4PDSA

Crystal structure of rad53 kinase domain and scd2 in complex with amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
300
structure length
249
Chain Sequence
TGIFKDFSIIDEVTVKKAIERTTGKTFSVKIIVTRELEVLQKLNHPRIVRLKGFYESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITAFGLAKVAYVAPEVIRRNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLSYGDFSQISLSQSLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Rad53 kinase activation by dimerization and activation segment exchange.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase RAD53
total genus 69
structure length 249
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pdsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdsA01
3CPCA 4LYNA 2BROA 2OBJA 4C2VA 2QHMA 1E1VA 4BDCA 4I5CA 5DE2A 2B55A 2OW3A 4I24A 4L01A 4ZEGA 3FZOA 5AUYA 3MESA 3PVBA 5L2TA 2J90A 3ZRMA 4RLKA 4QMWA 4Y85A 4YLJA 3L8VA 5LWMA 2GPHA 4C57A 3VS3A 4BR3A 3FHIA 3GCPA 3ENHA 4O7NA 2BCJA 4QYEA 4H36A 4YJOA 2XCHA 5ANDA 4AA5A 4DEEA 3VBWA 4A7CA 4BF2A 1OBGA 2Z7SA 4D4YA 2QVSE 4YJTA 2WMXA 4IB1A 2HZNA 3QGWA 2P3GX 3SXRA 3MH3A 5CSVA 5EK7A 4K9YA 5LVOA 3VS4A 3UQFA 2UZTA 2FGIA 4PNIA 5A46A 4CEGA 3SVVA 5HGIA 4BZDA 2FUMA 4QMOA 3T9IA 1YI3A 3QQKA 4EKKA 4QMQA 5F20A 4APPA 2NPQA 2G15A 3VUHA 3RGFA 4KUJA 3VW8A 4B9DA 4X3JA 4G16A 3CLYA 4BTMA 4M0ZA 2YCFA 1UKHA 4YZNA 4AE9A 3PJ8A 4AZEA 4M84A 3T3UA 4FSNA 3AC8A 5DVRA 4X3FC 2PYWA 3KULA 3RK9A 3SV0A 4DF3A 1GNGA 5DFPA 4I0RA 4E8AA 2JIUA 4K1BA 5K9IA 4H1JA 5LVNA 4E4MA 4PTGA 3PXFA 4RPVA 2CMWA 4GG7A 3G2FA 5J7BA 3R00A 4O84A 3VUGA 1Y57A 3QD4A 4WUNA 3D0EA 4DGGA 1SM2A 2YAAA 4KINA 2C6DA 2P2HA 3EQIA 2ITUA 4WRGA 5M51A 4FEWA 4J96A 1WBSA 5C9CA 5L3AA 1XH6A 2CN5A 1Q8YA 5DWRA 4HW7A 2EWAA 4KBAA 4WD5A 5L2QA 3O0GA 4EZ5A 4FZAB 3S00A 3TL8A 4O22A 5CENA 3RJCA 4F08A 2ZM4A 2CKQA 4DGOA 4JOAA 4RSSA 1LEWA 2WFYA 2XEYA 5IQAA 4BI2A 4DEDA 3DTCA 2OLCA 4I5HA 4EK5A 2PVRA 1JQHA 2X7OA 3GGFA 1ZMUA 3OF0A 5KNJA 4C62A 5H8GA 2CCHA 4MNFA 4V0GA 5IMEA 1KWPA 5EYDA 4BDBA 4E4LA 2R64A 2RFEA 1PY5A 3VS5A 4C3FA 4ZSJA 3QZIA 4DITA 2XK7A 3K5VA 3PA3A 4OT5A 5E92A 1W84A 4HCVA 1JNKA 4MQ2A 4R1VA 2WU6A 3ZZWA 5IA4A 3KCKA 4M67A 3HV3A 2Z2WA 5AIKA 3R9HA 1R3CA 3VUTA 4RIYA 3KQ7A 2XH5A 3V8WA 5I0BA 3UO5A 5AR5A 2J4ZA 3PY3A 5BMMA 5A6OA 3BLRA 4FTAA 2PVMA 4GH2A 4JR3A 5K0KA 3UQGA 5HNIX 4CG8A 2I0HA 4FYOA 5J95A 3R22A 1YI6A 4NW5A 4X2FA 3A4PA 4U8ZA 1BMKA 4DEHA 2IPXA 5AAFA 5M07A 2ZDUA 1H1QA 4Y95A 3WYXA 4FK3A 3UNZA 3FJQE 4IZAA 4WOVA 5D7VA 3ERKA 3DPKA 2GU8A 4O0YA 3MVMA 5EI2A 3WIGA 3HRFA 4C2WA 4L3JA 1CMKE 3UNKA 3LMHA 4I92A 2PSQA 2VD5A 4FKTA 3VF9A 2I1MA 4JT3A 3FZTA 5M53A 4ZTRA 5K0XA 4IEBA 4FSYA 4OTWA 2R7IA 3EFWA 5GJFA 4ZZOA 4FV0A 2WTVA 5FQDC 2VTOA 3CJFA 2YM6A 4MYGA 3OT3A 4X6QC 3MN3A 3WZKA 3TIYA 5A14A 2KTYA 1IEPA 3KMMA 4FTOA 4BDJA 2PHKA 4WBBB 2Y8OA 4OAUC 4CRLA 1WAKA 1KE8A 5JN2A 3H0YA 2WQNA 4UZDA 1BX6A 5IKWA 4MXOA 3RPYA 4A06A 5CNNA 4FG7A 2I40A 3RNYA 5CEPA 1Q3DA 2QQ7A 4JDKA 2JBPA 3MA6A 3WF8A 3HL7A 4RVMA 1BUHA 3UC3A 1UU8A 1W83A 3A8WA 4F7NA 2C1BA 5CAVA 4ACDA 3DK6A 4CLJA 4FSMA 4H1MA 5JFVA 3GU7A 5JFSA 3M11A 2PZIA 3OXIA 2VWVA 2XK6A 5KZ0A 4O7WA 3DB8A 5EM6A 3AC3A 3V5JA 1HCLA 4OTPA 1K3AA 3R0TA 3ZDUA 4FT0A 4AGDA 4GIHA 4QP8A 5HNBA 4A9UA 2BZKB 4W4WA 3NUNA 4FTCA 4U43A 2HIWA 3D94A 3OXTA 4NL0A 2I7QA 2HXLA 2C47A 3FMNA 3QUPA 2UVXA 1OIYA 3C4XA 3FZPA 5DLSA 5K5XA 3BX5A 4IWOA 2X8IA 3FYKX 3E3BX 3TT0A 3ZUTA 4FKQA 5KHXA 4RA5A 4RWLA 4DEBA 3HECA 5DR6A 3AD6A 4Z7HA 2R9SA 5LMKC 3PFQA 3CQEA 2WQMA 4OTQA 2CKEA 3RHKA 1RDQE 1ERKA 3HNGA 2C6TA 4RVTA 3E8NA 4MXAA 2JAMA 1REJA 4YJRA 3DKFA 1PHKA 1LP4A 5AV3A 3BKBA 4MD8E 3EOCA 4QMTA 4EJ7A 2WTKB 3ID6C 1OECA 3I4BA 4X2NA 5HI2A 3EZRA 1ZZLA 3COHA 3ZSIA 2ZVAA 3KXHA 2ZAZA 3R8PA 2WTWA 2WIHA 4JX7A 4PPAA 3PJ2A 4V04A 2W9FB 2FSLX 4IH8A 2WQBA 3QQHA 2WMUA 3SAYA 3EN5A 2E9NA 4IC7A 4RX7A 4F7LA 2C4GA 4BY9E 3SW7A 3FY2A 3ODYX 4JI9A 2JKKA 4WRSA 2J6MA 3E8CA 1KE6A 2JDRA 4TT7A 3RPVA 2PULA 5E1EA 4BDIA 2B7AA 5EH0A 3RALA 3E5AA 3ZSGA 2V22A 4JS8A 5DPVA 4GYGA 2WD1A 4CLIA 2WEIA 4X21A 5JZNA 5M08A 4OTRA 5D9HA 3FI2A 4FI1A 3SOCA 4ALWA 5C26A 2XK9A 3PVWA 4BVUA 3FI4A 1G8AA 3DKCA 5DMZA 4YPDA 4DBNA 3R9RA 5DOSA 3ZMMA 2C6MA 5TF9A 4LL0A 4EOLA 3G33A 4LRJA 2BDWA 4FTNA 4R5SA 5F95A 2QR8A 3PIYA 3Q3BA 4U0IA 5EDQA 4FKWA 3PP0A 1YRPA 2CSNA 1H1SA 5J79A 1U46A 1H1PA 1PXLA 3IPHA 1STCE 3ZLWA 5A3XA 4A4LA 5HIDA 2JLDA 4IHPA 2F7XE 1FVVA 2UW7A 3POZA 2HOGA 2BUJA 3E93A 5AV2A 4ENYA 5HTCA 4KKEA 4PP7A 4TYHA 5IH4A 3EQBA 4CFVA 2JITA 2QD9A 2UVYA 3OD6X 1M7NA 5HVYA 4XG6A 4FL1A 4ZJVA 4C33A 4UY9A 4CCBA 3TDWA 2WTKC 3EQDA 1Q97A 1FVTA 3BYMA 3CEKA 4O6LA 3H4JA 2WKMA 3UIMA 2WZJA 2W4OA 4NM0A 4KBKA 1Q4LA 3LFQA 4KRCA 2BALA 2H96A 4QYGA 4EQMA 5GINE 4F6WA 3QHRA 3EQRA 4O21A 2YZLA 3WZEA 2DUVA 3BU3A 4I21A 1UWHA 2J2IB 2X2MA 1P4FA 3AGMA 2ETRA 5IISA 4S31A 4X3FB 3MFTA 2W17A 3F9NA 3Q96A 4XBRA 3ZUVA 4XRJA 3C51A 3S0OA 2Q83A 4YJSA 3RP9A 3GU6A 5F4NA 3D7TB 2WTDA 2LGCA 5AV0A 2CGVA 4E1ZA 4MEDA 3FPMA 3F2NA 4WO5A 5I9XA 3D5XA 2V0DA 4NUSA 5HICA 4PTEA 1XH8A 3G6GA 2ITQA 4EUUA 1LUFA 2F7EE 3PE1A 1ZOGA 3OS3A 2XNOA 3QUEA 4AGCA 4RVLA 3WF7A 3I7CA 4BDEA 5IQBA 2HY81 3BEAA 3EB0A 4DFBA 4TTHB 4L42A 4LV8A 3GCQA 3FXWA 4HGSA 5AFVA 4U79A 2JKMA 2WO6A 3CGFA 3JXWA 4U3YA 4WNOA 5J9LA 2YLFA 4I1ZA 4CV9A 4F9CA 4EJNA 1OKWA 4JAJA 3KXNA 4BCJA 4D1SA 4D9TA 1RW8A 5HO8A 1YHVA 2BRMA 2QR7A 3EFLA 4IVAA 4W8DA 2PVFA 3LJ1A 3KC3A 3PPZA 4IW0A 4MBIA 4NCTA 2Y0AA 3UG2A 5JKGA 4YLKA 3JR1A 2Q0BA 3LHJA 3QRUA 3ZFYA 4FNYA 4F09A 3UO6A 4HCTA 2R3MA 2VNWA 4FNZA 2VZ6A 4FUYA 4MBLA 5J9YA 3FEGA 4NCTC 4FEVA 3PZEA 3D5VA 3SXFA 4EK6A 5JT2A 4RJ3A 5K4JA 2JEDA 4OAVB 4ZP5A 4BI1A 5ANKA 4BCIA 4ANNA 2YITA 4XBUA 3K54A 3G5DA 1JWHA 4PF4A 5EW3A 2WMQA 5AUTA 5EQEA 3LFCA 2BFYA 4M7IA 3DKOA 3W18A 4ACGA 3QWKA 3ZH8A 1V0PA 4KSQA 4D5HA 2B54A 3MWUA 4IQ6A 5J87A 5LCKA 3LJ0A 5E7RA 1QMZA 3KL8A 2VWZA 2IW8A 1F3MC 1Q62A 3HV6A 3GU5A 4OBQA 5EI6A 3FYJX 4I93A 2ITOA 3P5KA 4DEIA 5BVKA 4BYIA 4C4HA 5LQFA 1OIUA 3NZ0A 5I3OA 5EHOA 3FI3A 3EJ1A 1ZYSA 4FZ7A 4BCPA 4HVDA 3DA6A 3UOLA 4NM7A 2OZAA 3DK3A 4BCOA 5BQ0A 2A19B 4GUBA 3P23A 4KSPA 1ZZ2A 4TWPA 4K6ZA 3PJ3A 4AW5A 4QOXA 1R0EA 4BWKA 5AR8A 4H39A 1K9AA 3GFEA 5I9WA 5A9UA 4EH4A 3ZTXA 4HGTA 4PNKA 4L43A 1OITA 3F88A 5T3QA 5M4IA 4L52A 3PSBA 3C50A 3G6HA 3R1QA 3W2RA 2OIQA 2C6IA 4FX3A 4USDA 4FV9A 4BGHA 3DJ5A 4JG7A 3ELJA 3LFDA 1ZYJA 3DOGA 2HZ0A 4JG6A 5E90A 1GOLA 4EONA 2RG6A 4NKSA 3IG7A 1OGUA 1XWSA 2B4SB 2XB7A 3HLLA 4YZDA 3W16A 2VWBA 4ZAUA 5LOHA 4EOJA 3CQUA 5BX0A 4FTRA 1CSNA 4DGMA 3RKBA 5IUHA 3E88A 4AFEA 4BCNA 3CTQA 2Y6OA 4G5JA 4UMTA 5HQ0A 3OCGA 3MH1A 4YJNA 2P0CA 3ZU7A 5B2LA 3UDBA 4AOTA 1PMVA 4WNPA 4E5AX 1UU9A 3FSKA 3ET7A 4ALVA 5HLPA 3OY3A 2RSVA 4LOPA 4IB5A 4AG8A 3CE3A 2O65A 4ACHA 5E8SA 4M15A 5GZAA 4S34A 2PVJA 5J9ZA 5I9ZA 5FDXA 4FTLA 4O81A 3KRJA 5CTPA 3TZMA 3FPQA 2VN9A 2ITXA 3P08A 3ZM4A 4K11A 4EEVA 1O9UA 3HUCA 4MAOA 2ETMA 3UVPA 2O0UA 3CTHA 2XP2A 1GAGA 2J50A 3JPVA 1VR2A 4JL9A 3GC8A 5AMNA 5I9UA 3BQCA 1AQ1A 4CFFA 3VBQA 4EUTA 4O38A 4BDHA 5ETIA 4BTFA 3IDBA 4LI5A 3TUDA 4L7FA 2YAKA 5CVGA 2R3NA 5BUJA 4ERWA 5KMKA 5ANEA 2YM3A 5IEVA 5KUPA 3OBGA 4GU9A 4XJ0A 4C36A 4BI0A 4FOBA 4F65A 4YHTA 3PDTA 5IQGA 4IDTA 1M2RA 2WGJA 3VWAA 1J7IA 5CAOA 3UZTA 4IAIA 3R02A 2Z7LA 1PRYA 5AUXA 3QALE 3AC2A 2IO6A 3GXLA 2X0GA 4QP4A 3IOPA 1FMOE 5H3QA 2JGZA 3G9NA 1YQJA 1OL6A 3EZVA 1SNUA 4YSMA 1QPDA 4UYAA 4MWHA 4MCVA 1WVYA 4TRLA 4D4RA 4B6LA 2VO3A 3R7IA 2QOFA 3C0IA 2CPKE 4IWPA 3LQ5A 1ZYLA 4GVJA 4AZSA 2PZRA 4YLLA 3EKKA 3IKAA 4ACMA 2CNUA 3F2AA 3I0QA 4RIWB 5LCJA 3LQ3A 4D2PA 4ZSLA 3SOAA 4O83A 4G31A 4TN6A 4WNKA 5HCZA 2YDKA 3HGKA 4QMPA 3RBWA 5AP2A 2WMVA 3FLWA 3JY0A 4PDYA 2E2BA 1YWVA 2VX0A 3BGPA 3KN5A 1Q8TA 4JVGA 2AC5A 4XUFA 3PXRA 4FV5A 5CZHA 4ORKA 1W82A 4AT5A 4NW6A 4YZMA 2IVUA 4J52A 4BHZA 1NT2A 4EOMA 2PK9A 4DG3E 5HE1A 4C02A 4AWIA 4CZTA 4DFLA 2NRUA 2OXXA 2CDZA 3QTQA 3ZFXA 2HWOA 3ORKA 3C9WA 4FSRA 5CF8A 1ZOHA 3L9PA 3PXKA 3NUSA 5I3RA 4I23A 3TUBA 4RLLA 3QTRA 2FO0A 1JSTA 3QX2A 5TE0A 3UGCA 5B2KA 4G3DA 4IXPA 2QOKA 2VWUA 4XG7A 3C5UA 1HOWA 2G01A 3GT8A 2O64A 2PVNA 4IADA 3UPZA 2IZSA 2UW4A 3NYXA 2VU3A 2VTRA 2YIQA 2YM5A 3QA0A 3SG9A 4MXCA 1VEBA 4LRMA 3QQJA 1G3NA 1WCCA 3DK7A 3OWKA 3EYGA 1MP8A 1XQZA 4FV3A 4Z9LA 1MQ4A 4N6ZA 2OJ9A 5AP1A 3P1AA 3QD0A 4RIXA 2WOTA 3BHUA 4PDSA 2CKOA 3EMGA 3NNVA 3NUYA 4MH7A 4MBJA 4TW9A 2ZM3A 4IJ9A 2H34A 2OXDA 2XUUA 3MB7A 2QCSA 3PWDA 3E62A 3O23A 4YNEA 3FMHA 4BIDA 1GZOA 4EH7A 4FIIA 3V3VA 3WI6A 2W96B 4E93A 2O8YA 1KOAA 4FIEA 5F1ZA 2P33A 2A4LA 3PA4A 4ZOGA 3LFAA 3W32A 2BR1A 3GBZA 3VS7A 3WE4A 5CYIA 1Q99A 1OIQA 3M2WA 5D1JA 4BL1A 4PY1A 3NW5A 4W8EA 4NIFA 5CU3A 5C4KA 2O2UA 1WBNA 1YDTE 1DAYA 4G1WA 4JIAA 3WILA 4EOIA 5JGAA 3KRRA 4LOQA 4PPCA 5FD2A 4TL0A 2C3KA 5HG8A 4MD7E 3AMAA 3MY1A 4YUQA 3A7GA 4G3GA 2WHBA 3P7BA 4DG0E 3TTIA 4AZWA 4I5PA 4M66A 4LMNA 2BRNA 3VS1A 2UVZA 3KK8A 4FT5A 2R2PA 1SMHA 2J0KA 2BZHB 4F7JA 4TYGA 5GIOE 5ETFA 3O8UA 2ONLA 4U41A 1PXPA 4FVPA 2XNBA 4JIKA 5HU9A 5AUVA 3Q5IA 4EQCA 1PMUA 2BDFA 3PYYA 4OBOA 3AMYA 3OCBA 3CS9A 3DDQA 4FTQA 2HW7A 4IM0A 2J7TA 2XRUA 3QAME 2Z7RA 3FL5A 5AAEA 4D9UA 4O0XA 5AR7A 2YCSA 2YFXA 4ONAA 2B53A 3R7VA 2YCRA 2UZLA 1Z5MA 3VQHA 3WZJA 2XA4A 4RRVA 3PRFA 4DC2A 5EM5A 3IW8A 2PVYA 4OTFA 5A6NA 5IZFA 4BRXA 2QO2A 4XG8A 1WZYA 4R3RA 5HE2A 3Q9ZA 4D55A 5BMSA 3NRMA 2UZEA 5AP6A 1Q8WA 3V6RA 4FZ6A 3V8TA 3AGLA 2IZTA 4ALUA 3HAMA 1PJKA 1H08A 3NNUA 4Y73A 3PUPA 3RI1A 3QD3A 4MXXA 5CI7A 4F9YA 5HX8A 5L6OA 4O2PA 2QONA 4JG8A 3CIKA 3RVGA 3ZONA 4CMTA 2VX1A 5E9EA 3SHEA 1ATPE 2ZYBA 5LARA 3MA3A 3B8QA 3P0MA 3R7EA 3EQFA 3MW1A 3DBFA 1L8TA 2PVHA 4FIHA 1WBVA 2GNIA 3KK9A 4LMUA 4FKIA 3BLQA 3HKOA 3IDCA 3VQUA 4IX5A 5H8EA 5E8WA 3CQWA 4Q5HA 4X7QA 4LGGA 3GCSA 1URCA 2R0IA 3OTVA 2XMYA 1XR1A 2IVVA 2VUWA 4BZNA 3FMJA 2FSOX 3NYVA 4TNBA 2NNWB 2C5VA 3EL7A 4L44A 1JPAA 2BAJA 3KXGA 2YM8A 4USEA 3ZLSA 2IN6A 1B6CB 4F9BA 3C0HA 3KF7A 5AP0A 1YW2A 5KHWA 4L46A 5G6VA 3BWFA 4XG4A 5AR2A 3F3UA 3UQCA 4AZVA 5JFXA 1QL6A 4YO6A 3ZSHA 4YO4A 1Q3WA 3DJ7A 5CALA 5K4IA 2CNVA 3IW6A 4PDPA 4O6EA 4RX9A 3KFAA 5D7AA 5K3YA 2RFSA 1W8CA 3ORIA 5DR2A 5A4QA 3IW7A 2FH9A 5E8UA 4DFZE 4F6SA 4XEYA 4O91A 1YHWA 5TR6A 3N51A 2BRHA 3R1YA 4FTMA 4I0TA 5HKMA 3ZLXA 1I09A 4Z3VA 4FA2A 1JOWB 3CGOA 3DNDA 1OKVA 3AC5A 2WMAA 5AX3A 2GNLA 2OSCA 3NAXA 1ZMWA 4KB8A 5IEXA 4IMYA 2VTPA 4KIOA 5L2IA 2R7BA 3A61A 4QP9A 3FHRA 2DS1A 1Y6BA 4UZHA 2QURA 3IO7A 4BCFA 1OPJA 2ITYA 2REIA 3NLBA 3KU2A 4IANA 3TZ7A 3LAUA 2YN8A 1XH7A 4FT7A 5CNOA 3OOGA 3WIKA 4ZS0A 2VWWA 3FZSA 3QFVA 3LE6A 3BYUA 5AR4A 2OZOA 3R8ZA 4B8LA 4DTKA 4Y8DA 4ENXA 2PZ5A 2CLXA 4DEGA 4UB7A 3GU4A 4D58A 3HYHA 3EFJA 3CD3A 4F1TA 3R2YA 3S1HA 4E5WA 3ZYAA 3QWJA 3PVGA 4BYJA 4AF3A 3TKIA 2O63A 4WSYA 1IA8A 5FBOA 3AD5A 5BVFA 2AC3A 2RG5A 3FAAA 3PVUA 3QQLA 4UALA 5JRSA 4I6BA 4K77A 2VTQA 4TPTA 3RZBA 2YABA 4BCKA 1M7QA 4E20A 3BV2A 4P90A 3DJ6A 1U59A 1ZXEA 4R3PA 3DNEA 5KE0A 4HNFA 1P5EA 4LGHA 4YR8A 5HTIA 4IZ7A 3HV7A 4FV8A 5HBHA 3MI9A 2QKRA 2B9JA 3BEGA 3CCNA 2R3OA 3OZ6A 4PPBA 3UTOA 4Z16A 4W9WA 5KZIA 4FV1A 2OFVA 5IQHA 5HU3A 1S9IA 2JDOA 2PZYA 2BTRA 4FL3A 4OT6A 4YJVA 1U4DA 2BAQA 5ANGA 4FTJA 4AW0A 1A48A 2XJ1A 2XK4A 2RKUA 2UW5A 4GSBA 4M0YA 3DCVA 1GIJA 2GFCA 4RZVA 2CCIA 2GS2A 3FWQA 3QL8A 3ORLA 1B38A 4EH3A 4RT7A 3UOHA 3FC1X 4DCAA 3TV6A 1IAJA 2QOQA 4TWOA 4XRLA 3R9DA 4A4OA 3OROA 3E8EA 4I6QA 4AA4A 4F70A 1H00A 1L3RE 3PXQA 4YNOA 2BPMA 2EB2A 1TQMA 3NUXA 4GW8A 4YTIA 4G6NA 4B0GA 4EHZA 4O1OA 3KY2A 2WEVA 2PMIA 3T9TA 3QZGA 2QOLA 5H2UA 2PUUA 3ORTA 4L8MA 4BDDA 3F6XA 3M1SA 2UZWE 3D15A 3I5NA 1YKRA 5EDPA 4BIBA 3LLAA 3N4VA 3DGKA 5BYLA 2OI4X 1VYWA 5FTOA 4DG2E 4HGEA 3UZRA 4YZBA 4BCGA 5JRQA 3ZOSA 5CANA 4BB4A 4WG5A 3PTGA 5C01A 1R0PA 4RIXB 1REKA 3VF8A 3NUUA 1FVRA 3TDVA 2X2LA 4O0VA 4KNBA 4F7SA 4QMYA 3ZLYA 4XV1A 1OL2A 4FV7A 1ZLTA 4IJPA 4YURA 3OW4A 4L9IA 5BVWA 4JDHA 2JDSA 4RVKA 4B4LA 2PVLA 2R5TA 3UPXA 4PL3A 4J8MA 4AU8A 4EYJA 2XIYA 5BYYA 1Q5KA 2V7AA 3TZ9A 2R3GA 2ITZA 2XKFA 3DLSA 1QCFA 5F94A 2W5AA 5AADA 5BVDA 3UVRA 3T3VA 3FMDA 3LZBA 4FG9A 4I5MA 4FIFA 2X8DA 5E4HA 3EKNA 5CAUA 5KMNA 4EORA 1Q8ZA 4BBEA 3FLQA 3A7JA 1JSVA 4RFYA 4IVCA 3LXNA 1FOTA 4FICA 5T6KA 5B0XA 3BHYA 3L8PA 5AUWA 5CAQA 5HESA 3FKOA 4QTAA 3NCZA 5JEBA 1RQQA 5DR9A 4OW8A 2W1HA 4E73A 3PG3A 3SLSA 5IA5A 1YXTA 2W1DA 3P9JA 5CQUA 3VBXA 4ACCA 3VHKA 2RF9A 4CV8A 2Z60A 3P7CA 4J71A 3LXLA 4FL2A 3I81A 4JQ8A 3GFWA 4EK8A 3N4UA 3RK5A 5J1VA 2VV9A 4HNIA 3BU5A 2VGOA 3KXZA 3L9NA 3HV5A 3TJCA 3V6SA 3ORMA 3JS2A 4IX3A 5TO8A 2VTHA 2X39A 3WF9A 5FDPA 2R3HA 2JDVA 2JKQA 5CU2A 2DQ7X 3UIBA 2GHGA 1DI9A 1DM2A 3BHTA 2JAVA 3I7BA 3FXZA 1E9HA 2BIYA 4C4FA 2W4KA 4BKYA 2XIXA 4FGRA 5I9VA 4BWXA 1UVRA 4LM5A 4LRKA 3WE8A 1YOLA 4OBPA 5IF1A 1JKKA 4GMYA 2Q0NA 5ETCA 3UODA 3CSVA 1OL5A 1KE5A 3D2IA 3H3CA 2OJFE 3SD0A 3ZC5A 3ZS5A 4PMSA 5EYKA 4A9RA 5DYJA 1FBNA 2RGPA 2CGUA 5CSXA 5HIEA 1V0BA 3HMPA 3Q4ZA 2OJJA 4CMUA 2BFXA 3LW0A 5H8BA 1FPUA 3PZHA 3SC1A 4U9AA 5FTQA 2W99B 3SA0A 3D14A 4EC9A 4F1OA 5EQYA 2C5OA 5FP6A 3IW4A 2IG7A 2C5YA 1A06A 2X9EA 4Q9SA 3W33A 3ALOA 3RINA 5DGZA 4DINA 3RM7A 3IQ7A 3QRIA 3WARA 4CKJA 3EN6A 4GJ2A 5FGKA 3MVJA 5A54A 2QG5A 3DFCB 4RBLA 1MUOA 3CY2A 5FEDA 4U45A 1QPEA 4RJ4A 3R1NA 3ACKA 3PRIA 5AP5A 4ZSEA 3U55A 4NWMA 3HMMA 3HRCA 2PZPA 3I79A 3QC4A 3Q5ZA 4MXYA 2EXMA 1PXMA 5DI1A 5HD7A 3F82A 3F3VA 1PMNA 3HX4A 4G2FA 4UX9A 1PXNA 3EN9A 4R5YA 2X7GA 2VTJA 3NNXA 1CDKA 3P78A 4TYIA 4WT6A 5GZ9A 2PUPA 2ITVA 4EBVA 1B39A 4NEUA 3BELA 2HK5A 4GG5A 2LAVA 1BL7A 1OUYA 3BHHA 3BU6A 4JRVA 4WHZA 3OWJA 1TVOA 4UBAA 5HVKA 5B2MA 3BWJA 3LM0A 3FMKA 3CKXA 2C0OA 3KCFA 4I94A 4CXAA 2Y6MA 4XYFA 4QTBA 4ZY5A 5E1SA 5J5TA 4CYIA 4C34A 2YDIA 4PRJA 3KXMA 2XNMA 3LFBA 3MFRA 4ANBA 4MXZA 2Y7JA 4H3PA 4ZTLA 2ITWA 4I20A 4H05A 4GUEA 3GQLA 4J1RA 2GHLA 2GMXA 3R8MA 4NU1A 5D10A 5CWZA 1H01A 1PXJA 4FSTA 2PMNX 4QT1A 4HJOA 5CASA 1YOMA 3N9XA 2QU5A 4RWKA 2UZVA 4AUAA 5IQEA 3AC4A 3FXXA 3Q52A 1IAHA 4N70A 2NO3A 3AT3A 3QKLA 4I0SA 4Q9ZA 5KO1A 4RC4A 2GNJA 1WBWA 1XJDA 5CSPA 4I22A 4IZ5A 4R1YA 4AAAA 3F66A 4BKJA 4DTAA 4O0WA 5EW9A 1LPUA 4GK3A 2HENA 3NPCA 2ONLC 4PMPA 1MQBA 4F4PA 5FRIA 3VJOA 5IQIA 5E91A 4FSQA 4DN5A 4PMMA 4Y5QA 4AOIA 3IK3A 2WNTA 4NTSA 4P5QA 3SX9A 3DBCA 4AA0A 3ALNA 3GP0A 1UV5A 2A2AA 4L00A 5HBJA 2UZOA 2X81A 4ZZMA 3KKVA 4E6QA 2X8EA 4J7BA 3QTWA 3AQVA 4QYFA 1YDSE 2VWYA 3H10A 2C6OA 1OZ1A 3QCXA 4QRCA 3TN8A 4FKPA 4KAOA 2H6DA 2F57A 3DV3A 3PP1A 5LMAA 1H1RA 4CCUA 3R83A 4Y72A 4L67A 5CEIA 4B7TA 5HLWA 3ROYA 2A1AB 1R1WA 4X6RA 2GHMA 2OF2A 3GNIB 3M42A 1U5RA 3W8LA 4U80A 2PUIA 3DY7A 4NZWB 4KS7A 3EQPA 4AS0A 4GIIA 5EYCA 1IASA 2ZM1A 4QMVA 3LCOA 2OWBA 5L2SA 3LFNA 3ZRLA 5E8YA 5LMKA 2ETKA 3FI8A 1NVRA 4PMTA 3SRVB 5DEWA 3HAVA 4YP8A 2XKEA 4D2SA 1H07A 3EIDA 3IS5A 3VBVA 3NVMB 1XO2B 2WMWA 2BHHA 5HBEA 3TKUA 2CJMA 5DA3A 1NXKA 4JBVA 4I4FA 2ZJWA 3JYAA 3BQRA 3MV5A 4ZJIA 5D12A 5M4CA 4GK2A 3F3TA 4OUCA 2W1CA 4FG8A 4RFZA 3DLZA 4G3FA 5FWKK 3PLAE 2GNFA 1FGIA 5TKDA 4CRSA 2FSTX 4FMQA 1OL7A 3D7ZA 3NYNA 2VWXA 4J98A 4AQCA 3KVWA 3SG8A 1WBOA 3MIAA 3A7FA 3EFKA 4M8TA 4RFMA 2BDJA 4XP0A 1U5QA 4CTBA 2X1NA 4GEOA 4KIKB 4QD6A 4RWIA 4DFUA 4HYIA 4P4CA 3R71A 2YIRA 4J97A 2C3LA 2WQEA 1MRVA 1M17A 1SZMA 1JSUA 4RC3A 2GNHA 4U5JA 3RAIA 4BIEA 5E8ZA 4M68A 3ROCA 4LFIA 2W9ZB 4EHVA 3F7ZA 2EXEA 2OO8X 4FT3A 4XG9A 4EH8A 4UYNA 4ITIA 4G6OA 4MF0A 2H8HA 3GB2A 3WF6A 2I0VA 2J0IA 4CNHA 5EM8A 2J51A 3WOWA 3BPRA 3O51A 3KULB 5FTGA 2YERA 2UW0A 3AC1A 3PY1A 4QP1A 3DBQA 3HDMA 3UC4A 4QMUA 1PKGA 4QPMA 3BZ3A 4CT2A 3HV4A 5C1QB 3R2BA 1NW1A 3MFSA 3O50A 4FGBA 2XNPA 5AV1A 5C8NA 5C03A 2R0UA 1O6YA 4IAFA 4JBOA 4W4VA 2XEZA 3U4UA 4FR4A 3MIYA 2VTSA 1ZWSA 2WIPA 3LCSA 2YM7A 3MYGA 3NX8A 2HXQA 4PUZA 4RC2A 2WXVA 4CFXA 2VTAA 4Y5HA 1FMKA 4X0MA 4NFNA 4FKVA 3V8SA 4ASZA 4E6AA 2NP8A 4RWJA 5HCYA 5HHWA 3ZC6A 3FSFA 3VS6A 4XNEA 4DTBA 4NFMA 3OWLA 5HNGA 4MVFA 2PVKA 4FBXA 3F69A 1PXIA 4C4GA 4TKSA 4GKHA 2PWLA 3IW5A 4DEAA 5DN3A 5EG3A 3LCDA 2OXYA 1PKDA 4WBOA 3TEIA 2ZOQA 5EDRA 3ULIA 3ZO3A 2O5KA 4FKSA 4O0UA 3QRKA 4OGRA 3W1FA 4O7TA 2HZIA 5EI8A 3UE4A 1H28A 3LQ8A 4B99A 4O1PA 2IW6A 3FKLA 4RJ5A 3Q6WA 1LR4A 2ZMDA 4YZCA 4D4VA 1Q41A 3C4WA 3VUDA 1UNHA 3DB6A 3GCVA 4CKIA 2ACXA 3OC1A 3MB6A 3EQHA 3MFUA 3Q4UA 2F2UA 3MPAA 5HO6A 3UNJA 1ZYDA 5M4UA 3K3JA 2V5QA 3E92A 3WZDA 1ZYCA 3LPBA 3SDJA 1CTPE 2QLQA 2R3JA 5ACBC 4WA9A 4FK6A 1KV2A 3HMOA 2GNGA 4CZUA 5FEQA 2QHNA 2YWPA 2C0IA 3PWYA 4PQNA 5HO7A 5CF4A 4ZLZA 3KA0A 3VRYA 2UW6A 4CVAA 2V62A 3MVLA 4BCMA 5HD4A 4EQUA 5IDPA 2BRBA 4C59A 3F61A 4L68A 3RPRA 3CPBA 3ZO2A 3N4TA 4ZY6A 2BKZA 1F0QA 3EYHA 3O8TA 1YXXA 3WF5A 3OUKA 4KIPA 3H30A 3OWPA 2J5FA 3MJ2A 5KMIA 2PY3A 4ERKA 1J3HA 4FTTA 1FGKA 4E4NA 2FB8A 3II5A 3QQGA 2C69A 2E9PA 3W2OA 4YJUA 2QOOA 2JC6A 1SYKA 4TNDA 2YIYA 3E63A 3O8PA 3QXPA 1QPJA 3ITZA 3U9NA 4L7SA 3SW4A 2E9VA 3DS6A 3OHTA 4KD1A 4YBKA 3U54A 1XHAA 4V01A 1V0OA 2JKOA 2H9VA 3ZXZA 4XOYA 4E6CA 4FIJA 4MHAA 3WYYA 4U97A 3HA6A 2P2IA 4II5A 4E7WA 2CNQA 3HVCA 3EH9A 3OVVA 3S2PA 3TIZA 3QCQA 4DFXE 4FYNA 2VTLA 2X4FA 4GT4A 2AYPA 2YHVA 2RFDA 2W1GA 4APCA 5M4FA 3FE3A 2PE1A 5BVEA 3UP2A 5JGDA 3QD2B 1MRUA 3QQUA 2ERZE 4JR7A 2UZDA 1K2PA 4H3QA 3W2CA 3QUDA 3Q9XA 3PE2A 3O17A 3H9OA 2ZB0A 4G6LA 3C1XA 3NR9A 1Y6AA 4O0SA 2BZIB 3RPSA 2W5BA 2QO7A 2UZBA 1BKXA 3DAJA 1IR3A 2CLQA 1APME 4K33A 4MNEB 5FXQA 3ODZX 4V05A 1HCKA 3Q60A 5I9YA 4BTKA 5EQPA 4C4IA 5FG8A 2PL0A 2CHLA 3WBLA 4ANMA 4N6YA 4MTAA 3FL4A 3QLGA 3UYSA 3COIA 4FVQA 5G1XA 3Q04A 3S4QA 3UVQA 1GZKA 3FBVA 2VAGA 3HP5A 1JAMA 3Q9WA 1OBDA 2HZ4A 3BCEA 5E8TA 3ZBXA 2J0JA 3U6HA 3QA8A 4FZDB 2WMBA 2QODA 3HEGA 2ZB1A 4YSJA 3LKMA 2J5EA 4Y46A 5LVPA 3F2RA 3QCSA 4C4EA 4EH5A 4EH6A 3FMEA 2OH0E 3R30A 4PV0A 4EC8A 2RL5A 3GOKA 4W9XA 3TUCA 2WU7A 4ARKA 5BPYA 5KMOA 2SRCA 2XKDA 5M56A 1XH9A 4DGLC 5C4LA 2YLEA 3LMIA 4BHNA 2P4IA 4QP2A 5E8VA 3D4QA 5CVHA 3QZHA 4EK4A 5L4QA 3MY5A 2YIXA 5HG7A 3QX4A 3ENMA 3F5UA 5GIPE 2CGXA 4YC8A 4M13A 2OJIA 3RNIA 3HP2A 1Q8UA 3NW7A 4GFMA 4UWYA 3QTZA 3HUBA 5CQWA 3LVPA 2W1ZA 1J1CA 3DDPA 1OI9A 2G9XA 3QYWA 4CTCA 2RFNA 3POOA 4YZ9A 2IVTA 5DH3A 2F4JA 5CY3A 3FQHA 1RE8A 4P5ZA 4PL5A 2EUFB 5JK3A 4L3LA 1KE9A 1SVHA 1PXKA 5FLFA 2ESMA 4DT9A 4NJDA 3CTJA 2BTSA 3ATSA 5AUUA 1BI8A 2ITNA 3NW6A 2XNNA 3C7QA 4AW1A 4E4XA 3Q2JA 4DH5A 3LXPA 4HZRA 4BC6A 3HZTA 2XK3A 3MH2A 2QO9A 3NS9A 4DFNA 3LFFA 1URWA 4F6UA 4I3ZA 1IA9A 1Y91A 5CEKA 3TV4A 3MBLA 2VNYA 4C37A 4FZFB 4D0WA 2E9OA 4DA5A 1Q24A 2OG8A 2X6DA 3C4FA 1V1KA 4LL5A 4BTJA 4OR5A 3V01A 5M44A 3AXWA 3ZCLA 4RX5A 4FVRA 3TWJA 5HEZA 4I6FA 4FKUA 5IG1A 4BBFA 2BAKA 3W10A 3EHAA 4C7TA 4CZYB 3RM6A 2XNEA 1CKPA 1UA2A 2C6KA 2QKWB 2BMCA 4R7IA 1WBTA 3TTJA 3V51A 4ZTQA 2B9FA 1NVQA 4ZIMA 1YOJA 4TZRA 5I4NA 4JDIA 3ZXTA 4CT1A 4DE4A 3SRVA 2PE2A 1H8FA 4YBJA 4F64A 2UZUE 3DXQA 2YA9A 3PSCA 5IH5A 4FUXA 2UW3A 3FLYA 2G2FA 4Q5EA 2QU6A 4TWNA 5KCVA 2W05A 1VJYA 2GQGA 2GQRA 3RCJA 1Y8GA 5HE0A 3PIZA 3R21A 4GRBA 5LJJA 3ACJA 2FA2A 3O2MA 1ZAOA 3A2CA 4IWDA 2XZSA 2Z7QA 4JBQA 4RA4A 5IQDA 3RAWA 2X4ZA 3I1AA 4ZLYA 3B2TA 2VO0A 1JKTA 1YWRA 5AJQA 3A7HA 2R3IA 4YU2A 4U44A 4FF8A 4QTCA 3W2SA 1J7UA 5JZJA 5AR3A 4XCUA 4ZTSA 1UKIA 2VX3A 2YJRA 4GVAA 4XP2A 3RPOA 3LM5A 3UMXA 3VAPA 5C8KA 5IA3A 3A4OX 4ZZNA 2C5NA 4K0YA 1ZY5A 2W7XA 4FKLA 3NVKI 2OIBA 3NYOA 3LCTA 4WSQA 3A7IA 3DQXA 3RMFA 3LLTA 5GZ8A 3P7AA 4FKOA 1ZARA 1GIIA 2F49A 3JVSA 4IAAA 4CQEA 3F5PA 5AP7A 3CR0A 4FNWA 2WMRA 3FLSA 4UMRA 5IEYA 1Z9XA 2YACA 5KMLA 3QTUA 4JX3A 2IZRA 3UJGA 4JQEA 3QC9A 3EQCA 3C5IA 2GDOA 3VNTA 4L53A 3TG1A 5KKRC 5BYZA 3MSSA 5DT3A 4MWIA 4BN1A 4HVGA 2JBOA 3GQIA 1PMEA 3R28A 4G9RA 1GIHA 5F9EA 1UWJA 3R6XA 5BNJA 4LV5A 5AA9A 5LMBA 4F99A 1E1XA 4ZY4A 4KKHA 1Z57A 3UMWA 2WMSA 3LXKA 2BVAA 4DT8A 2B9HA 2OK1A 3FMLA 2W5HA 1H27A 4L6QA 3I6WA 2QOBA 3VS2A 3FLZA 5ICPA 4ZMEA 4EOQA 3GOPA 3O7LB 4IWQA 1MRYA 4DH8A 2CN8A 3CBLA 3L8SA 3RAHA 4XLIA 4YTCA 3FQEA 4XP3A 3R7OA 3NUPA 4OLIA 3V5TA 3B8RA 2G1TA 5CLPA 4YHFA 1GY3A 4FSZA 1JKSA 1U54A 2QOHA 3DTWA 2W1IA 1XH4A 4NSTA 1OM1A 4ZSGA 1KE7A 1M14A 2VGPA 3QRTA 3QLFA 5IQFA 4IM3A 4A4XA 5DEYA 2Y9QA 3O96A 4NM5A 3I6UA 4HGLA 4EBWA 5A4TA 3D83A 2IW9A 4O7SA 3G0EA 1ND4A 2A27A 3RHXA 3P79A 5HTBA 1ZRZA 2C0TA 1T45A 4GV1A 5HOAA 1ZY4A 4U7ZA 3BE9A 2R3LA 3SXSA 4BBMA 4BICA 4UXQA 2XIRA 5CU4A 2RIOA 2G2HA 2JIIA 3TI1A 3Q6UA 5JH6A 3MTFA 3PLSA 3NUAA 4X3FA 5JMSA 3JY9A 3VHEA 5CSWA 4EHEA 3BV3A 3S3IA 2ZV8A 4E3CA 3G9LX 3FUPA 3R63A 4D0XA 3E87A 3QTXA 3GU8A 5BVOA 2XNGA 3V5PA 4QQTA 4O7RA 2KULA 3JUHA 3HDNA 3ZHPC 4R8QA 2NRYA 1JVPP 3NDMA 2Z8CA 4GT5A 2DYLA 3A62A 3LFSA 3SGCA 2BILB 4X2KA 2XBAA 5GNKA 2WPAA 3MVHA 4BCQA 3MTLA 4IVBA 3MPTA 2ZMCA 2CGWA 4C3RA 2ITTA 3MDYA 3PSDA 1GZ8A 3QKKA 3ZO4A 3TACA 5M57A 5CU6A 4U3ZA 3GC0A 4RJ8A 2R3PA 3PIXA 4X2JA 4X2GA 2GSFA 4O0RA 2QNJA 3VN9A 2OGVA 4XHKB 1T46A 4RJ7A 3UOKA 4EOSA 1J7LA 4ZJJA 4TY1A 3UZPA 3U8WA 1AD5A 1DI8A 3GEQA 4KRDA 1VZOA 4KWPA 4RGJA 2GFSA 2WAJA 5GJDA 4UMPA 4ZTMA 5CAPA 4CKRA 3RCDA 4RIWA 3IOKA 4AP7A 4DAWA 5CEQA 4DCEA 4G3CA 4UN0C 1LEZA 1W98A 2VO7A 3QKMA 3IECA 1NA7A 1YI4A 3COKA 3DZQA 2YZAA 3IDPA 4ASDA 4N57A 4ZLOA 2I6LA 2C3JA 3CKWA 5IA1A 4S2ZA 1OKZA 1J91A 4EOOA 4G34A 3NGAA 4QMNA 3RWQA 3U51A 4IE9A 4RMZA 3P4KA 4I6HA 1OVEA 5HIBA 2I0YA 2VO6A 4LGDA 3R7GA 4W4XA 3EN7A 4MNEA 5HVJA 5AP3A 3TM0A 3R01A 4HOKA 2ZDTA 5EYMA 4EK3A 3Q9YA 3MJ1A 5J8IA 4J95A 4FSWA 4GL9A 4U40A 3COMA 5IA0A 3G15A 4RIYB 3CD8A 3UIUA 3QHWA 3F5XA 5D41A 3CC6A 4C61A 3C13A 4MQ1A 3IGGA 5L8JA 3DBDA 3QGYA 5A4EA 2XF0A 1UU7A 2GCDA 2CKPA 1W7HA 4KIQA 2XS0A 3ZUUA 4FTIA 3PPJA 3LMGA 3Q53A 3E7VA 4QP3A 4RIOA 4QMLA 5M06A 2YJSA 4ITJA 2PE0A 4GCJA 4RJ6A 3EL8A 4U81A 5FM2A 5EOBA 4O7LA 3ZO1A 5AAGA 4V0GB 2IVSA 3RAKA 2F9GA 3H9RA 3VRZA 4EH9A 5AWMA 3T8OA 4BDAA 5EM7A 3NAYA 3R9OA 2C1AA 2J0MB 4NTTA 3L8XA 3OTUA 3PJ1A 1P2AA 4FOCA 3BYSA 4GKIA 4KIKA 4I4EA 4KA3A 2UV2A 3G90X 4M97A 4F63A 3VULA 4IACA 5IPJA 4AT3A 2R3FA 2C30A 2FSMX 2HW6A 4D5KA 5HG9A 3AOXA 3MPMA 3AT2A 3ANRA 2QOIA 3BE2A 5H9BA 4AZTA 3A8XA 5ANOA 4BGGA 5C8MA 4USFA 3OP5A 4EH2A 2XJ0A 1CM8A 5CEOA 1SVEA 4PP9A 4S32A 5DBXA 3HRBA 2XJ2A 4OTIA 4LUEA 4XX9A 4ID7A 4RQVA 3NWWA 4ASEA 1EH4A 1UNLA 3V5WA 4QMXA 4EKLA 2B1PA 3HMNA 5A4CA 4JRNA 3EWHA 1AGWA 2HY0A 1WMKA 3KMWA 3TNHA 2Y4PA 3PJCA 2WMTA 4LOOA 2W0JA 3DU8A 4ZMFA 3QZFA 5CI6A 4BDGA 2R3QA 4FEQA 3ZFMA 5AV4A 4ZS4A 3ZEWA 5IDNA 3U6JA 4GS6A 5JFWA 2J9MA 2VTTA 2YDJA 3VS0A 3OMVA 1R78A 1DAWA 4ANQA 4S30A 2W1FA 1H4LA 2XIZA 3KRXA 5CZIA 5CT0A 3BYVA 4IFCA 4TYHB 5LXMA 4IFGA 2WQOA 3R73A 4FKJA 5FBNC 3KN6A 4F9WA 3F3ZA 3I60A 1KSWA 2I0EA 4YHJA 5T68A 4YTFA 5KBRA 3VO3A 2OZAB 3C4CA 5DRDA 5IQCA 3F5GA 1R39A 2PMOX 3OOMA 4P7EA 5DT4A 1PXOA 5ANIA 3TCPA 1H25A 5CSHA 1M2QA 5BVNA 5KMMA 1H24A 5FXSA 3NEWA 3ORXA 5ETAA 2Y4IC 4IB0A 2AUHA 1XBBA 3TNPC 4XG2A 4D2WA 3BBWA 3MH0A 2VTIA 3C4EA 3VBYA 2JFLA 2R4BA 3HA8A 3K5UA 3REPA 4E5BA 3Q4CA 3SQQA 5L2WA 3FV8A 5ACKA 3D9VA 4JXFA 4NKAA 4LG4A 4HVSA 5AM7A 3C4ZA 4FEXA 1PW2A 1CKIA 1ZMVA 2P55A 2W4JA 1JKLA 1P14A 3BGZA 4NH1A 3VJNA 4JDJA 4N0SA 4MKCA 4Y83A 2PMLX 1PYXA 4D2TA 3MS9A 4QQ5A 4WG4A 2BZJA 5EHYA 5AA8A 5K5NA 2VTMA 2QI8A 1NY3A 2UW9A 3FQSA 5AEPA 4FE2A 4FKGA 4TYEA 1OMWA 4L45A 4BKZA 5L6WL 3RZFA 3UOJA 3GI3A 2OKRA 3R8VA 4P2KA 4ANSA 4EOPA 5LVMA 2VTNA 3Q4TA 4J99A 5M55A 2X9FA 4TWCA 5E8XA 4A9YA 4GT3A 3LIJA 3CY3A 3DBEA 4FTKA 3FZ1A 4QNAA 5DIAA 1KOBA 4HYUA 1RJBA 4AFJA 4MF1A 4MD9E 2WOUA 4F1MA 2G2IA 1OUKA 3PY0A 2Z02A 2JFMA 5JQ5A 5EOLA 5B7VA 3GC7A 4TYJA 3QCYA 3GENA 1TQIA 2YISA 3QQFA 4IB3A 2BRGA 3GCUA 4C35A 5J1WA 4RG0A 4O96A 3A99A 3R8LA 1BLXA 5DRBA 3E7OA 4EWHA 3B2WA 3OT8A 2IJMA 5GJGA 4YGAA 3KRLA 4EZ3A 4RZWA 1GZNA 4FKRA 4M69A 1YXVA 2X6EA 3D7TA 4EWQA 2PTKA 1DS5A 2Y4IB 3FDNA 4HCUA 2ZV9A 3TJDA 4IX6A 3FC2A 5L8KA 3KRWA 1U54B 3R8UA 5CVFA 1YXSA 4GFGA 4IIRA 3UG1A 5JGBA 1FQ1B 3WZUA 1SVGA 4HVIA 3DAKA 3R7UA 4D1XA 3D2KA 3E8DA 2UZNA 4XOZA 4XV2A 2F2CB 3CXWA 2IWIA 4DHFA 4DLJA 3VUIA 5DG5A 2BHEA 4C58A 4DH7A 1G5SA 4FODA 4FV4A 4FSUA 4AGWA 2QLUA 3O7LD 3FZRA 5HZNA 3QRJA 3TKHA 4IC8A 4M14A 3KGAA 3QXOA 4L3PA 3KB7A 5J5SA 2HCKA 4YC3A 5CX9A 3DXPA 3OEZA 3OCSA 3KF4A 2WB8A 3BYOA 5FXRA 4UEUA 4WNMA 1X8BA 4D4SA 4QMZA 2XBJA 1OKYA 4GFOA 4QP7A 4QPAA 4QYHA 3H9FA 3THBA 4DH1A 1H0VA 5HG5A 4A07A 3O71A 4F0IA 1OL1A 1A9UA 3FY0A 4IAKA 4ANOA 4JLCA 2UUEA 3JVRA 3Q32A 4GU6A 2J0LA 4BCHA 4C38A 1VYZA 2ITPA 2GTMA 4HPUE 3TXOA 1WBPA 2OICA 3EQGA 3IONA 3VC4A 3VIDA 4G3EA 4QMMA 5CS6A 3FLNC 4YPSA 3S95A 4DGNA 3ORPA 4QPSA 3ETAA 3PXZA 4C4JA 5IH6A 4CMOA 2XVDA 5IU2A 3ANQA 2FYSA 3KREA 3OY1A 1WVXA 2C5XA 2XK8A 2XYUA 3ZZEA 2B0QA 4ZTNA 3GUBA 3K2LA 3DQWA 5CU0A 5BUIA 4U6RA 3BGQA 2PU8A 1CKJA 5CXHA 4IVDA 2W1EA 4DBXA 4HYSA 2O3PA 4J8NA 2C6EA 3LFEA 4JAIA 4AT4A 2R3KA 5M09A 4UV0A 4LQMA 4EOKA 2OF4A 2HYYA 3P86A 3TNWA 3LOKA 3AD4A 5EW8A 4RQKA 1YWNA 4JNWA 3E64A 1QPCA 2F7ZE 3OCTA 4PTCA 1OPLA 3OEFX 4UXLA 4AN3A 2B52A 4AW2A 5KKRB 1ZOEA 3DXNA 4OTGA 5TT7A 3A60A 2OIDA 2XRWA 4G17A 2WTCA 2A0CX 3OUNB 4GK4A 4QO9A 3V5QA 5KMJA 4R6VA 2PUNA 2YEXA 3D5UA 1TKIA 1Q61A 3QF9A 3ZM9A 4XH6A 4PDOA 3OG7A 5EHLA 2VRXA 4UMQA 3Q2MA 3R04A 4KKGA 3UIXA 4NIFB 4KBCA 3AG9A 4NK9A 3ZEPA 3BIZA 2OH4A 4C0TA 3ORNA 3VUMA 4K2RA 4YMJA 3L9MA 3ATTA 5HX6A 4FIGA 1WFCA 4U42A 5FP5A 4XLVA 4O2ZA 4DYMA 2OU7A 1UU3A 1YHSA 3RK7A 4IAZA 4IAYA 2C68A 5FEEA 3TNQB 2JD5A 2JDTA 2YCQA 5L8LA 4UWBA 4NYEA 1BL6A 3W2QA 3PPKA 2YIWA 3CP9A 3BHVA 4XG3A 2WTIA 1NVSA 3QBNA 2XIKA 5DT0A 4ZK5A 4M12A 5IA2A 4K8AA 1YVJA 3G0FA 4YJPA 3IGOA 3E3PA 3OFMA 4W4YA 1KV1A 4KS8A 3OBJA 2DWBA 4QTDA 3U87A 2XYNA 3KMUA 4HVHA 1BYGA 3HMIA 4R7HA 4DLIA 1UNGA 2PPQA 4QYYA 1I44A 4Q2AA 1H0WA 3U6IA 3DAEA 3C0GA 3QYZA 4IZYA 4UWCA 5AP4A 5EKNA 5DNRA 3DT1A 3UBDA 4AXAA 2GS6A 2YWVA 4AACA 4PL4A 1W0XC 3ULZA 1IRKA 5AIRA 4K18A 3OW3A 4YC6A 3RWPA 4CFNA 2OJGA 2V55A 1OIRA 5GHVA 4D28A 3NIEA 4NJ3A 3UYTA 3KVXA 5IUGA 3W2PA 4CFMA 4JJRA 4PWNA 2BIKB 1WVWA 4HYHA 1JLUE 2XM9A 4HZSA 3U4WA 4BFMA 5D11A 5HORA 1M52A 2WTJA 4CQGA 4S33A 4ZXTA 4PX6A 4E6DA 3R1SA 4FNXA 4RX8A 4YJQA 4XMOA 4TXCA 5ANJA 4EHGA 5CF6A 2QOCA 3FMMA 4AGUA 2ZV2A 2UW8A 4CSVA 5ITAA 3LJ2A 3W8QA 2X7FA 4WIHA 3W55A 3VVHA 5HCXA 4GYIA 4LUDA 4OTHA 3D5WA 2C6LA 3ZDIA 1SNXA 4NT4A 4C3PA 4F0FA 4FEUA 4KABA 2IZUA 3TNIA 3SKCA 4YTHA 2XM8A 4Z55A 3EN4A 4FTUA 3R7YA 3H0ZA 4XS2A 4O27B 4O0TA 4QMSA 4F0GA 4O86A 1GJOA 4IDVA 3VUKA 2ZV7A 2OFUA 4BWPA 5I5ZA 3AT4A 3I0OA 3TZ8A 4CYJA 1FINA 4F9AA 5AUZA 3MY0A 1M2PA 4FV6A 2HAKA 4G5PA 2QC6A 4WG3A 4DFYA 4CFWA 4QTEA 5IMXA 4I41A 4R3CA 4XV3A 4BDFA 1OPKA 4N4SA 5FUTA 4GJ3A 5EKOA 3QTSA 1PF8A 3I5ZA 2V7OA 4M3QA 4JQ7A 1KUTA 4R78A 2X2KA 1H1WA 3ZBFA 1XH5A 3NMUF 3PXYA 2GQSA 3DZOA 5IUIA 4H58A 5KX8A 5EFQA 1P4OA 4FV2A 3UO4A 4MK0A 4EYMA 4R77A 4AE6A 4AOJA 5FM3A 4D1ZA 4AX8A 2QG7A 4HPTE 1O6LA 5LVLA 3KXXA 1S9JA 3VBTA 2BKKA 4QQJA 2GS7A 5JQ8A 1BI7A 1F5QA 4H3BA 2FVDA 5HE3A 2ERKA 3UP7A 4BZOA 4ITHA 5CXZA 3AMBA 3G51A 4WUAA 4ZSAA 3FKNA 2HWPA 3GVUA 2EVAA 2GTNA 1IG1A 1XKKA 4JBPA 2R3RA 4R7BA 4M69B 4FT9A 4O7YA 4NM3A 4IM2A 3DKGA 3R9NA 5CT7A 4B8MA 4J53A 4XV9A 3ORZA 5J7HA 5L6PA 3NCGA 5BUEA 1XBAA 3F7WA 3NSZA 4QP6A 3F3WA 3RTPA 5CEMA 5AM6A 2C3IB 3BRBA 4O7ZA 3K3IA 1XBCA 1G8SA 4EL9A 2B9IA 2EU9A 3CJGA 2XKCA 4A9TA 1O6KA 4D2VA 4O82A 4CG9A 3NIZA 3PA5A 1YXUA 3QU0A 4ASXA 3DFAA 4C8BA 4D2RA 4CGAA 1J1BA 3QTIA 4QQCA 4AN2A 3V5LA 5A4LA 5CF5A 5HLNA 4ZTHA 4DH3A 4QNYA 2YM4A 2E9UA 4OTDA 3OXZA 4AN9A 1OB3A 4CFUA 4EI4A 5LWNA 3L1SA 3LCKA 2EXCX 3V04A 2VWIA 3BLHA 3BBTB 4G9CA 5C27A 4O7VA 1TQPA 5AX9A 4AZFA 3ZRKA 4Z7GA 3NNWA 1PYEA 4IBMA 3VW6A 2XCKA 3GC9A 2HELA 5JSMA 2WELA 1H26A 4A9SA 2EB3A 4BDKA 2JIVA 1Y8YA 2W06A 3BI6A 3U9CA 4BGQA 4EZ7A 4CD0A 5KBQA 5TOZA 1JBPE 4WKQA 3TV7A 3PG1A 3KEXA 4ANLA 4MX9A 4FC0A 4IX4A 1YDRE 3MGYA 4UMUA 3L9LA 4E26A 5DHJA
chains in the Genus database with same CATH superfamily
3CPCA 4LYNA 2BROA 2OBJA 4C2VA 2QHMA 1E1VA 4BDCA 4I5CA 5DE2A 2B55A 2OW3A 4I24A 4L01A 4ZEGA 3FZOA 5AUYA 3MESA 3PVBA 5L2TA 2J90A 3P5JC 3ZRMA 4RLKA 4QMWA 4Y85A 4YLJA 3L8VA 5LWMA 2GPHA 4C57A 3VS3A 4BR3A 3FHIA 3GCPA 3ENHA 4O7NA 2BCJA 4QYEA 4H36A 4YJOA 2XCHA 5ANDA 4AA5A 4DEEA 3VBWA 4A7CA 4BF2A 1OBGA 2Z7SA 3VONA 4D4YA 2QVSE 4YJTA 2WMXA 4IB1A 2HZNA 3QGWA 2P3GX 3SXRA 3MH3A 5CSVA 5EK7A 4K9YA 5LVOA 3VS4A 3UQFA 2UZTA 2FGIA 4PNIA 5A46A 4CEGA 3SVVA 5HGIA 4BZDA 3TMOA 2FUMA 4QMOA 3T9IA 1YI3A 3QQKA 4EKKA 4QMQA 5F20A 4APPA 2NPQA 2G15A 3VUHA 3RGFA 4KUJA 3VW8A 4B9DA 4X3JA 4G16A 3CLYA 4BTMA 4M0ZA 2YCFA 1UKHA 4YZNA 4AE9A 3PJ8A 4AZEA 4M84A 3T3UA 4FSNA 3AC8A 5DVRA 4X3FC 2PYWA 3KULA 3RK9A 3SV0A 4DF3A 1GNGA 5DFPA 4I0RA 4E8AA 3UDZA 2JIUA 4K1BA 5K9IA 4H1JA 5LVNA 4E4MA 2AEGA 4PTGA 3PXFA 4RPVA 2CMWA 4GG7A 3G2FA 5J7BA 3R00A 4O84A 3VUGA 1Y57A 3QD4A 4WUNA 3D0EA 4DGGA 1SM2A 2YAAA 4KINA 2C6DA 2P2HA 3EQIA 2ITUA 4WRGA 5M51A 4AQKA 4FEWA 4J96A 1WBSA 5C9CA 5L3AA 1XH6A 2CN5A 1Q8YA 5DWRA 4HW7A 2EWAA 4KBAA 4WD5A 5L2QA 3O0GA 4EZ5A 4FZAB 3S00A 3TL8A 4O22A 5CENA 3RJCA 4F08A 2ZM4A 2CKQA 4DGOA 1ST0A 4JOAA 4RSSA 1LEWA 2WFYA 2XEYA 5IQAA 4BI2A 4DEDA 3DTCA 2OLCA 4I5HA 4EK5A 2PVRA 1JQHA 2X7OA 3GGFA 1ZMUA 3OF0A 5KNJA 4C62A 5H8GA 2CCHA 4MNFA 4V0GA 5IMEA 1KWPA 5EYDA 4BDBA 4E4LA 2R64A 2RFEA 1PY5A 3VS5A 4C3FA 4ZSJA 3QZIA 4DITA 2XK7A 3K5VA 3PA3A 4OT5A 5E92A 1W84A 4HCVA 1JNKA 4MQ2A 4R1VA 2WU6A 3ZZWA 5IA4A 3KCKA 4M67A 3HV3A 2Z2WA 5AIKA 3R9HA 1R3CA 3VUTA 4RIYA 3KQ7A 2XH5A 3V8WA 5I0BA 3UO5A 5AR5A 2J4ZA 3PY3A 5BMMA 5A6OA 3BLRA 4FTAA 2PVMA 4GH2A 4JR3A 5K0KA 3UQGA 5HNIX 4CG8A 2I0HA 4FYOA 5J95A 3R22A 1YI6A 4NW5A 4X2FA 3A4PA 4U8ZA 1BMKA 4DEHA 2IPXA 5AAFA 5M07A 2ZDUA 1H1QA 4Y95A 3WYXA 4FK3A 3UNZA 3FJQE 4IZAA 4WOVA 5D7VA 3ERKA 3DPKA 2GU8A 4O0YA 3MVMA 5EI2A 3WIGA 3HRFA 4C2WA 4L3JA 1CMKE 3UNKA 3LMHA 4I92A 2PSQA 2VD5A 4FKTA 3VF9A 2I1MA 4JT3A 3FZTA 5M53A 3W0OA 4ZTRA 5K0XA 4IEBA 4FSYA 4OTWA 2R7IA 3EFWA 5GJFA 4ZZOA 4FV0A 2WTVA 5FQDC 2VTOA 3CJFA 2YM6A 4MYGA 3OT3A 4X6QC 3MN3A 3WZKA 3TIYA 5A14A 2KTYA 1IEPA 3KMMA 4FTOA 4BDJA 2PHKA 4WBBB 2Y8OA 4OAUC 4CRLA 1WAKA 1KE8A 5JN2A 3H0YA 2WQNA 4UZDA 1BX6A 5IKWA 4MXOA 3RPYA 4A06A 5CNNA 4FG7A 2I40A 3RNYA 5CEPA 1Q3DA 2QQ7A 4JDKA 2JBPA 3MA6A 3WF8A 3HL7A 2X0PA 4RVMA 1BUHA 3UC3A 1UU8A 1W83A 3A8WA 4F7NA 2C1BA 5CAVA 4ACDA 3DK6A 4CLJA 4FSMA 4H1MA 5JFVA 3GU7A 5JFSA 3M11A 2PZIA 3OXIA 2VWVA 2XK6A 5KZ0A 4O7WA 3DB8A 5EM6A 3AC3A 3V5JA 1HCLA 4OTPA 1K3AA 3R0TA 3ZDUA 4FT0A 4AGDA 4GIHA 4QP8A 5HNBA 4A9UA 2BZKB 4W4WA 3NUNA 4FTCA 4U43A 2HIWA 3D94A 3OXTA 4NL0A 2I7QA 2HXLA 2C47A 3FMNA 3QUPA 2UVXA 1OIYA 3C4XA 3FZPA 5DLSA 5K5XA 3BX5A 4IWOA 2X8IA 3FYKX 3E3BX 3TT0A 3ZUTA 4FKQA 5KHXA 4RA5A 4RWLA 4DEBA 3HECA 5DR6A 3AD6A 4Z7HA 2R9SA 5LMKC 3PFQA 3CQEA 2WQMA 4OTQA 2CKEA 3RHKA 1RDQE 1ERKA 3HNGA 2C6TA 4RVTA 3E8NA 4MXAA 2JAMA 1REJA 4YJRA 3DKFA 1PHKA 1LP4A 5AV3A 3BKBA 4MD8E 3EOCA 4QMTA 4EJ7A 2WTKB 3ID6C 1OECA 3I4BA 4X2NA 5HI2A 3EZRA 1ZZLA 3COHA 3ZSIA 2ZVAA 3KXHA 2ZAZA 3R8PA 2WTWA 2WIHA 4JX7A 4PPAA 3PJ2A 4V04A 2W9FB 2FSLX 4IH8A 2WQBA 3QQHA 2WMUA 3SAYA 3EN5A 2E9NA 4IC7A 4RX7A 4F7LA 2C4GA 4BY9E 3SW7A 3FY2A 3ODYX 4JI9A 2JKKA 4WRSA 2J6MA 3E8CA 1KE6A 2JDRA 4TT7A 3RPVA 2PULA 5E1EA 4BDIA 2B7AA 5EH0A 3RALA 3E5AA 3ZSGA 2V22A 4JS8A 5DPVA 4GYGA 2WD1A 4CLIA 2WEIA 4X21A 5JZNA 5M08A 4OTRA 5D9HA 3FI2A 4FI1A 3SOCA 4ALWA 5C26A 2XK9A 3PVWA 4BVUA 3FI4A 1G8AA 4MUQA 3DKCA 5DMZA 4YPDA 4DBNA 3R9RA 5DOSA 3ZMMA 2C6MA 5TF9A 4LL0A 4EOLA 3G33A 4LRJA 2BDWA 4FTNA 4R5SA 5F95A 2QR8A 3PIYA 3Q3BA 4U0IA 5EDQA 4FKWA 3PP0A 1YRPA 2CSNA 1H1SA 5J79A 1U46A 1H1PA 1PXLA 3IPHA 1STCE 3ZLWA 5A3XA 4A4LA 5HIDA 2JLDA 4IHPA 2F7XE 1FVVA 2UW7A 3POZA 2HOGA 2BUJA 3E93A 5AV2A 4ENYA 5HTCA 4KKEA 4PP7A 4TYHA 5IH4A 3EQBA 4CFVA 2JITA 2QD9A 2UVYA 3OD6X 1M7NA 5HVYA 4XG6A 4FL1A 4ZJVA 4C33A 4UY9A 4CCBA 3TDWA 2WTKC 3EQDA 1Q97A 1FVTA 3BYMA 3CEKA 4O6LA 3H4JA 2WKMA 3UIMA 2WZJA 2W4OA 4NM0A 4KBKA 2XANA 1Q4LA 3LFQA 4KRCA 2BALA 2H96A 4QYGA 4EQMA 5GINE 4F6WA 3QHRA 3EQRA 4O21A 2YZLA 3WZEA 2DUVA 3BU3A 4I21A 1UWHA 2J2IB 2X2MA 1P4FA 3AGMA 2ETRA 5IISA 4S31A 4X3FB 3MFTA 2W17A 3F9NA 3Q96A 4XBRA 3ZUVA 4XRJA 3C51A 3S0OA 2Q83A 4YJSA 3RP9A 3GU6A 5F4NA 3D7TB 2WTDA 2LGCA 5AV0A 2CGVA 4E1ZA 4MEDA 3FPMA 3F2NA 4WO5A 5I9XA 3D5XA 2V0DA 4NUSA 5HICA 4PTEA 1XH8A 3G6GA 2ITQA 4EUUA 1LUFA 2F7EE 3PE1A 1ZOGA 3OS3A 2XNOA 3QUEA 4AGCA 4RVLA 3WF7A 3I7CA 4BDEA 5IQBA 2HY81 3BEAA 3EB0A 4DFBA 4TTHB 4L42A 4LV8A 3GCQA 3FXWA 4HGSA 5AFVA 4U79A 2JKMA 2WO6A 3CGFA 3JXWA 4U3YA 4WNOA 5J9LA 2YLFA 4I1ZA 4CV9A 4F9CA 3NFGB 4EJNA 1OKWA 4JAJA 3KXNA 4BCJA 4D1SA 4D9TA 1RW8A 5HO8A 1YHVA 2BRMA 2QR7A 3EFLA 4BJJA 4IVAA 4W8DA 2PVFA 3LJ1A 3KC3A 3PPZA 4IW0A 4MBIA 4NCTA 2Y0AA 3UG2A 5JKGA 4YLKA 3JR1A 2Q0BA 3LHJA 3QRUA 3ZFYA 4FNYA 4F09A 3UO6A 4HCTA 2R3MA 2VNWA 4FNZA 2VZ6A 4FUYA 4MBLA 5J9YA 3FEGA 4NCTC 4FEVA 3PZEA 3D5VA 3SXFA 4EK6A 5JT2A 4RJ3A 5K4JA 2JEDA 4OAVB 4ZP5A 4BI1A 5ANKA 4BCIA 4ANNA 2YITA 4XBUA 3K54A 3G5DA 1JWHA 4PF4A 5EW3A 2WMQA 5AUTA 5EQEA 3LFCA 2BFYA 4M7IA 3DKOA 3W18A 4ACGA 3QWKA 3ZH8A 1V0PA 4KSQA 4D5HA 2B54A 3MWUA 4IQ6A 5J87A 5LCKA 3LJ0A 5E7RA 1QMZA 3KL8A 2VWZA 2IW8A 1F3MC 1Q62A 3HV6A 3GU5A 4OBQA 5EI6A 3FYJX 4I93A 2ITOA 3P5KA 4DEIA 5BVKA 4BYIA 4C4HA 5LQFA 1OIUA 3NZ0A 5I3OA 5EHOA 3FI3A 3EJ1A 1ZYSA 4FZ7A 4BCPA 4HVDA 3DA6A 3UOLA 4NM7A 2OZAA 3DK3A 4BCOA 5BQ0A 2A19B 4GUBA 3P23A 4KSPA 1ZZ2A 4TWPA 4K6ZA 3PJ3A 4AW5A 4QOXA 1R0EA 4BWKA 5AR8A 4H39A 1K9AA 3GFEA 5I9WA 5A9UA 4EH4A 3ZTXA 4HGTA 4PNKA 4L43A 1OITA 3F88A 5T3QA 5M4IA 4L52A 3PSBA 3C50A 3G6HA 3R1QA 3W2RA 2OIQA 2C6IA 4FX3A 4USDA 4FV9A 4BGHA 3DJ5A 4JG7A 3ELJA 3LFDA 1ZYJA 3DOGA 2HZ0A 4JG6A 5E90A 1GOLA 3VJNA 4EONA 2RG6A 4NKSA 3IG7A 1OGUA 1XWSA 2B4SB 2XB7A 3HLLA 4YZDA 3W16A 2VWBA 4ZAUA 5LOHA 4EOJA 3CQUA 5BX0A 4FTRA 1CSNA 4DGMA 3RKBA 5IUHA 3E88A 4AFEA 4BCNA 3CTQA 2Y6OA 4G5JA 4UMTA 5HQ0A 3OCGA 3MH1A 4YJNA 2P0CA 3ZU7A 5B2LA 3UDBA 4AOTA 1PMVA 4WNPA 4E5AX 1UU9A 3FSKA 3ET7A 4ALVA 5HLPA 3OY3A 2RSVA 4LOPA 4IB5A 4AG8A 3CE3A 2O65A 4ACHA 5E8SA 4M15A 5GZAA 4S34A 2PVJA 5J9ZA 5I9ZA 5FDXA 4FTLA 4O81A 3KRJA 4O4CA 5CTPA 3TZMA 3FPQA 2VN9A 2ITXA 3P08A 3ZM4A 4K11A 4EEVA 1O9UA 3HUCA 4MAOA 2ETMA 3UVPA 2O0UA 3CTHA 2XP2A 1GAGA 2J50A 3JPVA 1VR2A 4JL9A 3GC8A 5AMNA 5I9UA 3BQCA 1AQ1A 4CFFA 3VBQA 4EUTA 4O38A 4BDHA 5ETIA 4BTFA 3IDBA 4LI5A 3TUDA 4L7FA 2YAKA 5CVGA 2R3NA 5BUJA 4ERWA 5KMKA 5ANEA 2YM3A 5IEVA 5KUPA 3OBGA 4GU9A 4XJ0A 4C36A 4BI0A 4FOBA 4F65A 4YHTA 3PDTA 5IQGA 4IDTA 1M2RA 2WGJA 3VWAA 1J7IA 5CAOA 3UZTA 4IAIA 3R02A 2Z7LA 1PRYA 5AUXA 3QALE 3AC2A 2IO6A 3GXLA 2X0GA 4QP4A 3IOPA 1FMOE 5H3QA 2JGZA 3G9NA 1YQJA 1OL6A 3EZVA 1SNUA 3W0QA 4YSMA 1QPDA 4UYAA 4MWHA 4MCVA 1WVYA 4TRLA 4D4RA 4B6LA 2VO3A 3R7IA 2QOFA 3C0IA 2CPKE 4IWPA 3LQ5A 1ZYLA 4GVJA 4AZSA 2PZRA 4YLLA 3EKKA 3IKAA 4ACMA 2CNUA 3F2AA 3I0QA 4RIWB 5LCJA 3LQ3A 4D2PA 4ZSLA 3SOAA 4O83A 4G31A 4TN6A 4WNKA 5HCZA 2YDKA 3HGKA 4QMPA 3RBWA 5AP2A 2WMVA 3FLWA 3JY0A 4PDYA 2E2BA 1YWVA 2VX0A 3BGPA 3KN5A 1Q8TA 4JVGA 2AC5A 4XUFA 3PXRA 4FV5A 5CZHA 4ORKA 1W82A 4AT5A 4NW6A 4YZMA 2IVUA 4J52A 4BHZA 1NT2A 4EOMA 2PK9A 4DDIA 4DG3E 5HE1A 4C02A 4AWIA 4CZTA 4DFLA 1OGYA 2NRUA 2OXXA 2CDZA 3QTQA 3ZFXA 2HWOA 3ORKA 3C9WA 4FSRA 5CF8A 1ZOHA 3L9PA 3PXKA 3NUSA 5I3RA 4I23A 3TUBA 4RLLA 3QTRA 2FO0A 1JSTA 3QX2A 5TE0A 3UGCA 5B2KA 4G3DA 4IXPA 2QOKA 2VWUA 4XG7A 3C5UA 1HOWA 2G01A 3GT8A 2O64A 2PVNA 4IADA 3UPZA 2IZSA 2UW4A 3NYXA 2VU3A 2VTRA 2YIQA 2YM5A 3QA0A 3SG9A 4AXFA 4MXCA 1VEBA 4LRMA 3QQJA 1G3NA 1WCCA 3DK7A 3OWKA 3EYGA 1MP8A 1XQZA 4FV3A 4Z9LA 1MQ4A 4N6ZA 2OJ9A 5AP1A 3P1AA 3QD0A 4RIXA 2WOTA 3BHUA 4PDSA 2CKOA 3EMGA 3NNVA 3NUYA 4MH7A 4MBJA 4TW9A 2ZM3A 4IJ9A 2H34A 2OXDA 2XUUA 3MB7A 2QCSA 3PWDA 3E62A 3O23A 4YNEA 3FMHA 4BIDA 1GZOA 4EH7A 4FIIA 3V3VA 3WI6A 2W96B 4E93A 2O8YA 1KOAA 4FIEA 5F1ZA 2P33A 2A4LA 3PA4A 4ZOGA 3LFAA 3W32A 2BR1A 3GBZA 3VS7A 3WE4A 5CYIA 1Q99A 1OIQA 3ML1A 3M2WA 5D1JA 4BL1A 4PY1A 3NW5A 4W8EA 4NIFA 5CU3A 5C4KA 2O2UA 1WBNA 1YDTE 1DAYA 4G1WA 4JIAA 3WILA 4EOIA 5JGAA 3KRRA 4LOQA 4PPCA 5FD2A 4TL0A 2C3KA 5HG8A 4MD7E 3AMAA 3MY1A 4YUQA 3A7GA 4G3GA 2WHBA 2XARA 3P7BA 4DG0E 3TTIA 4AZWA 4I5PA 4M66A 4LMNA 2BRNA 3VS1A 2UVZA 3KK8A 4FT5A 2R2PA 1SMHA 2J0KA 2BZHB 4F7JA 4TYGA 5GIOE 5ETFA 3O8UA 2ONLA 4U41A 1PXPA 4FVPA 2XNBA 4JIKA 5HU9A 5AUVA 3Q5IA 4EQCA 1PMUA 2BDFA 3PYYA 4OBOA 3AMYA 3OCBA 3CS9A 3DDQA 4FTQA 2HW7A 4IM0A 2J7TA 2XRUA 3QAME 2Z7RA 3FL5A 5AAEA 4D9UA 4O0XA 5AR7A 2YCSA 2YFXA 4ONAA 2B53A 3R7VA 2YCRA 2UZLA 1Z5MA 3VQHA 3WZJA 2XA4A 4RRVA 3PRFA 4DC2A 5EM5A 3IW8A 2PVYA 4OTFA 5A6NA 5IZFA 5BV3A 1W2DA 4BRXA 2QO2A 4XG8A 1WZYA 4R3RA 5HE2A 3Q9ZA 4D55A 5BMSA 3NRMA 2UZEA 5AP6A 1Q8WA 3V6RA 4FZ6A 3V8TA 3AGLA 2IZTA 4ALUA 3HAMA 1PJKA 1H08A 3NNUA 4Y73A 3PUPA 3RI1A 3QD3A 4MXXA 5CI7A 4F9YA 5HX8A 5L6OA 4O2PA 2QONA 4JG8A 3CIKA 3RVGA 3ZONA 4CMTA 2VX1A 5E9EA 3SHEA 1ATPE 2ZYBA 5LARA 3MA3A 3B8QA 3P0MA 3R7EA 3EQFA 3MW1A 3DBFA 1L8TA 2PVHA 4FIHA 1WBVA 2GNIA 3KK9A 4LMUA 4FKIA 3BLQA 3HKOA 3IDCA 3VQUA 4IX5A 5H8EA 5E8WA 3CQWA 4Q5HA 4X7QA 4LGGA 3GCSA 1URCA 2R0IA 3OTVA 2XMYA 1XR1A 2IVVA 2VUWA 4BZNA 3FMJA 2FSOX 2IF8A 3NYVA 4TNBA 2NNWB 2C5VA 3EL7A 4L44A 1JPAA 2BAJA 3KXGA 2YM8A 4USEA 3ZLSA 2IN6A 1B6CB 4F9BA 3C0HA 3KF7A 5AP0A 1YW2A 5KHWA 4L46A 5G6VA 3BWFA 4XG4A 5AR2A 3F3UA 3UQCA 4AZVA 5JFXA 1QL6A 4O4EA 4YO6A 3ZSHA 4YO4A 1Q3WA 3DJ7A 5CALA 5K4IA 2CNVA 3IW6A 4PDPA 4O6EA 4RX9A 3KFAA 5D7AA 5K3YA 2RFSA 1W8CA 3ORIA 5DR2A 5A4QA 3IW7A 2FH9A 5E8UA 4DFZE 4F6SA 4XEYA 4O91A 1YHWA 5TR6A 3N51A 2BRHA 3R1YA 4FTMA 4I0TA 5HKMA 3ZLXA 1I09A 4Z3VA 4FA2A 1JOWB 3CGOA 3DNDA 1OKVA 3AC5A 2WMAA 5AX3A 2GNLA 2OSCA 3NAXA 1ZMWA 4KB8A 5IEXA 4IMYA 2VTPA 4KIOA 5L2IA 2R7BA 3A61A 4QP9A 3FHRA 2DS1A 1Y6BA 4UZHA 2QURA 3IO7A 4BCFA 1OPJA 2ITYA 2REIA 3NLBA 3KU2A 4IANA 3TZ7A 3LAUA 2YN8A 1XH7A 4FT7A 5CNOA 3OOGA 3WIKA 4ZS0A 2VWWA 3FZSA 3QFVA 4DHJA 3LE6A 3BYUA 5AR4A 2OZOA 3R8ZA 4B8LA 4DTKA 4Y8DA 4ENXA 2PZ5A 2CLXA 4DEGA 4UB7A 3GU4A 4D58A 3HYHA 3EFJA 3CD3A 4F1TA 3R2YA 3S1HA 4E5WA 3ZYAA 3QWJA 3PVGA 4BYJA 4AF3A 3TKIA 4AXDA 2O63A 4WSYA 1IA8A 5FBOA 3AD5A 5BVFA 2AC3A 2AQXA 2RG5A 3FAAA 3PVUA 3QQLA 4UALA 5JRSA 3W0RA 4I6BA 4K77A 2VTQA 4TPTA 3RZBA 2YABA 4BCKA 1M7QA 4E20A 3BV2A 4P90A 3DJ6A 1U59A 1ZXEA 4R3PA 3DNEA 5KE0A 4HNFA 1P5EA 4LGHA 4YR8A 5HTIA 4IZ7A 3HV7A 4FV8A 5HBHA 3MI9A 2QKRA 2B9JA 3BEGA 3CCNA 2R3OA 3OZ6A 4PPBA 3UTOA 4Z16A 4W9WA 5KZIA 4FV1A 2OFVA 5IQHA 5HU3A 1S9IA 2JDOA 2PZYA 2BTRA 4FL3A 4OT6A 4YJVA 1U4DA 2BAQA 5ANGA 4FTJA 4AW0A 1A48A 2XJ1A 2XK4A 2RKUA 2UW5A 4GSBA 4M0YA 3DCVA 1GIJA 2GFCA 4RZVA 2CCIA 2GS2A 3FWQA 3QL8A 3ORLA 1B38A 4EH3A 4RT7A 3UOHA 3FC1X 4DCAA 3TV6A 1IAJA 2QOQA 4TWOA 4XRLA 3R9DA 4A4OA 3OROA 3E8EA 4I6QA 4AA4A 4F70A 1H00A 1L3RE 3PXQA 4YNOA 2BPMA 2EB2A 1TQMA 3NUXA 4GW8A 4YTIA 4G6NA 4B0GA 4EHZA 4O1OA 3KY2A 2WEVA 2PMIA 3T9TA 3QZGA 2QOLA 5H2UA 2PUUA 3ORTA 4L8MA 4BDDA 3F6XA 3M1SA 2UZWE 3D15A 3I5NA 1YKRA 5EDPA 4BIBA 3LLAA 3N4VA 3DGKA 5BYLA 2OI4X 1VYWA 5FTOA 4DG2E 4HGEA 3UZRA 4YZBA 4BCGA 5JRQA 3ZOSA 5CANA 4BB4A 4WG5A 3PTGA 5C01A 4F78A 1R0PA 4RIXB 1REKA 3VF8A 3NUUA 1FVRA 1G8JA 2X2LA 3TDVA 4O0VA 4KNBA 4F7SA 4QMYA 3ZLYA 4XV1A 1OL2A 4FV7A 1ZLTA 4IJPA 4YURA 3OW4A 4L9IA 5BVWA 4JDHA 2JDSA 4RVKA 4B4LA 2PVLA 2R5TA 3UPXA 4PL3A 4J8MA 4AU8A 4EYJA 3AKKA 2XIYA 5BYYA 1Q5KA 2V7AA 3TZ9A 2R3GA 2ITZA 2XKFA 3DLSA 1QCFA 5F94A 2W5AA 5AADA 5BVDA 3UVRA 3T3VA 3FMDA 3LZBA 4FG9A 4I5MA 4FIFA 2X8DA 5E4HA 3EKNA 5CAUA 5KMNA 4EORA 1Q8ZA 4BBEA 3FLQA 3A7JA 1JSVA 4RFYA 4IVCA 3LXNA 1FOTA 4FICA 5T6KA 5B0XA 3BHYA 3L8PA 5AUWA 5CAQA 5HESA 3FKOA 4QTAA 3NCZA 5JEBA 1RQQA 5DR9A 4FJVA 4OW8A 2W1HA 4E73A 3PG3A 3SLSA 5IA5A 1YXTA 2W1DA 3P9JA 5CQUA 3VBXA 4ACCA 3VHKA 2RF9A 4CV8A 2Z60A 3P7CA 4J71A 3LXLA 4FL2A 3I81A 4JQ8A 4AXEA 3GFWA 4EK8A 3N4UA 3RK5A 5J1VA 2VV9A 4HNIA 3BU5A 2VGOA 3KXZA 3L9NA 3HV5A 3TJCA 3V6SA 3ORMA 3JS2A 4IX3A 5TO8A 2VTHA 2X39A 3WF9A 5FDPA 2R3HA 3O5AA 2JDVA 2JKQA 5CU2A 2DQ7X 3UIBA 2GHGA 1DI9A 1DM2A 3BHTA 2JAVA 3I7BA 3FXZA 2ZFYA 1E9HA 2BIYA 4C4FA 2W4KA 4BKYA 2XIXA 4FGRA 5I9VA 4BWXA 1UVRA 4LM5A 4LRKA 3WE8A 1YOLA 4OBPA 5IF1A 1JKKA 4GMYA 2Q0NA 5ETCA 3UODA 3CSVA 1OL5A 1KE5A 3D2IA 3H3CA 2OJFE 3SD0A 3ZC5A 3ZS5A 4PMSA 5EYKA 4A9RA 5DYJA 1FBNA 2RGPA 2CGUA 5CSXA 5HIEA 1V0BA 3HMPA 3Q4ZA 2OJJA 4CMUA 2BFXA 3LW0A 5H8BA 1FPUA 3PZHA 3SC1A 4U9AA 5FTQA 4QDVA 2W99B 3SA0A 3D14A 4EC9A 4F1OA 5EQYA 2C5OA 5FP6A 3IW4A 2IG7A 2C5YA 1A06A 2X9EA 4Q9SA 3W33A 3ALOA 3RINA 5DGZA 4DINA 3RM7A 3IQ7A 3QRIA 3WARA 4CKJA 3EN6A 4GJ2A 5FGKA 3MVJA 5A54A 2QG5A 3DFCB 4RBLA 1MUOA 3CY2A 5FEDA 4U45A 1QPEA 4RJ4A 3R1NA 3ACKA 3PRIA 5AP5A 4ZSEA 3U55A 4NWMA 3HMMA 3HRCA 2PZPA 3I79A 3QC4A 3Q5ZA 4MXYA 2EXMA 1PXMA 5DI1A 5HD7A 3F82A 3F3VA 1PMNA 3HX4A 4G2FA 4UX9A 1PXNA 3EN9A 4R5YA 2X7GA 2VTJA 3NNXA 1CDKA 3P78A 2X0OA 4TYIA 4WT6A 5GZ9A 2PUPA 2ITVA 4EBVA 1B39A 4NEUA 3BELA 2HK5A 4GG5A 2LAVA 1BL7A 1OUYA 3BHHA 3BU6A 4JRVA 4WHZA 3OWJA 1TVOA 4UBAA 5HVKA 1VLRA 5B2MA 3BWJA 3LM0A 3FMKA 3CKXA 2C0OA 3KCFA 4I94A 4CXAA 2Y6MA 4XYFA 4QTBA 4ZY5A 5E1SA 5J5TA 4CYIA 4C34A 2YDIA 4PRJA 3KXMA 2XNMA 3LFBA 3MFRA 4ANBA 4MXZA 2Y7JA 4H3PA 4ZTLA 2ITWA 4I20A 4H05A 4GUEA 3GQLA 4J1RA 2GHLA 2GMXA 3R8MA 4NU1A 5D10A 5CWZA 1H01A 1PXJA 4FSTA 2PMNX 4QT1A 3UDSA 4HJOA 5CASA 1YOMA 3N9XA 2QU5A 4RWKA 2UZVA 4AUAA 5IQEA 3AC4A 3FXXA 3Q52A 1IAHA 4N70A 2NO3A 3AT3A 3QKLA 4I0SA 4Q9ZA 5KO1A 4RC4A 2GNJA 1WBWA 1XJDA 5CSPA 4I22A 4IZ5A 4R1YA 4AAAA 3F66A 4BKJA 4DTAA 4O0WA 5EW9A 1LPUA 4GK3A 2HENA 3NPCA 2ONLC 4PMPA 1MQBA 4F4PA 5FRIA 3VJOA 5IQIA 5E91A 4FSQA 4DN5A 4PMMA 4Y5QA 4AOIA 3IK3A 2WNTA 4NTSA 4P5QA 3SX9A 1ST4A 3DBCA 4AA0A 3ALNA 3GP0A 1UV5A 2A2AA 4L00A 4QDEA 5HBJA 2UZOA 2X81A 4ZZMA 3KKVA 4E6QA 2X8EA 4J7BA 3QTWA 3AQVA 4QYFA 1YDSE 2VWYA 3H10A 2C6OA 1OZ1A 3QCXA 4QRCA 3TN8A 4FKPA 4KAOA 2X0QA 2H6DA 2F57A 3DV3A