4PDSA

Crystal structure of rad53 kinase domain and scd2 in complex with amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
300
structure length
249
Chain Sequence
TGIFKDFSIIDEVTVKKAIERTTGKTFSVKIIVTRELEVLQKLNHPRIVRLKGFYESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITAFGLAKVAYVAPEVIRRNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLSYGDFSQISLSQSLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase RAD53
publication title Structural basis of Rad53 kinase activation by dimerization and activation segment exchange.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 69
structure length 249
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pdsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdsA01
4IAYA 3OT8A 2PZ5A 5HD7A 4JIAA 4FMQA 2BDFA 3KF7A 3FYKX 3ORIA 2BZJA 4GFGA 5HCXA 4FK3A 3WIGA 5IQHA 4R5YA 5HKMA 2QLUA 4MCVA 4JDHA 4IBMA 2VTMA 1FMKA 2BZIB 4BDKA 2YISA 4S32A 3ZSHA 1Q8YA 5JN2A 5BVKA 5ITAA 3AC2A 3BHUA 3S4QA 3MVMA 4KS7A 2ZV9A 2YLFA 3BLRA 4LM5A 3UMWA 4BWKA 4O7RA 2J9MA 4FV2A 4AS0A 5AA9A 5CALA 4OBQA 5J9YA 2YM4A 3HA8A 4FZ6A 4XLVA 3WZEA 1FGIA 5AV4A 5M09A 3A2CA 4FZAB 3EQIA 4P2KA 5LCKA 3ZFYA 4YUQA 3LE6A 5EM7A 2BTSA 2W5AA 4RBLA 4GJ2A 2E9NA 1ZAOA 1Y6BA 2B53A 2X1NA 5T6KA 5FUTA 4IWPA 4CXAA 3VVHA 4PP7A 3A62A 1KE6A 4FC0A 3SG8A 5DR2A 3RPVA 4I21A 3JY0A 4FTOA 4X2NA 4DF3A 4M69A 4O0YA 1YXXA 3DK7A 1Z9XA 5ANDA 4GIIA 4HYHA 2JFLA 3PFQA 5K3YA 3VQHA 4ANSA 4A9SA 2WMRA 1Q24A 2QOLA 4IB1A 5JFWA 4TT7A 4XYFA 4O6EA 3B2WA 4GU9A 5M06A 3QTQA 2H6DA 4BN1A 4WUAA 2BIYA 2WQMA 4K11A 4NKAA 2C5OA 3MH1A 4KIKB 4ZK5A 4QMNA 5AUTA 2JDTA 4MQ2A 4O7SA 4PWNA 4LG4A 4RJ8A 2ITYA 3EJ1A 2J2IB 3UIUA 5HO7A 3BV2A 4YHJA 3N9XA 3FYJX 1TQIA 1U5QA 2PVFA 3ALOA 3Q53A 4X21A 3ZH8A 3GT8A 3FMNA 3P9JA 4FKSA 1PYEA 2GS2A 5JH6A 3OFMA 5CF8A 4FNWA 4YTIA 2BRBA 1DAWA 4M3QA 5ACBC 3LAUA 5AFVA 3DNEA 4GK2A 3TUBA 4W4XA 3IONA 2Z02A 4D9TA 2J0KA 1PF8A 4Q5HA 3UOKA 2QC6A 1E1VA 5FM2A 3EKNA 4GMYA 4RT7A 3NCZA 2XS0A 2ITQA 1GAGA 2OG8A 3E92A 5CX9A 4ERKA 5E8YA 5L2QA 4ANOA 3R7IA 4O7VA 2HOGA 2OFUA 1JPAA 2VNYA 3FQSA 4HZSA 2OICA 3SXSA 2XNNA 4F6WA 3DTCA 3D5XA 3E5AA 3OW3A 3SQQA 5AUZA 4FTAA 2QOBA 3LXPA 3MH3A 4BKZA 4IZ5A 3UC3A 3ZEWA 5AADA 3QTSA 3MA3A 4EJ7A 4WHZA 3UP2A 3VUMA 1J91A 2HCKA 3PVGA 2X7FA 4DEIA 5CF4A 4PTEA 4X7QA 3EFKA 3HMPA 5FQDC 3DTWA 4EK3A 1OI9A 4APCA 4I5HA 4C8BA 2SRCA 4BB4A 5HO8A 3NNUA 3F6XA 2PY3A 4FTRA 2WAJA 2FH9A 4BKYA 3F3ZA 3C50A 3M1SA 4I93A 5FEDA 4A9TA 2Y9QA 3ACJA 3NPCA 4XP3A 2LAVA 4ANNA 4ORKA 5CT7A 3AD6A 4QMVA 4XV1A 2XM9A 3FHIA 4YZMA 3D4QA 2XIRA 4RVTA 3EN7A 3OY3A 3QHRA 4PPCA 3PA3A 3FMMA 4QNYA 5B0XA 2PU8A 5CZIA 5A4CA 3LFSA 2H96A 3R22A 3HP2A 2VN9A 3BGQA 3O96A 4KIPA 2RIOA 3V5WA 4AZEA 1H28A 4M15A 4RFZA 3Q4UA 1PXJA 4FR4A 4FOBA 1X8BA 3R8LA 4BGQA 2XNGA 3HV6A 5LWNA 4C02A 3ENHA 5KZ0A 1Q4LA 5LMKC 3OCTA 2YACA 4LL5A 2YM3A 3P7CA 4NSTA 2UZTA 4KIOA 4EK6A 3OP5A 2PUUA 1STCE 3VNTA 1CM8A 3BEAA 3IW8A 4I4FA 5CAVA 4ACCA 5CZHA 3C5UA 4EOLA 3V8TA 4CT1A 3POZA 1PMNA 1GJOA 3PJCA 4FKQA 4N0SA 3UNKA 5IQIA 4O6LA 2PHKA 2VTAA 3EQFA 4L43A 1YOJA 4MNEA 4WG5A 3HGKA 4AXAA 4PDSA 4GV1A 3R04A 3W2QA 3B2TA 1WCCA 2UVYA 4BC6A 3DLSA 5M07A 4YZDA 5FXSA 1ZYSA 1EH4A 1MQ4A 2QO2A 2C30A 2DS1A 2H9VA 5CSWA 1GIIA 4BCOA 3NX8A 1GZNA 5B2KA 2BRNA 3LXKA 1XBBA 4QP6A 4KUJA 4JBOA 3P7BA 4B8LA 2Z7QA 5K4IA 3BU3A 4XV3A 3PUPA 3V6RA 4MKCA 4LL0A 3FY0A 2EVAA 2G1TA 3VBXA 3T9TA 5BVFA 3OS3A 3KEXA 3ZCLA 4I20A 1ND4A 2IN6A 5CEMA 4IB5A 5DI1A 3O8TA 4OT5A 4IDVA 4FKJA 4ONAA 4WRSA 5KZIA 4CMTA 3I5NA 3LFFA 5E8WA 4HPUE 1WBNA 2OI4X 5DGZA 5BQ0A 4GYIA 3TTIA 3ZO2A 2YCFA 4E3CA 5LVNA 3I0QA 3D14A 2HIWA 3GOPA 3KRRA 4M68A 3FL4A 5BYZA 5A4TA 5CVFA 3LQ3A 3LLTA 3UODA 1JOWB 3ANRA 3FHRA 4WBOA 4R1VA 2IZTA 4L6QA 3CE3A 2ZV2A 4CKRA 3UPXA 4G17A 3MDYA 4HNIA 4IEBA 3ANQA 5DT3A 4KAOA 3HV7A 4MF0A 3PSBA 3CGOA 4AFEA 4K0YA 4C2WA 5AP2A 2E9VA 5JEBA 4EKKA 3F2RA 4E93A 1QMZA 4FI1A 3G33A 3THBA 5HE2A 4L3LA 3LHJA 3ORLA 4U9AA 1RJBA 4DLIA 4XX9A 1XJDA 3DKFA 4CEGA 5I9XA 2ZOQA 5HI2A 1Z57A 3U4WA 4D58A 4BGGA 4G3GA 2I0VA 1KE9A 4BDIA 5J7BA 5KCVA 4JX7A 4FSMA 2G2FA 4DFUA 4IVCA 1RE8A 4F9YA 3FZTA 4E73A 2CLXA 3LCTA 4DGOA 4IADA 2WMQA 2YCRA 1YVJA 3OXIA 4BTJA 4E1ZA 4FV6A 5EDPA 4UMRA 3HV5A 3VW6A 3RCDA 4F9AA 2CCHA 4FSUA 3RK5A 3GUBA 4FV9A 3UP7A 2C6LA 1XO2B 1IRKA 1Y57A 4WUNA 4CFUA 1KOAA 2QOKA 1V1KA 4S34A 4UWYA 5JGAA 3KMUA 5L6OA 4B0GA 4F9CA 4ZSLA 2VTRA 2HWPA 4NW5A 4BRXA 4ZSGA 3LM5A 2YABA 3KKVA 3QA0A 4KSPA 4BL1A 4D2VA 4I0SA 3W32A 1ZMUA 4ZMFA 5J9ZA 4QYGA 1LEZA 2UW8A 4JNWA 2WIPA 3VRYA 2J51A 4YJVA 4EUTA 5K9IA 3QL8A 4LGHA 3CBLA 2JIUA 4AQCA 4TWCA 4AA5A 3R83A 3F5GA 2X7OA 4GT5A 3OXTA 4UB7A 3NUAA 4ZTSA 1J3HA 4PV0A 4ZJJA 3CTJA 4D1SA 2X7GA 5AX3A 1H1QA 3IDCA 3FLYA 4G2FA 4FV0A 3CLYA 5AUUA 4ZMEA 2VO6A 1L3RE 5M4IA 2BUJA 4HCUA 3RJCA 5H8GA 4XG3A 4EWQA 3EQRA 2VTIA 4RJ7A 3SGCA 2KULA 4L44A 5EKNA 5LJJA 2C5YA 3QUEA 4TWOA 2CNQA 4DH7A 3ZO3A 1QPCA 2ZM3A 3QZGA 4GK3A 3QGWA 3UOHA 5HBEA 4FSYA 1BL6A 4IM2A 4NJ3A 3DB6A 2JAVA 4BCNA 3E63A 2Y6OA 5CU3A 1SZMA 3RPSA 3F2AA 3I6UA 3TDWA 5EK7A 4RZWA 3R1SA 3VUKA 1APME 4E5WA 2WEVA 4R6VA 1GIJA 3JVRA 4LI5A 3GNIB 4XCUA 2VUWA 2R3QA 4QPSA 3LM0A 3RP9A 4B8MA 4O81A 5AV3A 5GZAA 4WO5A 1M2RA 4JS8A 4R3CA 4V05A 3MH0A 2XKDA 2VAGA 3GCUA 3TNWA 2GNHA 3QX2A 4Y85A 3JUHA 4FK6A 4JQEA 4UWBA 4AN2A 4C4FA 4XG9A 1IAHA 3QRTA 1DAYA 4AGDA 3HV3A 3TG1A 4IW0A 4FG9A 2CDZA 3FMKA 5EI8A 2R3OA 4ANMA 2YERA 3VBYA 2E2BA 3HP5A 5HNIX 5GJDA 3EFLA 1BI8A 4FVRA 2HW7A 4YZBA 3SXFA 5J5SA 3WOWA 3ZLWA 2OKRA 3Q9YA 4OTRA 5K5NA 3OF0A 1R39A 3UOJA 4AZFA 4HNFA 2QU5A 5IQGA 3F61A 4WNPA 1OKVA 4GT3A 4BDFA 2WZJA 2C5XA 3LFCA 2CN5A 4KSQA 4QMPA 3MIAA 4Q2AA 4ANBA 3GU7A 1XH5A 4MVFA 2HK5A 5EOLA 2OK1A 4ZS0A 2J50A 4A06A 5KBRA 2CPKE 4L3PA 4IWDA 4WG3A 2VWVA 2WMAA 2P4IA 3DBCA 5HICA 4AW0A 4YSJA 3LMHA 3ET7A 2QU6A 2XP2A 3R1QA 5M4FA 1BI7A 4FUYA 4I5PA 4HZRA 1JAMA 3UMXA 3I6WA 5CTPA 3L1SA 3JR1A 2XJ2A 3RKBA 3R1YA 2BKKA 5DYJA 2R3LA 4D4RA 2YCQA 2RG6A 5M53A 5HOAA 5AR3A 4EZ3A 1W84A 3Q4CA 3SOCA 2RFSA 3IKAA 3MWUA 3BWJA 3MGYA 2OZAA 3FSFA 4MF1A 2YHVA 4LYNA 2ACXA 4QP1A 5HO6A 4C4JA 3GC7A 5LVPA 2VTOA 3HNGA 3F3TA 3K5UA 1FPUA 5E91A 4ZZNA 3DFAA 1UU3A 2Q0BA 4FSZA 4IVBA 4OTWA 5EOBA 5CU6A 5C27A 3RZFA 3S3IA 1YDSE 2GTNA 4Y5QA 5CAUA 5IA1A 4ZTHA 4FYNA 4QYEA 2X0GA 4FTTA 3NYOA 5FTQA 3HMOA 1ZOEA 2WMBA 4BHNA 4XH6A 3UYSA 3SA0A 3EN4A 4XG6A 2BALA 5C26A 2JKMA 4YZCA 4QTEA 2CGUA 5KKRC 4PMMA 3FUPA 4FG8A 1UNHA 4X3FC 4FIFA 3D7ZA 3Q6UA 3QQGA 3W2OA 5JK3A 4GW8A 2CGVA 3HECA 4EHVA 1SVHA 2CKEA 2YDJA 1URCA 2XK4A 2O2UA 4AW5A 3DLZA 3CY3A 1P2AA 4W4YA 2C1BA 4XRLA 2WTWA 1YDTE 3MV5A 3R2BA 2GSFA 4QP9A 5F9EA 3KGAA 5AP3A 4CZYB 3LFAA 1OITA 1K9AA 2GHLA 3ODYX 3O8UA 4DFYA 1S9JA 3Q9XA 5FD2A 1Y6AA 3TACA 5AM6A 5C03A 3NVMB 3HZTA 2YIWA 3CPBA 3DS6A 1OVEA 1KOBA 4EONA 2ETRA 3TUDA 4D1XA 3OUNB 3NEWA 3QD0A 5DOSA 1L8TA 2BFXA 2ETMA 2JGZA 2QG7A 3HLLA 4YHTA 4DT9A 3VS2A 2XBJA 4QOXA 5A4EA 3KXHA 4Y5HA 3VBTA 3FKLA 3PIYA 1MRVA 2QR7A 3FC2A 4PDPA 1OPKA 3BLHA 4WKQA 3G6GA 3SD0A 1NXKA 5CS6A 3NCGA 2WTDA 5HVYA 3ODZX 4BCKA 4TWNA 2WMUA 2RFNA 4IM0A 2OXYA 3EMGA 3P4KA 4YJSA 4DEAA 5HG8A 3U6JA 1O6LA 5C8KA 4QTCA 1JWHA 2VO3A 1KV1A 4KIKA 3O7LD 3KK9A 3LW0A 3NW5A 3UTOA 2GNIA 4BICA 3H0YA 3KULA 2REIA 4QP2A 3PSCA 2RSVA 3Q5ZA 5JFSA 1GNGA 3VS1A 1ZXEA 2JBPA 3IGGA 5CI6A 3MI9A 5C1QB 3QZHA 1GZOA 5C8NA 2IW9A 3FBVA 4WD5A 3U87A 4H58A 3OMVA 4D4VA 4F64A 3C4EA 3DK6A 5EYDA 4MK0A 3S1HA 3R8PA 5BYLA 1PXKA 4CTCA 5HIEA 2YWVA 5DG5A 2XEYA 3LPBA 3GC8A 4WSYA 5ANGA 3W2RA 4BCHA 2QQ7A 2HELA 4JRNA 3KRXA 3HA6A 3IQ7A 3DGKA 4F70A 4D5HA 4KBKA 1ZYLA 2W1ZA 3LQ5A 4EBWA 2V5QA 4LMUA 1JKKA 3NSZA 3T3UA 4BDAA 4RPVA 3MVJA 2C6KA 2IW8A 1CMKE 4M7IA 5AUYA 1YXUA 3EQHA 3EN5A 4DLJA 3G0FA 5IQDA 4FX3A 2W96B 3E7OA 1YI4A 4EOKA 2QVSE 2VWYA 1SVEA 4RWLA 2IVSA 1UU7A 3O8PA 1M14A 2UW6A 4U97A 3ORKA 3SV0A 3PTGA 3LCDA 5HHWA 4KKEA 3B8QA 4A4OA 1IAJA 2FA2A 3BE9A 4I4EA 4K8AA 2YWPA 4W8EA 1GZ8A 3UO5A 3HRFA 2CKPA 4WBBB 4QYFA 5LVMA 4D55A 4WOVA 3EB0A 3GBZA 2QOIA 2XCKA 3IW5A 3U9CA 4E7WA 4RX8A 3TNHA 3P1AA 3UZPA 4OT6A 1H25A 1OB3A 5AIKA 2HW6A 4PDYA 1SM2A 3VRZA 5HNBA 1W0XC 3WYXA 4YBJA 3LFBA 3VIDA 3N4UA 3MPMA 3KRJA 4BYIA 3KA0A 4PQNA 3BELA 2VTPA 5HZNA 4ITJA 3SXRA 4YURA 1IG1A 3MW1A 3F9NA 2IZSA 4AOJA 2ITUA 3LFDA 4XBUA 4FG7A 4NEUA 4F7SA 4GT4A 2XK9A 5FG8A 2QI8A 5CAQA 3BHVA 3QWKA 5HBHA 2JC6A 3BQRA 3W8QA 1ZY4A 3EIDA 4K6ZA 5HE0A 4C4IA 4G3FA 2A19B 5DPVA 3WF6A 2PVYA 1H0WA 2CN8A 4FT0A 2PTKA 4GIHA 5D7VA 3VO3A 3BU5A 4UYAA 4DEBA 2ITOA 3FPMA 3QCQA 4NCTC 5CWZA 4UMQA 4EOSA 3HL7A 3PVBA 4BHZA 4F63A 1FINA 2XJ0A 3MESA 4JOAA 3NNXA 4NCTA 4QYHA 3KXMA 3QQHA 5EFQA 4DFZE 3P86A 1U4DA 3W8LA 3ZOSA 3V8SA 4FT3A 3U55A 4APPA 4DG2E 5L2IA 5EI2A 3CTHA 2R3RA 5KNJA 1AQ1A 2X6EA 2Z60A 3OVVA 2BTRA 2YAAA 3KL8A 4ACMA 4IVDA 5EHOA 4FIIA 4J99A 4O0VA 3QTRA 3CJGA 5CSVA 5LVLA 4C34A 5IQEA 4DGNA 3ZLYA 2OSCA 2XK6A 4G31A 4OW8A 2VV9A 2HZ0A 4TYIA 1GOLA 1DS5A 3JVSA 1Q3DA 3A7JA 4HVSA 5BUEA 4QMZA 5E8TA 5L6WL 1Q62A 4J97A 5E92A 3G0EA 4A4XA 3LIJA 4U8ZA 1FBNA 4PPBA 3OC1A 4PNIA 3TM0A 1Y8YA 2AC5A 2RGPA 2YDIA 3A7HA 4R1YA 2B9JA 3HKOA 2XKCA 3QYWA 4UX9A 2BAKA 5AP5A 3DBQA 4R8QA 3WZJA 1KUTA 4O0UA 4U44A 2VWXA 4X2GA 5HIDA 4A4LA 2CSNA 4GU6A 4ALVA 3TIYA 4X6RA 4IJPA 4XJ0A 3DAEA 4ZEGA 4TPTA 3ORTA 1FQ1B 4RSSA 5HVKA 4EH4A 1OKWA 4FBXA 1ERKA 3DAJA 3ORPA 4FIGA 1CTPE 4M0YA 3BCEA 4LGDA 3O71A 5LXMA 4QP7A 4WNMA 3L8VA 2WTKC 4IHPA 4NW6A 4EYMA 3DJ7A 2XMYA 2YIYA 3JXWA 3P79A 4M84A 1QPJA 1P4FA 3NDMA 3DBEA 4U81A 5HU9A 5IZFA 4O82A 5DE2A 2JITA 5M4UA 1OIYA 2W9ZB 5I9ZA 3QGYA 1BKXA 2PMLX 5AP4A 3OWKA 3PA4A 4MXZA 4ASXA 4BFMA 2PVRA 4QNAA 4RJ5A 5I3OA 4IANA 4KBAA 3FMEA 4JDIA 5DIAA 4C35A 2PL0A 3H10A 4EOJA 5IA0A 4FYOA 5CQWA 1UWJA 4RFYA 4D2PA 5J7HA 3DFCB 3LJ1A 3NUPA 1WAKA 4FTLA 3W18A 1YOMA 4RX5A 3L9PA 2PUPA 5E1EA 5IISA 3QCXA 5KKRB 2XA4A 4EZ7A 1TQMA 1UKIA 4YZ9A 2DUVA 4BDJA 4X3FB 4QQJA 5CAPA 1FVVA 3PXZA 5FXRA 5JSMA 3ORNA 4BI0A 4R78A 3NYVA 3V5PA 4MXAA 3MBLA 4NWMA 3RK9A 1CKJA 3MFTA 5T68A 3TI1A 3R8ZA 4LFIA 3R00A 4EK4A 5HD4A 5IMXA 3TL8A 2PMIA 1U54B 1SVGA 1M17A 1M52A 1WBTA 4DFXE 4FSNA 1HCKA 2QHMA 3EQCA 2HZ4A 3DJ5A 3I60A 1SYKA 3K3JA 4D4SA 4GRBA 2WEIA 4KABA 5CU4A 4BBEA 4OTHA 1YHSA 1VZOA 4CFFA 2VGOA 3F82A 4FIEA 3W55A 2XEZA 4D0XA 4DBXA 1FOTA 1RW8A 2NPQA 5E7RA 3N4TA 3FXXA 3TNQB 2VWBA 2C6EA 3LJ0A 4BIBA 1REKA 1OPLA 3F7ZA 3QUPA 5BVNA 3FLSA 3KXXA 3OEFX 3PE1A 3QTZA 5H2UA 2V62A 4YNOA 4AA4A 4MYGA 2GDOA 2J4ZA 2GU8A 3FE3A 4RWIA 4BBMA 3QU0A 2IO6A 2C6TA 2GPHA 2I7QA 2XK8A 4DHFA 3L9MA 1FVRA 3QCSA 2NNWB 2HZIA 2W0JA 3FSKA 4TZRA 3BEGA 5BUJA 3P08A 2R3GA 4E4LA 1E9HA 3H0ZA 1GY3A 1P5EA 2QKRA 1M2QA 1PMEA 4QMSA 5G1XA 5G6VA 4FV4A 3FMJA 3P78A 4RFMA 4ANQA 4V04A 3NYXA 1JKLA 1ZOGA 4MHAA 5E8XA 2VZ6A 4H3BA 4LUEA 3PRIA 2HXLA 3ATSA 3KCKA 3KULB 2XVDA 4O38A 5GJGA 2YCSA 3PIXA 1MRYA 2VD5A 3P0MA 3D83A 2XKFA 1YWVA 4XBRA 3Q3BA 5KO1A 2ITPA 3GB2A 2OLCA 4HGEA 4HYSA 4O1OA 3LXNA 3KRWA 3O23A 5HLWA 1NVRA 1OL6A 2ZM4A 4H39A 3KY2A 2UZLA 4WRGA 3RINA 1WVYA 2A0CX 2F57A 2W9FB 2BR1A 3HMIA 1B6CB 1YW2A 4FTUA 4ITHA 2XYUA 4YLKA 3GENA 3WIKA 1BYGA 2VTHA 3LXLA 1KE5A 4BCIA 5KE0A 3TEIA 1H8FA 3DXQA 4LRKA 4DEDA 4GFOA 4M67A 1MP8A 4IX5A 2PMNX 3OTVA 4EOQA 1PRYA 3ZLXA 4UXLA 4X0MA 4NM7A 4ACHA 4ZLYA 3WZKA 1W83A 1HCLA 4EYJA 4FL2A 2GNFA 4FA2A 1Q97A 4K33A 3QC4A 2JKKA 2J0IA 3BYVA 2UZBA 3PWYA 2OJ9A 5IH6A 2A1AB 5ANKA 1UNLA 2R3MA 3UOLA 3U51A 5IQCA 2OBJA 4DCEA 3ZFMA 2QURA 2VWIA 4GYGA 3IK3A 4UMUA 4M13A 3SRVA 1IA9A 3ZBXA 3PPKA 4K9YA 4JBQA 4X2KA 4NFMA 5HX6A 3UZRA 3LFEA 3DJ6A 2WFYA 4BTMA 5EHYA 4L7FA 4UY9A 3KMMA 3CS9A 4IZYA 3W2PA 4AAAA 2IJMA 3QTWA 4P90A 1YWNA 3GVUA 2PULA 2Y6MA 2H8HA 3KCFA 1YQJA 4E26A 3R0TA 1ZLTA 4NKSA 4CFMA 5HGIA 3FZ1A 3GC9A 3F5PA 2UZOA 4RC4A 2ZB1A 5KUPA 4DT8A 3RVGA 3I4BA 3TZ9A 4HGSA 3RBWA 3R7YA 3EL8A 5KMIA 1BLXA 1IEPA 1H1RA 4O91A 4ANLA 4NFNA 4U43A 4JT3A 4O0XA 3DV3A 4F1OA 4CT2A 3E8NA 4FNXA 5M44A 3O51A 5C01A 2BILB 2ERKA 2JLDA 2R3JA 2C5VA 2UW4A 5DNRA 2GMXA 4J52A 4PTGA 1H26A 3MS9A 4QTBA 5LMKA 3OWPA 1OKYA 4YLLA 5AV1A 1OUKA 1XH4A 2VTJA 3NR9A 3FMLA 4RIXB 4K18A 3KVWA 3DAKA 4D5KA 1OUYA 2W1FA 3MPAA 4EC8A 4AP7A 3UJGA 2OXDA 3FMHA 4E6QA 4BCQA 2CNVA 4FE2A 3IPHA 2PVHA 1WBPA 1GIHA 1PYXA 3EZRA 5EW8A 3RAHA 4C3FA 4ZJIA 3E7VA 2ITNA 2ITXA 2J0JA 5IPJA 4M12A 2BFYA 2X39A 2ZDTA 3NAYA 4ZP5A 5FEEA 3PXQA 4A7CA 3OZ6A 4PL4A 2XH5A 2QOQA 4CD0A 3ZM9A 4LRJA 5K4JA 3LCSA 5CEIA 4IB0A 2WELA 3KU2A 4EH7A 4FTKA 3S2PA 4I6FA 5HLPA 1R0EA 1SNUA 3ZDIA 2OXXA 4O1PA 4C61A 3E62A 2Y8OA 5HX8A 3V01A 4OR5A 5FBNC 3UNJA 5IF1A 3R7OA 5GINE 2GHGA 5KBQA 3MYGA 1F5QA 2A27A 2F9GA 3FL5A 5L8LA 2VWZA 2F49A 4NM0A 4JVGA 1XBCA 4E5BA 5J79A 4IM3A 4QRCA 3VUHA 1ZOHA 4X2FA 5DRDA 5TT7A 1HOWA 3BU6A 3O7LB 3VULA 5IUHA 5L2TA 2O8YA 4O27B 5H8EA 2P3GX 4M97A 4XV2A 1UU9A 4D0WA 4I0RA 4F1MA 4H1JA 1YXTA 4CCBA 3DKGA 3VUGA 4C62A 3GCVA 1OL2A 2IW6A 3NNWA 4TKSA 1OECA 4IZ7A 4RC3A 1RDQE 4XRJA 3AXWA 4Y72A 1K3AA 3ELJA 4ITIA 2G01A 4QTAA 3FPQA 5DMZA 5CENA 1PKGA 3AC3A 4O83A 2R9SA 1M7QA 5CXHA 2WTKB 5DT4A 5BVOA 5CEOA 1E1XA 4DGMA 5I9WA 2VTSA 2CNUA 4BWPA 3R2YA 4I22A 2O63A 3F69A 4JI9A 1Q8TA 5E8VA 3VHKA 4OTQA 4HW7A 3DBFA 4RA5A 2B0QA 3C4XA 4EH9A 4EOMA 4YTCA 4AOTA 4NJDA 4F99A 2BAJA 3R71A 3UZTA 1A9UA 3BZ3A 3EHAA 4QYYA 2W1CA 1JSUA 4E6DA 3PJ8A 5CF5A 1Q5KA 3G51A 4L53A 5KX8A 5LCJA 4PF4A 2ZJWA 3U8WA 5L4QA 3I0OA 1UVRA 2CGXA 3R1NA 4IZAA 3G90X 3PXFA 3GU5A 1FGKA 1OPJA 3AC4A 3CP9A 3FI2A 5CEPA 1S9IA 3I5ZA 2PVNA 1OBGA 4YR8A 4R3PA 5DRBA 4DC2A 5L2WA 4L8MA 1ZWSA 4ZSEA 4RIOA 3E64A 3D7TB 2P2IA 2BDWA 4FV5A 2FSOX 2P0CA 3FQHA 4RWJA 3VN9A 5I5ZA 2ONLC 4FV1A 2UW5A 2YLEA 3PY0A 3PA5A 5EHLA 4C37A 4HOKA 4PDOA 4XHKB 1PXOA 2UZVA 4FTMA 1NW1A 3GC0A 4LMNA 2RFDA 2VTQA 3GGFA 3GU6A 4GUEA 3VF8A 4C4GA 4OAUC 2XNBA 4UXQA 4ID7A 3VUDA 4HCVA 4BDDA 3AT2A 2I0EA 2VRXA 4LRMA 4TYGA 4YSMA 4G34A 3ZEPA 4J53A 4YC3A 4AUAA 2QNJA 2X8EA 1PXPA 4ZZMA 4ZY5A 5DBXA 4RJ6A 5IU2A 4II5A 5L6PA 3OTUA 3F7WA 5ETIA 4F7NA 4ZOGA 3OOGA 5L8JA 4E4XA 4I6QA 2W99B 2KTYA 4C38A 5GZ8A 4DEEA 2W1HA 1PXLA 4EK5A 3R21A 2NRYA 4P4CA 3QQLA 4QMUA 2GFCA 3OCGA 4IXPA 4F9BA 3CD8A 5KMLA 2GQRA 3C0GA 5AAGA 2F2UA 2WOTA 3NS9A 2X2MA 5FM3A 2C3JA 4EQMA 3MPTA 2WU6A 4AZSA 3KFAA 4RRVA 5I4NA 3LCKA 2ZV7A 3RM7A 2XNMA 3U6IA 5CU2A 5DWRA 2X2KA 1JBPE 2IVTA 4F7LA 4YTFA 4FKTA 4R7HA 2J5EA 4JXFA 2OO8X 3BPRA 1BMKA 3ZS5A 2WQOA 4EHZA 5CNOA 3S95A 2QOFA 3EN6A 4ACGA 3MFRA 3R01A 4L7SA 3R7VA 3TNPC 2R64A 3VJOA 2Z2WA 2FVDA 5AP7A 4I5CA 2B1PA 2XCHA 4FOCA 3PSDA 3AT4A 3SVVA 4RWKA 2RFEA 5HTCA 5AUXA 4QMWA 4AOIA 2W4JA 1IA8A 3DA6A 4ZTNA 3LVPA 2CCIA 4B6LA 4WNKA 2W17A 3D94A 2W06A 3RNYA 5K0XA 2RL5A 3HVCA 4O96A 4KINA 2BMCA 2B9FA 2QOHA 4V01A 5AUWA 4Z3VA 3SRVB 4RIYA 5JRQA 2ITVA 4FV8A 2XF0A 1VEBA 2C68A 3AD4A 2WMWA 2GS7A 1PJKA 3FQEA 4IFCA 5FTOA 3WZUA 4DFLA 3RAKA 4E6AA 4HCTA 4C7TA 3IOKA 3M2WA 4LOPA 4ZLZA 4JAIA 3LCOA 2GFSA 4PX6A 4KA3A 2YIQA 4ZSJA 3WE4A 3ZHPC 4F0FA 3GU4A 2WMXA 5DT0A 2YZLA 4R7BA 1OKZA 2UZUE 3VW8A 4Z7HA 3EN9A 4AG8A 4MTAA 4L68A 1XR1A 4GG7A 2Z7SA 2VTNA 2EXMA 4WNOA 2YITA 3V51A 1OL7A 3FKNA 4BCJA 4CRLA 4O0SA 3LOKA 2V7AA 3KB7A 4K1BA 4QP4A 3E8DA 2BPMA 5AM7A 2X8DA 2UZNA 4I1ZA 5GNKA 4Q9ZA 4BI2A 2G15A 5DHJA 4FIHA 3I79A 4A9YA 1KE7A 1H0VA 4HVDA 3ZUTA 3ERKA 5LMAA 2JEDA 4H36A 4L52A 5JQ5A 2X4FA 3LFNA 2RKUA 4IMYA 2OW3A 4ZZOA 4D9UA 1YI6A 4Y8DA 1Y91A 3VBQA 3BHHA 3GFEA 4P5QA 2JKQA 3D5VA 2VTLA 4LQMA 3RK7A 3Q04A 4BIDA 4A07A 3SW7A 3TZ7A 4FEUA 4UWCA 4BDHA 3CKXA 1XHAA 4R77A 2X9EA 4WG4A 3ZMMA 5ETCA 3KN5A 5KHXA 4RVKA 5E9EA 4DE4A 5JGDA 4BI1A 3NAXA 3OD6X 4JRVA 2R0UA 4ZXTA 4TYJA 4ZLOA 3ZRKA 4G6LA 5EQEA 4IQ6A 2CMWA 1YXVA 5D7AA 5FXQA 3U6HA 3PJ3A 4CCUA 3EYHA 1AD5A 3FZPA 3IDPA 4XOZA 2B4SB 4FUXA 1TVOA 4DBNA 4M66A 2B7AA 4FTIA 1JKSA 4FGRA 5I9UA 3QTXA 4W4VA 5CAOA 2F7EE 2YJSA 5EM6A 4BKJA 1DI9A 4J71A 4EH3A 4NTTA 4DH8A 5HCYA 3PJ2A 3UO4A 4X3FA 4RG0A 2FYSA 5DVRA 4H05A 3G5DA 2B54A 3RZBA 2RG5A 3IW4A 3ROYA 3BGZA 4R5SA 4G6OA 2XRUA 4G3EA 1U54A 4AN3A 4XMOA 1PY5A 4C57A 2HXQA 3I7BA 4FKPA 2ZAZA 3V5JA 2UW9A 4FF8A 4FTQA 3KXNA 1TQPA 4QMXA 4YGAA 4CLJA 2BHEA 2C6OA 4TW9A 5F1ZA 3SAYA 3LFQA 4BDEA 4ZSAA 5BMSA 4FEWA 4MH7A 2R5TA 4FGBA 2XZSA 4KWPA 3WI6A 5A9UA 4C33A 2QOOA 2XUUA 1PXIA 4UBAA 4W9XA 1H00A 3RPOA 3KRLA 4TYHA 2QO7A 3COMA 3JY9A 3Q4ZA 3A61A 3TCPA 5C4LA 5IDPA 1MQBA 3S00A 5C9CA 4WT6A 5M56A 4AGCA 4YPDA 3VUTA 3QZFA 5LQFA 3IO7A 3OWJA 4ERWA 3FDNA 3E93A 3RGFA 3EFWA 4JAJA 3VBVA 2P55A 5FP5A 2NP8A 3MB7A 1U46A 3DQWA 1OIUA 3WZDA 3UPZA 1JVPP 3LKMA 3PZHA 4I6HA 4DFNA 4IIRA 2J0MB 3NUUA 4GKIA 3VS5A 4ZY4A 3A7FA 2QHNA 1VR2A 3CXWA 3RTPA 3ZSIA 4RZVA 3ZUVA 5HORA 3RM6A 3TWJA 3C4CA 5LVOA 3MJ2A 3BHYA 3D15A 3U9NA 3BRBA 4KD1A 3QRKA 1R78A 3RMFA 3QALE 3ZXTA 5B2LA 3QUDA 4RIWA 3DCVA 5L8KA 2C3IB 2G9XA 3CCNA 2LGCA 4YLJA 4MD7E 2P33A 4P7EA 2YEXA 3C9WA 3D2KA 4DTBA 4H3QA 4GVJA 4FKGA 1FVTA 5HTIA 5HESA 3R9DA 4DTAA 4QQ5A 4U6RA 4CQEA 2YFXA 4RLKA 3FI3A 3GU8A 4G16A 3LLAA 2GNGA 5KMJA 4HVIA 1R0PA 1WBWA 4FSWA 5IA5A 3TIZA 3LZBA 1Q8WA 3ORMA 3IW7A 2JFMA 2Z8CA 4JDJA 4J98A 3E3BX 4D1ZA 1NVSA 2F2CB 2VNWA 4JX3A 5AV0A 3QWJA 1ZY5A 1WBSA 3MJ1A 3OY1A 5FDXA 2JDOA 4E4MA 3AG9A 4JQ7A 4USFA 4U7ZA 4Z9LA 1QPEA 5M55A 3CGFA 2ZM1A 2GNLA 2HY81 4XP2A 2BRGA 4F7JA 4EI4A 3CIKA 2XRWA 3KVXA 3TT0A 2FSTX 5CASA 1REJA 5JZJA 3ZO1A 4XOYA 2WQBA 2G2IA 4M0ZA 1ZMWA 4DCAA 3A8XA 2F4JA 3MY1A 4L9IA 2WTIA 3N51A 1BL7A 2ERZE 3E87A 2YJRA 4EH2A 2W4OA 2OU7A 4ZTRA 2X2LA 3T3VA 5IEYA 4QMYA 3G6HA 3ITZA 4D2TA 4ZAUA 2XIXA 3ZDUA 2VU3A 5JQ8A 4YJNA 4KS8A 5E1SA 5M57A 2UVZA 1YOLA 3LQ8A 3W1FA 2PWLA 1XH9A 3AQVA 4FZDB 5CEKA 3NGAA 3D9VA 4RA4A 4UALA 4G9RA 2ESMA 1OZ1A 5AIRA 3H9RA 3F3UA 5C8MA 1NVQA 3UQFA 3UVPA 1W8CA 2JDRA 2HAKA 3KK8A 3F3VA 4KNBA 3R63A 4EJNA 3WBLA 4UYNA 4NL0A 2IZRA 2R7IA 2X8IA 4U42A 4EBVA 4RIYB 4LGGA 2Q0NA 3O2MA 4RIXA 5GZ9A 2PVMA 4UZDA 1KE8A 5DLSA 2X9FA 4S2ZA 3TV6A 3TKUA 4C3PA 4MXXA 4USDA 5IH4A 2WQNA 3AMYA 4USEA 2QR8A 2GHMA 2VO0A 2I1MA 5LMBA 2EWAA 3GI3A 3POOA 4J1RA 5CT0A 1H07A 4ZJVA 3ZUUA 1WVWA 4RMZA 4RJ3A 5I9YA 4IAKA 3WF9A 4Q9SA 2J0LA 2Y4IC 2YIRA 3QTUA 5AP1A 4NZWB 3Q9ZA 1VYWA 3BYUA 4GCJA 5IQBA 1M7NA 3R7GA 4ACDA 3DDPA 2PZIA 3AOXA 4EH6A 3Q60A 1XQZA 3L8PA 5A6NA 1Y8GA 4PNKA 5TKDA 4UEUA 5FWKK 4Y95A 1YKRA 1JLUE 3DB8A 3BHTA 2R3PA 4I3ZA 4LV8A 4ZIMA 5FEQA 3UIBA 5HE1A 4YO4A 1P14A 3TN8A 5IDNA 2UW3A 2H34A 1G3NA 1ATPE 2GQSA 5ETAA 2WPAA 2YA9A 2ITTA 2W1DA 1ZZLA 5KHWA 3HRCA 2W5HA 4HYUA 4O7NA 4N6YA 3V6SA 4N70A 5ACKA 4ZY6A 3CPCA 5K5XA 3ZYAA 5BVDA 3HAVA 3NW7A 4OGRA 4GSBA 3OOMA 3IDBA 5C4KA 4CGAA 3E8EA 3H4JA 3MFSA 1OGUA 1Q41A 3QRJA 4CQGA 5EDQA 4M8TA 4MNFA 3FAAA 2BAQA 4JG6A 4MXYA 3BBWA 3I1AA 4G6NA 2IG7A 1ZYJA 3KMWA 2UW0A 3NNVA 2WMSA 4UMTA 1SMHA 4W8DA 5CSPA 3RALA 2B9HA 4OAVB 2O3PA 3II5A 4RC2A 5TO8A 3W2SA 2WD1A 3CD3A 4PPAA 1H4LA 3MTLA 3FZRA 4D4YA 2WTJA 3NZ0A 2WU7A 3RAWA 4L42A 4QQCA 4IJ9A 4JR3A 4YBKA 2BCJA 4ASDA 4DH1A 1F3MC 4QMOA 2W1GA 4QPAA 4F0GA 2J6MA 3C13A 3ORXA 1H01A 2WOUA 3D2IA 4U45A 3BLQA 3UIMA 4KKGA 5IUGA 4BGHA 3D7TA 2R0IA 5M08A 4FTCA 1CSNA 4L00A 3CC6A 4YHFA 4L67A 4AW2A 4NUSA 3U54A 4TYHB 3S0OA 2ZDUA 2V0DA 2X4ZA 2O0UA 1JQHA 5AAFA 3R9NA 3NUNA 5A3XA 4O7TA 3RI1A 2B55A 3ZRLA 3G9LX 4AF3A 5AR8A 4MBIA 2A2AA 2PSQA 3W33A 4CSVA 1F0QA 2Z7RA 3KC3A 5J1VA 1G8AA 5T3QA 2VWWA 2FUMA 4ZTLA 3ZC5A 3PE2A 2B52A 3CEKA 3UC4A 3C4ZA 3EKKA 4FVPA 3NWWA 3ORZA 3FJQE 3F5UA 4CFXA 3Q4TA 1PMVA 3GQLA 3HUCA 5E90A 4FIJA 3B8RA 3ZM4A 2XIKA 3ZTXA 3LMIA 3CJFA 2ZVAA 3R7EA 3GQIA 3MY5A 4G5JA 4DG0E 3OW4A 1V0PA 4K77A 3R9RA 3PPZA 1KSWA 1H1PA 5CANA 1T46A 4CG8A 4O21A 4RIWB 5M4CA 3CQEA 2IZUA 4QPMA 4FEXA 5AR4A 2R4BA 4MBJA 4DA5A 4FL1A 1O6YA 4PMTA 1AGWA 3QQKA 3CSVA 3E3PA 5BMMA 4AN9A 4AE9A 3UVQA 3KXGA 4CMUA 4NM3A 2BRHA 4BWXA 4ZS4A 1BUHA 3D0EA 3QRUA 5GHVA 5EYCA 4BZOA 4IAAA 1SNXA 4NH1A 5EYKA 3OG7A 3QD2B 3WE8A 5GIPE 1LR4A 2BZKB 1R1WA 3UYTA 5EW9A 3A60A 4B9DA 5A4QA 4C3RA 1VYZA 2WKMA 4Q5EA 4YJUA 4PL3A 5J9LA 4U5JA 3HMMA 3UDBA 4I92A 4GEOA 4EOPA 5HVJA 3T8OA 3O50A 1YRPA 4GG5A 4G5PA 4YU2A 4MD9E 3FV8A 1IR3A 1OIQA 4FODA 3E8CA 4YNEA 3MN3A 4Y73A 5EDRA 3PLSA 4I6BA 4J96A 4PY1A 5JZNA 4XG2A 4EOOA 5CNNA 2OF4A 3ACKA 5FBOA 5HG9A 3PYYA 4AT4A 3ZLSA 4B99A 2I0YA 4G3CA 1VJYA 4DEHA 4XNEA 2VGPA 3AC8A 2C0TA 3ZU7A 4EORA 5E4HA 2F7XE 4JJRA 4QQTA 4JBVA 1YHWA 5BVWA 1Q8ZA 4DTKA 4J8NA 1YXSA 2C6MA 2QO9A 3PP1A 3QRIA 4JDKA 3QQUA 4IAZA 3DQXA 4FT7A 4RQVA 3FC1X 3V5TA 4CTBA 3C7QA 3PXYA 4I23A 4AT3A 3OCBA 1YDRE 1Q61A 2PK9A 3AT3A 3IECA 4OBOA 4TY1A 4BZDA 4QP8A 4O7WA 2OF2A 3OCSA 3L9NA 3R8VA 4BTKA 4CYJA 3DXPA 1JKTA 4EQUA 2GNJA 3H30A 4LV5A 3DDQA 5ANIA 4BZNA 1I09A 4ALUA 5A14A 3EQPA 3R7UA 3G15A 2C3LA 2WGJA 5CYIA 3SDJA 4AA0A 4O0RA 4QO9A 3ZRMA 4C4HA 5IEXA 4CFVA 1UKHA 2BIKB 4IC7A 4Z55A 3FLWA 2WNTA 2F7ZE 4PRJA 2Q83A 4CVAA 4J7BA 4JR7A 2OH4A 3BI6A 2VTTA 4MAOA 2HWOA 2PUIA 4YC8A 3V5QA 2P2HA 3QFVA 4LUDA 2XNEA 4BCPA 1CKIA 4AT5A 3W16A 3HX4A 5HIBA 3DK3A 2HY0A 3K3IA 2VO7A 3COKA 3RHXA 5HNGA 4I24A 3JPVA 4RX7A 5EI6A 3UBDA 4CMOA 1PW2A 1WBOA 3ALNA 4A9UA 4YPSA 2JKOA 4F9WA 4TYEA 3AC5A 3R8MA 2Y4IB 5HTBA 4RQKA 2VX3A 2XBAA 4KRDA 5DR9A 5D12A 3RCJA 5DFPA 3QD4A 1MUOA 4PTCA 3QZIA 3CR0A 3QAME 4BR3A 3DNDA 5A54A 2C0OA 3UG1A 4AE6A 1XH8A 3C1XA 4IH8A 5AV2A 1YI3A 5LWMA 3JYAA 3UVRA 2R3HA 2UUEA 5J8IA 1GZKA 1NY3A 4WA9A 4C36A 3VC4A 1OL5A 4FZ7A 3SW4A 2OFVA 4QMTA 5J87A 4OTFA 2BVAA 4S33A 2WMTA 3A8WA 2EU9A 3NIZA 3PZEA 2QODA 3R28A 4BDGA 2FSMX 1YHVA 4F4PA 4H3PA 1ZMVA 2ZMDA 4DGLC 4HVHA 2ITZA 5CEQA 3RWPA 5CVHA 4E4NA 2ZB0A 3NRMA 2OIBA 3MVLA 4B7TA 1H27A 4F09A 4NK9A 3LMGA 2BKZA 2FO0A 3QA8A 4EHGA 3OXZA 2OJFE 5FDPA 2JAMA 3MFUA 5AEPA 4FTNA 3UGCA 4PP9A 1Q99A 3BV3A 3CY2A 3EQGA 2JDSA 4W9WA 3CKWA 1H24A 4L46A 5ANOA 1OBDA 3RAIA 3CQWA 3OWLA 4MWHA 4F08A 4BVUA 3DZQA 3F5XA 3HV4A 2PVKA 2C4GA 4ENYA 5HCZA 1Q8UA 2I40A 3FWQA 3QTIA 1YWRA 2QONA 4F65A 4GK4A 4EK8A 3Q5IA 1NT2A 4KKHA 4XLIA 5JT2A 4E5AX 2CKQA 4CV8A 3UNZA 4AX8A 3C4WA 4FZFB 4YTHA 5ETFA 4BY9E 3HUBA 3UO6A 3MIYA 4OTGA 2CKOA 2OGVA 4R3RA 5DEWA 2WMVA 3QKMA 4KRCA 5IQAA 1QL6A 4MQ1A 3ULIA 3FI4A 5F20A 2PZPA 4DH3A 2C3KA 4I5MA 5J95A 2R3KA 3C0HA 2EB2A 2R3IA 2XK3A 4U0IA 3TNIA 4U80A 2XKEA 3SOAA 2ONLA 2GS6A 3RNIA 3TV4A 5AX9A 4ASZA 2EUFB 4ZTQA 3PJ1A 3GEQA 4ZTMA 1UWHA 2YM7A 3ZZEA 3BIZA 4TNDA 4CNHA 3Q32A 3OUKA 5I0BA 2I6LA 3FMDA 4NYEA 4W4WA 1LPUA 3Q52A 4HVGA 3QLGA 3COIA 3TDVA 1M2PA 5BX0A 4FT9A 4F1TA 3MA6A 4GS6A 3KXZA 2PPQA 4IAFA 5I9VA 2AUHA 5H9BA 3ZXZA 3T9IA 3TXOA 2PUNA 4YJPA 2W4KA 3F2NA 5D1JA 3QKKA 5HBJA 1J7UA 3W10A 3GXLA 2UW7A 4GFMA 3V04A 4M69B 3AGLA 3BWFA 4G9CA 3VS3A 4FTJA 1Z5MA 4DINA 3QQFA 2Y0AA 4DFBA 1LUFA 1MRUA 2GCDA 3VWAA 3DY7A 3SX9A 1ZYDA 5AWMA 4O0TA 4BBFA 1UA2A 2OH0E 4Z16A 3DZOA 4TNBA 2HZNA 4FNYA 2EXCX 2CGWA 2WO6A 4FKWA 3ULZA 4EWHA 2C69A 2OJGA 4MEDA 3BYSA 4AWIA 1ZARA 4QTDA 4U41A 3MB6A 3QYZA 4TTHB 1UNGA 1H1WA 4FKOA 4FEVA 1URWA 2OWBA 4FICA 4AGWA 4UN0C 1JSVA 3NIEA 5CY3A 4C0TA 2JIVA 5IQFA 2QG5A 2PVLA 3UG2A 3GCPA 3QXPA 4WIHA 4X2JA 3IS5A 3I7CA 4DN5A 3VAPA 3OROA 5D41A 3SKCA 4OTIA 4K2RA 1QPDA 3I81A 1BX6A 4EH5A 3HEGA 3PY3A 2FB8A 4FEQA 4O7ZA 3HMNA 2NRUA 2I0HA 4CV9A 3GOKA 3TV7A 5I3RA 3A4OX 1DI8A 3QLFA 3P23A 5CI7A 4C4EA 5K0KA 2QKWB 3PG1A 1KWPA 4L3JA 1WZYA 5ANEA 4KB8A 2C0IA 4CG9A 4Z7GA 5JFVA 4CFWA 3H9OA 2PMOX 4N57A 3TJDA 2J90A 4BCGA 3RPRA 4B4LA 1DM2A 1XKKA 2XIYA 4TWPA 3UQGA 4BDBA 4DAWA 1J7IA 4L01A 1CKPA 3PY1A 3R30A 3ZBFA 1WFCA 1WVXA 4YJTA 5CSXA 2XB7A 4JBPA 4Y46A 5AUVA 3A4PA 1V0BA 4E6CA 3R9HA 5LOHA 2PYWA 4GJ3A 5AMNA 3L9LA 3PVWA 4GL9A 4UMPA 1PMUA 5D11A 3FLNC 1WMKA 2IVUA 2W05A 5EYMA 2JD5A 4R7IA 5B7VA 3QHWA 4YP8A 4EEVA 3V5LA 4E8AA 3D5WA 3EFJA 5TOZA 2PVJA 3A99A 5CQUA 5H3QA 4ARKA 1XBAA 5F95A 1PXMA 4TL0A 2FGIA 5FLFA 3U4UA 4IX3A 1B39A 3FLQA 4MX9A 3EH9A 5EQPA 3AC1A 2WTVA 3C0IA 5HEZA 4O84A 3BGPA 4MBLA 3IW6A 5DR6A 1PKDA 4NIFA 1WBVA 2ETKA 3KQ7A 4J8MA 4AZTA 5AA8A 1UU8A 3GP0A 3DOGA 2YDKA 3QCYA 2RF9A 4ALWA 5IA2A 4EZ5A 2UZEA 3WARA 4CZTA 5IA4A 5L3AA 1CDKA 3PVUA 4BDCA 3FZSA 4LOOA 4AU8A 4U40A 4YJRA 4HJOA 2NO3A 3FY2A 2JBOA 4RJ4A 4V0GA 5IA3A 3ID6C 5BVEA 4GVAA 1W98A 4O2PA 4XG4A 2QCSA 4CKJA 4PMSA 3QXOA 2QOCA 1ZZ2A 2AC3A 4OUCA 2WHBA 2IVVA 1OMWA 1K2PA 4MNEB 5BNJA 2C6DA 3IOPA 1V0OA 4IC8A 5AR7A 4AGUA 4XP0A 4IACA 5J1WA 2EB3A 2J7TA 3H3CA 4ASEA 5D9HA 2BRMA 3NYNA 4BIEA 1Q3WA 5A6OA 4O0WA 2DWBA 4YC6A 1W82A 2ZMCA 3R9OA 5CVGA 3SC1A 3F88A 1XH7A 2QD9A 3M11A 2PE2A 4O7LA 5CLPA 4FV3A 2O64A 2BHHA 5DEYA 1B38A 3EQBA 2WXVA 4XS2A 3PG3A 3G2FA 3L8XA 3VS6A 4X3JA 4IDTA 2OJJA 2UZWE 3O17A 5EG3A 5EM8A 3BE2A 3N4VA 4O7YA 1U5RA 2YN8A 2GTMA 3COHA 4GH2A 2HENA 3G9NA 3ROCA 3QQJA 3TJCA 3TZ8A 3WILA 4DYMA 5CF6A 5KMMA 5EQYA 1O9UA 4M14A 4HGLA 3OBGA 4EQCA 3Q2MA 3SHEA 3RWQA 3VHEA 3VJNA 4FL3A 4JG8A 5H8BA 3NVKI 2XM8A 3DXNA 3F3WA 3FZOA 1J1CA 4FSQA 2CLQA 2UV2A 3EQDA 4FT5A 3FXZA 4LOQA 3TKIA 5BPYA 4FKRA 3V8WA 3P7AA 4HYIA 3PXKA 2YM8A 3PIZA 4OTDA 5A46A 1G8SA 3QX4A 4MXCA 1H1SA 4FV7A 3VUIA 5LARA 4F6UA 2XJ1A 3AMBA 4OLIA 5TE0A 4A9RA 4AFJA 4DEGA 4UV0A 1FMOE 1OM1A 3Q96A 4MWIA 3AMAA 4XUFA 3ZO4A 4CZUA 4AZWA 5IEVA 4TXCA 3V3VA 5IG1A 1LP4A 3D5UA 2JIIA 3Q6WA 1J1BA 2C5NA 2OZOA 2BROA 3DPKA 5E8SA 5AR5A 5IUIA 5TF9A 3TZMA 4CLIA 3DKCA 2CJMA 4RLLA 4RVLA 4UZHA 3EZVA 5HG5A 5IH5A 4XG8A 5KMOA 3P5KA 3QKLA 3CTQA 4BCFA 1UV5A 3MVHA 4FKVA 4O2ZA 3WF5A 4KBCA 4MXOA 2EXEA 4XV9A 3HDNA 2FSLX 3NW6A 2Z7LA 3RPYA 4J95A 4L45A 3PPJA 4AW1A 4QP3A 5BYYA 4HGTA 3JS2A 3KF4A 4D2WA 3ZONA 5DH3A 2AYPA 3IG7A 5KMKA 3FKOA 3F66A 4N4SA 3ZC6A 2IWIA 3EYGA 2WTCA 4C59A 4FNZA 1A06A 1A48A 4EL9A 1XH6A 4YMJA 3LJ2A 2C47A 3BBTB 2PE1A 2ITWA 4FKLA 4IVAA 4BCMA 4D2SA 3KN6A 5EKOA 3A7GA 2UVXA 4NT4A 4I0TA 5ICPA 4EC9A 3SG9A 4FSTA 5GIOE 2Y7JA 1TKIA 3ETAA 3PP0A 4NU1A 2GQGA 4Y83A 5KMNA 1T45A 2ZV8A 3L8SA 3QC9A 5EM5A 4E20A 3OHTA 4C58A 2X6DA 2UZDA 4N6ZA 2G2HA 4RVMA 4RX9A 5CSHA 3VS0A 3PDTA 3AD5A 2E9OA 2JDVA 4TRLA 2O5KA 1XWSA 1ZRZA 2XK7A 3DKOA 2BDJA 4RGJA 3C51A 4QMLA 3EOCA 2DYLA 3MH2A 5CXZA 3R02A 5F4NA 3HAMA 2XYNA 3GCQA 3VS7A 1RQQA 4IE9A 4CRSA 1P4OA 2YZAA 3DT1A 4YO6A 5AJQA 4QT1A 4U3YA 4CYIA 2W1IA 3A7IA 3BX5A 3PRFA 5EW3A 4AZVA 3DBDA 2O65A 4DG3E 1LEWA 2YIXA 3E88A 4EUUA 4EHEA 2WB8A 2VX0A 2J5FA 1G5SA 3OEZA 3FEGA 3K2LA 4FSRA 3BYOA 3MTFA 3OBJA 4BTFA 3R73A 4BF2A 2WQEA 3NMUF 2VWUA 2VX1A 2X81A 4JG7A 4YJOA 3R8UA 4KIQA 3GCSA 3RHKA 4I41A 5HQ0A 4U3ZA 2V7OA 5E8UA 5CU0A 5JRSA 5AR2A 4U79A 3BQCA 3EL7A 3EWHA 3VBWA 3NUXA 5D10A 3BYMA 4JL9A 4H1MA 5A4LA 2PZYA 2W5BA 5HLNA 5JFXA 3ZSGA 3QD3A 3ENMA 4MD8E 2OJIA 2XNOA 4XG7A 3UE4A 4XEYA 5B2MA 2Y4PA 3AGMA 5GJFA 4I94A 3GFWA 1NA7A 5DN3A 5DA3A 3BKBA 1OIRA 5JMSA 3NUSA 2OIDA 4S31A 2OIQA 3TKHA 4JQ8A 5JGBA 4NTSA 4CFNA 4EH8A 2E9PA 1U59A 3K5VA 4QD6A 4C2VA 3Q2JA 2A4LA 4IWOA 2V55A 3ZFXA 5HG7A 5IKWA 3H9FA 1KV2A 2HYYA 3IGOA 3QBNA 5AAEA 4ENXA 2PZRA 3W2CA 4EKLA 3SLSA 3PWDA 1JNKA 4HPTE 2XNPA 4S30A 5TR6A 3R6XA 3ZZWA 1JSTA 1J7LA 1PXNA 2E9UA 4GKHA 4IAIA 3MY0A 2C1AA 4OTPA 2IPXA 1OL1A 3TTJA 3OT3A 3KREA 1O6KA 2R3FA 5FRIA 5HE3A 4FVQA 2ZYBA 3ATTA 3VQUA 2QLQA 3WF8A 5J5TA 5AP0A 4DH5A 3NLBA 4IWQA 4DGGA 4JLCA 4PUZA 5AP6A 4G1WA 4IFGA 5FP6A 4D28A 4GUBA 4DITA 1H08A 4NIFB 3HYHA 4EOIA 2DQ7X 5F94A 3O0GA 5IMEA 2BZHB 3K54A 2B9IA 5JKGA 4P5ZA 4AACA 2R2PA 3C4FA 3Q9WA 3PXRA 3REPA 1W7HA 2W1EA 3HRBA 2PE0A 5ANJA 4V0GB 4YZNA 5L2SA 4TN6A 1IASA 3VS4A 3NUYA 4WSQA 2C6IA 4D2RA 1PHKA 4F6SA 1I44A 2YAKA 4FKUA 5BUIA 2OZAB 2CHLA 4FKIA 4OBPA 3UIXA 3VF9A 5HU3A 5E8ZA 3TUCA 4QMMA 1ZYCA 4O22A 1R3CA 4YJQA 3C5IA 3PLAE 5FGKA 2YM6A 3CQUA 3HDMA 3FXWA 5M51A 3FI8A 2WIHA 2V22A 4IX4A 4F0IA 4O86A 3WF7A 2XIZA 2R7BA 4IB3A 3WYYA 4JIKA 4PMPA 2YM5A 5EH0A 4CKIA 5FTGA 4BYJA 3QF9A 2R3NA 4X6QC 3DU8A 3MSSA 4IX6A 4NM5A 3M42A 1QCFA 4G3DA 4QMQA 3UQCA 3FLZA 4PL5A 2W7XA
chains in the Genus database with same CATH superfamily
4IAYA 3OT8A 2PZ5A 5HD7A 4JIAA 4FMQA 2BDFA 3KF7A 3FYKX 3ORIA 2BZJA 4GFGA 5HCXA 4FK3A 3WIGA 5IQHA 4R5YA 5HKMA 2QLUA 4MCVA 4JDHA 4IBMA 2VTMA 1FMKA 2BZIB 4BDKA 2YISA 4S32A 3ZSHA 1Q8YA 5JN2A 5BVKA 5ITAA 3AC2A 3BHUA 3S4QA 3MVMA 4KS7A 2ZV9A 2YLFA 3BLRA 4LM5A 3UMWA 4BWKA 4O7RA 2J9MA 4FV2A 4AS0A 5AA9A 5CALA 4OBQA 5J9YA 2YM4A 3HA8A 4FZ6A 4XLVA 4AXEA 3WZEA 1FGIA 5AV4A 5M09A 3A2CA 4FZAB 3EQIA 4P2KA 5LCKA 3ZFYA 4YUQA 3LE6A 5EM7A 2BTSA 2W5AA 4RBLA 4GJ2A 1ST0A 2E9NA 1ZAOA 1Y6BA 2B53A 2X1NA 5T6KA 5FUTA 4IWPA 4CXAA 3VVHA 4PP7A 3A62A 1KE6A 4FC0A 3SG8A 5DR2A 3RPVA 4I21A 3JY0A 4FTOA 4X2NA 4DF3A 4M69A 4O0YA 1YXXA 3DK7A 1Z9XA 5ANDA 4GIIA 4HYHA 2JFLA 3PFQA 5K3YA 3VQHA 4ANSA 4A9SA 2WMRA 1Q24A 2QOLA 2XAMA 4IB1A 5JFWA 4TT7A 4XYFA 4O6EA 3B2WA 4GU9A 5M06A 3QTQA 2H6DA 4BN1A 4WUAA 4FJVA 2BIYA 2WQMA 4K11A 4NKAA 2C5OA 3MH1A 4KIKB 4ZK5A 4QMNA 5AUTA 2JDTA 4MQ2A 4O7SA 4PWNA 4LG4A 4RJ8A 2ITYA 3EJ1A 2J2IB 3UIUA 5HO7A 3BV2A 4YHJA 3N9XA 3FYJX 1TQIA 1U5QA 2PVFA 3ALOA 3Q53A 4X21A 3ZH8A 3GT8A 3FMNA 3P9JA 4FKSA 1PYEA 2GS2A 5JH6A 4DDIA 3OFMA 5CF8A 4FNWA 4YTIA 2BRBA 1DAWA 4M3QA 5ACBC 3LAUA 5AFVA 3DNEA 4GK2A 3TUBA 4W4XA 3IONA 2Z02A 4D9TA 2J0KA 1PF8A 4Q5HA 3UOKA 2QC6A 1E1VA 5FM2A 3EKNA 4GMYA 4RT7A 3NCZA 2XS0A 2ITQA 1GAGA 2OG8A 3E92A 5CX9A 4ERKA 5E8YA 5L2QA 4ANOA 3R7IA 4O7VA 2HOGA 2OFUA 1JPAA 2VNYA 3FQSA 4HZSA 2OICA 3SXSA 2XNNA 4F6WA 4F78A 4BJJB 3DTCA 3D5XA 3E5AA 3OW3A 3SQQA 5AUZA 4FTAA 2QOBA 3LXPA 3MH3A 4BKZA 4IZ5A 3UC3A 3ZEWA 5AADA 3QTSA 3MA3A 4EJ7A 4WHZA 3UP2A 3VUMA 1J91A 3W0RA 2HCKA 3PVGA 2X7FA 4DEIA 5CF4A 4PTEA 4X7QA 3EFKA 3HMPA 5FQDC 3DTWA 4EK3A 1OI9A 4APCA 4I5HA 4C8BA 2SRCA 4BB4A 5HO8A 3NNUA 3F6XA 2PY3A 4FTRA 2WAJA 2FH9A 4BKYA 3F3ZA 3C50A 3M1SA 4I93A 5FEDA 4A9TA 2Y9QA 3ACJA 3NPCA 4XP3A 2LAVA 4ANNA 3AKKA 4ORKA 5CT7A 3AD6A 4QMVA 4XV1A 2XM9A 3FHIA 4YZMA 3D4QA 2XIRA 4RVTA 3EN7A 3OY3A 3QHRA 4PPCA 3PA3A 3FMMA 4QNYA 5B0XA 2PU8A 5CZIA 5A4CA 3LFSA 2H96A 3R22A 3HP2A 2VN9A 3BGQA 3O96A 4KIPA 2RIOA 3V5WA 4AZEA 1H28A 4M15A 4RFZA 3Q4UA 1PXJA 4FR4A 4FOBA 1X8BA 3R8LA 4BGQA 2XNGA 3HV6A 5LWNA 4C02A 3ENHA 5KZ0A 1Q4LA 5LMKC 3OCTA 2YACA 4LL5A 2YM3A 3P7CA 4NSTA 2UZTA 4KIOA 4EK6A 3OP5A 2PUUA 1STCE 3P5JC 3VNTA 4FRFA 1CM8A 3BEAA 3IW8A 4I4FA 5CAVA 4ACCA 5CZHA 3C5UA 4EOLA 3V8TA 4CT1A 3POZA 1PMNA 1GJOA 3PJCA 4FKQA 4N0SA 3UNKA 5IQIA 4O6LA 2PHKA 2VTAA 3EQFA 4L43A 1YOJA 4MNEA 4WG5A 3HGKA 4AXAA 4PDSA 4GV1A 3R04A 3W2QA 3B2TA 1WCCA 2UVYA 4BC6A 3DLSA 5M07A 4YZDA 5FXSA 1ZYSA 1EH4A 1MQ4A 2QO2A 2C30A 2DS1A 2H9VA 5CSWA 1GIIA 4BCOA 3W0PA 3NX8A 1GZNA 5B2KA 2BRNA 3LXKA 1XBBA 4QP6A 4KUJA 4JBOA 3P7BA 4B8LA 2Z7QA 5K4IA 3BU3A 4XV3A 3PUPA 3V6RA 4MKCA 4LL0A 3FY0A 2EVAA 2G1TA 3VBXA 3T9TA 5BVFA 3OS3A 3KEXA 3ZCLA 4I20A 1ND4A 2IN6A 5CEMA 4IB5A 5DI1A 3O8TA 4OT5A 4IDVA 4FKJA 4ONAA 4WRSA 5KZIA 4CMTA 3I5NA 3LFFA 5E8WA 4HPUE 1WBNA 2OI4X 5DGZA 5BQ0A 4GYIA 3TTIA 3ZO2A 2YCFA 4E3CA 5LVNA 3I0QA 3D14A 2HIWA 3GOPA 3KRRA 4M68A 3FL4A 5BYZA 5A4TA 5CVFA 3LQ3A 3LLTA 3UODA 1JOWB 3ANRA 3FHRA 4WBOA 4R1VA 2IZTA 4L6QA 3CE3A 2ZV2A 4CKRA 3UPXA 4G17A 3MDYA 4HNIA 4IEBA 3ANQA 5DT3A 4KAOA 3HV7A 4MF0A 3PSBA 3CGOA 4AFEA 4K0YA 4C2WA 5AP2A 2E9VA 5JEBA 4EKKA 3F2RA 4E93A 1QMZA 4FI1A 3G33A 3THBA 5HE2A 4L3LA 3LHJA 3ORLA 4U9AA 1RJBA 4DLIA 4XX9A 1XJDA 3DKFA 4CEGA 2ZFYA 5I9XA 2ZOQA 5HI2A 1Z57A 3U4WA 4D58A 4BGGA 4G3GA 2I0VA 1KE9A 4BDIA 5J7BA 5KCVA 4JX7A 4FSMA 2G2FA 4DFUA 4IVCA 1RE8A 4F9YA 3FZTA 4E73A 2CLXA 3LCTA 4DGOA 4IADA 2WMQA 2YCRA 1YVJA 3OXIA 4BTJA 4E1ZA 2XARA 4FV6A 2XAOA 5EDPA 4UMRA 3HV5A 3VW6A 3RCDA 4F9AA 2CCHA 4FSUA 3RK5A 3GUBA 4FV9A 3UP7A 2C6LA 1XO2B 1IRKA 1Y57A 4WUNA 4CFUA 1KOAA 2QOKA 1V1KA 4S34A 4UWYA 5JGAA 3KMUA 5L6OA 4B0GA 4F9CA 4ZSLA 2VTRA 2HWPA 4NW5A 4BRXA 4ZSGA 3LM5A 2YABA 3KKVA 3QA0A 4KSPA 4BL1A 4D2VA 4I0SA 3W32A 1ZMUA 4ZMFA 5J9ZA 4QYGA 1LEZA 2UW8A 4JNWA 2WIPA 3VRYA 2J51A 4YJVA 4EUTA 5K9IA 3QL8A 4LGHA 3CBLA 2JIUA 4AQCA 4TWCA 4AA5A 3R83A 3F5GA 2X7OA 4GT5A 3OXTA 4UB7A 3NUAA 4ZTSA 1J3HA 4PV0A 4ZJJA 3CTJA 4D1SA 2X7GA 5AX3A 1H1QA 3IDCA 3FLYA 4G2FA 4FV0A 3CLYA 5AUUA 4ZMEA 2VO6A 1L3RE 5M4IA 2BUJA 4HCUA 3RJCA 5H8GA 4XG3A 4EWQA 3EQRA 2VTIA 4RJ7A 3SGCA 3W0SA 2KULA 4L44A 5EKNA 5LJJA 2C5YA 3QUEA 4TWOA 2CNQA 4DH7A 3ZO3A 1QPCA 2ZM3A 3QZGA 4GK3A 3QGWA 3UOHA 5HBEA 4FSYA 1BL6A 4IM2A 4NJ3A 3DB6A 2JAVA 4BCNA 3E63A 2Y6OA 5CU3A 1SZMA 3RPSA 3F2AA 3I6UA 3TDWA 5EK7A 4RZWA 3R1SA 3VUKA 1APME 4E5WA 2WEVA 4R6VA 1GIJA 3JVRA 4LI5A 3GNIB 3NFGB 4XCUA 2VUWA 2R3QA 4QPSA 3LM0A 3RP9A 4B8MA 4O81A 5AV3A 5GZAA 4WO5A 1M2RA 4JS8A 4R3CA 4V05A 4AXDA 5BV3A 3MH0A 2XKDA 2VAGA 3GCUA 3TNWA 1VLRA 2GNHA 3QX2A 4Y85A 3JUHA 4FK6A 4JQEA 4UWBA 4AN2A 4C4FA 4XG9A 1IAHA 3QRTA 1DAYA 4AGDA 3HV3A 3TG1A 4IW0A 4FG9A 2CDZA 3W0QA 3FMKA 5EI8A 2R3OA 4ANMA 2YERA 3VBYA 2E2BA 3HP5A 5HNIX 4O4FA 5GJDA 3EFLA 1BI8A 4FVRA 2HW7A 4YZBA 2X0QA 3SXFA 5J5SA 3WOWA 3ZLWA 2OKRA 3Q9YA 4OTRA 5K5NA 3OF0A 1R39A 3UOJA 4AZFA 4HNFA 2QU5A 5IQGA 3F61A 4WNPA 1OKVA 4GT3A 4BDFA 2WZJA 2C5XA 3LFCA 2CN5A 4KSQA 4QMPA 3MIAA 4Q2AA 4ANBA 3GU7A 1XH5A 4MVFA 2HK5A 5EOLA 2OK1A 4ZS0A 2J50A 4A06A 5KBRA 2CPKE 4L3PA 4IWDA 4WG3A 2VWVA 2WMAA 2P4IA 3DBCA 5HICA 4AW0A 4YSJA 3LMHA 3ET7A 2QU6A 2XP2A 3R1QA 5M4FA 1BI7A 4FUYA 4I5PA 4HZRA 1JAMA 3UMXA 3I6WA 5CTPA 3L1SA 3JR1A 2XJ2A 3RKBA 3R1YA 2BKKA 5DYJA 2R3LA 4D4RA 2YCQA 2RG6A 5M53A 5HOAA 5AR3A 4EZ3A 1W84A 3Q4CA 3SOCA 2RFSA 3IKAA 3MWUA 3BWJA 3MGYA 2OZAA 3FSFA 4MF1A 2YHVA 4LYNA 2ACXA 4QP1A 5HO6A 4C4JA 3GC7A 5LVPA 2VTOA 3HNGA 3F3TA 3K5UA 1FPUA 5E91A 4ZZNA 3DFAA 1UU3A 2Q0BA 4FSZA 4IVBA 4OTWA 5EOBA 5CU6A 5C27A 3RZFA 3S3IA 1YDSE 2GTNA 4Y5QA 5CAUA 5IA1A 4ZTHA 4FYNA 4QYEA 2X0GA 4FTTA 3NYOA 5FTQA 3HMOA 1ZOEA 2WMBA 4BHNA 4XH6A 3UYSA 3SA0A 3EN4A 4XG6A 2BALA 5C26A 2JKMA 4YZCA 4QTEA 2CGUA 5KKRC 4PMMA 3FUPA 4FG8A 1UNHA 4X3FC 4FIFA 3D7ZA 3Q6UA 3QQGA 1W2CA 3W2OA 5JK3A 4GW8A 2CGVA 3HECA 4EHVA 1SVHA 2CKEA 2YDJA 1URCA 4MUQA 2XK4A 2O2UA 4AW5A 3DLZA 3CY3A 1P2AA 4W4YA 2C1BA 4XRLA 2WTWA 1YDTE 3MV5A 3R2BA 2GSFA 4QP9A 5F9EA 3KGAA 5AP3A 4CZYB 3LFAA 1OITA 1K9AA 2GHLA 3ODYX 3O8UA 4DFYA 1S9JA 3Q9XA 5FD2A 1Y6AA 3TACA 5AM6A 5C03A 3NVMB 3HZTA 2YIWA 3CPBA 3DS6A 1OVEA 1KOBA 4EONA 2ETRA 3TUDA 4D1XA 3OUNB 2A98A 3NEWA 3QD0A 5DOSA 1L8TA 2BFXA 2ETMA 2JGZA 2QG7A 3HLLA 4YHTA 4DT9A 3VS2A 2XBJA 4QOXA 5A4EA 3KXHA 4Y5HA 4DDGA 3VBTA 3FKLA 3PIYA 1MRVA 2QR7A 3FC2A 4PDPA 1OPKA 3BLHA 4WKQA 3G6GA 3SD0A 1NXKA 5CS6A 3NCGA 2WTDA 5HVYA 3ODZX 4BCKA 4TWNA 2WMUA 2RFNA 4IM0A 2OXYA 3EMGA 3P4KA 4YJSA 4DEAA 5HG8A 3U6JA 1O6LA 5C8KA 4QTCA 1JWHA 2VO3A 1KV1A 4KIKA 3O7LD 3KK9A 3LW0A 3NW5A 3UTOA 2GNIA 4BICA 3H0YA 3KULA 2REIA 4QP2A 3PSCA 2RSVA 3Q5ZA 5JFSA 1GNGA 3VS1A 1ZXEA 2JBPA 3IGGA 5CI6A 3MI9A 5C1QB 3QZHA 1GZOA 5C8NA 2IW9A 3FBVA 4WD5A 3U87A 4H58A 3OMVA 4D4VA 4F64A 3C4EA 3DK6A 5EYDA 4MK0A 3S1HA 3R8PA 5BYLA 1ST4A 1PXKA 4CTCA 5HIEA 2YWVA 5DG5A 2XEYA 3LPBA 3GC8A 4WSYA 5ANGA 3W2RA 4BCHA 2QQ7A 2HELA 4JRNA 3KRXA 3HA6A 3IQ7A 3DGKA 4F70A 4D5HA 4KBKA 1ZYLA 2W1ZA 3LQ5A 4EBWA 2V5QA 4LMUA 1JKKA 3NSZA 3T3UA 4BDAA 4RPVA 3MVJA 2C6KA 2IW8A 1CMKE 4M7IA 5AUYA 1YXUA 3EQHA 3EN5A 4DLJA 3G0FA 5IQDA 4FX3A 2W96B 3E7OA 1YI4A 4EOKA 2QVSE 2VWYA 1SVEA 4RWLA 2IVSA 1UU7A 3O8PA 1M14A 2UW6A 4U97A 3ORKA 3SV0A 3PTGA 3LCDA 5HHWA 4KKEA 3B8QA 4A4OA 1IAJA 2FA2A 3BE9A 4I4EA 4K8AA 2YWPA 4W8EA 1GZ8A 3UO5A 3HRFA 2CKPA 3PFYA 4WBBB 4QYFA 5LVMA 4D55A 4WOVA 4AAYA 3EB0A 3GBZA 2QOIA 2XCKA 3IW5A 3U9CA 4E7WA 4RX8A 3TNHA 3P1AA 1XMLA 3UZPA 4OT6A 1H25A 1OB3A 5AIKA 2HW6A 4PDYA 1SM2A 3VRZA 5HNBA 1W0XC 3WYXA 4YBJA 3LFBA 3VIDA 3N4UA 3MPMA 3KRJA 4BYIA 3KA0A 4PQNA 3BELA 2VTPA 5HZNA 4ITJA 3SXRA 4YURA 1IG1A 3MW1A 3F9NA 2IZSA 4AOJA 2ITUA 3LFDA 4XBUA 4FG7A 4NEUA 4F7SA 4GT4A 2XK9A 5FG8A 2QI8A 5CAQA 3BHVA 3QWKA 5HBHA 2JC6A 3BQRA 3W8QA 1ZY4A 3EIDA 4K6ZA 5HE0A 4C4IA 4G3FA 2XANA 2A19B 5DPVA 3WF6A 2PVYA 1H0WA 2CN8A 4FT0A 2PTKA 4GIHA 5D7VA 3VO3A 3BU5A 4UYAA 4DEBA 2ITOA 3FPMA 3QCQA 4NCTC 5CWZA 4UMQA 4EOSA 3HL7A 3PVBA 4BHZA 4F63A 1FINA 2XJ0A 3MESA 4JOAA 3NNXA 4NCTA 4QYHA 3KXMA 3QQHA 5EFQA 4DFZE 3P86A 1U4DA 3W8LA 3ZOSA 3V8SA 4FT3A 3U55A 4APPA 4DG2E 5L2IA 5EI2A 3CTHA 2R3RA 5KNJA 1AQ1A 2X6EA 4QEBA 2Z60A 3OVVA 2BTRA 2YAAA 3KL8A 4ACMA 4IVDA 5EHOA 4FIIA 4QDVA 4J99A 4O0VA 3QTRA 3CJGA 5CSVA 5LVLA 4C34A 5IQEA 4DGNA 3ZLYA 2OSCA 2XK6A 4G31A 4OW8A 2VV9A 2HZ0A 4TYIA 1GOLA 1DS5A 3JVSA 1Q3DA 3A7JA 4HVSA 5BUEA 4QMZA 5E8TA 5L6WL 1Q62A 4J97A 5E92A 3G0EA 4A4XA 3LIJA 4U8ZA 1FBNA 4PPBA 3OC1A 4PNIA 3TM0A 1Y8YA 2AC5A 2RGPA 2YDIA 3A7HA 4R1YA 2B9JA 3HKOA 2XKCA 3QYWA 4UX9A 2BAKA 5AP5A 3DBQA 4R8QA 3WZJA 1KUTA 4O0UA 4U44A 2VWXA 4X2GA 5HIDA 4A4LA 2CSNA 4GU6A 4ALVA 3TIYA 4X6RA 4IJPA 4XJ0A 3DAEA 4ZEGA 4TPTA 3ORTA 1FQ1B 4RSSA 5HVKA 4EH4A 1OKWA 4FBXA 1ERKA 3DAJA 3ORPA 4FIGA 1CTPE 4M0YA 3BCEA 4LGDA 3O71A 5LXMA 4QP7A 4WNMA 3L8VA 2WTKC 4IHPA 4NW6A 4EYMA 3DJ7A 2XMYA 2YIYA 3JXWA 3P79A 4M84A 1QPJA 1P4FA 3NDMA 3DBEA 4U81A 5HU9A 5IZFA 4O82A 5DE2A 2JITA 5M4UA 1OIYA 2W9ZB 5I9ZA 3QGYA 1BKXA 2PMLX 5AP4A 3OWKA 3PA4A 4MXZA 4ASXA 4BFMA 2PVRA 4QNAA 4RJ5A 5I3OA 4IANA 4KBAA 3FMEA 4JDIA 5DIAA 4C35A 2PL0A 3H10A 4EOJA 5IA0A 4FYOA 5CQWA 1UWJA 4RFYA 4D2PA 5J7HA 3DFCB 3LJ1A 3NUPA 1WAKA 4FTLA 3W18A 1YOMA 4RX5A 3L9PA 2PUPA 5E1EA 5IISA 3QCXA 5KKRB 2XA4A 4EZ7A 1TQMA 1UKIA 4YZ9A 2DUVA 4BDJA 4X3FB 4QQJA 5CAPA 1FVVA 3PXZA 5FXRA 4DHZA 5JSMA 3ORNA 4BI0A 4R78A 3NYVA 3V5PA 4MXAA 3MBLA 4NWMA 3RK9A 1CKJA 3MFTA 5T68A 3TI1A 3R8ZA 4LFIA 3R00A 4EK4A 5HD4A 5IMXA 3TL8A 2PMIA 1U54B 1SVGA 1M17A 1M52A 1WBTA 4DFXE 4FSNA 1HCKA 2QHMA 3EQCA 2HZ4A 3DJ5A 3I60A 1SYKA 3K3JA 4D4SA 4GRBA 2WEIA 4KABA 5CU4A 4BBEA 4OTHA 1YHSA 1VZOA 4CFFA 2VGOA 3F82A 4FIEA 3W55A 2XEZA 4D0XA 4DBXA 1FOTA 1RW8A 2NPQA 5E7RA 3N4TA 3FXXA 3TNQB 2VWBA 2C6EA 3LJ0A 4BIBA 1REKA 1OPLA 3F7ZA 3QUPA 5BVNA 3FLSA 3KXXA 3OEFX 3PE1A 3QTZA 5H2UA 2V62A 4YNOA 4AA4A 4MYGA 2GDOA 2J4ZA 2GU8A 3FE3A 4RWIA 4BBMA 3QU0A 2IO6A 2C6TA 2GPHA 2I7QA 2XK8A 4DHFA 3L9MA 1FVRA 3QCSA 2NNWB 2HZIA 2W0JA 3FSKA 4TZRA 3BEGA 5BUJA 3P08A 2R3GA 3W0OA 4E4LA 1E9HA 3H0ZA 1GY3A 1P5EA 2QKRA 1M2QA 1PMEA 4QMSA 5G1XA 5G6VA 4FV4A 3FMJA 3P78A 4RFMA 4ANQA 4V04A 3NYXA 1JKLA 1ZOGA 4MHAA 5E8XA 2VZ6A 4H3BA 4LUEA 3PRIA 2HXLA 3ATSA 3KCKA 3KULB 2XVDA 4O38A 5GJGA 2YCSA 3PIXA 1MRYA 2VD5A 3P0MA 3D83A 2XKFA 1YWVA 4XBRA 3Q3BA 5KO1A 2ITPA 3GB2A 2OLCA 4HGEA 4HYSA 4O1OA 3LXNA 3KRWA 3O23A 5HLWA 1NVRA 1OL6A 2ZM4A 4H39A 3KY2A 2UZLA 4WRGA 3RINA 1WVYA 2A0CX 2F57A 2W9FB 2BR1A 3HMIA 1B6CB 1YW2A 4FTUA 4ITHA 2XYUA 4YLKA 3GENA 3WIKA 1BYGA 2VTHA 3LXLA 1KE5A 4BCIA 5KE0A 3TEIA 1H8FA 3DXQA 4LRKA 4DEDA 4GFOA 4M67A 1MP8A 4IX5A 2PMNX 3OTVA 4EOQA 1PRYA 3ZLXA 4UXLA 4X0MA 4NM7A 4ACHA 4ZLYA 3WZKA 1W83A 1HCLA 4EYJA 4FL2A 2GNFA 4FA2A 1Q97A 4K33A 3QC4A 2JKKA 2J0IA 3BYVA 2UZBA 3PWYA 2OJ9A 5IH6A 2A1AB 5ANKA 1UNLA 2R3MA 3UOLA 3U51A 5IQCA 2OBJA 4DCEA 3ZFMA 2QURA 2VWIA 4GYGA 3IK3A 4UMUA 4M13A 3SRVA 1IA9A 3ZBXA 3PPKA 4K9YA 4JBQA 4X2KA 4NFMA 5HX6A 3UZRA 3LFEA 3DJ6A 2WFYA 4BTMA 5EHYA 4L7FA 4UY9A 3KMMA 3CS9A 4IZYA 3W2PA 4AAAA 2IJMA 3QTWA 4P90A 1YWNA 3GVUA 2PULA 2Y6MA 2H8HA 3KCFA 1YQJA 4E26A 3R0TA 1ZLTA 4NKSA 4CFMA 5HGIA 3FZ1A 3GC9A 3F5PA 2UZOA 4RC4A 2ZB1A 5KUPA 4DT8A 2IF8A 3I4BA 3RVGA 3TZ9A 4HGSA 3RBWA 3R7YA 3EL8A 5KMIA 1BLXA 1IEPA 1H1RA 4O91A 4ANLA 4NFNA 4U43A 4JT3A 4O0XA 3DV3A 4F1OA 4JMQA 4CT2A 3E8NA 4FNXA 5M44A 3O51A 5C01A 2BILB 2ERKA 2JLDA 2R3JA 2C5VA 2UW4A 5DNRA 2GMXA 4J52A 4PTGA 1H26A 3MS9A 4QTBA 5LMKA 3OWPA 1OKYA 4YLLA 5AV1A 1OUKA 1XH4A 2VTJA 3NR9A 3FMLA 4RIXB 4K18A 3KVWA 3DAKA 4D5KA 3UDZA 1OUYA 2W1FA 3MPAA 4EC8A 4AP7A 3UJGA 2OXDA 3FMHA 4E6QA 4BCQA 2CNVA 4FE2A 3IPHA 2PVHA 1WBPA 1GIHA 1PYXA 3EZRA 5EW8A 3RAHA 4C3FA 4ZJIA 3E7VA 2ITNA 2ITXA 2J0JA 5IPJA 4M12A 2BFYA 2X39A 2ZDTA 3NAYA 4ZP5A 5FEEA 3PXQA 4A7CA 3OZ6A 4PL4A 2XH5A 2QOQA 4CD0A 3ZM9A 4LRJA 5K4JA 1W2FA 3LCSA 5CEIA 4IB0A 2WELA 3KU2A 4EH7A 4FTKA 3S2PA 4I6FA 5HLPA 1R0EA 1SNUA 3ZDIA 2OXXA 4O1PA 4C61A 3E62A 2Y8OA 5HX8A 3V01A 4OR5A 5FBNC 3UNJA 5IF1A 3R7OA 5GINE 2GHGA 5KBQA 3MYGA 1F5QA 2A27A 2F9GA 3FL5A 5L8LA 2VWZA 2F49A 4NM0A 4JVGA 1XBCA 4E5BA 5J79A 4IM3A 4QRCA 3VUHA 1ZOHA 4X2FA 5DRDA 5TT7A 1HOWA 3BU6A 3O7LB 3VULA 5IUHA 5L2TA 2O8YA 4O27B 5H8EA 2P3GX 4M97A 4XV2A 1UU9A 3NFFB 4D0WA 4I0RA 4F1MA 4H1JA 1YXTA 4CCBA 3DKGA 3VUGA 4C62A 3GCVA 1OL2A 2IW6A 3NNWA 4TKSA 1OECA 4IZ7A 4RC3A 1RDQE 4XRJA 3AXWA 4Y72A 1K3AA 3ELJA 4ITIA 2G01A 4QTAA 3FPQA 5DMZA 5CENA 1PKGA 3AC3A 4O83A 2R9SA 1M7QA 5CXHA 2WTKB 5DT4A 5BVOA 5CEOA 1E1XA 4DGMA 5I9WA 2VTSA 2CNUA 4BWPA 3R2YA 4I22A 2O63A 3F69A 4JI9A 1Q8TA 5E8VA 3VHKA 4OTQA 4HW7A 3DBFA 4RA5A 2B0QA 3C4XA 4EH9A 4EOMA 4YTCA 4AOTA 4NJDA 4F99A 2BAJA 3R71A 3UZTA 1A9UA 3BZ3A 3EHAA 4QYYA 2W1CA 1JSUA 4E6DA 3PJ8A 5CF5A 1Q5KA 3G51A 4L53A 5KX8A 5LCJA 4PF4A 2ZJWA 3U8WA 5L4QA 3I0OA 1UVRA 2CGXA 3R1NA 4IZAA 3G90X 3PXFA 3GU5A 1FGKA 1OPJA 3AC4A 3CP9A 3FI2A 5CEPA 1S9IA 3I5ZA 2PVNA 1OBGA 4YR8A 4R3PA 5DRBA 4DC2A 5L2WA 4L8MA 1ZWSA 4ZSEA 4RIOA 3E64A 3D7TB 2P2IA 2BDWA 4FV5A 2FSOX 2P0CA 3FQHA 4RWJA 3VN9A 5I5ZA 2ONLC 4FV1A 2UW5A 2YLEA 3PY0A 3PA5A 5EHLA 4C37A 4HOKA 4PDOA 4XHKB 1PXOA 2UZVA 4FTMA 1NW1A 3GC0A 4LMNA 2RFDA 2VTQA 3GGFA 3GU6A 4GUEA 3VF8A 4C4GA 4OAUC 2XNBA 4UXQA 4ID7A 3VUDA 4HCVA 4BDDA 3AT2A 2I0EA 2VRXA 4LRMA 4TYGA 4YSMA 4G34A 3ZEPA 4J53A 4YC3A 4AUAA 2QNJA 2X8EA 1PXPA 4ZZMA 4ZY5A 3VONA 5DBXA 4RJ6A 5IU2A 4II5A 5L6PA 3OTUA 3F7WA 5ETIA 4F7NA 4ZOGA 3OOGA 5L8JA 4E4XA 4I6QA 2W99B 2KTYA 4C38A 5GZ8A 4DEEA 2W1HA 1PXLA 4EK5A 3R21A 2NRYA 4P4CA 3QQLA 4QMUA 2GFCA 3OCGA 4IXPA 4F9BA 3CD8A 5KMLA 3W0NA 2GQRA 3C0GA 5AAGA 2F2UA 2WOTA 3NS9A 2X2MA 5FM3A 2C3JA 4EQMA 3MPTA 2WU6A 4AZSA 3KFAA 4RRVA 5I4NA 3LCKA 2ZV7A 3RM7A 2XNMA 3U6IA 5CU2A 5DWRA 2X2KA 1JBPE 2IVTA 4F7LA 4YTFA 4FKTA 4R7HA 2J5EA 4JXFA 2OO8X 3BPRA 1BMKA 3ZS5A 2WQOA 4EHZA 5CNOA 3S95A 2QOFA 3EN6A 4ACGA 3MFRA 3R01A 4L7SA 3R7VA 3TNPC 2R64A