4PDSA

Crystal structure of rad53 kinase domain and scd2 in complex with amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
300
structure length
249
Chain Sequence
TGIFKDFSIIDEVTVKKAIERTTGKTFSVKIIVTRELEVLQKLNHPRIVRLKGFYESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITAFGLAKVAYVAPEVIRRNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLSYGDFSQISLSQSLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase RAD53
publication title Structural basis of Rad53 kinase activation by dimerization and activation segment exchange.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 69
structure length 249
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pdsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdsA01
2P3GX 1UA2A 4YJSA 3LE6A 2H6DA 1OB3A 2XKFA 3QYZA 4FGBA 2QKRA 4AA4A 2ZJWA 4O91A 4ZZMA 2CGXA 1M17A 2KTYA 1TQPA 1H1SA 4J1RA 4M84A 3ZRMA 4TNBA 2WMVA 4DEGA 2W99B 3FKOA 5EH0A 3VJOA 3D2KA 3F5UA 1FGIA 2P4IA 2PVYA 2YACA 4G6NA 4GT5A 2HZ0A 5CTPA 5E7RA 3TKUA 2IN6A 3I4BA 4IX4A 1JAMA 1JVPP 4ACCA 3UIMA 4C8BA 3ETAA 3FE3A 2Z2WA 1Z57A 4RPVA 4NZWB 4FIGA 4HVGA 3DZOA 3RKBA 2XNOA 4LG4A 4AW0A 3DB6A 4JAJA 3G9LX 5M08A 2IVTA 4F9CA 1YKRA 3S2PA 5E8WA 5DYJA 2V55A 3BI6A 1J1BA 4LOOA 4WG5A 2WTKC 2WMWA 4QMNA 2WQMA 2XIXA 4D2WA 2B9JA 2GQSA 4BTJA 4XHKB 2R9SA 3E3PA 2ZV8A 4QPMA 3U9NA 2VRXA 3C4ZA 3D5VA 3PJ2A 5ETIA 3AGMA 5EYKA 3WBLA 2YIQA 1E1XA 4A4LA 1JLUE 4X2JA 2G15A 3HGKA 3JXWA 4PP7A 4YJVA 3TUDA 1ZYLA 4QMZA 1XBBA 5HNIX 3R1NA 3ULZA 4EWQA 4Y95A 2Z7SA 1PXLA 1M2QA 1YI4A 4FUXA 5EFQA 4EOMA 2PE1A 3LJ1A 4H1JA 2R0UA 5EW8A 3H10A 5EKOA 1JWHA 5FXQA 5F9EA 3ZUVA 2FO0A 4O7YA 3PVGA 3AMAA 3HYHA 3FXZA 2GSFA 4X6RA 2BHEA 3MH3A 1B38A 1CKJA 2BZKB 2VNYA 3NVMB 3R00A 4F0GA 3EN4A 1OL2A 2V62A 4K33A 3GC7A 3HMNA 4MBIA 4QTDA 4RJ4A 4KNBA 4RT7A 5DWRA 3QA0A 5JEBA 1IA9A 1A9UA 2QQ7A 4FTOA 1GZOA 2GQGA 4D2PA 4DINA 2XKEA 5CAPA 3RK5A 2E2BA 4BGGA 3FL5A 4FOCA 4ITIA 4GK4A 4IM2A 1SMHA 3PUPA 4MXCA 1BL7A 5H2UA 2OSCA 5M4FA 3V5QA 5IA4A 5LWNA 1FPUA 1O6YA 2YA9A 3QU0A 2J5EA 3OXZA 5AFVA 3OW4A 2DQ7X 4X3FA 4ACGA 4BKZA 4XBUA 3CQWA 4FL1A 4FZAB 2CNVA 3OT3A 4EOOA 2FSOX 1W82A 4RX8A 1OPLA 1SYKA 5FP6A 4I94A 3KVXA 4A9UA 2VTIA 4EORA 2ZB1A 3AMYA 4OTPA 3V6RA 4QMQA 1E1VA 4Z3VA 2Z02A 2C5YA 2ITXA 3O96A 4WUNA 4X3FC 4O81A 5IQAA 4WG4A 2WD1A 3Q6UA 3QRTA 2QU5A 2JBPA 3U54A 2GFCA 3MBLA 2I0HA 3ZLSA 2Y4IC 3LXKA 4ENYA 5I5ZA 3D5WA 2BDJA 3BGZA 3L1SA 3VUKA 3E8CA 5ACBC 2GNLA 3SQQA 2VAGA 5HQ0A 5DG5A 5IKWA 5JQ5A 2BTSA 4QO9A 1Q8ZA 4R3CA 3QGWA 4DH3A 4C37A 4O0YA 3QRJA 4H39A 3NDMA 2UZVA 4FSRA 2I40A 3Q5IA 4DBNA 3KN6A 2X2MA 4TYHA 4ERKA 4XCUA 5CQUA 2ITYA 2CLQA 1FVTA 3FLQA 3VUIA 4FG8A 3F6XA 4L42A 2W1HA 4AT4A 2PVLA 4JQ7A 3ORTA 2JDTA 2R2PA 2JIVA 3ZZWA 4YGAA 3TUCA 3CGOA 3ACKA 3GC9A 2VGPA 2GU8A 3UG2A 4FVPA 4I3ZA 1KE7A 2ITOA 2W5HA 4ITJA 4DGLC 4J95A 2HZNA 3FLYA 5LMBA 3CCNA 2F57A 3NIEA 3KMWA 4NKSA 4U8ZA 3U87A 4EC8A 4OW8A 3TNWA 4EOQA 4PF4A 3VUGA 4D4SA 3DKCA 4F9WA 2BRNA 4RWIA 3C0IA 3R7GA 1UU8A 4YZNA 3KMUA 3PSCA 3LHJA 4C2VA 3BPRA 3KQ7A 3QCXA 3RAWA 3UGCA 4YLJA 2HW6A 2JITA 1Y6BA 5I9UA 3TNIA 3S0OA 3WIGA 3BELA 3DK3A 3LFAA 4IX3A 5KBQA 2R3IA 3T9IA 2PPQA 1JSVA 3HRBA 1PXJA 3QGYA 5L3AA 4YBJA 4CZYB 1H1WA 4ZJJA 4F70A 2VWBA 4I6QA 2ZMCA 1IAJA 2UV2A 3G9NA 1H28A 4GFGA 1TVOA 4XV9A 5AR7A 3OOGA 4X2KA 3ZXTA 3LCKA 3TM0A 4YTIA 3LMGA 2GQRA 5HO6A 3H9RA 5IZFA 1BI8A 3PA4A 1WBNA 5IUIA 4DTKA 4FYOA 3LLAA 3IW7A 3PXKA 4IANA 4IC8A 3QZGA 3RGFA 2G2IA 5DHJA 1DI8A 1JQHA 4FNWA 4G3DA 5LVLA 2PUUA 2ERKA 2WGJA 4YSJA 5CF5A 2BCJA 4QPAA 2XKDA 5EYMA 4UXQA 2PMLX 3LLTA 5K4JA 3GU7A 3ORIA 3A4PA 4GIHA 5M07A 3BRBA 5CZIA 3DBQA 4ANMA 4CQEA 1JBPE 4W4YA 3UTOA 5HTIA 4KIOA 4TL0A 2PHKA 1NA7A 4FTIA 1NVSA 3OHTA 2RSVA 2WQBA 2QVSE 4BCJA 3SDJA 5HE3A 3GB2A 1U4DA 3DDQA 5LJJA 4HVHA 4YBKA 3F69A 3I0OA 4WT6A 3WIKA 4RX9A 4LI5A 1OVEA 3JUHA 4U5JA 3DBDA 3KA0A 4QMLA 3E64A 4U80A 4C3RA 4MF1A 3TV4A 3NYNA 1SVGA 2J9MA 2X7FA 3PJ3A 4ARKA 3HKOA 4QP3A 5DIAA 2UW9A 4B6LA 2RF9A 3BE2A 3QXOA 3W55A 1XKKA 4L3LA 4IIRA 4DFBA 1IR3A 4RFMA 4BCGA 3IQ7A 4FTCA 3EFWA 3KL8A 3R73A 4HYIA 4KB8A 3VNTA 3ZC6A 4ZY5A 3N4UA 3SGCA 3ORMA 2V5QA 4YC8A 4WG3A 3I60A 3MPTA 2IWIA 2ZV9A 3DBCA 5F94A 2P2IA 2XRUA 3CIKA 1H0VA 3P79A 3ZRKA 2W1DA 1QPJA 2GNHA 3FI4A 5CU2A 4NWMA 4X3FB 4KWPA 3ZO3A 3UOJA 3NW5A 4M7IA 4YU2A 2A2AA 2BVAA 2QONA 1H01A 4G9RA 3IOKA 3AT2A 4UWYA 4A4XA 2Y4IB 4YPDA 2YWPA 4XLVA 2BDWA 2VTQA 4UZHA 1XJDA 2WEIA 3CLYA 4E3CA 3D2IA 3EJ1A 4CTBA 2ETMA 4RX7A 1RDQE 2X7GA 3DKFA 4O84A 2VWVA 3E87A 4BKYA 2BPMA 2OI4X 3BYMA 4G3FA 4WBOA 1H1PA 3MDYA 2H9VA 3OC1A 2YCQA 3R0TA 1MQBA 1XH6A 3AC5A 3ZFXA 5GIOE 5L4QA 4RVLA 4JIKA 1MQ4A 2HXLA 2WXVA 4FKOA 4BHZA 3FYKX 1BYGA 4IC7A 3GCQA 4PWNA 3U9CA 4HYSA 1S9IA 2UVYA 4FZ6A 4YZMA 1BL6A 4JS8A 3Q5ZA 4X6QC 1I44A 1OL5A 3SG9A 4HVSA 4TYHB 5CI6A 3UZTA 5AAGA 2PVFA 2HAKA 2O2UA 4AN3A 2W06A 4ALVA 1PXMA 4W9XA 2WU6A 2VX1A 2OXDA 1H0WA 2WFYA 3TN8A 4ZLOA 2JKOA 3MH2A 3F5XA 3QD3A 5I9ZA 5AR5A 3A60A 4FG9A 5GJFA 3EFLA 4MXZA 4BGQA 3BV3A 3CTQA 4PTCA 4EHEA 3PXFA 3ANRA 2XYNA 3SX9A 3ID6C 4D2RA 3E92A 3ZLYA 3R9NA 2XEZA 3IK3A 3P7BA 4RC2A 2OU7A 3MB6A 4FV5A 2O63A 3W2SA 2YDKA 3HUBA 2E9PA 3FMJA 3AQVA 4RFZA 4RVKA 4BDHA 1H8FA 2EB3A 4ENXA 3EYGA 3PJCA 2C6MA 3V51A 3RPRA 4D9UA 1H1RA 1WBWA 2UZEA 5DEWA 4C38A 4D2SA 2VWIA 4IBMA 4TKSA 3TDWA 5FBNC 2R4BA 3A99A 5AP6A 2YJRA 2YHVA 1YVJA 5M4IA 4GMYA 2QODA 4IHPA 3UVPA 5FLFA 5KO1A 2QO9A 4FTUA 3C4EA 4M66A 2WAJA 4NTSA 5HD7A 1IA8A 5HO7A 3QC4A 3DU8A 3CP9A 4X3JA 2UW6A 2BZJA 5FTGA 5J9YA 2VD5A 3AC1A 3R63A 3TKIA 3W33A 3Q4CA 3QTUA 3NS9A 4YJNA 5EW3A 4O0RA 3I7BA 3VUDA 5LWMA 4BVUA 5ETFA 3W2QA 4FNZA 4E1ZA 5ANKA 3G33A 4GS6A 5KZIA 2UZNA 2JGZA 4QOXA 3LFCA 3LFEA 2PULA 5CASA 4IFGA 3WF8A 5J5SA 4JG7A 2IZTA 4L3PA 2QOFA 3RPSA 3ZOSA 5G1XA 4C33A 4JBOA 4AGCA 3WZDA 3ORXA 3IOPA 4I6FA 1KOBA 2V7OA 4AS0A 5TKDA 3Q32A 2CGUA 3CKWA 1Q3DA 3P0MA 3FDNA 3PVWA 4S34A 5ANOA 4AP7A 4EOJA 4U41A 4DTBA 5E8TA 3O7LB 4FKPA 2J2IB 1YXTA 3OMVA 3TI1A 2I0VA 5HG5A 4DH5A 5GINE 4IAZA 3VUHA 3FLZA 1PXIA 3H0YA 5CNOA 3DBFA 3HMMA 5AP3A 3NCGA 1W83A 3GU8A 4PMMA 3MTFA 3SXRA 4CZTA 3QALE 4IWQA 3VULA 3OEFX 3VBYA 3ZFYA 4G3CA 4PDYA 2QLUA 4DEIA 4KD1A 3CTJA 4ZSJA 1XO2B 5FGKA 5LVPA 2XMYA 3SHEA 4CNHA 3FZPA 4BYJA 5CF8A 5LCJA 3QRUA 4FT5A 1R1WA 2VTHA 2E9VA 2VWZA 2QKWB 1Q8UA 4F9BA 1OL6A 3C50A 2OGVA 3RAIA 3OWJA 3ROCA 4KKEA 3QHRA 4LGGA 1M2RA 2XJ0A 3E62A 2CN8A 3EIDA 2R3LA 5IEXA 3LMIA 3DXQA 2R5TA 4EWHA 1SZMA 3UVRA 2EUFB 3FJQE 2CGWA 2W5BA 4C02A 2F7XE 4OTHA 5IQIA 1ZYSA 3PWYA 2JKMA 4JX3A 5CENA 4O1OA 4D1XA 5IISA 2Y0AA 4QMPA 4EK8A 1RJBA 1A48A 4QMTA 4JAIA 1PMVA 3NNUA 4FSZA 4PY1A 4RSSA 3OFMA 5AV0A 4F6WA 3MFTA 2VU3A 4QMYA 3KN5A 5DPVA 3THBA 1OIYA 2R3GA 3M42A 5BX0A 3WOWA 1AQ1A 3GFEA 5DE2A 1KWPA 4DFNA 4BCPA 2YLEA 4U43A 1P14A 3L8SA 4RIWA 4H36A 2I1MA 3EQPA 4O7TA 4HCTA 4ZEGA 3QRIA 4D4YA 3OD6X 4KSPA 3Q2MA 5L6PA 4BN1A 1UWHA 4GKHA 4UALA 2VWXA 4FKGA 5H8BA 3U4UA 2UZLA 4KSQA 1CSNA 4RRVA 3IECA 3D7TB 2AC3A 4M12A 3EOCA 1UV5A 3HV6A 4NYEA 1GZNA 5FM2A 3R1SA 3Q04A 4PNIA 2JKKA 3S00A 4CG8A 3II5A 3IS5A 2B9IA 3VBXA 3LFSA 4O86A 2JD5A 3O50A 3B2TA 2CHLA 3Q52A 2JIUA 3FHRA 5IH6A 4FTAA 3UOHA 5F95A 2GNGA 4GYIA 3ENHA 1ZOEA 4I93A 3NUUA 4DG0E 3QTWA 3FMDA 3MH1A 3NUPA 2IVSA 3O17A 4GEOA 3V8WA 3BHVA 4UYAA 4B7TA 4DEHA 4R1VA 2FA2A 2JC6A 4BR3A 4U3ZA 2B53A 2W4OA 2G9XA 3OT8A 2C69A 3KF4A 3FYJX 2W5AA 4TW9A 2UZBA 1MRYA 4DFLA 3MYGA 4ZMEA 4A4OA 4ORKA 3D0EA 1GZKA 2H34A 3QQJA 4FR4A 3BV2A 4QYEA 3QQUA 4V05A 3W32A 4ZY4A 5IMEA 5T3QA 4FUYA 2W1IA 3UNZA 5C8NA 4V01A 1OKYA 4RJ8A 2OZAA 3DFCB 1A06A 5JT2A 4AU8A 1F0QA 3SV0A 4ZMFA 4O7SA 2WTWA 5FEQA 3UBDA 5HX6A 5CAOA 1R78A 2HOGA 2F7EE 5K0XA 4J97A 4JQ8A 4TXCA 5D12A 2PMOX 4B0GA 4USFA 1FMOE 1GOLA 1LPUA 3R71A 4BCQA 5KHWA 2G01A 2C30A 3UJGA 3LJ0A 2CNQA 5ACKA 3FZTA 4RFYA 4QP2A 4OBPA 3O8TA 4X7QA 3V01A 4XG3A 3KREA 4EJ7A 1W0XC 5B2MA 2DS1A 2GNIA 1NVQA 3BYSA 4FV4A 4GW8A 3PXQA 4HPTE 4WNPA 3QD2B 3BBTB 3GGFA 4Q9SA 2YEXA 4QP6A 4XG2A 2CN5A 3FMHA 3GEQA 4XOZA 4E5AX 3LAUA 2X4ZA 4E93A 4JJRA 4MQ1A 4XH6A 1XWSA 4AAAA 2VTJA 3GP0A 2R3MA 3QQHA 4R77A 2XM9A 4ID7A 4N6YA 3Q9ZA 2B4SB 2BKZA 3PRIA 4ZXTA 2VTAA 2J5FA 2VTOA 4ANOA 4FEWA 3FC1X 3PPZA 2XJ1A 3EQGA 5CNNA 2EXEA 3FAAA 5HLNA 3GC8A 3PXZA 5J79A 3AC4A 3R7UA 3TNPC 3G0FA 3TKHA 4IAAA 1STCE 3EFKA 4G9CA 2PL0A 2XIRA 5C9CA 5EI6A 3CE3A 1XH7A 4C0TA 5E8ZA 5FQDC 3QF9A 4RJ5A 3TTJA 3LM5A 3OWKA 5IQBA 4N4SA 3ATTA 4CRSA 1MUOA 4RWJA 3UOKA 3UZRA 5CX9A 4Y46A 4NJDA 4UMRA 3VBQA 3MH0A 4YO6A 4O38A 1WBSA 5A14A 4IJ9A 2BKKA 1OBGA 4XV3A 3GI3A 3F7ZA 3L8VA 4KRCA 4ZTHA 4C62A 4JDIA 2RIOA 1OITA 3MVJA 3QQGA 4GSBA 4IZAA 4E4LA 4BWXA 3WILA 2BIYA 1YOLA 4P7EA 4TYEA 5FG8A 2A0CX 2OK1A 3HV7A 2LAVA 4M97A 3AC2A 2O5KA 4UXLA 3NAXA 4QP4A 4AQCA 4A9TA 1SVHA 3WF6A 4BB4A 2C5OA 1G3NA 1R39A 5E8XA 4H05A 4EOLA 4MXYA 4DG3E 3HA6A 4C4JA 4D1ZA 4L43A 5CSPA 5M4UA 4GVAA 1WBVA 3ORKA 2HY0A 3FSFA 4QP8A 5C1QB 3RM6A 5DEYA 4EHGA 3SOAA 4CT1A 3EQFA 2I0EA 3NW7A 3TNQB 5AV1A 4RIYA 4J8NA 3CXWA 4QMOA 4O7VA 3VS6A 4NM3A 4W8EA 5CAUA 3QD4A 4PL4A 4AE9A 2ONLA 1NY3A 3JVSA 4CSVA 4IX5A 4CXAA 3PLAE 3PZHA 4NW5A 4FF8A 4KIQA 1R3CA 3G0EA 3UMWA 5L2SA 4KUJA 2WQOA 2J0LA 1UU7A 2Q0NA 2J7TA 3DKOA 4TT7A 3ZRLA 4EOPA 5IA1A 3CQUA 4XG9A 5JFSA 3NMUF 2PWLA 5FD2A 3GOKA 5A46A 2ONLC 3VS2A 1OKZA 2YM4A 2P33A 3QLFA 3R83A 3NNWA 4AGWA 1IASA 4YNOA 4OTQA 4AG8A 1OPKA 2WOTA 3ZSIA 2RFNA 2YISA 4BZOA 5J9ZA 2UZDA 5K5XA 4F1MA 1FBNA 3EN9A 5FEEA 1ZZ2A 1YXVA 2VX3A 4E73A 5C26A 4IB1A 2CJMA 3VS4A 2XIKA 2XK4A 3VIDA 3F7WA 3UC4A 1ZZLA 2ERZE 4DBXA 2BUJA 5AX9A 4MXOA 3WF5A 1E9HA 2PVRA 4A9RA 2BMCA 1XBAA 1K3AA 3IDPA 2RFDA 4LMNA 4RJ6A 4EZ5A 5KE0A 5AA8A 5CEPA 2VO3A 5EM8A 2WMAA 2YERA 4K2RA 4CCUA 2YM6A 2QR8A 3VUMA 4DLIA 4BI0A 1U5RA 3SLSA 5CF4A 4YMJA 2G2FA 2YN8A 1KV2A 3HL7A 4AZTA 1MP8A 5KMMA 2WHBA 3MIYA 4M67A 5DNRA 2C0IA 5HIBA 2PZPA 3TUBA 2WMUA 3FI8A 4UX9A 2OZAB 4WA9A 3CPCA 4ANBA 2X2KA 2WELA 4NUSA 1QCFA 3WF9A 4MK0A 5CF6A 3ITZA 2LGCA 4CD0A 1OIQA 1OI9A 3KRJA 3MB7A 4D5KA 3KK9A 2IZSA 1NVRA 4LRMA 5CT7A 4RWKA 3G51A 3WYYA 2QOBA 3QUEA 4XG7A 4E6DA 2F9GA 3E8DA 4S30A 4U79A 4X0MA 2YCSA 4ZTMA 4CKJA 5D11A 4X2FA 1IEPA 3OUKA 3FUPA 5EHYA 2FGIA 4CFNA 4MH7A 5AV3A 5IEVA 4TYJA 3VQHA 5JGBA 1OM1A 2C3LA 4K18A 2HWPA 3W2RA 4O21A 4MD9E 4RLLA 4DH8A 4C35A 2OH4A 3CD3A 3HEGA 4G6LA 5ITAA 3OWLA 2GTMA 2E9UA 3LCSA 4WNOA 3HP5A 4U40A 5EW9A 2RG5A 1REKA 5J95A 3F9NA 2JDSA 5AIRA 3W16A 4G5JA 4XNEA 4Y73A 2Z7LA 3EHAA 4BZNA 2W9ZB 3DS6A 4MF0A 5H3QA 4E4NA 4LRJA 4HYUA 4ZSGA 5M55A 4ZAUA 4LV5A 1XH8A 1GJOA 4MWHA 5E8YA 5FRIA 3HX4A 4EH6A 2CCHA 4GK2A 5HESA 5DGZA 2HIWA 3IGGA 2OLCA 5HZNA 5CEMA 2C3IB 5IQEA 5IQHA 3BYUA 4FT0A 2GDOA 3LXPA 3N9XA 4IM0A 5IQFA 1P5EA 2RKUA 4PL5A 1W98A 2ZM3A 2PSQA 4MNEA 4XP0A 3W8LA 3IW4A 3IKAA 3GT8A 3IONA 4A9SA 2QR7A 5BQ0A 2Y7JA 2ZDTA 4PTEA 4CMOA 3TIZA 2BRHA 4HNFA 4FOBA 1FQ1B 4JLCA 4RGJA 2OFVA 2YLFA 4RA5A 3AD6A 4YZBA 5LVNA 4WSQA 1YXXA 1YHSA 3TV6A 2SRCA 3GQIA 4OTRA 4YZDA 3VQUA 1UWJA 3EN5A 3R2BA 5BYLA 3BGQA 4TZRA 2ZV7A 5KX8A 5HU3A 4QQTA 5HBJA 2UZOA 4GUBA 4FTQA 1LP4A 1Q61A 2UZTA 4M3QA 4QT1A 2UW8A 3BZ3A 4IFCA 4FEVA 4N6ZA 2EVAA 2X8IA 4JOAA 3NCZA 2QOCA 2YCFA 2IJMA 3A8WA 2OXXA 5AV4A 4RIYB 3OCTA 4K11A 5BUJA 5L6OA 2EB2A 2XB7A 3VW8A 2BIKB 3BBWA 3IDCA 5B0XA 2VUWA 3OTVA 2GMXA 3GOPA 4Q5EA 1QPEA 3COMA 3I0QA 1YDRE 4WKQA 2IPXA 2FYSA 1HOWA 4EH8A 2PTKA 2H8HA 1ZMWA 4BDAA 1JKLA 5AP0A 3EZVA 2WTJA 3KRRA 3HUCA 3C0GA 5DT0A 3HZTA 4JG6A 3P7AA 4Y5QA 5L2WA 1SNXA 5A4QA 3ZC5A 1JKKA 2XK9A 5IQGA 3Q4ZA 3DJ5A 5HBHA 4ACDA 3FZSA 1L8TA 4PDSA 4Q2AA 3UZPA 3ZO2A 2ITVA 4R78A 3U51A 3BQCA 4G1WA 4FSTA 5HTCA 3QZHA 4C61A 4TYIA 5ANJA 2R3HA 2QG7A 2VO0A 3P86A 4AZEA 2CLXA 2ITZA 4LRKA 2PK9A 2QO7A 4XRLA 3H4JA 3UIXA 4AACA 5CLPA 1CM8A 4C4HA 2OJ9A 3CY3A 3OG7A 4L00A 3QUPA 5CVGA 4DFZE 3TV7A 2F2CB 3NWWA 4ZP5A 5IU2A 5JQ8A 4YHTA 4FG7A 2BZIB 4KBKA 1J3HA 4U9AA 4M0ZA 3ZSGA 5HOAA 4ZZOA 2OF4A 1H24A 3PY0A 4WHZA 4XX9A 3NYVA 4APCA 3BQRA 3P08A 5GHVA 1K2PA 2OBJA 5E4HA 3U6IA 2PZ5A 4GK3A 4KABA 3TZ9A 4AX8A 4EJNA 3GU5A 4QP9A 3TEIA 1AGWA 2OJIA 2UW0A 3TT0A 1Q5KA 2Y4PA 3PE1A 4TWPA 4YP8A 4A7CA 1J91A 5EYDA 5EQYA 1CKPA 2OO8X 2JIIA 3AT3A 3BHHA 3DA6A 4AN2A 3QBNA 3NUNA 4FEQA 2UVXA 1SVEA 3OTUA 4P5QA 3TIYA 2PU8A 2A1AB 2C5XA 1GIHA 4XRJA 4AA5A 3PIXA 3KU2A 3TZ8A 4IAYA 1IG1A 2WTKB 2VTLA 4BICA 1QPCA 3QAME 5A4CA 5BVKA 4FX3A 3VVHA 5FDXA 3A7GA 5BPYA 2HK5A 4TRLA 2VX0A 2YAKA 3TL8A 4NW6A 4EBWA 3MN3A 3UPXA 4Q9ZA 1F3MC 3MGYA 4FT7A 5CU3A 2VO7A 3LFNA 3RTPA 2HWOA 2XKCA 3DJ6A 5EM6A 4JRNA 4BIEA 4CYJA 1TQIA 4UWCA 4RWLA 4WNMA 1ZAOA 3U8WA 5HD4A 2WB8A 4ZK5A 5AR2A 3E88A 4KBCA 4MHAA 4RX5A 3NVKI 3R7OA 2GS6A 3LCDA 3W1FA 5H9BA 2ZM1A 4TYGA 2O65A 3R6XA 5CT0A 1R0EA 3QKMA 4RMZA 4RVTA 3RNYA 4H58A 3F3ZA 3IO7A 1OUKA 3K5UA 5EM7A 3QUDA 3MFSA 3WF7A 3H30A 4HGEA 2YCRA 4BCFA 5A3XA 4GT4A 5M09A 4BDDA 3HNGA 4NM5A 2OH0E 5ANGA 3ZZEA 3UC3A 2PMNX 4L7FA 1VJYA 4L68A 5JZJA 4YHFA 4IMYA 1WZYA 4JBQA 4I5MA 3VN9A 4E4MA 2GNFA 4JR7A 1ZOGA 2CDZA 3DLSA 3POOA 5BYZA 2V22A 3KXXA 3D9VA 3ULIA 2ETKA 2WMTA 3RZFA 2G1TA 4IB5A 4ZTRA 4ALUA 2BHHA 4QD6A 4IEBA 3DK7A 4EK5A 2QNJA 3OBGA 4DE4A 1OZ1A 4EQMA 2DYLA 2HZIA 3K3IA 4FSQA 4HPUE 4U6RA 5CSWA 3S3IA 3DFAA 3REPA 4DAWA 4ZLZA 4WBBB 4C4EA 4ZS0A 4DGOA 2W17A 4M0YA 5HVJA 5EDQA 4KINA 4IZ7A 4Y8DA 3AG9A 2XM8A 3KK8A 5AIKA 4U3YA 4WUAA 3SAYA 5CEOA 1WBTA 3LQ8A 4FKIA 4NJ3A 4EHZA 2YIWA 3AT4A 5LCKA 5FWKK 3LPBA 4BDBA 2QCSA 3VW6A 3NPCA 3OP5A 3FQEA 1PXOA 3ZHPC 3EWHA 1WCCA 2PUPA 5HG7A 3S1HA 4UB7A 2XNEA 4DC2A 1ZMUA 4FTKA 4AUAA 3S95A 3B2WA 2R64A 2UW3A 4PPAA 2QOKA 4LV8A 3O8UA 2C6KA 5HG8A 4DGMA 3G2FA 4EH5A 5TE0A 3OEZA 1T45A 1PXKA 1IAHA 3FI3A 4QMSA 3UP7A 3BCEA 3R8ZA 4HCUA 4CLJA 3GXLA 4QTEA 5ICPA 3ZUUA 1FMKA 2Q0BA 2Y8OA 3A7FA 5JK3A 3OOMA 4EH7A 2A27A 5E91A 5J1VA 3KRWA 3TDVA 1ZWSA 2QURA 4JXFA 5I3RA 3DNEA 3SRVA 4RJ7A 4AFEA 3BYOA 4C2WA 5FUTA 4M15A 5G6VA 5JMSA 5JGDA 4FIEA 4S33A 1YRPA 4FZDB 3FHIA 2BFXA 2B52A 2AUHA 4XS2A 4DN5A 3GBZA 3IPHA 1PMEA 1TQMA 4O82A 3PE2A 3BHYA 3O23A 3UYTA 4IAIA 1YHVA 3FQSA 4GUEA 4UEUA 3UG1A 1H08A 2PVNA 3PJ8A 5C4KA 3RNIA 3K3JA 1OGUA 4ALWA 5HG9A 4OTFA 4FV6A 2XP2A 5LQFA 4N57A 3UVQA 5DFPA 4F6UA 2BROA 4PUZA 3Q9XA 4L44A 3D4QA 4FKLA 4IZ5A 4YSMA 4RZVA 4IWDA 5CSVA 3VRZA 5KMIA 4FE2A 3V5PA 4G31A 4WO5A 3KXNA 3Q53A 1PF8A 3W8QA 4FV2A 4D2TA 2ETRA 2XRWA 4F6SA 3OCBA 2R3PA 3OXIA 3UPZA 4L6QA 3TZ7A 4XG8A 4APPA 4QPSA 5IG1A 2QHNA 4LGHA 3W2CA 1UKIA 5EYCA 4ZOGA 2C6DA 3EQDA 1OL1A 4V0GA 3TCPA 4D0WA 3IW6A 4RA4A 5HNBA 5LVOA 3K2LA 4L7SA 2JBOA 3B8RA 4JQEA 1LEZA 4OBOA 5CI7A 1TKIA 2W1FA 3KY2A 3NX8A 4ZY6A 1OMWA 2WQNA 3DY7A 3R01A 1ZOHA 4C4GA 2WTIA 3HVCA 1BLXA 4ASXA 1REJA 2CKEA 3G6HA 1EH4A 4I5CA 5FXSA 2YABA 3UODA 4R8QA 4B99A 4BCOA 5E8VA 5M51A 5AR4A 4CTCA 4TTHB 4ZZNA 2REIA 3OY3A 5DA3A 4F99A 4EQUA 2XNNA 3LJ2A 1P4OA 2IVUA 5J7HA 4I21A 5M4CA 1U59A 3OF0A 4O7WA 4W4XA 2W1ZA 3LMHA 3PRFA 3KKVA 5JRQA 3RPYA 5BUIA 2XNBA 2ITTA 5CWZA 4DF3A 1M14A 3PPKA 1ZXEA 2OWBA 1DS5A 3QTSA 5T6KA 4F7LA 4KS8A 1BX6A 1QPDA 3CY2A 4EZ3A 5DT3A 1URCA 4NTTA 2PZRA 4IVCA 3M2WA 4JL9A 3Q60A 2RFEA 4YZ9A 1Q62A 5D10A 4I23A 3VS5A 4HVDA 3Q9WA 3SC1A 1OL7A 4DT9A 4QYYA 3TG1A 3DB8A 4YJPA 4FL3A 3V8SA 4EH9A 3SXSA 4MNFA 2YM7A 4O96A 1HCLA 2BALA 4CG9A 2XK7A 3VS3A 5E1EA 4EK3A 2PYWA 3PWDA 2HENA 5LARA 1OIRA 2XUUA 5BNJA 4BDFA 3V5WA 3ANQA 3VBTA 5GZ8A 3AXWA 5A6NA 3UQCA 3PDTA 1ND4A 4IACA 4OTIA 4BBFA 2FVDA 3A62A 4ANQA 1Q24A 3PYYA 1YI6A 3FEGA 3SXFA 4L9IA 1XH4A 2Y6MA 3LIJA 1APME 1WFCA 5LXMA 1PXNA 2V0DA 1YDSE 4NSTA 1VYWA 5HNGA 4BDCA 5M44A 4W4WA 4K0YA 5JRSA 4JDKA 3EFJA 3R8PA 4IVAA 4AGUA 2CKPA 4K6ZA 4CMUA 2OJGA 4PDPA 5J8IA 4GL9A 5EG3A 2IVVA 2B7AA 3QZIA 5E92A 4DG2E 1WVWA 5F4NA 5AUUA 5B7VA 1XR1A 1O6LA 2GCDA 2FSTX 4ONAA 2GS7A 1OIUA 2X8DA 4D9TA 3D83A 3VBVA 2Y9QA 5LOHA 2BAKA 3ODYX 4A06A 4EH4A 3R02A 5JZNA 3EKNA 5L2IA 3WARA 4N70A 3C0HA 5HE2A 3MWUA 1CDKA 4FTNA 3BU5A 1BUHA 3H9OA 4AT5A 5I0BA 3QTIA 4JBVA 4EOIA 5AX3A 1W84A 3T8OA 3SRVB 3P4KA 3P7CA 2JDVA 2XVDA 4QMXA 5HVYA 4M68A 4RJ3A 3WI6A 1ERKA 4MYGA 4BGHA 1XQZA 5AR8A 4JVGA 4TWCA 3ZM4A 5FDPA 1YOMA 2BRMA 4OTWA 4LYNA 3ZO4A 4O2PA 5CQWA 5AUVA 4IAFA 4C7TA 2OIQA 3EQRA 3N51A 5HI2A 4M69A 3UYSA 3JYAA 3UO6A 4P4CA 2C0OA 3VBWA 5DMZA 5E8UA 3QXPA 5DRDA 4FL2A 3QRKA 5C01A 4F0FA 4NFMA 4BRXA 3ZCLA 1JKSA 2PVKA 5C27A 5TF9A 2CMWA 2BRGA 2A4LA 2J0IA 3I6UA 2BAJA 2XA4A 4JDJA 5AR3A 5HCXA 2XCKA 4LL5A 4BI2A 4UMUA 3LFFA 3VAPA 2P2HA 2QU6A 4IJPA 4Y5HA 3UNKA 1K9AA 1KE5A 3ZS5A 3E8NA 4CKIA 1H4LA 4OT6A 3BLQA 4KKHA 4YO4A 3RALA 5IQDA 4NFNA 2XNPA 3A7HA 5HCZA 4NCTA 4HZSA 4DCEA 4BBMA 4JG8A 3RBWA 5CEIA 2WQEA 3FLNC 2YJSA 4GYGA 2X9FA 4O0XA 3C4WA 4V0GB 4YHJA 3VHKA 3PSBA 4KIKA 4MVFA 3SOCA 5M53A 2XK6A 1Y57A 3OCGA 4DITA 5F1ZA 4FV0A 2ACXA 4NCTC 2F2UA 4F7JA 5KKRC 3Q9YA 3HDMA 5BYYA 5LVMA 4H3BA 4BY9E 4DEBA 4O83A 2KULA 3C9WA 4MXXA 4BL1A 4FV3A 4NH1A 5AUTA 2XIYA 3ALOA 2P55A 2I0YA 2HXQA 3ORNA 4ERWA 2XS0A 2C47A 2XNMA 4ZIMA 3V04A 3QTRA 3MY0A 3R30A 1VEBA 4NM7A 4AZSA 5BVOA 3DQWA 3QLGA 5KMLA 3PZEA 3R8VA 4ZJIA 3NRMA 4UY9A 5KHXA 3AOXA 1Q4LA 3NEWA 4FYNA 4I41A 2JAVA 2C6EA 5AP5A 1ZLTA 2BFYA 3EQIA 3MPAA 1RQQA 4LFIA 4R3RA 2HY81 3CD8A 4FV7A 3C5IA 3GCSA 4G34A 4BCKA 4AT3A 2ZMDA 2Z7QA 3WYXA 2WO6A 4IVDA 3PG3A 4MBLA 5LMKA 4DCAA 4HCVA 3AMBA 5K4IA 4L52A 3TACA 4MKCA 3RAKA 3EH9A 3DLZA 2PZYA 2WKMA 1PYEA 4J99A 5HKMA 2WTCA 2XNGA 4UWBA 4KS7A 1JKTA 4OR5A 4BCHA 2B0QA 1WMKA 3L9LA 3MVLA 5EOLA 1V0PA 4FICA 4AW5A 5CAQA 5LMKC 1P4FA 3CTHA 1Q8YA 3PG1A 4E26A 3BIZA 4OTGA 1Y6AA 4AZWA 3MSSA 3R7YA 4YJUA 4U81A 3LKMA 4QNAA 2QG5A 4J53A 2YITA 3EKKA 5AP1A 3W2PA 3N4TA 4WD5A 1IRKA 5IUHA 3COKA 4C34A 3NUAA 3PY1A 4EL9A 5BVEA 3ORLA 4E8AA 4Z16A 2C4GA 4O6EA 2EU9A 3E3BX 3O0GA 3L8PA 4FTLA 2R3JA 4FV1A 4FODA 3RM7A 2VGOA 4FT9A 4ZSEA 3A8XA 4RIWB 3PA3A 3GU4A 3DOGA 1YOJA 3MV5A 5A9UA 3QTZA 3RI1A 3EQCA 4FSYA 3ZEWA 1OUYA 2O8YA 4LUEA 4LMUA 5KNJA 3LQ3A 4MCVA 3MI9A 5TO8A 3P9JA 4L3JA 4EQCA 1YI3A 3DGKA 4AN9A 2QO2A 2O0UA 2PVMA 3DK6A 5H8GA 4MX9A 4BCIA 3NYOA 4JX7A 3RPVA 3DAEA 2ZAZA 4CFMA 1JPAA 2VWUA 2X6EA 2ZB0A 4F1OA 3RPOA 3MA6A 3T3UA 2YM3A 1G8SA 1CTPE 4YLLA 3U6HA 3QCQA 1GY3A 4DEEA 1BKXA 3ZFMA 3CKXA 1DI9A 4BWKA 2HW7A 4CRLA 4EC9A 1YXUA 2X39A 3JVRA 3OY1A 3ATSA 2UZUE 3CGFA 5DRBA 5DR9A 1I09A 3SG8A 1GIIA 2RGPA 3F3WA 5FTQA 4G17A 4AGDA 4XV1A 4F0IA 5M56A 5HICA 4M69B 3FZRA 5IF1A 3UQFA 4XBRA 3V5JA 3V5LA 3O71A 3PPJA 3C5UA 3V5TA 1PRYA 3EN7A 3T3VA 1FINA 2C68A 4D2VA 3ZXZA 1VYZA 1M7QA 3DKGA 3FKNA 3NUXA 4HYHA 1UVRA 4YNEA 2XK8A 3G90X 5HBEA 4UYNA 2WIHA 1BI7A 3ZTXA 1H26A 3DXNA 3SW4A 2VTTA 4TWOA 4EUTA 3EMGA 5KMKA 4HW7A 4L67A 2QC6A 3ZU7A 4EK4A 3H0ZA 4O27B 4BIDA 5CXHA 3G5DA 1PXPA 4C59A 4M8TA 3OZ6A 3F3TA 3C51A 2F4JA 3E7VA 3IW8A 3Q3BA 5DVRA 5I4NA 3WE4A 4IQ6A 4IZYA 3GCVA 3G15A 2PUIA 3KXMA 4KIKB 4L46A 5TOZA 3VF9A 1J7IA 4FV8A 4S2ZA 1VZOA 4AWIA 2X4FA 3MA3A 4MEDA 1KOAA 1UU3A 2CPKE 2IG7A 2OICA 4JDHA 4BHNA 4O6LA 2OF2A 3QZFA 4G6OA 4AOJA 3OXTA 3DTCA 3F88A 4ITHA 4O2ZA 1OKVA 3ZBFA 2FSLX 3RP9A 3E7OA 3LFDA 2YZAA 4GU6A 4EKLA 4TY1A 4YTHA 4PL3A 4G16A 4BZDA 5KMOA 2OKRA 5JKGA 4FKRA 4IW0A 1ZY4A 4BYIA 3OVVA 3T9TA 2WMSA 4AW1A 4D55A 3EYHA 4E6AA 5IA3A 3S4QA 5TT7A 2PZIA 2I6LA 3GCPA 5HIEA 1Q97A 4QYHA 3QQLA 1MRUA 3WE8A 4XP3A 2X8EA 3UOLA 5CEKA 3PJ1A 3R8MA 2XF0A 4IB0A 5B2LA 2RL5A 4RBLA 4JIAA 4R7IA 4RLKA 3C4CA 4BDJA 2WTVA 5HE0A 3DZQA 3PSDA 4CV8A 5CZHA 4XUFA 3QCSA 4PQNA 3R22A 1KUTA 3VC4A 5DR6A 5IUGA 3FY2A 4BBEA 5DN3A 3LW0A 3E5AA 5E9EA 1ZRZA 4CFWA 3ZM9A 3D94A 4RQVA 4IB3A 5CSXA 2IZUA 4F4PA 3KMMA 4D0XA 5EK7A 2BAQA 1DM2A 3F2RA 2PE0A 4O1PA 4PV0A 1J1CA 2UUEA 4LQMA 5JN2A 4XV2A 2Z7RA 5K0KA 3BHUA 2ITPA 3UDBA 1SNUA 3KEXA 4FIHA 2OZOA 4AA0A 4NM0A 4TNDA 3DXPA 3C4FA 5CYIA 4YR8A 1X8BA 1W7HA 3KULA 3L9MA 4CVAA 2Z60A 4XG4A 5HLWA 1YHWA 4NU1A 5JGAA 3RHKA 3PY3A 2QOLA 4I0RA 3ORPA 3AD5A 4GH2A 2AC5A 2E9NA 2UVZA 1NT2A 2IZRA 5EI8A 2VTSA 4LGDA 3V3VA 3A2CA 4DYMA 3MPMA 4QRCA 4EOSA 3QTQA 4B8LA 3NZ0A 5AUWA 3RVGA 3FPMA 1T46A 3JS2A 2WZJA 4W9WA 3P23A 4XOYA 2WMRA 4ZTSA 1G8AA 4X21A 3HDNA 4R5YA 2J4ZA 3GC0A 4X2GA 1UNGA 4C4FA 4DLJA 4F9AA 5HORA 4RVMA 4NEUA 4XG6A 5D41A 3FMMA 3IDBA 3NR9A 4YURA 2NRUA 2PE2A 4I1ZA 5AM6A 4R7BA 3BWJA 2OJJA 4UBAA 3CC6A 2NP8A 1OECA 4QTBA 4DGGA 3L9NA 3F66A 3UIUA 4FK6A 1U5QA 3MVMA 4BWPA 4RIOA 4YJQA 2O3PA 2X0GA 4I0SA 4UV0A 4ZSLA 4FC0A 4YZCA 5D1JA 2JDRA 2C5NA 3KC3A 1Q8TA 3ZMMA 4ANLA 4FMQA 3DJ7A 3O8PA 1WVYA 4FTTA 4IXPA 4EONA 5JSMA 4CFUA 2J6MA 3DPKA 3PVBA 2V7AA 4QYGA 1FOTA 2X6DA 5BVWA 3RJCA 4DHFA 3AC8A 4I6HA 5HTBA 3TNHA 5I9VA 5IEYA 2YZLA 3ERKA 3HA8A 3R9RA 3PXRA 2A19B 3GNIB 3GU6A 3BEAA 3CPBA 4FSMA 3DQXA 3VO3A 5IA2A 4GRBA 3VS1A 3R28A 2UW5A 4BTFA 2YIYA 4DH1A 3HRFA 3F3UA 4WIHA 2GS2A 2HCKA 4BDGA 3WZUA 4OGRA 4O7RA 4K9YA 3I79A 4ASDA 5DBXA 4LOPA 4CKRA 1KE9A 4II5A 4YJOA 5E1SA 5IH4A 2F49A 2R3QA 5E90A 3ZEPA 3FLWA 1U54A 4O0WA 4DT8A 4IM3A 5DI1A 4GKIA 4B4LA 5HU9A 3LVPA 1G5SA 3PP0A 1V0OA 3ZLXA 4FKJA 4FKQA 4HGTA 3LXLA 3MY1A 3P5KA 2R0IA 4ANSA 1U46A 4R3PA 3M1SA 3FPQA 4LOQA 2OIBA 4FKWA 4J71A 3IW5A 2QLQA 3K5VA 4QMMA 4Q5HA 3FLSA 5GJGA 4F63A 4D1SA 4FBXA 4FK3A 4YJTA 4IWOA 2CNUA 2VV9A 5A4TA 3DCVA 3BHTA 4FI1A 2HELA 3CR0A 4MAOA 4BIBA 1CMKE 4UMTA 4EH2A 5IQCA 4I4EA 2IO6A 3A4OX 1Q99A 2ZVAA 4IADA 2QOQA 4MQ2A 3QFVA 1M2PA 1UNHA 3A7IA 3L9PA 4X2NA 2BTRA 3AD4A 4GVJA 4NIFA 5AP7A 5CEQA 4N0SA 3QTXA 4O0TA 3RCDA 1OBDA 3FXWA 4EOKA 4GFMA 4ASZA 4FZFB 4HGSA 3FY0A 3NLBA 4RC4A 2GPHA 3KB7A 2C3KA 4MTAA 4WOVA 3BLHA 3PIYA 4WRSA 3RK9A 4AOTA 3NYXA 3R7VA 2P0CA 2C6LA 5HE1A 4AE6A 4HVIA 3ZLWA 4H1MA 1JSUA 2W1GA 4EYJA 2XIZA 4MNEB 5FP5A 4BF2A 3FSKA 5I3OA 5GNKA 3D5XA 4F65A 4UZDA 5KMJA 4FTRA 1LR4A 2R3KA 3ZONA 3R2YA 4ACMA 2VTRA 4K77A 5AEPA 3MESA 4HOKA 2BZHB 3ZDUA 3F3VA 2FSMX 4GFOA 1H1QA 4XLIA 3VUTA 4CFFA 4E6CA 2QOHA 3I5NA 3PA5A 2BILB 2J0MB 2C5VA 3FL4A 2VWYA 3FZOA 4J8MA 2CSNA 2XK3A 4FSUA 4QQCA 3R9HA 1GZ8A 4KIPA 3R04A 3ZDIA 3KF7A 3HAVA 1PW2A 2CCIA 2RG6A 2YM5A 4O0UA 5ANEA 3BLRA 3HV4A 4C57A 3JY9A 4FSNA 4IDVA 1QL6A 3KULB 3Q2JA 3ROYA 2WPAA 4QP7A 3M11A 4FIJA 3D14A 3RK7A 4GU9A 5CAVA 5D7VA 3R1YA 1ATPE 3P1AA 5DR2A 4F64A 3HLLA 2PVJA 3BGPA 3BKBA 5C8KA 3MW1A 3D7ZA 2F7ZE 3CBLA 4CCBA 4I0TA 5AUXA 1YWNA 2XH5A 4RIXA 1RE8A 3UQGA 4O0SA 4Z9LA 3UO4A 4GIIA 4AFJA 4USDA 5CY3A 4FIIA 3QKKA 4BCNA 3QQFA 4DFXE 3NNVA 3KRXA 4IH8A 2BRBA 4LL0A 1Z9XA 2J0KA 5IDPA 3R7EA 4RQKA 2B1PA 5DT4A 2JAMA 4O7ZA 4U44A 4BDEA 4BC6A 4P5ZA 4Z7HA 3W2OA 3UIBA 2QOIA 3FV8A 5ANDA 3PVUA 4OAVB 3QCYA 1W8CA 5DOSA 3MJ2A 1F5QA 5BVNA 5JFXA 2WMXA 3D7TA 5GZ9A 2QD9A 4U45A 2JEDA 4HNIA 4Y72A 4DEDA 3QKLA 1Y8YA 2QHMA 5FBOA 4YUQA 3KFAA 3QC9A 4EUUA 5HVKA 2VTMA 1SM2A 3ALNA 3FQHA 1PY5A 3MS9A 4YLKA 5AJQA 4UN0C 5HCYA 4P90A 5JH6A 4U7ZA 4BTKA 2HZ4A 3EQHA 1GIJA 4IVBA 5L6WL 3UE4A 2Z8CA 4I24A 4OUCA 1ZARA 4QQ5A 5LMAA 4CV9A 4BTMA 3LZBA 5K5NA 3TJCA 1RW8A 5KBRA 4ZTLA 5L8LA 2R7BA 2WIPA 4G5PA 4GJ2A 4I5PA 2YDJA 4CT2A 3RHXA 3FWQA 5D9HA 2G2HA 1UKHA 3I6WA 1MRVA 1Y8GA 1FVVA 4CZUA 1XH9A 3Q96A 5A6OA 3FI2A 2R3OA 2DUVA 3EL8A 2PUNA 3QD0A 5BVDA 1J7UA 3Q4TA 4U97A 4MBJA 3JR1A 1B39A 4UMPA 5HO8A 4JR3A 1U54B 1P2AA 2NPQA 4QMVA 2ZV2A 3B8QA 3LCTA 2X2LA 5C8MA 4NKAA 4QTAA 3BWFA 2C1BA 2B55A 4FNXA 5B2KA 3UO5A 3N4VA 5D7AA 5K3YA 4NK9A 3ELJA 2W9FB 5CANA 5ETAA 5CU6A 3FXXA 3QWJA 4FKUA 4TPTA 3RINA 1B6CB 4F7NA 4C3FA 2C1AA 3ACJA 3CJGA 3QX4A 2C3JA 4FKTA 5JFWA 1JOWB 2OXYA 2OW3A 3BX5A 4F1TA 1GAGA 2C6IA 3ODZX 3UMXA 4GV1A 2XJ2A 1JNKA 2PVHA 1URWA 4EEVA 4A07A 4GJ3A 1PMUA 1PJKA 5AP4A 3OROA 1YWVA 4AZFA 3SVVA 2JFMA 5KUPA 2OG8A 5A4LA 3OWPA 4ZTQA 3H3CA 4JBPA 4NIFB 4PRJA 5FXRA 5KCVA 1ZYDA 4Y85A 2WU7A 3DAKA 1CKIA 2FB8A 2GNJA 5CSHA 2IW9A 3GFWA 4ZTNA 3SD0A 5K9IA 5L2TA 2ITUA 3L8XA 1Z5MA 1J7LA 3FKLA 4XP2A 1ZYCA 4DTAA 2R3RA 1Q41A 3EB0A 2WTDA 2C0TA 4H3QA 4EKKA 4C58A 3A61A 1ZMVA 3BU3A 3MFRA 4JRVA 4LUDA 2WOUA 2OIDA 3VJNA 2GHMA 2OFUA 3MTLA 4K8AA 2VO6A 3FC2A 1YWRA 2GFSA 2VTNA 3ORZA 4G3EA 5CU4A 2XZSA 3EQBA 4GCJA 4I5HA 4I92A 3POZA 2BR1A 4AXAA 3F82A 5KMNA 4PMSA 5IA5A 4PMTA 1WVXA 1KSWA 1O6KA 2JLDA 4IX6A 4R6VA 3R9DA 5AAEA 4TN6A 3HV3A 3LCOA 2ITQA 4MD7E 2JFLA 4LM5A 5F20A 4CLIA 4L8MA 4J96A 2QOOA 1PHKA 5J5TA 3QL8A 3FMLA 4R1YA 1DAYA 1WAKA 2J51A 3C7QA 3OS3A 4S32A 5AP2A 5AAFA 4ASEA 5CXZA 3NGAA 5EQPA 2R3FA 1S9JA 2FUMA 4MXAA 1XH5A 3RCJA 3CEKA 2VZ6A 3VWAA 2VNWA 3RAHA 3KCFA 3E8EA 3GUBA 5AV2A 3QX2A 4OAUC 3CSVA 4V04A 2W1EA 4PDOA 3OBJA 1BMKA 3WZEA 2FH9A 3A7JA 3FBVA 3KXZA 4RIXB 4EZ7A 2VWWA 2NO3A 1Q8WA 4R5SA 4BCMA 4D28A 2B9FA 3BEGA 4UMQA 3TTIA 5E8SA 3R1QA 1V0BA 5HX8A 5IH5A 4OTDA 3LXNA 1XHAA 3D5UA 4D4VA 3U4WA 3TZMA 2IW6A 4E5BA 3W18A 2ZYBA 4FT3A 3MIAA 2YAAA 4PX6A 4WRGA 2W4KA 3GVUA 3HP2A 4WNKA 4A9YA 3E63A 4HZRA 1H25A 1ZY5A 2RFSA 2VN9A 4OT5A 4HGLA 4W8DA 3F5GA 5FM3A 3ZH8A 1WBPA 4NL0A 4GG7A 1H00A 3LOKA 4XJ0A 2J50A 1XBCA 5J87A 4EYMA 3VRYA 2Q83A 3KVWA 5C03A 5L8KA 4QTCA 1UU9A 4KA3A 1PMNA 5HEZA 2W96B 3FMKA 4FKSA 4ACHA 4CFXA 3F2AA 4JNWA 4I20A 4PPCA 4ZJVA 4YC3A 4RC3A 1FGKA 3C4XA 1FVRA 4RZWA 3DV3A 2E9OA 4ZS4A 1O9UA 3QYWA 3I7CA 3NNXA 4BKJA 4C3PA 4IDTA 3G6GA 5HLPA 3E93A 4EI4A 2W0JA 1KE8A 3ENMA 3BU6A 3DBEA 3PIZA 4B8MA 4W4VA 3RWQA 2B9HA 3NSZA 4FTJA 4P2KA 4YC6A 4E6QA 4U0IA 1LEWA 2BDFA 4U42A 3RMFA 4HJOA 1OPJA 2CGVA 1Y91A 3ZBXA 3P78A 2YM8A 4D5HA 4J98A 3R8UA 4C36A 4YPSA 2Y6OA 1NW1A 1V1KA 3GQLA 2J0JA 3QWKA 4NT4A 2X9EA 3TJDA 4F7SA 2IW8A 5BUEA 5BMSA 4KKGA 3R9OA 3MY5A 3BE9A 5EI2A 2X1NA 4G3GA 4DFUA 1HCKA 3Q6WA 4JI9A 3JPVA 2ZOQA 2ESMA 5IMXA 2ZM4A 5C4LA 2W4JA 4QYFA 1YXSA 1YDTE 3AGLA 3ZO1A 4OLIA 3VHEA 3LQ5A 5ANIA 5FEDA 4C4IA 3EL7A 5EHOA 4E20A 1YQJA 2GHGA 3C1XA 2W7XA 4Z7GA 4EBVA 1NXKA 1M7NA 1VR2A 4F9YA 4PMPA 4PNKA 2H96A 3ZUTA 5J9LA 5AA9A 1PYXA 5AADA 4GG5A 4L45A 1L3RE 4FNYA 1UNLA 4GT3A 3D15A 3PTGA 2CKOA 2B54A 3DDPA 2YIRA 5AM7A 4IAKA 3VF8A 2EXCX 5GJDA 2X7OA 4FEXA 4MWIA 5GZAA 4B9DA 3ET7A 1AD5A 3ZYAA 3K54A 3DTWA 3OW3A 2XBAA 3H9FA 2VTPA 3F61A 4QNYA 4E7WA 4DEAA 3CQEA 4G2FA 3MVHA 2R3NA 2XBJA 3ZSHA 2YDIA 2YFXA 2YIXA 3GCUA 1WBOA 3KXHA 5AWMA 3WZJA 2WMQA 4S31A 3V8TA 3I1AA 4OBQA 3LM0A 5L2QA 3HECA 4ZSAA 3QHWA 5TR6A 4R7HA 4FTMA 1QMZA 1YW2A 2XEYA 3HAMA 3Q4UA 2EWAA 4ANNA 1DAWA 4FVQA 5BMMA 3HMPA 3KRLA 3IG7A 3KCKA 4CMTA 4FA2A 2XCHA 2UZWE 3COHA 3JY0A 4AW2A 5CVFA 4I22A 3R8LA 3DNDA 4L01A 5AMNA 3OCSA 3V6SA 4D58A 4USEA 2XYUA 4FGRA 5CS6A 5AUYA 3U55A 3I5ZA 4QMWA 5EM5A 4FSWA 4O22A 4TWNA 2I7QA 5T68A 5I9XA 4CGAA 3NAYA 4BI1A 5IPJA 3HMIA 3MJ1A 2JDOA 3QQKA 2PMIA 3EZRA 3TXOA 2DWBA 1ZYJA 5HHWA 4BDKA 4F09A 3UP2A 2W05A 1PKGA 3F2NA 5BVFA 2YWVA 4DGNA 3SA0A 2WEVA 5CVHA 5KZ0A 4O7LA 3QA8A 4FVRA 2WMBA 3MFUA 4Y83A 3PXYA 3RZBA 4AZVA 5EKNA 5EHLA 4I6BA 3O7LD 4XYFA 3EN6A 4ZLYA 3U6JA 2UW4A 5JFVA 3COIA 1KV1A 4IE9A 2QI8A 3LFBA 1OKWA 4M14A 3NUYA 4XEYA 3I81A 3FZ1A 2OJFE 3TWJA 4BFMA 4YTFA 5IDNA 3DAJA 5DLSA 4PTGA 2ITWA 2J90A 4FV9A 2C6OA 3PP1A 4QMUA 4QP1A 3FMNA 4YJRA 5DH3A 5HGIA 3SKCA 4Z55A 2ITNA 3R21A 1Q3WA 3GENA 4F08A 5A54A 1KE6A 3F5PA 4IWPA 3FMEA 5J7BA 5ETCA 3W10A 4EHVA 1LUFA 2GTNA 4FZ7A 5AUZA 2ZDUA 3CS9A 5H8EA 4DFYA 3NUSA 3VS0A 4DH7A 5L8JA 3AC3A 4JT3A 4CQGA 5EQEA 4PPBA 4D4RA 4BDIA 3HV5A 4AF3A 4J7BA 4EH3A 2EXMA 3SW7A 4EK6A 5IA0A 3UNJA 2X81A 1GNGA 4E5WA 2O64A 2NRYA 3O2MA 4FKVA 3CJFA 4K1BA 4KAOA 4PP9A 4CYIA 2AYPA 1H27A 3KXGA 5EDPA 3VS7A 4J52A 3RWPA 5M06A 4FEUA 2GHLA 3WZKA 2PY3A 3PFQA 3NW6A 3BYVA 4CEGA 4YTCA 2HYYA 1H07A 3HRCA 2R7IA 3OUNB 3C13A 1PKDA 5J1WA 3HMOA 4RG0A 3IGOA 2NNWB 4KRDA 4XMOA 2C6TA 4WSYA 4E4XA 1R0PA 3R7IA 4M13A 2UW7A 4L53A 3PLSA 4O7NA 3NIZA 5EOBA 4O0VA 4MD8E 2WNTA 3KGAA 5EDRA 5A4EA 5M57A 5I9WA 5HIDA 4AOIA 4DA5A 3O51A 5FTOA 5I9YA 5GIPE 3LFQA 1M52A 5CU0A 3DT1A 5KKRB 4I4FA 4KBAA 4QQJA 4FIFA 2JKQA 4CFVA 4H3PA 5CALA 1JSTA 2W1CA 2CKQA
chains in the Genus database with same CATH superfamily
2P3GX 1UA2A 4YJSA 3LE6A 3W0OA 2H6DA 1OB3A 2XKFA 3QYZA 4FGBA 2QKRA 4AA4A 2ZJWA 4O91A 4ZZMA 2CGXA 1M17A 2KTYA 1TQPA 1H1SA 4J1RA 4M84A 3ZRMA 4TNBA 2WMVA 4DEGA 2W99B 3FKOA 5EH0A 3VJOA 3D2KA 3F5UA 1FGIA 2P4IA 2PVYA 2YACA 4G6NA 4GT5A 2HZ0A 5CTPA 5E7RA 3TKUA 2IN6A 3I4BA 4IX4A 1JAMA 1JVPP 4ACCA 3UIMA 4C8BA 3ETAA 3FE3A 2Z2WA 1Z57A 4RPVA 4NZWB 4FIGA 4HVGA 3NFGB 3DZOA 3RKBA 2XNOA 4LG4A 4AW0A 3DB6A 4JAJA 3G9LX 5M08A 2IVTA 4F9CA 1YKRA 3S2PA 5E8WA 5DYJA 2V55A 3BI6A 1J1BA 4LOOA 4WG5A 2WTKC 2WMWA 4QMNA 2WQMA 2XIXA 4D2WA 2B9JA 2GQSA 4BTJA 4XHKB 2R9SA 3E3PA 2ZV8A 4QPMA 3U9NA 2VRXA 3C4ZA 3D5VA 3PJ2A 5ETIA 3AGMA 5EYKA 3WBLA 2YIQA 1E1XA 4A4LA 1JLUE 4X2JA 2G15A 3HGKA 3JXWA 4PP7A 4YJVA 3TUDA 1ZYLA 4QMZA 1XBBA 5HNIX 3R1NA 3ULZA 4EWQA 4Y95A 2Z7SA 1PXLA 1M2QA 1YI4A 4FUXA 5EFQA 4O4EA 4EOMA 2PE1A 3LJ1A 4H1JA 2R0UA 5EW8A 3H10A 5EKOA 1JWHA 5FXQA 5F9EA 3ZUVA 2FO0A 4O7YA 3PVGA 3AMAA 3HYHA 3FXZA 2GSFA 4X6RA 4O4FA 2BHEA 3MH3A 1B38A 1CKJA 2BZKB 2VNYA 3NVMB 3R00A 4F0GA 3EN4A 1OL2A 2V62A 2X0QA 3GC7A 3HMNA 4K33A 4MBIA 4QTDA 4KNBA 4RJ4A 4RT7A 3QA0A 5JEBA 1IA9A 1A9UA 2QQ7A 4FTOA 1GZOA 2GQGA 4D2PA 4DINA 2XKEA 5CAPA 3RK5A 2E2BA 4BGGA 3FL5A 4FOCA 4ITIA 4GK4A 4IM2A 1SMHA 3PUPA 4MXCA 1BL7A 5H2UA 2OSCA 5M4FA 3V5QA 5IA4A 5LWNA 1FPUA 1O6YA 2YA9A 3QU0A 2J5EA 3OXZA 5AFVA 3OW4A 2DQ7X 4X3FA 4ACGA 4BKZA 4XBUA 3CQWA 4FL1A 4FZAB 2CNVA 3OT3A 4EOOA 2FSOX 1W82A 4RX8A 1OPLA 1SYKA 5FP6A 4I94A 3KVXA 4A9UA 2VTIA 4EORA 2A98A 2ZB1A 3AMYA 4OTPA 3V6RA 1E1VA 4QMQA 4Z3VA 2Z02A 2C5YA 2ITXA 3O96A 4WUNA 4X3FC 4O81A 5IQAA 4WG4A 2WD1A 3Q6UA 3QRTA 2QU5A 2JBPA 3U54A 2GFCA 3MBLA 2I0HA 3ZLSA 2Y4IC 3LXKA 4ENYA 5I5ZA 3D5WA 2BDJA 3BGZA 3L1SA 3VUKA 3E8CA 5ACBC 2GNLA 3SQQA 2VAGA 1G8KA 5HQ0A 5DG5A 5IKWA 5JQ5A 2BTSA 4QO9A 1Q8ZA 4R3CA 3QGWA 4DH3A 4C37A 4O0YA 3QRJA 4H39A 3NDMA 2UZVA 4FSRA 2I40A 3Q5IA 4DBNA 3KN6A 2X2MA 4TYHA 4ERKA 4XCUA 3ML1A 5CQUA 2ITYA 2CLQA 1FVTA 3FLQA 3VUIA 4FG8A 3F6XA 4L42A 2W1HA 4AT4A 2PVLA 4JQ7A 3ORTA 2JDTA 2R2PA 2JIVA 3ZZWA 4YGAA 3TUCA 3CGOA 3ACKA 3GC9A 4QDEA 2VGPA 2GU8A 3UG2A 4FVPA 4I3ZA 1KE7A 2ITOA 2W5HA 4ITJA 4DGLC 4J95A 2HZNA 3FLYA 5LMBA 3CCNA 2F57A 3NIEA 3KMWA 4NKSA 4U8ZA 3U87A 4EC8A 1TFFA 4OW8A 3TNWA 4EOQA 4PF4A 3VUGA 4D4SA 3DKCA 4F9WA 2BRNA 4RWIA 3C0IA 3R7GA 1UU8A 4YZNA 3KMUA 3PSCA 3LHJA 4C2VA 3BPRA 3KQ7A 3QCXA 3RAWA 3UGCA 4YLJA 2HW6A 2JITA 1Y6BA 5I9UA 3TNIA 3S0OA 3WIGA 3BELA 4QDVA 3DK3A 3TYKA 3LFAA 4IX3A 5KBQA 2R3IA 3T9IA 1XMMA 2PPQA 1JSVA 3HRBA 1PXJA 3QGYA 5L3AA 4YBJA 4CZYB 1H1WA 4ZJJA 4F70A 2VWBA 4I6QA 2ZMCA 1IAJA 2UV2A 3G9NA 1H28A 4GFGA 1TVOA 4XV9A 5AR7A 3OOGA 4X2KA 3ZXTA 3LCKA 3TM0A 4YTIA 3LMGA 2GQRA 5HO6A 3H9RA 5IZFA 1BI8A 3PA4A 1WBNA 5IUIA 4DTKA 4FYOA 3LLAA 3IW7A 3PXKA 4IANA 4IC8A 3QZGA 3RGFA 2G2IA 5DHJA 1DI8A 1JQHA 4FNWA 4G3DA 5LVLA 2PUUA 2ERKA 2WGJA 4YSJA 5CF5A 2BCJA 4QPAA 4DDGA 2XKDA 5EYMA 4UXQA 2PMLX 3LLTA 5K4JA 3GU7A 3ORIA 3A4PA 4GIHA 5M07A 3BRBA 5CZIA 3DBQA 4ANMA 4CQEA 1JBPE 4W4YA 3UTOA 5HTIA 4KIOA 4TL0A 2PHKA 1NA7A 4FTIA 1NVSA 3OHTA 2RSVA 2WQBA 2QVSE 4BCJA 3SDJA 5HE3A 3GB2A 1U4DA 3DDQA 5LJJA 4HVHA 3UDSA 4YBKA 3F69A 3I0OA 4WT6A 3WIKA 4RX9A 4LI5A 1OVEA 3JUHA 4U5JA 3DBDA 3KA0A 4QMLA 3E64A 4U80A 4C3RA 4MF1A 3TV4A 3NYNA 1SVGA 2J9MA 2X7FA 3PJ3A 4ARKA 3HKOA 4QP3A 5DIAA 2UW9A 4B6LA 2RF9A 3BE2A 3QXOA 3W55A 1XKKA 3PFYA 4L3LA 4IIRA 4DFBA 1IR3A 4RFMA 4BCGA 3IQ7A 4FTCA 3EFWA 3KL8A 3R73A 4HYIA 4KB8A 3VNTA 3ZC6A 4ZY5A 3N4UA 3SGCA 3ORMA 2V5QA 4YC8A 4WG3A 3I60A 3MPTA 3AKKA 2IWIA 2ZV9A 3DBCA 5F94A 2P2IA 2XRUA 3CIKA 1H0VA 3P79A 3ZRKA 2W1DA 1QPJA 2GNHA 3FI4A 5CU2A 4NWMA 4X3FB 4KWPA 3ZO3A 3UOJA 3NW5A 4M7IA 4YU2A 2A2AA 2BVAA 2QONA 1H01A 4G9RA 3IOKA 3AT2A 4UWYA 4A4XA 2Y4IB 4YPDA 2YWPA 4XLVA 2BDWA 2VTQA 4UZHA 1XJDA 2WEIA 3CLYA 4E3CA 3D2IA 3EJ1A 4CTBA 2ETMA 4RX7A 1RDQE 2X7GA 3DKFA 4O84A 2VWVA 3E87A 4BKYA 2BPMA 2OI4X 3BYMA 4G3FA 4WBOA 1H1PA 3MDYA 2H9VA 3OC1A 2YCQA 3R0TA 1MQBA 1XH6A 3AC5A 3ZFXA 5GIOE 5L4QA 4RVLA 4JIKA 1MQ4A 2HXLA 2WXVA 4FKOA 4BHZA 3FYKX 1BYGA 4IC7A 3GCQA 4PWNA 3U9CA 4HYSA 3UDTA 1S9IA 2UVYA 4FZ6A 4YZMA 1BL6A 4JS8A 3Q5ZA 4X6QC 1I44A 1OL5A 3SG9A 4HVSA 4TYHB 5CI6A 3UZTA 5AAGA 2PVFA 3O5AA 2HAKA 2O2UA 4AN3A 2W06A 4ALVA 1PXMA 4W9XA 2WU6A 2VX1A 2OXDA 1H0WA 2WFYA 3TN8A 4ZLOA 2JKOA 3MH2A 3F5XA 3QD3A 5I9ZA 5AR5A 3A60A 4FG9A 5GJFA 3EFLA 4MXZA 4BGQA 3BV3A 3CTQA 4PTCA 4EHEA 3PXFA 3ANRA 2XYNA 3SX9A 3ID6C 4D2RA 3E92A 3ZLYA 3R9NA 2XEZA 3IK3A 3P7BA 4RC2A 2OU7A 3MB6A 4FV5A 2O63A 3W2SA 2YDKA 3HUBA 2E9PA 3FMJA 3AQVA 4RFZA 4RVKA 4BDHA 1H8FA 2EB3A 1ST4A 4ENXA 3EYGA 3PJCA 2C6MA 3V51A 3RPRA 4D9UA 1H1RA 1WBWA 2UZEA 3BL9A 5DEWA 4C38A 4D2SA 2VWIA 4IBMA 4TKSA 3TDWA 5FBNC 2R4BA 3A99A 5AP6A 2YJRA 2YHVA 1YVJA 5M4IA 4GMYA 2QODA 4IHPA 3UVPA 3NFFB 5FLFA 5KO1A 2QO9A 4FTUA 3C4EA 4M66A 2WAJA 4NTSA 5HD7A 1IA8A 5HO7A 3QC4A 3DU8A 3CP9A 4X3JA 2UW6A 2BZJA 5FTGA 5J9YA 2VD5A 3AC1A 3R63A 3TKIA 3W33A 3Q4CA 3QTUA 3NS9A 4YJNA 5EW3A 4O0RA 3I7BA 3VUDA 5LWMA 4BVUA 5ETFA 3W2QA 4FNZA 4E1ZA 5ANKA 3G33A 4GS6A 5KZIA 2UZNA 2JGZA 4QOXA 3LFCA 3LFEA 2PULA 5CASA 4IFGA 3WF8A 5J5SA 4JG7A 2IZTA 4L3PA 2QOFA 3RPSA 3ZOSA 5G1XA 4C33A 4JBOA 4AGCA 3WZDA 3ORXA 3IOPA 4I6FA 1KOBA 2V7OA 4AS0A 5TKDA 3Q32A 2CGUA 3CKWA 1Q3DA 3P0MA 3FDNA 3PVWA 4S34A 5ANOA 4AP7A 4EOJA 4U41A 4DTBA 5E8TA 3O7LB 4FKPA 2J2IB 1YXTA 3OMVA 3TI1A 2I0VA 5HG5A 4DH5A 5GINE 4IAZA 3VUHA 3FLZA 1PXIA 3H0YA 5CNOA 3DBFA 3HMMA 5AP3A 3NCGA 1W83A 3GU8A 4PMMA 3MTFA 3SXRA 4CZTA 3QALE 4IWQA 3VULA 4AAYA 3OEFX 3VBYA 3ZFYA 4G3CA 4PDYA 2QLUA 4DEIA 4KD1A 3CTJA 4ZSJA 1XO2B 5FGKA 5LVPA 2XARA 2XMYA 3SHEA 4CNHA 3FZPA 4BYJA 5CF8A 5LCJA 3QRUA 4FT5A 1R1WA 2VTHA 2E9VA 2VWZA 2QKWB 1Q8UA 4F9BA 1OL6A 3C50A 2OGVA 3RAIA 3OWJA 3ROCA 4KKEA 3QHRA 4LGGA 1M2RA 2XJ0A 3E62A 2CN8A 3EIDA 2R3LA 5IEXA 3LMIA 3DXQA 2R5TA 4EWHA 1SZMA 3UVRA 2EUFB 3FJQE 2CGWA 2W5BA 4C02A 2F7XE 4OTHA 5IQIA 1ZYSA 3PWYA 2JKMA 4JX3A 5CENA 4O1OA 4D1XA 5IISA 2Y0AA 4QMPA 4EK8A 1RJBA 2ZFYA 1A48A 4QMTA 4JAIA 1PMVA 3NNUA 4FSZA 4PY1A 4RSSA 3OFMA 5AV0A 4F6WA 3MFTA 4BJJA 2VU3A 4QMYA 3KN5A 5DPVA 3THBA 1OIYA 2R3GA 3M42A 5BX0A 3WOWA 1AQ1A 3GFEA 5DE2A 1KWPA 4DFNA 4BCPA 2YLEA 4U43A 1P14A 3L8SA 4RIWA 4H36A 2I1MA 3EQPA 4O7TA 4HCTA 4ZEGA 3QRIA 4D4YA 3OD6X 4KSPA 3Q2MA 5L6PA 4BN1A 1UWHA 4GKHA 4UALA 2VWXA 4FKGA 5H8BA 3U4UA 2UZLA 4KSQA 1CSNA 4RRVA 3IECA 3D7TB 2AC3A 4M12A 3EOCA 1UV5A 3HV6A 4NYEA 1GZNA 5FM2A 3R1SA 3Q04A 4PNIA 2JKKA 3S00A 4CG8A 3II5A 3IS5A 2B9IA 3VBXA 3LFSA 4O86A 2JD5A 3O50A 3B2TA 2CHLA 3Q52A 2JIUA 3FHRA 5IH6A 4FTAA 3UOHA 5F95A 2GNGA 4GYIA 3ENHA 1ZOEA 4I93A 3NUUA 4DG0E 3QTWA 3FMDA 3MH1A 3NUPA 2IVSA 3O17A 4GEOA 3V8WA 3BHVA 4UYAA 4B7TA 4DEHA 1XMLA 4R1VA 2FA2A 2JC6A 4BR3A 4U3ZA 2B53A 2W4OA 2G9XA 3OT8A 2C69A 3KF4A 3FYJX 2W5AA 4TW9A 2UZBA 1MRYA 4DFLA 3MYGA 4ZMEA 4A4OA 4ORKA 3D0EA 1GZKA 2H34A 3QQJA 4FR4A 3BV2A 4QYEA 3QQUA 4V05A 3W32A 4ZY4A 5IMEA 5T3QA 4FUYA 2W1IA 3UNZA 5C8NA 4V01A 1OKYA 4RJ8A 2OZAA 3DFCB 1A06A 5JT2A 4AU8A 1F0QA 3SV0A 4ZMFA 4O7SA 2WTWA 5FEQA 3UBDA 5HX6A 5CAOA 1R78A 2HOGA 2F7EE 5K0XA 4J97A 4JQ8A 4TXCA 5D12A 2PMOX 4B0GA 4USFA 1FMOE 1GOLA 1LPUA 3R71A 4BCQA 5KHWA 2G01A 2C30A 3UJGA 3LJ0A 2CNQA 5ACKA 3FZTA 4RFYA 4QP2A 4OBPA 3O8TA 4X7QA 3V01A 4XG3A 3KREA 4EJ7A 1W0XC 5B2MA 2DS1A 2GNIA 1NVQA 3BYSA 4FV4A 4GW8A 3PXQA 4HPTE 4WNPA 3QD2B 3BBTB 3GGFA 4Q9SA 2YEXA 4QP6A 4XG2A 2CN5A 3FMHA 3GEQA 4XOZA 4E5AX 3LAUA 2X4ZA 4E93A 4JJRA 4MQ1A 4XH6A 1XWSA 4AAAA 2VTJA 3GP0A 2R3MA 3QQHA 4R77A 2XM9A 4ID7A 4N6YA 3Q9ZA 2B4SB 2BKZA 3PRIA 4ZXTA 2VTAA 2J5FA 2VTOA 4ANOA 4FEWA 3FC1X 3PPZA 2XJ1A 3EQGA 5CNNA 2EXEA 3FAAA 5HLNA 3GC8A 3PXZA 5J79A 3AC4A 3R7UA 3TNPC 3G0FA 3TKHA 4IAAA 1STCE 3EFKA 4G9CA 2PL0A 2XIRA 5C9CA 5EI6A 3CE3A 1XH7A 4C0TA 5E8ZA 5FQDC 3QF9A 4RJ5A 3TTJA 3LM5A 3OWKA 5IQBA 4N4SA 3ATTA 4CRSA 1MUOA 4RWJA 3UOKA 3UZRA 5CX9A 4Y46A 2X0PA 4O4DA 4NJDA 4UMRA 3VBQA 3MH0A 4YO6A 4O38A 1WBSA 5A14A 4IJ9A 2BKKA 1OBGA 4XV3A 3GI3A 3F7ZA 3L8VA 4KRCA 4ZTHA 4C62A 4JDIA 2RIOA 1OITA 3MVJA 3QQGA 4GSBA 4IZAA 4E4LA 4BWXA 3WILA 2BIYA 1YOLA 4P7EA 4TYEA 5FG8A 2A0CX 2OK1A 3HV7A 2LAVA 4M97A 3AC2A 2O5KA 4UXLA 3NAXA 4QP4A 4AQCA 3KIOC 4A9TA 1SVHA 3WF6A 4BB4A 2C5OA 1G3NA 1R39A 5E8XA 4H05A 4EOLA 4MXYA 4DG3E 3HA6A 4C4JA 4D1ZA 4L43A 5CSPA 5M4UA 4GVAA 1WBVA 3ORKA 2HY0A 3FSFA 4QP8A 5C1QB 3RM6A 5DEYA 4EHGA 3SOAA 4CT1A 3EQFA 2I0EA 3NW7A 3TNQB 5AV1A 4RIYA 4J8NA 3CXWA 4QMOA 4O7VA 3VS6A 4NM3A 4W8EA 5CAUA 3QD4A 4PL4A 2IEWA 2ONLA 1NY3A 3JVSA 4AE9A 4CSVA 4IX5A 4CXAA 3PLAE 3PZHA 4NW5A 4FF8A 4KIQA 1R3CA 3G0EA 3UMWA 5L2SA 4KUJA 2WQOA 2J0LA 1UU7A 2Q0NA 2J7TA 3DKOA 4TT7A 3ZRLA 4EOPA 5IA1A 3CQUA 4XG9A 5JFSA 3W0RA 4DDIA 3NMUF 2PWLA 5FD2A 3GOKA 5A46A 2ONLC 3VS2A 1OKZA 2YM4A 2P33A 3QLFA 3R83A 3NNWA 4AGWA 1IASA 4YNOA 4OTQA 4AG8A 1OPKA 2WOTA 3ZSIA 2RFNA 2YISA 4BZOA 5J9ZA 2UZDA 5K5XA 4F1MA 1FBNA 3EN9A 5FEEA 1ZZ2A 1YXVA 2VX3A 4E73A 5C26A 4IB1A 2CJMA 3VS4A 2XIKA 2XK4A 3VIDA 3F7WA 3UC4A 1ZZLA 2ERZE 4DBXA 2BUJA 5AX9A 4MXOA 3WF5A 1E9HA 2PVRA 4A9RA 2BMCA 1XBAA 1K3AA 3IDPA 2RFDA 4LMNA 4RJ6A 4EZ5A 5KE0A 5AA8A 5CEPA 2VO3A 5EM8A 2WMAA 2YERA 4K2RA 4CCUA 2YM6A 2QR8A 3VUMA 4DLIA 4BI0A 1U5RA 3SLSA 5CF4A 4YMJA 2G2FA 2YN8A 1KV2A 1VLRA 3HL7A 4AZTA 1MP8A 5KMMA 2WHBA 3MIYA 4M67A 5DNRA 2C0IA 5HIBA 2PZPA 3TUBA 2WMUA 3FI8A 4UX9A 2OZAB 4WA9A 3CPCA 4ANBA 2X2KA 2WELA 4NUSA 3VONA 1QCFA 3WF9A 4MK0A 5CF6A 3ITZA 2LGCA 4CD0A 1OIQA 1OI9A 3KRJA 3MB7A 4D5KA 3KK9A 2IZSA 1NVRA 4LRMA 5CT7A 4RWKA 3G51A 3WYYA 2QOBA 3QUEA 4XG7A 4E6DA 2F9GA 3E8DA 4S30A 4U79A 4X0MA 2YCSA 4ZTMA 4CKJA 5D11A 4X2FA 1IEPA 3OUKA 3FUPA 5EHYA 2FGIA 4CFNA 4MH7A 5AV3A 5IEVA 4TYJA 3VQHA 5JGBA 1OM1A 2C3LA 4K18A 2HWPA 3W2RA 4O21A 4MD9E 4RLLA 4DH8A 4C35A 2OH4A 3CD3A 3HEGA 4G6LA 5ITAA 3OWLA 2GTMA 2E9UA 3LCSA 4WNOA 3HP5A 4U40A 5EW9A 2RG5A 1REKA 3PUFC 5J95A 3F9NA 2JDSA 5AIRA 3W16A 4G5JA 4XNEA 4Y73A 2Z7LA 3EHAA 4BZNA 2W9ZB 3DS6A 4MF0A 5H3QA 4E4NA 4LRJA 4HYUA 4ZSGA 5M55A 4ZAUA 4LV5A 1XH8A 1GJOA 4MWHA 5E8YA 5FRIA 3HX4A 4O4BB 4EH6A 2CCHA 4GK2A 5HESA 5DGZA 2HIWA 3IGGA 2OLCA 5HZNA 5CEMA 2C3IB 5IQEA 5IQHA 3BYUA 4FT0A 2GDOA 3LXPA 3N9XA 4IM0A 5IQFA 1P5EA 2RKUA 4PL5A 1W98A 2ZM3A 2PSQA 4MNEA 4XP0A 3W8LA 3IW4A 3IKAA 3GT8A 3IONA 4A9SA 1TZDA 2QR7A 5BQ0A 2Y7JA 2ZDTA 4PTEA 4CMOA 3TIZA 2BRHA 4HNFA 4FOBA 1FQ1B 4JLCA 4RGJA 2OFVA 2YLFA 4RA5A 3AD6A 4YZBA 5LVNA 4WSQA 1YXXA 1W2DA 1YHSA 3TV6A 2SRCA 1ST0A 3GQIA 4OTRA 4YZDA 3VQUA 1UWJA 3EN5A 3R2BA 5BYLA 3BGQA 4TZRA 2ZV7A 5KX8A 5HU3A 4QQTA 5HBJA 2UZOA 4GUBA 4FTQA 1LP4A 1Q61A 2UZTA 4M3QA 4QT1A 3W0SA 2UW8A 3BZ3A 4IFCA 4FEVA 4N6ZA 2EVAA 2X8IA 4JOAA 3NCZA 2QOCA 2YCFA 2IJMA 3A8WA 2OXXA 5AV4A 4RIYB 3OCTA 4K11A 5BUJA 5L6OA 2EB2A 2XB7A 3VW8A 2BIKB 3BBWA 3IDCA 5B0XA 2VUWA 3OTVA 2GMXA 3GOPA 4Q5EA 1QPEA 3COMA 3I0QA 1YDRE 4WKQA 2IPXA 2FYSA 1HOWA 4EH8A 2PTKA 2H8HA 1ZMWA 4BDAA 1JKLA 5AP0A 3EZVA 2WTJA 3KRRA 3HUCA 3C0GA 5DT0A 3HZTA 4JG6A 3P7AA 4Y5QA 5L2WA 1SNXA 5A4QA 3ZC5A 1JKKA 2XK9A 5IQGA 3Q4ZA 3DJ5A 5HBHA 4ACDA 3FZSA 1L8TA 4PDSA 4Q2AA 3UZPA 3ZO2A 2ITVA 4R78A 3U51A 3BQCA 4G1WA 4FSTA 5HTCA 3QZHA 4C61A 4TYIA 5ANJA 2R3HA 2QG7A 2VO0A 3P86A 4AZEA 2CLXA 2ITZA 4LRKA 2PK9A 2QO7A 4XRLA 3H4JA 3UIXA 4AACA 5CLPA 1CM8A 4C4HA 2OJ9A 3CY3A 3OG7A 4L00A 3QUPA 5CVGA 4DFZE 3TV7A 2F2CB 3NWWA 4ZP5A 5IU2A 5JQ8A 4YHTA 4FG7A 2BZIB 4KBKA 1J3HA 4U9AA 4M0ZA 3ZSGA 5HOAA 4ZZOA 2OF4A 1H24A 3PY0A 4WHZA 4XX9A 3NYVA 4APCA 3BQRA 3P08A 5GHVA 1K2PA 2OBJA 5E4HA 3U6IA 2PZ5A 4GK3A 4KABA 3TZ9A 4AX8A 4EJNA 3GU5A 4QP9A 3TEIA 3W0PA 1AGWA 2OJIA 2UW0A 3TT0A 5BV3A 1Q5KA 2Y4PA 3PE1A 4TWPA 4YP8A 4A7CA 1J91A 5EYDA 5EQYA 1CKPA 2OO8X 2JIIA 3AT3A 3BHHA 3DA6A 4AN2A 4AQKA 3QBNA 3NUNA 4FEQA 2UVXA 1SVEA 3OTUA 4P5QA 3TIYA 2PU8A 2A1AB 2C5XA 1GIHA 4XRJA 4AA5A 3PIXA 3KU2A 3TZ8A 4IAYA 1IG1A 2WTKB 2VTLA 4BICA 2XAMA 1QPCA 3QAME 5A4CA 5BVKA 4FX3A 3VVHA 5FDXA 3A7GA 5BPYA 2HK5A 4TRLA 2VX0A 2YAKA 3TL8A 4NW6A 4EBWA 3MN3A 3UPXA 4Q9ZA 1F3MC 3MGYA 4FT7A 5CU3A 2VO7A 3LFNA 3RTPA 2HWOA 2XKCA 3DJ6A 5EM6A 4JRNA 4BIEA 4CYJA 1TQIA 4UWCA 4RWLA 4WNMA 1ZAOA 3U8WA 5HD4A 2WB8A 4ZK5A 5AR2A 3E88A 4KBCA 4MHAA 4RX5A 3NVKI 3R7OA 2GS6A 3LCDA 3W1FA 5H9BA 2ZM1A 4TYGA 2O65A 3R6XA 5CT0A 1R0EA 3QKMA 4RMZA 4RVTA 3RNYA 4H58A 3F3ZA 3IO7A 1OUKA 3K5UA 5EM7A 3QUDA 3MFSA 3WF7A 3H30A 4HGEA 2YCRA 4BCFA 5A3XA 4GT4A 5M09A 4BDDA 3HNGA 4NM5A 2OH0E 2XAOA 5ANGA 3ZZEA 3UC3A 2PMNX 4L7FA 1VJYA 4L68A 5JZJA 4YHFA 4IMYA 1WZYA 4JBQA 4I5MA 3VN9A 4E4MA 2GNFA 4JR7A 1ZOGA 2CDZA 3DLSA 3POOA 5BYZA 2V22A 3KXXA 3D9VA 3ULIA 2ETKA 2WMTA 3RZFA 2G1TA 4IB5A 4ZTRA 4ALUA 2BHHA 4QD6A 4IEBA 3DK7A 4EK5A 2QNJA 3OBGA 4DE4A 1OZ1A 4EQMA 2DYLA 2HZIA 3K3IA 4FSQA 4HPUE 4U6RA 5CSWA 3S3IA 3DFAA 3REPA 4DAWA 4ZLZA 4WBBB 4C4EA 4ZS0A 4DGOA 2W17A 4M0YA 5HVJA 5EDQA 4KINA 4IZ7A 4Y8DA 3AG9A 2XM8A 3KK8A 5AIKA 4U3YA 4WUAA 3SAYA 5CEOA 1WBTA 3LQ8A 4FKIA 4NJ3A 4EHZA 2YIWA 3AT4A 5LCKA 5FWKK 3LPBA 4BDBA 2QCSA 3VW6A 3NPCA 3OP5A 3FQEA 1PXOA 3ZHPC 3EWHA 1WCCA 2PUPA 5HG7A 3S1HA 4UB7A 4F78A 2XNEA 4DC2A 1ZMUA 4FTKA 4AUAA 3S95A 3B2WA 2R64A 2UW3A 4PPAA 2QOKA 4LV8A 3O8UA 2C6KA 5HG8A 4DGMA 3G2FA 4EH5A 5TE0A 3OEZA 1T45A 1PXKA 1IAHA 3FI3A 4QMSA 3UP7A 3BCEA 3R8ZA 4HCUA 4CLJA 3GXLA 4QTEA 5ICPA 3ZUUA 1FMKA 2Q0BA 2Y8OA 3A7FA 5JK3A 3OOMA 4EH7A 2A27A 5E91A 5J1VA 3KRWA 3TDVA 1ZWSA 2QURA 4JXFA 5I3RA 3DNEA 3SRVA 4RJ7A 4AFEA 3BYOA 4C2WA 5FUTA 4M15A 5G6VA 5JMSA 5JGDA 4FIEA 4S33A 1YRPA 4FZDB 3FHIA 2BFXA 2B52A 2AUHA 4XS2A 4DN5A 3GBZA 3IPHA 1PMEA 1TQMA 4O82A 3PE2A 3BHYA 3O23A 3UYTA 4IAIA 1YHVA 3FQSA 4GUEA 4UEUA 3UG1A 1H08A 2PVNA 3PJ8A 5C4KA 3RNIA 3K3JA 1OGUA 4ALWA 5HG9A 4OTFA 4FV6A 2XP2A 5LQFA 4N57A 3UVQA 5DFPA 4F6UA 2BROA 4PUZA 3Q9XA 4L44A 3D4QA 4FKLA 4IZ5A 4YSMA 4RZVA 4IWDA 5CSVA 3VRZA 5KMIA 4FE2A 3V5PA 4G31A 4WO5A 3KXNA 3Q53A 1PF8A 3W8QA 4FV2A 4D2TA 2ETRA 2XRWA 4F6SA 3OCBA 2R3PA 3OXIA 3UPZA 4L6QA 3TZ7A 4XG8A 4APPA 4QPSA 5IG1A 2QHNA 4LGHA