4SB 5AUWA 4IMYA 5KO1A 1JKLA 1ZYCA 2PZRA 3UOJA 3TV4A 4FEUA 1O9UA 4KINA 3VS1A 3GU8A 2ZFYA 3THBA 3MDYA 2WQBA 4KB8A 3VUHA 4WNOA 4A9YA 2XK3A 4FIIA 4IWPA 2WGJA 4KS7A 3UGCA 4FTNA 2UZDA 4XLIA 5BUEA 2P55A 2QO9A 3O0GA 4QD6A 4XG9A 2JFLA 3DT1A 1A9UA 4I93A 5DA3A 3DS6A 5HG8A 1JPAA 1XWSA 2OKRA 5IUHA 2BIYA 2QOQA 3TIZA 4AW0A 2QCSA 4Q5HA 4TPTA 5HLPA 5EM7A 1Y6BA 2I0EA 3CS9A 1Q3WA 1W2CA 3PPZA 4UYAA 5CQUA 5IZFA 2BIKB 4JRVA 1SMHA 4GT4A 5F94A 3VRYA 3LMIA 3PFYA 3FMEA 3MV5A 2R3KA 4JIKA 2W1GA 5CT0A 3W55A 2Z7QA 4KNBA 3WZEA 2R3OA 4WG4A 4F0IA 3AC1A 1ZWSA 4L42A 2YN8A 5E1SA 5F4NA 4P5QA 3CP9A 4M97A 4OTHA 4I24A 3PVUA 2UVXA 3BYUA 2WTVA 3UP7A 4IB0A 1Q8ZA 2B54A 4TYGA 3R8MA 3UMWA 2PE1A 2PUPA 3K3JA 2OJGA 1LPUA 2YAKA 3OTVA 5T6KA 3HMPA 2XZSA 4I4EA 5HG5A 4QTCA 1O6KA 1YOLA 4QMWA 4FSQA 3KRJA 2VGOA 4KIQA 5AUVA 4F09A 4Z7HA 5CEKA 3AC4A 3UIBA 4JG7A 4FTTA 1PYEA 4TXCA 1UKHA 1KUTA 2W5BA 5FM2A 4JMQA 4HNIA 2JC6A 2V55A 5JZJA 4RC4A 4CFUA 3P23A 3RP9A 3NNUA 4BTKA 4EHZA 4HCUA 5I9XA 3V5TA 3HUBA 3PP0A 4G6LA 5HVYA 4J96A 4J99A 3RGFA 4AP7A 3FEGA 3OFMA 2YACA 4O0UA 5CSWA 5IG1A 3A8XA 3KN5A 2QU6A 4XH6A 2WTIA 5CZIA 4HNFA 3JVSA 3CCNA 4WA9A 4YJTA 5EDQA 4QNAA 4EC9A 3R1QA 3H0YA 5A4TA 3Q32A 3EQPA 4MD8E 1OKWA 4JBOA 2IN6A 1BYGA 3MPMA 3P1AA 4FSTA 4FK3A 3MVMA 2PZ5A 3K5UA 4ANNA 5E8TA 4CFXA 1PXJA 3O51A 5BVFA 4IZAA 3V8WA 2XUUA 2HAKA 5AP0A 3RTPA 2VZ6A 4RT7A 3HA6A 2YCQA 3AT2A 1W98A 5HU9A 5D9HA 3HMIA 1ST4A 4J8NA 2R64A 3BKBA 3NAXA 4R3CA 5HKMA 3R7GA 2ITTA 4G3EA 3MTLA 3SAYA 1J7UA 2A27A 3DPKA 4MH7A 1PY5A 2RFNA 3BE9A 2IZSA 3TNQB 1KE9A 4X0MA 4QP3A 4ZSLA 3VAPA 3GC8A 4R1VA 5EW3A 5H9BA 3CKXA 5DYJA 3SG8A 1YWNA 4QYFA 1MP8A 3TXOA 1BX6A 5FBNC 4YTHA 4FSMA 3W2SA 4C57A 2C69A 4FV4A 3K2LA 3S1HA 3MWUA 4C4JA 5IQGA 4HOKA 3TNIA 4JI9A 5CEPA 3PSDA 3E8NA 1ZOHA 3E3BX 3WIKA 5JEBA 1R78A 5IQFA 4G6NA 5DBXA 4HGSA 4U40A 2V7OA 4I0TA 4KSPA 3UDZA 5KBRA 2ITNA 1X8BA 2HZ0A 1OBDA 4X3FA 5FG8A 2VWYA 3AGLA 4MF1A 3KULB 3OBGA 3SLSA 4FSNA 1YOJA 2OF4A 3WF6A 4BKJA 2WTKC 2PE0A 5L6PA 3TUCA 3S3IA 4O0SA 4FEQA 4WIHA 2DWBA 2C6DA 3DK7A 5IQAA 1GOLA 4DINA 4BCMA 4XX9A 1DI9A 5DFPA 3DZOA 3TWJA 2O5KA 3Q9ZA 4ERWA 5I5ZA 3LJ1A 1STCE 4R7IA 2HENA 4DH8A 1F0QA 2QNJA 5DHJA 2CN8A 3KXZA 3PA4A 2HYYA 3IO7A 4MTAA 5IQBA 4WNMA 2YCRA 4E5WA 5L3AA 5HBEA 3N4VA 4YZNA 4G3DA 3LQ5A 4UALA 1T45A 4CT1A 4G3GA 3C4ZA 2F4JA 3R7OA 4AFEA 3FLWA 3MY5A 4L52A 3GCVA 5CI6A 5CNOA 2WZJA 1W82A 3RK5A 3CTQA 5GHVA 3OT8A 1IRKA 2VTTA 2R3LA 4O1PA 5C9CA 2BR1A 4JQEA 2WU7A 1WZYA 5AR8A 3B2TA 4NCTC 4FTJA 2G2HA 3FV8A 4QQJA 1JQHA 3BWFA 1V0BA 4XCUA 1PMUA 3ROCA 4WD5A 5CVFA 3LFSA 2B9IA 5EOBA 2I0VA 4FNZA 2BRGA 3HA8A 4AOJA 1YXTA 4QYGA 2OJ9A 3MFRA 5BV3A 4LUDA 1ZOEA 3W0RA 1L3RE 3R7YA 4AN9A 5CVHA 3I0OA 4NM0A 4EL9A 4IFCA 4Q9ZA 4NUSA 3DKOA 3NUUA 4G5PA 4I5HA 4YBKA 3EHAA 4BDBA 1ZMWA 4O7SA 3N9XA 4A4XA 3MJ2A 3DBDA 3ATTA 3WF9A 3DKFA 3ETAA 1Y57A 4RFYA 2Y7JA 2A19B 5HX8A 5DT3A 3KB7A 3PXFA 2JIIA 4EH4A 5A14A 2ERZE 4PTEA 3HMOA 1EH4A 2FSMX 3BPRA 5TO8A 4C4IA 1Y8YA 4FSRA 5J7HA 4O86A 3S95A 4LV8A 3CGFA 5EHYA 3AC5A 1FVRA 1JSVA 2GHGA 2NPQA 1JNKA 1SVEA 3E63A 5CXZA 1UWHA 3PA3A 4QQ5A 3EQCA 4YTCA 2C0TA 5D41A 1MRUA 2BILB 3PXQA 2OJJA 4QP1A 4QMPA 2BPMA 2JEDA 4I1ZA 1Q8UA 1P4OA 2GTNA 4AGDA 4NJ3A 2H96A 4ACDA 1XHAA 4OBQA 4EOJA 2DUVA 4Q5EA 4U43A 5GJFA 4DHJA 2VWVA 3Q6WA 3NNVA 5HESA 4DYMA 3AXWA 5CY3A 3OWLA 4HYSA 3B8QA 4B0GA 4ANMA 2W9FB 2R3HA 4PPBA 4TWOA 4X2NA 3RJCA 4D0XA 3WI6A 2W1ZA 2C5VA 3NDMA 4DEDA 4TYIA 3Q5IA 3ZYAA 3HUCA 4RFMA 4FJVA 4TYHA 5IUIA 2XCKA 1OKVA 2DYLA 2J90A 3KXHA 3OC1A 4IX3A 4CKRA 3R1YA 5HNIX 1WBNA 2ZMDA 4F0GA 5E8SA 5JFWA 1Z5MA 4BIDA 4OTRA 5AMNA 4YR8A 3KMWA 1FVTA 4GU9A 3WZUA 3R0TA 4ZOGA 3IECA 4BWPA 2Z02A 1PXNA 5EM5A 4ACMA 3HV6A 2C68A 1H8FA 4F64A 5L8JA 4RZVA 3F5UA 3VBYA 4RA4A 2PYWA 3AKJA 2XIXA 4BKZA 2F7ZE 4O0XA 4AZVA 3ULZA 4TL0A 3KIOC 3W0QA 4RIYA 4FEVA 3R28A 3TZ9A 3AD4A 3EYGA 4LGDA 3U54A 2YEXA 3QBNA 4YSMA 4FKUA 5AA9A 4YTFA 4AXCA 3CC6A 3Q3BA 4ANLA 4OR5A 4BFMA 3COIA 5CT7A 4N6ZA 4Y85A 4D4YA 4AOIA 4FNWA 4FA2A 1E1VA 1PXIA 3NYVA 3EYHA 1PKGA 5ETFA 4JX3A 4CQGA 2X4ZA 3EZVA 3FMHA 3QRUA 4KAOA 3R2YA 3Q2JA 4XJ0A 1OPJA 2YIYA 3GUBA 2OIQA 2GNHA 1UV5A 4GK4A 4EYJA 2OO8X 5BNJA 4BR3A 4YPDA 5HCYA 5A9UA 3F5GA 5IDPA 3SVVA 3AKKA 2EXCX 2UW0A 2QODA 3W2CA 4BZOA 3AOXA 3QX2A 4JX7A 4ZIMA 2GMXA 3PLSA 4OTPA 5HCZA 5CAVA 4DTAA 1QMZA 2HZIA 1M7QA 5T3QA 3GOPA 4DEAA 4K33A 4C36A 4IZ5A 3PG1A 4GYGA 4JDKA 4U3YA 4QTBA 4E73A 3R9OA 2CNUA 3P5JC 3VF9A 4C7TA 3FC1X 4AW2A 4C02A 1UVRA 4CKIA 3IPHA 3DGKA 2JDTA 2IW6A 1HCKA 4IWOA 4YURA 4S31A 3DXQA 4NM3A 4YZMA 3VQHA 2PMNX 5CU2A 5KMNA 3FI8A 5J1WA 5D12A 3TDWA 4X3FC 4D4SA 3UYTA 4BCJA 3DB8A 3FZOA 5HU3A 1OL6A