4MBJA

Human b-raf kinase domain in complex with an imidazopyridine-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
269
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Imidazo[4,5-b]pyridine inhibitors of B-Raf kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 62
structure length 269
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mbjA01
2EU9A 3AD6A 4FSNA 5HG5A 4AW0A 2C3JA 1OKVA 5EI6A 3HUCA 4CTBA 3RBWA 3D83A 4GK4A 4E6DA 3DS6A 4XX9A 1YXUA 3HV6A 5EM7A 4UMRA 1NW1A 2PZPA 3QQJA 3SG8A 4PDYA 4GKHA 4EBVA 1JNKA 4J98A 4FICA 2XBJA 2GNHA 2C1BA 3GFWA 3LCSA 5A6NA 4NKSA 4BDHA 4XRJA 4FYNA 4O86A 2CGUA 5CVGA 3ZONA 5M08A 3PZEA 2BPMA 2XH5A 3VHKA 4IJPA 4FZAB 5A4QA 3FMNA 3LFQA 2BRMA 4FR4A 2PWLA 2JAMA 4GJ2A 2XNEA 1Y8YA 4MNEB 4ZZOA 4NWMA 3E7OA 1Q24A 3ENHA 1PMNA 5GHVA 2W1EA 2G01A 4UY9A 4EL9A 5A4CA 1UNHA 3WF9A 4BGGA 2ITTA 2G15A 3FLZA 2W7XA 3R2YA 3LAUA 2BCJA 5L2QA 4AN9A 2HW6A 1GZNA 4DGMA 3NW6A 5J1VA 2PSQA 4IAIA 5ANOA 5A9UA 4EH9A 3OC1A 3LPBA 4AS0A 3TI1A 2BAQA 4BDKA 4QTAA 4FL2A 3VC4A 4UMPA 2VWWA 3EN6A 3VUIA 4J95A 4BR3A 3GXLA 3R6XA 2JKMA 4P7EA 3FZOA 5DHJA 3QHWA 3V3VA 2W1GA 2ONLA 3FMDA 1GZOA 5HGIA 1JSVA 4Z16A 3VS2A 4FGBA 3GCPA 4EOOA 5AADA 3RHXA 4L53A 3UG2A 5LVOA 2OJGA 1XBBA 2Y9QA 4C4JA 5KKRB 3S0OA 2O65A 3KN6A 4IWDA 5BYYA 2YABA 4ZS4A 1Q61A 3OEFX 1NA7A 2QHMA 3ZRMA 4HPUE 4BDIA 4O22A 5J9LA 4J7BA 3NNVA 4FA2A 4DEEA 5IUHA 2HOGA 4OT5A 3W1FA 4PWNA 2BZHB 3KL8A 5FQDC 2XK7A 5IQEA 4RA4A 1AGWA 3OWKA 1BL6A 3NUNA 4FTQA 3MFUA 5FG8A 4BTFA 4A7CA 4IAAA 2JEDA 4PV0A 4R3PA 3FLWA 4EHZA 4J8MA 4GUBA 2C0TA 3OY1A 3F7ZA 4AUAA 5AP1A 2J7TA 2VV9A 4Y46A 3QX4A 3MN3A 1YQJA 4WA9A 4WG4A 3TNIA 3ET7A 1W82A 4S30A 3VBVA 4Z3VA 3DNDA 1LR4A 1UU8A 4F6WA 2QG5A 1P2AA 3NAYA 4AWIA 1ZY5A 3D0EA 5ANIA 5ANKA 3TKHA 3WIGA 4FNXA 3NX8A 2OJFE 4LRMA 3EQGA 4XG8A 4D1XA 3R7GA 5LVPA 3LZBA 1PMEA 3D4QA 3N51A 4FV2A 4EHEA 3HKOA 4NT4A 3FZTA 5FXSA 2C30A 4FVQA 4LI5A 2F7ZE 3ZDIA 2JDVA 4FZFB 3M42A 3RWQA 2B0QA 4RG0A 2W5AA 3E62A 1E9HA 3KY2A 2HZNA 2BDFA 5IUIA 2PK9A 2IG7A 3TL8A 3Q9ZA 4E5BA 5DEYA 4O6EA 4ZTLA 5FDPA 5DI1A 4DFBA 2RGPA 1X8BA 5J87A 4DH3A 4CZUA 5JN2A 2LAVA 3W16A 4YSJA 3K3IA 2X7GA 4WG3A 4I92A 3QTRA 4AZTA 3OVVA 4WBOA 2W5HA 5AV2A 1Q8UA 3MIYA 4RPVA 2EXMA 1PYXA 2F9GA 2GHMA 4UZDA 3ZO1A 4ARKA 3S95A 4C0TA 2WFYA 4CTCA 3A7JA 4Q5HA 2CLXA 2XS0A 1FMKA 5AP3A 4EK6A 4YUQA 1KV1A 2OJ9A 4QRCA 2XNNA 4DEGA 5DNRA 4BDCA 4D4YA 1Q4LA 1XH5A 2A1AB 1QL6A 2X8IA 4K18A 4YC3A 2AC5A 2R3HA 5CY3A 5F4NA 3ODZX 3GVUA 4IXPA 2XCKA 4I22A 4M3QA 2F7XE 3G0EA 3ZDUA 3HECA 3HMPA 2CCHA 3P08A 4GVAA 4RFZA 4IVAA 2NNWB 5LCKA 1H1QA 3EL7A 1FGIA 3L9PA 3G9NA 4K6ZA 3MWUA 4YU2A 2R3IA 1P14A 3QTZA 3L9MA 4KAOA 4P2KA 2UVZA 1E1VA 4KB8A 3ZM9A 1H07A 4ZY5A 2QOOA 4PTEA 5LARA 3TV6A 2OWBA 2VTNA 4AZSA 2PUUA 2W17A 2YDJA 3Q96A 2ITOA 2WMXA 3VS5A 5T68A 3W8QA 1JKTA 3H3CA 2ETKA 3LCKA 4MK0A 1RQQA 2DWBA 3NWWA 4FIGA 5E8TA 4QMWA 1QCFA 1SYKA 4A9SA 4D2TA 3ITZA 2WTJA 3KULB 3E93A 3NGAA 4ASZA 4AQCA 4DFXE 1FGKA 4ZMFA 3F6XA 2EWAA 2J5FA 3LXPA 1OZ1A 3ORKA 4B0GA 3VULA 5TKDA 2EUFB 1MQ4A 2HY81 5AP7A 2ONLC 4BRXA 4KSQA 1ND4A 3ZO4A 4KS7A 5M56A 2Y8OA 3KF7A 4C62A 3BV2A 4BCOA 3ZC6A 2XMYA 4P5QA 3IDCA 2W9ZB 4QQ5A 4V0GB 4XCUA 3F3WA 4QMXA 3KC3A 3LXLA 4G3CA 3GU5A 4AZVA 1U59A 3ZH8A 2X81A 2WIHA 3ZTXA 3R83A 3FMHA 4R1YA 3PA3A 4F0IA 4I21A 2BZJA 3H9RA 3T9IA 5C03A 3R21A 4AT5A 1Q8YA 5CU6A 4XUFA 2IWIA 2ITZA 4I5PA 4AT3A 2OZAB 2QOHA 4DCEA 4XG7A 4OTFA 4HCTA 1M2PA 4E4MA 3FI4A 3GQLA 2XYUA 4FIIA 4RJ8A 3PPZA 4E4NA 3TKIA 4KWPA 3C1XA 5JRQA 3VUTA 4AGDA 1CM8A 4U8ZA 4FG7A 5K4IA 3WE4A 3C13A 1Q8WA 3ALNA 3FI2A 3P9JA 4IACA 3ANQA 3CP9A 2OICA 3EYHA 4QMZA 5IA5A 5DR9A 4FTRA 4RIWB 4YLLA 4RIXB 4U45A 4JXFA 2JKKA 1GNGA 4IZAA 2IVSA 4TWCA 3EKNA 4V04A 3TV7A 5D7AA 3Q4UA 3AGLA 1PYEA 3D5WA 4I0SA 5DLSA 5B2KA 4JRNA 5JFXA 4XEYA 3EQFA 3LMGA 3FL4A 4K77A 4FGRA 3CIKA 3CTHA 4LOPA 4LQMA 2QOFA 4G2FA 4S33A 5BVKA 5LVNA 1GAGA 2JLDA 3EFJA 5DIAA 5FRIA 5J95A 2EB3A 3AG9A 3UMXA 2CKPA 4YC6A 4JDIA 3O0GA 5HG9A 2PVNA 1H08A 2VTTA 1UV5A 3OBGA 3R9OA 1OPKA 4MXZA 4RJ6A 2WOUA 4FI1A 3SD0A 2OF4A 2IN6A 3BWJA 3UG1A 4ERWA 3KXNA 5IQAA 3ENMA 3MA6A 5AP5A 3JVRA 2R3MA 3I0OA 3PIXA 2FSTX 3QD3A 3QTXA 1U46A 4FMQA 2I1MA 3PVGA 4EK4A 4UB7A 1GOLA 3NR9A 3QCXA 1GY3A 2XK8A 4EH5A 2WMUA 4IAZA 4UZHA 4N6ZA 5KBRA 4GIIA 4USFA 2VWBA 4CCUA 4LRJA 4E5WA 4TWPA 4MD7E 2OF2A 1YWRA 4X3JA 1Z57A 3D7TA 4JQEA 3UOHA 5HLWA 5B2LA 1YWVA 3ZLXA 2XJ1A 3JUHA 2OFUA 4TXCA 2IW9A 3V6RA 3QCQA 4MQ1A 3FY2A 3QZIA 5I9UA 4D2SA 2C3LA 3DJ7A 4Q2AA 5HD4A 2V55A 2VGOA 3BLQA 4L7SA 4BCIA 3QF9A 3VN9A 3ZUUA 5CSVA 4CMOA 3CEKA 4CQGA 1UKIA 1AQ1A 1V1KA 3DLSA 1ATPE 2WQNA 5DG5A 5CS6A 3HEGA 2J6MA 2PHKA 3COHA 3R9HA 5H8EA 4CLJA 4OAVB 4FYOA 2JGZA 4B8LA 2XIZA 4BWXA 3LXNA 4FBXA 4YJOA 4M8TA 3TACA 2JBOA 4XOZA 1OKWA 1VEBA 5F1ZA 3GUBA 1T45A 4E73A 4WD5A 2PE1A 4YTIA 1YDRE 4ZTQA 2ZVAA 4W4VA 4F9BA 4C8BA 2WMTA 3LQ8A 3NLBA 5HKMA 3L8VA 3MIAA 3RCDA 5DVRA 3IGOA 3AT4A 4C33A 5CXZA 3EFWA 2B53A 4HGTA 3R9NA 4AZFA 1XWSA 1AD5A 4FNYA 2WQBA 4F1TA 3VO3A 1PF8A 4MXCA 3UZTA 4I6QA 2KTYA 3PLSA 2PPQA 1ZYLA 4ZJIA 3V8WA 4GFOA 2YM5A 4EWQA 5H3QA 3SAYA 1FBNA 2VTPA 4LL0A 3E63A 3U9CA 1FQ1B 3U6HA 3Q52A 5HNBA 3CKXA 4CZYB 5CEKA 3A2CA 4O1OA 2E9VA 3O7LB 3SHEA 3GC7A 2IPXA 4ANLA 3BCEA 3D15A 4J8NA 3C4ZA 5EW3A 4FT9A 4Z7HA 4D28A 3BHVA 5CAPA 5I9VA 3QL8A 4K9YA 5HG8A 1TKIA 3NYVA 4MHAA 4HNFA 4KNBA 1J7UA 1UU3A 4XG3A 1HCKA 4FTNA 3C0GA 4YPDA 4FEUA 2WQMA 4ZEGA 4ZLYA 4HZSA 1TQMA 3P78A 4GS6A 4FIHA 4CKRA 3H30A 3Q4TA 2Y6MA 3DKGA 3E88A 3Q6WA 2O5KA 4RIYA 4DT8A 3VBWA 3MA3A 4D9UA 3ORNA 3MVLA 3FV8A 2WPAA 4OAUC 5B2MA 1YI3A 2JIIA 2VNWA 2YM7A 2GQGA 3G2FA 4FT0A 1UA2A 4LGDA 4U40A 5JZNA 5HNIX 4KBKA 3E5AA 5CXHA 4IHPA 4X2GA 1U4DA 5FGKA 1UWJA 5HCZA 1FVVA 2VTLA 2IVTA 4QP1A 5DT4A 4ZSAA 5LCJA 4E8AA 3FI8A 2C6OA 2KULA 2VNYA 5C01A 4H1JA 3MVMA 4LYNA 4Z7GA 3SVVA 4BIBA 1JKSA 2O0UA 3NYXA 3O8UA 4C4IA 3SOAA 3H9OA 3K3JA 3T8OA 3PRIA 4FKRA 4QP6A 1MRVA 5L8LA 3BBWA 2A2AA 3ALOA 3QKLA 4B6LA 2BROA 4EH4A 2NRUA 3DB6A 3DXNA 3OXIA 2H8HA 3HDMA 3UDBA 3F82A 3IW6A 3R22A 3BEGA 4BZNA 5E9EA 3AXWA 1KE6A 2IJMA 4YHTA 3HX4A 4KIOA 5AR4A 5FP6A 4PP9A 4QMSA 3PVUA 3QRUA 3VBQA 4JG8A 3JPVA 4RLKA 3BYUA 4W9XA 5A14A 1OIUA 3LM5A 3R8LA 4RX7A 1A06A 4TKSA 2BZKB 4TNDA 1OVEA 4AG8A 3LW0A 2ZV9A 3EQRA 3ZXTA 5AUVA 3GC0A 3FKLA 3U4WA 5IH4A 3FHIA 5ANJA 5JQ8A 3Q4CA 5LMAA 3IO7A 4U41A 4O84A 3E8NA 2NRYA 3Q6UA 3F2RA 4EOSA 5CEIA 3FLNC 1ZYDA 2VTIA 4DLIA 3UOJA 3EN7A 3VRYA 5HVKA 3QWJA 2YITA 4M69B 4ITIA 1U54A 1QPEA 4FSZA 4WKQA 3UP7A 3UJGA 3RPOA 4WNMA 3R02A 4E4XA 4JBQA 5HZNA 5I0BA 5KX8A 2ZOQA 3D94A 3R9RA 4KBCA 4ACGA 2VWXA 4I4FA 2R64A 2X4FA 3DDQA 5TT7A 1XBAA 4BBMA 2QOBA 3EQBA 4ZP5A 2VWYA 5AFVA 2GS7A 3P7AA 5K4JA 3E8DA 4CV8A 3HAVA 1IRKA 3DBQA 1OI9A 2UZUE 5DOSA 3NZ0A 4KIPA 4RMZA 4XJ0A 3PJ3A 4QPMA 1YVJA 3SQQA 3HVCA 4M66A 3COMA 3NS9A 3IOKA 3UVQA 3PPJA 5ICPA 2WU7A 2OZOA 3OWPA 2BTRA 5CWZA 4FV3A 4K1BA 1RE8A 4BKZA 4LUDA 3VUMA 4E26A 4FTIA 3IW5A 5DEWA 4WNOA 3BLRA 2UZDA 3PE1A 1W98A 3QQGA 4OUCA 4RC3A 4K0YA 4EOKA 1NVSA 4L46A 5JRSA 4ZMEA 3C0HA 4F9AA 3QAME 5HCXA 2E9UA 3OD6X 1WCCA 3OOMA 4IAKA 3ZO3A 4FV4A 3EN5A 4LMUA 4O0VA 5D11A 4UMQA 4L42A 1OL1A 3CY2A 2Y7JA 3DT1A 4O27B 4OTHA 2BZIB 2C5NA 3BHUA 5CALA 3RAIA 2EXEA 4NK9A 2IZSA 4FEVA 2WQOA 4BZOA 2XK9A 4PTGA 5LJJA 4E6CA 1YKRA 3AC4A 2XA4A 2GS6A 4G6NA 4W4XA 3KXMA 3FSKA 3BE2A 3JY9A 4IZYA 4HVSA 3CC6A 1J1BA 3LJ1A 5DE2A 2GQSA 5GIPE 5EDRA 3OG7A 4K11A 2QOIA 4IE9A 4BKYA 3EN4A 4I6HA 2W1HA 3OROA 3WE8A 1QPDA 3B2WA 4A07A 2YJRA 4OTIA 3R30A 4R3CA 3OWJA 4RZVA 3LQ5A 3SRVA 4GH2A 3V6SA 4FSYA 4AE6A 3QALE 2BAKA 3SDJA 2YZAA 3U54A 3VQUA 3KKVA 2C3IB 3O2MA 5ANEA 3HLLA 5AP4A 3I6WA 3ZCLA 4YP8A 2UZOA 5DRDA 5HTBA 2ITYA 5CX9A 2P2HA 4I24A 4FC0A 3NYOA 3HZTA 2UW9A 2CNQA 3ZXZA 4FL3A 4BZDA 5FM3A 5JGDA 5JH6A 3H0ZA 4XNEA 1ZZ2A 3C4WA 4R7IA 2YIYA 1JLUE 5GNKA 4F7NA 1LP4A 5I5ZA 4JS8A 5TE0A 2XP2A 4EC8A 3PXFA 2WMAA 3WF8A 2A4LA 4EOIA 2UW0A 3MVHA 3ELJA 3DXPA 4NEUA 3CPCA 4M14A 4W4YA 3MB7A 3EMGA 5EG3A 4FSMA 4H39A 5HNGA 2OKRA 4F99A 3OCGA 4YZDA 5HBEA 3AMAA 3QCYA 3PY1A 4KABA 5L6PA 3Q9YA 1PKDA 2OO8X 4FKLA 2LGCA 1P5EA 3RNYA 2ETRA 3HP2A 2CKQA 5CT0A 4BTJA 2PUIA 4V05A 1MRYA 3S00A 2VUWA 4RWLA 5AR3A 3THBA 3TZ7A 2O8YA 1JWHA 4UWCA 4QPAA 4IDTA 1YI6A 3VS4A 5J7BA 3I5NA 3DZQA 1GZ8A 4X0MA 4JBVA 5HBJA 2ZV7A 5EI8A 4M13A 2ITUA 3NNXA 4WSYA 5KMLA 5EFQA 5DRBA 3R7VA 3KXZA 2ZYBA 2BILB 4NFMA 3UOLA 3UNZA 5C1QB 3C5IA 3A7HA 4YGAA 5AAEA 1LEZA 4BWKA 1CMKE 4F9CA 5DR6A 2CN5A 4EUTA 4J99A 4O38A 2J0LA 3OS3A 5DA3A 1FVRA 4M12A 5A46A 4YO6A 4AT4A 3V5LA 4CGAA 4YHJA 5AA8A 3UNKA 1VYWA 5M44A 3Q3BA 3R0TA 4FT5A 4X2NA 3WILA 4R5SA 3NW5A 4PPCA 2HZ4A 1W0XC 4FV8A 1L3RE 5HG7A 4CSVA 3O7LD 4CT1A 3D2IA 3DK3A 2E2BA 3EZVA 3QU0A 4F7SA 4QOXA 2BDWA 2DUVA 4DEBA 3BBTB 2BFXA 1BI8A 4QMTA 3OOGA 2E9PA 3BI6A 1PXLA 5FDXA 1BMKA 4XOYA 4GV1A 2BRNA 2XM9A 3PVBA 3BWFA 3TNWA 5AV4A 2C6TA 4E20A 3V5JA 3PWYA 1URWA 4L6QA 4MKCA 4PNIA 3I5ZA 4YLJA 2HYYA 2VN9A 3RM7A 1XH7A 2H9VA 4GKIA 3KQ7A 2JFMA 3DBEA 4MH7A 4EH7A 4Y85A 4JL9A 1ZOEA 1GIHA 4FTUA 3PFQA 1W83A 5A4TA 3CD8A 1H1RA 3FUPA 2IZUA 3OCBA 3ZS5A 3PP1A 1WFCA 4BGQA 5IH6A 4FKUA 5JFWA 3U6IA 1ZWSA 2BDJA 3PUPA 4BYIA 3E92A 3P23A 4G6OA 2CJMA 5BUJA 4KS8A 1SM2A 3R63A 4S31A 4FUYA 5J5TA 5E1EA 3QRIA 4YJQA 2J9MA 1Q8ZA 3VHEA 2I0HA 5IA2A 4XV9A 4X2KA 3FQEA 3GI3A 3VQHA 4WG5A 2OU7A 3C4CA 3ZFMA 2W1ZA 2GSFA 4RWIA 4ANSA 4BBFA 2OXXA 4DH7A 4LV5A 1ZOGA 4E3CA 1XO2B 4FSWA 3CS9A 3ZRKA 3IW7A 3TXOA 4B99A 3MI9A 3UIUA 5CF5A 2J0JA 4YJVA 5HLNA 2B9HA 2PY3A 4QP4A 1RJBA 5JEBA 2YCQA 4J96A 5KCVA 1ZLTA 3FBVA 3F7WA 4G3EA 1UNLA 2PMOX 4ZK5A 2XIYA 2XKFA 4IZ5A 5HO6A 3GCQA 4BKJA 2JDOA 3EHAA 4GT3A 5K3YA 3RPVA 5A3XA 1J7LA 3O96A 3KRLA 2CDZA 5EW9A 4IADA 5CENA 5D1JA 4IMYA 4FNWA 5HOAA 4GFGA 4KIQA 4GK2A 4R7BA 5AA9A 2HWOA 2CPKE 4TWNA 4JBOA 3UTOA 5IUGA 4FTMA 2PVLA 3RAKA 2BIYA 4HYSA 4JT3A 4S34A 4FTKA 4MYGA 2B4SB 2OBJA 4IEBA 4L67A 5IDPA 3ZHPC 5M07A 4OGRA 4D4SA 4AW5A 3EFLA 5JK3A 3AC5A 4FSUA 5DT0A 2PE2A 5CEOA 3PJ2A 2C5YA 3TIYA 4M15A 2AYPA 2RFEA 4XV3A 4BVUA 3F3UA 2OXDA 4UXLA 4ALWA 3IK3A 3NCZA 5LXMA 5AWMA 4JLCA 3E3BX 3QKMA 3R8VA 4L45A 2AUHA 3UGCA 4FTJA 5AR2A 4F1OA 5ETIA 2QO9A 3IW4A 3MJ1A 4HNIA 5EW8A 3TJDA 4DEIA 5FBNC 3HA6A 2I0VA 4W8EA 5EKOA 4BDFA 1VJYA 3TIZA 1KOBA 3JVSA 3LIJA 4RX8A 4FEXA 5M06A 4IDVA 3ZFYA 5HIEA 5T3QA 5GIOE 2BKZA 2GHLA 2OIDA 2O2UA 4HVIA 3JYAA 3CQWA 3PJCA 4MQ2A 3U6JA 5H9BA 3RP9A 2ZV8A 4I5HA 5AUTA 2JDRA 4JR3A 2FH9A 3LCDA 4NSTA 2RFDA 3KMWA 4O83A 5C26A 5HD7A 3DNEA 4QP2A 4N6YA 2NP8A 4WNKA 4E6AA 4F9YA 2GQRA 4I6BA 4R77A 4HOKA 3R9DA 4KRCA 4TYHB 3QD4A 3VUGA 4U3YA 4C58A 3I6UA 1G8AA 3W33A 4MNFA 3EJ1A 1XQZA 5FP5A 3O51A 2I0YA 3ACKA 4MXAA 4H58A 2BKKA 3ULZA 2X9EA 2YCRA 5IQGA 2VO3A 4IM2A 4CKIA 5EM5A 3CLYA 4AGCA 5CF8A 5DN3A 2PMIA 4WRSA 4XRLA 2C5OA 2WTVA 4GRBA 3D5UA 3ZM4A 4A4LA 2BHHA 3CQEA 4QMUA 4RIOA 4NM3A 3KB7A 2J2IB 3C7QA 5AV3A 2OJIA 3D7TB 3LFBA 2W4KA 2G2IA 3BRBA 3OTVA 4FSTA 4D55A 1O6LA 4FUXA 1XH8A 3UIMA 4C38A 4PL5A 4BCMA 4ZOGA 5FBOA 5IH5A 5KZ0A 4LG4A 1YOJA 2CMWA 4F6SA 4XH6A 4FTLA 2PU8A 2R9SA 2JFLA 2OH0E 1M14A 2XNOA 4L3PA 4PNKA 5E8YA 4RGJA 1G8SA 4FODA 4ANOA 2CNVA 2H6DA 2X2KA 4EZ5A 1YHWA 3QZHA 5GINE 1DAWA 1GIJA 2PMNX 3UMWA 2VO7A 3DV3A 3HP5A 5AEPA 4YJPA 5CSXA 4ZAUA 2RKUA 3NUUA 4O96A 3DXQA 4EOQA 3IQ7A 3GQIA 3DBCA 4EK3A 5B0XA 2VTJA 2RFNA 5HE3A 1XR1A 2R0UA 5AAGA 3TG1A 1PHKA 4ASEA 2NPQA 3LQ3A 1WBTA 3UYSA 1M2RA 2PYWA 2ZAZA 1ZXEA 3D5XA 2CGWA 4NM7A 3FL5A 3NVMB 3HDNA 4HPTE 2OJJA 5H2UA 4CV9A 5CVHA 4NU1A 3O8TA 4X3FA 4IWQA 4FIEA 4LOOA 4IB0A 3SV0A 4KUJA 4I3ZA 4NM5A 4ENYA 3O23A 4RFYA 5C4KA 1ZOHA 3HA8A 3KXXA 4A4OA 1OPJA 3LLTA 5HX6A 3VIDA 4NIFA 3A99A 4O1PA 3SXRA 2Q83A 4JVGA 3C4EA 4UYAA 4ONAA 4KSPA 4IW0A 4L00A 3CXWA 3CE3A 2OH4A 4EH2A 3MH3A 3D9VA 5M4UA 1YRPA 5EQPA 2FSOX 4CFUA 2WU6A 4FF8A 4GT5A 1O6KA 4ZSJA 5HO8A 3BLHA 3SLSA 1UWHA 4DA5A 4TY1A 1H27A 4JX7A 3TUCA 3A8WA 2XZSA 4J71A 4YPSA 3AC3A 3COIA 4ZS0A 3BX5A 3DKFA 2VTAA 3QA0A 4I6FA 3KREA 4XV1A 5CAOA 3EIDA 3VW6A 2X7OA 3OFMA 4ID7A 3O50A 4YNEA 3FAAA 3ZSIA 5FWKK 2XF0A 3PWDA 3AOXA 4QYYA 2J50A 5AR8A 2IW8A 3W2CA 4RIYB 4PY1A 4L01A 4MCVA 3KMMA 3R7YA 5EKNA 3HL7A 4DTAA 2WMQA 5FLFA 3HRBA 3TDWA 3P5KA 5J9YA 3ZUVA 5AX3A 5K5NA 3CBLA 3ORIA 4F1MA 4RWKA 4EOPA 2WAJA 3E64A 3RNIA 5LMKA 3G6GA 1H8FA 2HELA 4ZTSA 2GDOA 4DN5A 1DS5A 1M7QA 4BCQA 4N0SA 3C4FA 4RVLA 4MWHA 4DFYA 4PPBA 3LMIA 5HQ0A 1Q62A 4ZTRA 3W2RA 3C0IA 4ANMA 5I3RA 3EWHA 4H3BA 4PMMA 2DYLA 2FVDA 1UU9A 5C27A 3SXSA 2V7AA 3U87A 5CASA 4DEDA 4M97A 4OT6A 5HCYA 2HZ0A 4JIAA 3FMMA 4FIFA 1H1SA 5I9ZA 2QG7A 2WEIA 4TYGA 3CQUA 2QKRA 1KE8A 3VS6A 4MXYA 1BKXA 2FB8A 5A6OA 2R3FA 2QOLA 4WOVA 4EQMA 2QOQA 3B8QA 4JNWA 5CAQA 4CMTA 3UZRA 4HVHA 3Q5ZA 3UBDA 4BDDA 2UW5A 3F3VA 1ZYJA 3TN8A 5KMJA 3U8WA 4EOLA 5CU3A 4Y5QA 3RM6A 2QI8A 4F63A 2R3GA 2WD1A 3A60A 4C3RA 3F2NA 3GOPA 1JSUA 1S9IA 2BR1A 4O0TA 3I79A 4DBNA 3LM0A 4C36A 3PDTA 2GTNA 4RRVA 4FKIA 4IJ9A 5EYCA 3DB8A 3GCSA 2ITPA 3A61A 3CPBA 3RTPA 4ORKA 1T46A 1VR2A 4U42A 5AP6A 3DDPA 4EKLA 4AP7A 1U54B 1XH4A 4JRVA 3QLGA 2QO7A 4U80A 2RL5A 5CLPA 5LOHA 4YZNA 2YM6A 3GENA 5FUTA 3QBNA 3CCNA 3H10A 2C47A 3NAXA 4IB1A 2QLUA 3F3ZA 2HIWA 4C57A 5IG1A 5DWRA 3DAKA 2Y4IC 3W2QA 3FEGA 1JKLA 4FK3A 3OXZA 4R1VA 4DTBA 3FDNA 1ZMUA 4UN0C 4KINA 4G6LA 4MEDA 4YZCA 4O7YA 3MH0A 1R0PA 2WMWA 4O21A 5HICA 3FZSA 4IX3A 3JY0A 1Z9XA 3MPAA 3M11A 1OIRA 2J4ZA 2WXVA 3CD3A 2A19B 4QNYA 5HU3A 1OB3A 2C6EA 4PMTA 1K2PA 3F61A 4KKGA 5IMEA 5CANA 1WBWA 3HV4A 2GNIA 5KE0A 3VNTA 4AACA 3RJCA 2CGVA 4QNAA 4Y8DA 2FYSA 5IA1A 3MFRA 5AIRA 3TEIA 3QYZA 3WIKA 4ACCA 2ETMA 5BUEA 5T6KA 5JFVA 5CU4A 3FYJX 3BKBA 3DBFA 4MBIA 5LWMA 2CHLA 4QP9A 4X2JA 5E90A 1YWNA 5AUYA 3ZEPA 4D0WA 4F0GA 1J1CA 4BHNA 4PMSA 4UV0A 4B4LA 3DU8A 1P4OA 2YWPA 3D5VA 4U43A 1JOWB 3UQFA 3MV5A 2YACA 1F0QA 3BE9A 4FV7A 4BCFA 5JZJA 3SOCA 5AP0A 3QTUA 4AA5A 4AN2A 4P4CA 4NFNA 2QNJA 4EWHA 3KRRA 4D5HA 4O0WA 2X8DA 3PY3A 2J5EA 5CTPA 1BX6A 4IIRA 4E1ZA 4EC9A 1OMWA 4TL0A 4DGOA 3QQLA 1OM1A 2WMSA 2WTKC 1Y57A 5HO7A 5AJQA 2IW6A 2BRBA 4WO5A 1G5SA 2QU6A 2V62A 2HENA 3FLYA 4KIKB 4UEUA 3UC4A 2PL0A 4D4VA 2F2UA 4JG7A 3SRVB 3EN9A 4RC2A 4YZMA 3K5UA 3D7ZA 3ZEWA 4DH8A 3UQCA 3R8PA 4DYMA 5DGZA 2W1CA 3SGCA 4BIEA 3QA8A 1IG1A 3VUKA 3I0QA 3P4KA 3R7OA 4UYNA 2G2FA 4CVAA 2F7EE 4EONA 2ERKA 2WTDA 3DPKA 4AXAA 2FO0A 4A9TA 5AUWA 3RWPA 4D2WA 4CNHA 2CSNA 2XM8A 5EK7A 2GHGA 3R28A 5DT3A 3VWAA 4WNPA 3E7VA 4CYJA 3EH9A 2QURA 3HAMA 4GVJA 4U79A 3ROCA 4JG6A 5GZ9A 5IEXA 1ZAOA 3OWLA 4FKQA 4HW7A 3KRJA 4NTSA 1OL6A 1Q3DA 1H1WA 1V0BA 3BU5A 1OPLA 3KVXA 4CQEA 3OCSA 3PG3A 4QMYA 3KU2A 4I4EA 2PVJA 4AX8A 4C4FA 3OY3A 5ITAA 2R3PA 1U5QA 2ZV2A 2YCFA 2WHBA 1CSNA 5L4QA 2J51A 2JKOA 4R5YA 1GJOA 4PDOA 2XBAA 4MX9A 4FV5A 3VJOA 3WYXA 5IEYA 4V01A 5HEZA 4RQVA 3OXTA 3UIXA 3QC4A 1PXPA 3A7IA 4AA4A 2BMCA 3KMUA 3MFSA 3AMBA 3UPXA 3QTIA 1MUOA 2JDTA 2PZRA 3DAEA 2W4JA 3ZO2A 3Q9WA 2B52A 4IC7A 2OLCA 4DEAA 3UPZA 4E6QA 5IQDA 4FG8A 1JPAA 3RALA 3DFCB 3HRCA 4LM5A 4RVTA 4CRLA 1QPJA 3KULA 3R8MA 2UW6A 2W1FA 5BVDA 3UYTA 3EZRA 2G9XA 3HGKA 5KMOA 4G3DA 4DHFA 1WBSA 2QC6A 4F09A 2XCHA 1UVRA 3KGAA 4R78A 4OBPA 3V01A 5DPVA 3R1QA 2OG8A 5HTIA 3QXOA 1OIQA 2WTIA 5BVEA 5CSPA 2VD5A 3E8EA 2GTMA 2QQ7A 4NYEA 4IH8A 2Z7QA 4Y95A 4YJTA 4PDSA 3EQPA 4W4WA 3N4UA 3BU3A 3KCFA 4LGHA 1ZYCA 3KN5A 4IVBA 2CLQA 4BDEA 4HVGA 4O7TA 3PYYA 4QMNA 3S3IA 5KZIA 4FT7A 4FKTA 5HE0A 1DI8A 4I0RA 4FKVA 3TZ8A 4EH6A 3WF7A 5M4IA 3BU6A 3AT3A 4FV0A 4LV8A 4MF0A 4FKOA 2C6MA 3FZRA 4G5PA 3EOCA 3FXXA 4TNBA 3W2PA 3FMKA 3BYVA 3DBDA 5HVYA 5IU2A 3EQDA 3COKA 3K54A 4O7SA 4D1SA 3H4JA 2YIQA 2YIWA 4PPAA 4EOMA 4D1ZA 1H0VA 4A9YA 4JI9A 1JKKA 2QONA 3WF5A 4RX5A 5JFSA 4F7LA 3QTWA 4P5ZA 5JGBA 4JBPA 4XLIA 3WZJA 1WBPA 3MH1A 1XKKA 4M0YA 4N57A 4YZBA 3JR1A 4S2ZA 2QKWB 4G34A 3ZSGA 4FKJA 3LFDA 4MTAA 1TQPA 2WOTA 4GU9A 3UO4A 5JGAA 5HE2A 4RJ5A 1R39A 2VTSA 4FSQA 5FXRA 2PVFA 4CFWA 3M2WA 3NUPA 2G2HA 1PXKA 3NRMA 2VTMA 2VGPA 3NUXA 4HYUA 4ASXA 4B8MA 3FZPA 4BI0A 4C3FA 5IF1A 2PVYA 3QD2B 4JQ7A 1DAYA 2V5QA 3I60A 3QFVA 4ZJJA 1LEWA 5BVFA 4H3PA 5M4FA 4DFUA 4RC4A 3UQGA 4BL1A 3AMYA 5CEPA 1O9UA 3AQVA 5CF6A 4C7TA 5HI2A 4KRDA 4AGUA 1OUKA 1YXVA 3G5DA 3P79A 4ZY6A 4I5MA 2R3JA 5TF9A 2BIKB 1JSTA 1SZMA 3ORXA 5F95A 5AV0A 3HV5A 5CNNA 4F7JA 1Q97A 2GU8A 3ZBFA 3RZBA 4IBMA 5KUPA 4JR7A 1OGUA 4DC2A 3H9FA 5IQBA 3R1YA 3SA0A 4R7HA 1YXXA 4FOBA 2GMXA 2ZB1A 3F88A 2R7BA 3B8RA 2JDSA 3BEAA 2W1DA 3A7GA 3HMMA 3NEWA 4MXOA 4NW5A 4FV9A 1J91A 4QD6A 4QMMA 5EYKA 3G9LX 4E4LA 4KBAA 4IFCA 1IAJA 4OTQA 1SMHA 4U44A 4ACDA 4BDAA 4F6UA 3PJ1A 5HESA 5K0KA 3C9WA 4BWPA 5CEMA 2RG5A 2X1NA 3PA4A 4N4SA 4ZSGA 4HGLA 1F5QA 3F2AA 2VO6A 4UX9A 1FPUA 2I6LA 2ITXA 3P1AA 4YJNA 3TKUA 5EOBA 3VBXA 5IQFA 4BF2A 3S1HA 2PVRA 5BYZA 3HV7A 3R7UA 5I9WA 4FTTA 3C5UA 3KXHA 1STCE 5AR5A 2EB2A 5M09A 3GFEA 3LLAA 2XK4A 3N9XA 2VX3A 4U7ZA 5HVJA 1PRYA 1EH4A 3KRWA 2B55A 2WMVA 3ZFXA 1SVHA 4AFEA 4EHGA 5JQ5A 4LL5A 3QQHA 2UZVA 4CG8A 2V7OA 2CCIA 4WSQA 3HUBA 4OTPA 1YW2A 2JBPA 1FINA 2H34A 4WRGA 1XH6A 2RFSA 4FEQA 1YDSE 3B2TA 2GS2A 1HOWA 3KFAA 3OHTA 3U4UA 5IPJA 4DINA 3LFFA 4O0YA 2XUUA 3PIYA 1H25A 2WMBA 2X6EA 4U81A 1APME 1SNUA 2VWUA 4MD9E 4P90A 1K9AA 1UKHA 5EYDA 3BHYA 3IDBA 2XKDA 3OF0A 3AC2A 4UWYA 4X2FA 2W0JA 2YLFA 5ETFA 4UMTA 3ZUTA 2BALA 4NUSA 1QMZA 2BTSA 2EXCX 3PJ8A 4IVDA 3FPMA 4YNOA 4DEHA 5LQFA 2E9OA 4OTDA 3WZDA 3A8XA 3TWJA 3VVHA 5FEDA 4O7WA 2IVVA 3V5WA 3ZLSA 5E8VA 4MVFA 3IKAA 4JDHA 4YJUA 5BVWA 4C37A 2X7FA 3PLAE 4AW1A 4IX5A 1H00A 3TTJA 5JT2A 1H28A 3FWQA 3NPCA 2W06A 3C50A 4Z55A 5L2SA 3QKKA 1J7IA 2Y4IB 4MWIA 5E8ZA 3CJGA 3ZOSA 3BYOA 5JKGA 5L2WA 5EYMA 4JDJA 1CTPE 1MQBA 3OCTA 1OL5A 2J0IA 4F70A 5BVOA 1OL2A 1ZMVA 5J9ZA 2W96B 3TJCA 4YMJA 1YOLA 2WO6A 3QWKA 5CQUA 4M0ZA 5HHWA 4IFGA 4EH8A 4O7RA 3TNPC 2RF9A 3QX2A 5L8JA 4X3FB 4GU6A 3EB0A 5GZAA 4XHKB 2GNJA 5AMNA 5M51A 2Z02A 2ITVA 4DGNA 3MB6A 2SRCA 4NIFB 4QQJA 3F5PA 1ERKA 3L9LA 5GJGA 5J1WA 3F5UA 4XYFA 2QU5A 4YZ9A 1ZZLA 3ULIA 3QYWA 3ZRLA 3NSZA 5EHYA 4QTBA 1WBVA 4C4EA 4XP2A 2RG6A 2HZIA 4O2PA 3DFAA 2P55A 2XB7A 4ZZNA 4QYEA 4AU8A 4BHZA 1ZARA 4YJRA 1O6YA 1WMKA 3G33A 3R2BA 5I3OA 3UVRA 3FQSA 4AOJA 1REJA 5E92A 2YWVA 4BFMA 3T3VA 2R5TA 3FKNA 2P33A 2EVAA 3GT8A 3UVPA 1WVXA 1OKYA 2JIVA 2P0CA 2QO2A 5G1XA 3TDVA 4CT2A 4CZTA 2C6DA 4B9DA 4IAYA 5AUUA 5M4CA 3F9NA 2QOCA 4EJ7A 4TW9A 3OTUA 3CY3A 4I5CA 2JC6A 5LMBA 5EQYA 3IG7A 4O2ZA 1PXMA 3IS5A 2WTKB 3GU7A 3SXFA 2C6IA 4TT7A 2BFYA 2I0EA 1PJKA 4Q5EA 1PMVA 5E8UA 5EDPA 3RMFA 3UNJA 4F0FA 5E1SA 3CTQA 3RCJA 3FY0A 3V5TA 4YC8A 4L44A 4AW2A 1M7NA 4GYGA 2Z7RA 2WB8A 5ANGA 5M55A 2C5VA 3N4TA 1YHVA 2YDIA 4K8AA 1M17A 4IWPA 3NMUF 4BI1A 3PRFA 3VBYA 1IAHA 4AGWA 4FIJA 5AV1A 2Z2WA 4EJNA 2C6LA 3MPTA 3ORPA 5IEVA 3FLSA 4D9TA 2F4JA 2HXQA 5EM8A 3SKCA 4L43A 4ZY4A 4DAWA 3PPKA 1XH9A 3LFNA 3EQIA 3V5PA 3HMIA 3ACJA 5HE1A 2F49A 1FMOE 4QO9A 1PXIA 5LVLA 4BDBA 4PTCA 3FYKX 4XBRA 3GU6A 4PMPA 1Y6AA 4NCTA 2WZJA 3D14A 1NVRA 2JKQA 3VW8A 2UW3A 2ZB0A 3OP5A 3ZYAA 3NYNA 5KNJA 1JBPE 4F65A 1KSWA 4IWOA 5FXQA 3KEXA 3BHHA 3VUDA 4O7LA 3GU4A 3MTFA 3MPMA 5CAVA 3KVWA 4DFLA 5M53A 5CU2A 4USEA 3H0YA 4X21A 1Q5KA 2WTCA 4BI2A 3RK9A 1GIIA 4EH3A 3SW4A 3LFCA 2Z8CA 5J7HA 2J0KA 3L1SA 2GNFA 4X6QC 4D5KA 3O17A 1HCLA 2VX0A 1S9JA 3MGYA 4EZ7A 4RVMA 4C2WA 1RW8A 2HXLA 2Z60A 4AAAA 5KBQA 1YDTE 4IM3A 1TVOA 4UXQA 3PIZA 5I9YA 1MP8A 3PSCA 3BELA 3EKKA 4N70A 4XG2A 4EOJA 2YM8A 3O8PA 5CZIA 4O0RA 4RSSA 3WBLA 4ANBA 3PZHA 1PMUA 3QGWA 2C5XA 4QMPA 3DK7A 4FX3A 3E3PA 4FSRA 3UP2A 4BCHA 1W7HA 3TTIA 2UW4A 3TUDA 4LGGA 3UOKA 3QC9A 3F5GA 4QP7A 2YA9A 4L8MA 3BZ3A 2Q0BA 4ERKA 3RINA 3SG9A 1W8CA 2UW8A 4CD0A 2WIPA 3DK6A 4WUAA 4FEWA 5KO1A 5HIBA 2VTRA 4OW8A 3FXZA 2YLEA 4CLIA 3FI3A 2J90A 5GZ8A 2X0GA 1IEPA 5D41A 4QT1A 4U9AA 4DG2E 5FM2A 2ZDTA 2F57A 3D2KA 3WZUA 1BLXA 4CRSA 2C68A 3BQCA 4EQCA 1KE5A 2YN8A 4YHFA 3QUEA 3VS7A 4EK8A 1WVWA 5EM6A 4IZ7A 3QD0A 2PZYA 2XVDA 3I7BA 5HU9A 5AX9A 2WTWA 1BI7A 4CMUA 3FPQA 2G1TA 5FTOA 3DOGA 4G3FA 5IKWA 3IOPA 3E87A 3I7CA 4AN3A 4YR8A 5KHWA 2JITA 1SVGA 4BB4A 2W9FB 4C2VA 3NUAA 4L68A 3IGGA 3MVJA 3TT0A 1KWPA 4BIDA 4ASDA 2I40A 4BC6A 4EI4A 1CKIA 1JQHA 2WKMA 3DCVA 3POOA 4FG9A 3G51A 4HYIA 4FTCA 4CFFA 5C8KA 5CF4A 3V8TA 3LXKA 1Q99A 2C69A 2PMLX 4DE4A 4I41A 4ZIMA 4E7WA 3W8LA 4FZ6A 4HCVA 4DF3A 4GUEA 4MAOA 2ERZE 4FE2A 3K5VA 3W2SA 4TYIA 4O7ZA 3CR0A 3U55A 4GCJA 4LRKA 4BY9E 2XEZA 3GU8A 4PP7A 5FEQA 2UV2A 3ZBXA 2XRUA 3CGFA 3ZZWA 3JS2A 3KA0A 4H05A 2W5BA 1OBDA 3P7BA 2VWIA 4GJ3A 2Y0AA 3WI6A 5DR2A 1CKPA 5DMZA 3IECA 2CKOA 4NL0A 3I1AA 3PXRA 4J53A 5L2TA 4AZWA 4QMQA 2V0DA 3LOKA 3OT3A 4GFMA 4FKPA 5IQIA 3PE2A 4CKJA 3GB2A 3I4BA 5C8NA 1ZMWA 3NUYA 3TCPA 5HBHA 4ENXA 2WEVA 3TNQB 5HIDA 3UO6A 2B9FA 2UVYA 4QPSA 1I09A 2FA2A 3DZOA 1OBGA 5BQ0A 1OECA 2IVUA 4O0UA 2PVHA 2UZTA 3R73A 4D58A 2BUJA 4CYIA 1Y8GA 3TZMA 3WOWA 5IA3A 4II5A 2QCSA 4IAFA 4KA3A 3QUPA 4GYIA 4NCTC 5K0XA 3PTGA 4PDPA 4QTDA 5ACKA 3PA5A 4ZLOA 1H1PA 4G9RA 4RJ3A 5FEEA 5IA4A 2PZIA 2YFXA 5DBXA 3LKMA 3MH2A 4NJ3A 1REKA 5IQHA 1ZRZA 4BCPA 4RLLA 5CAUA 2ZMDA 1IR3A 1H0WA 2ITNA 1IA9A 2YJSA 4YTHA 2YAKA 4O7VA 4CFNA 2XEYA 4GK3A 3MY1A 4W8DA 3UO5A 3WARA 3QQFA 5CSHA 4EQUA 3FC1X 2DS1A 2YIXA 3TNHA 1PW2A 4L3LA 1K3AA 1FVTA 4FVRA 4J52A 4O6LA 4HGSA 4YSMA 5EOLA 5AUZA 4EUUA 5H8BA 4UMUA 3PVWA 5I9XA 4O91A 3QZGA 4G5JA 3HV3A 3UODA 1UU7A 5D9HA 5CQWA 4CFMA 3EFKA 5KMKA 4XP3A 1QPCA 2O3PA 3PXYA 4X7QA 3N4VA 4TYJA 4GW8A 4NJDA 3SW7A 4Q9ZA 3QGYA 3QQUA 4FOCA 3CSVA 4QMOA 2X4ZA 4IX6A 3ZU7A 2VX1A 4XG9A 5CYIA 5A4EA 4MNEA 3G15A 1E1XA 3MDYA 2W99B 3A4OX 1A48A 3CKWA 4F9WA 2C0IA 1YOMA 1LUFA 2XRWA 3F69A 4EZ3A 5BYLA 3PXZA 4CEGA 4GG7A 3IONA 4F64A 3LFSA 2UZLA 5AIKA 5JSMA 3AC8A 5BMSA 4QP3A 5DYJA 4ZLZA 4H36A 5ETCA 4K33A 1H26A 3OMVA 3TV4A 2P2IA 3WF6A 5IISA 3RVGA 1W84A 4YBKA 4E5AX 3R8ZA 3NCGA 4M68A 2XK3A 2BAJA 3CTJA 2Y4PA 3KK9A 2O63A 4G9CA 2C3KA 3CJFA 3LFEA 2P4IA 1Q41A 2YEXA 4LFIA 4Q9SA 1L8TA 2PULA 3MSSA 5KMIA 5CT7A 2ITQA 4AOTA 5B7VA 1XBCA 5K9IA 4XP0A 3W10A 4QYHA 1Q3WA 4RA5A 2WMRA 3AC1A 1URCA 3BIZA 4DG0E 3LMHA 1CKJA 3E8CA 5FTGA 3ORTA 1YXTA 4M84A 3W32A 3RK7A 4PX6A 3NIEA 3R04A 4W9WA 4FK6A 5ANDA 2GFSA 1NT2A 3U51A 3BYSA 5CZHA 2YCSA 1YI4A 1M2QA 3FQHA 3PXQA 4NZWB 2CNUA 3LHJA 4WUNA 1BL7A 4I20A 1WVYA 2I7QA 4NKAA 1NVQA 3PXKA 3MTLA 4XMOA 1YXSA 3NUSA 4TYHA 3Q2MA 5EHLA 5L6OA 3A4PA 4X3FC 1PXJA 3QXPA 4MD8E 4WBBB 3RI1A 4NW6A 3GGFA 4C61A 4A9RA 3DA6A 5AR7A 3G6HA 3RZFA 4O82A 3FSFA 5D12A 3P7CA 2E9NA 3Q4ZA 3AGMA 4U3ZA 4BCGA 4DGGA 2QOKA 2VO0A 4O81A 4IC8A 3QZFA 3PSDA 4ZTHA 2QD9A 4JJRA 4ITHA 3QRKA 4PQNA 5L3AA 1H01A 2CKEA 1PXNA 3ETAA 5CSWA 5C9CA 3IPHA 4I0TA 3QRTA 5D7VA 3ANRA 3GOKA 4ZXTA 2HY0A 1SVEA 2WGJA 1CDKA 4GEOA 1SNXA 4L9IA 5TO8A 4XLVA 2OIQA 4XV2A 3PY0A 1R0EA 2R3NA 3ERKA 4OBQA 2PTKA 4HZRA 1ZYSA 2XK6A 1JVPP 3P0MA 3VAPA 1OITA 4TN6A 5DFPA 3R01A 3AD4A 3QUDA 1B6CB 5IA0A 2QR7A 3UIBA 1Q8TA 3VS3A 4BGHA 3MFTA 2PUNA 4YBJA 4C59A 1KE7A 5LMKC 4A9UA 3ZMMA 1IASA 3G0FA 3DKCA 3WYYA 5F20A 3EQHA 1R78A 2BRGA 1RDQE 2UZWE 3KCKA 3V8SA 4AZEA 3DKOA 2F2CB 4JIKA 5L2IA 5EHOA 2PVKA 3DQWA 4L52A 2VTHA 4C34A 4G16A 4H1MA 4YTCA 4IX4A 3PP0A 3Q9XA 3OW3A 4JQ8A 3BV3A 1B39A 4OBOA 3DTCA 1ZY4A 4RQKA 3G90X 4HYHA 3LJ0A 1FOTA 2YM3A 4U97A 3DLZA 5FTQA 3HRFA 3BGPA 3M1SA 5G6VA 4RWJA 5CI7A 3GP0A 4PL4A 3W55A 1NXKA 1KE9A 4NH1A 4PL3A 2JIUA 4QTEA 3FZ1A 4RJ4A 3II5A 4NM0A 3S2PA 5F9EA 5J8IA 3QTSA 2XNBA 1PKGA 2IZTA 3BGQA 3LFAA 5BUIA 2HAKA 3FE3A 3HMNA 4FTOA 4GMYA 4MXXA 2R3KA 4I94A 2YISA 2HCKA 4ZTMA 2OI4X 3OEZA 2Y6OA 1WBNA 3A7FA 3EL8A 4RVKA 1KOAA 2FUMA 3FJQE 3RGFA 4ZSEA 4IB5A 3DGKA 3TZ9A 4WIHA 2ESMA 1UNGA 1XHAA 3R8UA 3VS1A 4BDGA 2YZLA 4Y83A 3FMLA 2OSCA 1WBOA 3ORZA 4UWBA 4UBAA 1DI9A 3EQCA 1U5RA 4EKKA 3ID6C 3RHKA 2ZM3A 2VTOA 4LOQA 3WZEA 2Z7LA 4BN1A 2BHEA 4I1ZA 2YDKA 1F3MC 2B9IA 2XNPA 1YHSA 3GBZA 5GJFA 4B7TA 3TUBA 3RKBA 1BUHA 2C4GA 3F66A 4R6VA 5BPYA 1V0PA 2W4OA 4EEVA 5J5SA 4JOAA 2R0IA 3VS0A 2FSMX 4XG6A 2O64A 4MBLA 2J0MB 5TR6A 4ZTNA 3WZKA 4ALUA 3Q04A 3R1SA 5BNJA 3GEQA 5KKRC 2HK5A 3L9NA 3S4QA 2NO3A 4KD1A 4OTGA 4V0GA 3UZPA 4CCBA 4DH5A 5K5XA 3POZA 2GNGA 2UZEA 4YO4A 4YURA 3R00A 2X39A 2B1PA 3ZC5A 4RJ7A 3FC2A 2DQ7X 4QQTA 2XIRA 5GJDA 4TWOA 1R1WA 4FKWA 4A4XA 4HVDA 2OZAA 2XKCA 3DTWA 4IANA 4L3JA 4AE9A 4BDJA 4APCA 3FMEA 3QTQA 5L8KA 4TTHB 3OT8A 5IQCA 3Q60A 3Q2JA 4ZJVA 4ALVA 2R3OA 2QVSE 2ACXA 2X2MA 4Y73A 2RIOA 3GNIB 4EYMA 3RAWA 4QMVA 5EI2A 1TQIA 3RAHA 4XS2A 3RK5A 3VF8A 4BCJA 4RIWA 4BTKA 4F4PA 2REIA 2B7AA 2ZMCA 4RIXA 5F94A 3VUHA 3DY7A 3REPA 4DLJA 5ETAA 2VZ6A 4G31A 5ACBC 5EDQA 3V5QA 1KV2A 5AUXA 3W2OA 4JDKA 5A54A 4YJSA 2R3RA 2VWZA 4KKHA 5E8SA 3GCUA 4G3GA 3NNWA 4USDA 5CEQA 4IVCA 5C4LA 4TZRA 3IDPA 4KKEA 4CFXA 5EH0A 4C35A 4O7NA 4D0XA 5KMMA 2OFVA 3MW1A 4ITJA 3ZLWA 2C1AA 2WNTA 3W18A 5BVNA 3DJ5A 5CU0A 4Z9LA 3LE6A 4ACMA 4EORA 2UZBA 2XNGA 3BQRA 5CI6A 2YHVA 5HTCA 3BPRA 1PXOA 2H96A 1BYGA 4E93A 4JAIA 2GCDA 3SX9A 3VJNA 4D2PA 2XIXA 4OTWA 1LPUA 3Q32A 4RBLA 5IMXA 4RT7A 4Y5HA 3GC9A 3V04A 2B54A 4BTMA 1G3NA 2R2PA 2R7IA 3C4XA 3GC8A 3MY0A 4ZZMA 4APPA 5IDNA 5L6WL 1H4LA 3C51A 2ITWA 4Y72A 1WAKA 1Y91A 4ANQA 2XKEA 2X6DA 2XJ2A 5JMSA 4YTFA 3R71A 5AAFA 5IZFA 3HYHA 4H3QA 1OUYA 2CGXA 4HGEA 3HMOA 4FZ7A 2Z7SA 4TPTA 5LVMA 3MESA 3HNGA 5BMMA 3L8SA 3GCVA 3UE4A 3I81A 3OBJA 2HW7A 4EBWA 3QRJA 4PUZA 2R3LA 4DTKA 4OLIA 2VTQA 3RPYA 4HJOA 3SC1A 3LVPA 3BGZA 1IA8A 2JAVA 2YAAA 4XG4A 4DH1A 2A27A 2HWPA 4I23A 3VBTA 3PSBA 3R1NA 4QQCA 3NDMA 5BX0A 4M67A 4GIHA 3CGOA 4D4RA 2W05A 2WQEA 2UW7A 3VF9A 2R4BA 3KXGA 3MY5A 1H24A 2FGIA 3DAJA 3DQXA 2BVAA 4I93A 5E8WA 3R7IA 4EHVA 2ZM4A 4FVPA 3VRZA 2C0OA 5C8MA 5LWNA 4QYFA 1VZOA 2IO6A 5AM6A 2CN8A 4AA0A 3T3UA 4C3PA 4DFZE 3RPSA 2ZM1A 4FTAA 4JAJA 4BCKA 2XYNA 4TYEA 3MS9A 4DT9A 5CNOA 4DBXA 3FMJA 1A9UA 4F08A 4MF1A 4EK5A 3PG1A 3ORLA 4FNZA 2R3QA 3F3TA 4S32A 2RSVA 4KIKA 3BHTA 2PZ5A 3AD5A 3O71A 2PE0A 4D2VA 3FHRA 1Z5MA 3ORMA 4D2RA 2VAGA 3L8XA 2VRXA 4TRLA 1B38A 2PUPA 4OTRA 1NY3A 2OW3A 4LUEA 5CVFA 3KRXA 4DCAA 4XBUA 1KUTA 3QLFA 3RPRA 1PY5A 2XJ0A 4K2RA 3V51A 5M57A 2FSLX 2VWVA 3OW4A 3U9NA 4C4GA 4QP8A 4O0SA 4L7FA 3DJ6A 4FKSA 3K2LA 3ODYX 3ZLYA 5HORA 2WELA 5AP2A 4O0XA 4U5JA 3NNUA 3Q53A 4C02A 2BRHA 4GL9A 2OK1A 5AM7A 5E91A 2UZNA 4AOIA 3FXWA 2VU3A 2X9FA 4ZSLA 3KF4A 2GNLA 3JXWA 4FKGA 2XNMA 5E7RA 1R3CA 4WHZA 4BBEA 3MJ2A 1I44A 5KMNA 4X6RA 4FZDB 4BYJA 5HX8A 1Y6BA 4RZWA 4CFVA 4HCUA 3ROYA 3R7EA 4QYGA 3OZ6A 2Q0NA 4YLKA 4G17A 1OKZA 2P3GX 4WT6A 2X8EA 4G1WA 4IB3A 1OIYA 4CXAA 3TM0A 2ZDUA 2QR8A 2V22A 3Q5IA 4RX9A 1WZYA 5HLPA 2YM4A 4DG3E 4M7IA 5I4NA 1XJDA 4R8QA 3FKOA 3NW7A 3IW8A 5H8GA 2YIRA 4EYJA 4R3RA 1DM2A 5A4LA 4AF3A 4PF4A 3NVKI 4DITA 4IM0A 3QQKA 2OGVA 3AT2A 1J3HA 2XIKA 4GSBA 4UALA 3NIZA 2C6KA 4AFJA 1P4FA 3ATSA 4NTTA 4FV6A 4LMNA 4RFMA 1JAMA 2YERA 2W1IA 3ZSHA 1OL7A 3MYGA 3LJ2A 4GT4A 4J1RA 2UVXA 3QHRA 3L8PA 3UC3A 2ZJWA 5KHXA 3A62A 4FT3A 2GPHA 2GFCA 4JX3A 3KK8A 5EQEA 1MRUA 5J79A 5E8XA 4FV1A 2B9JA 1M52A 3QCSA 2OXYA 4DFNA 4DGLC 5TOZA 2PVMA 5D10A 2JD5A 2UUEA 3LCTA 4MBJA 2A0CX 4OR5A 4U6RA 1V0OA 4J97A 3LCOA 4ANNA 5E4HA 3OUNB 2QLQA 4QTCA 3OUKA 4U0IA 3T9TA 5DH3A 4GG5A 4ACHA 4M69A 1VYZA 3BYMA 3FLQA 3F5XA 2QHNA 3ZZEA 4BICA 4BCNA 2AC3A 4QMLA 3EYGA 3MBLA 2IZRA 4A06A 4C4HA 4FL1A 4IQ6A 2OIBA 4CG9A 1GZKA 5FD2A 3P86A 4PRJA 3ATTA 2QODA 2X2LA
chains in the Genus database with same CATH superfamily
2EU9A 3AD6A 4FSNA 5HG5A 4AW0A 2C3JA 1OKVA 5EI6A 3HUCA 4CTBA 3RBWA 3D83A 4GK4A 4E6DA 3DS6A 4XX9A 1YXUA 3HV6A 5EM7A 4UMRA 1NW1A 2PZPA 3QQJA 3SG8A 4PDYA 4GKHA 4EBVA 1JNKA 4J98A 4FICA 2XBJA 2GNHA 3TYKA 2C1BA 3GFWA 3LCSA 4QDVA 5A6NA 3UDTA 4NKSA 4BDHA 4XRJA 4FYNA 4O86A 2CGUA 5CVGA 3ZONA 5M08A 3PZEA 2BPMA 2XH5A 3VHKA 4IJPA 4FZAB 5A4QA 3FMNA 3LFQA 2BRMA 4FR4A 2PWLA 2JAMA 4GJ2A 2XNEA 1Y8YA 4MNEB 4ZZOA 4NWMA 3E7OA 1Q24A 3ENHA 1PMNA 5GHVA 2W1EA 2G01A 4UY9A 4EL9A 5A4CA 1UNHA 3WF9A 4BGGA 2ITTA 2G15A 3FLZA 2W7XA 3R2YA 3LAUA 2BCJA 5L2QA 4AN9A 2HW6A 1GZNA 4DGMA 3NW6A 5J1VA 2PSQA 4IAIA 5ANOA 5A9UA 4EH9A 3OC1A 3LPBA 4AS0A 3TI1A 2BAQA 4BDKA 4QTAA 4FL2A 3VC4A 4UMPA 2VWWA 3EN6A 3VUIA 4J95A 4BR3A 3GXLA 3R6XA 2JKMA 4P7EA 3FZOA 5DHJA 3QHWA 3V3VA 2W1GA 2ONLA 3FMDA 1GZOA 5HGIA 1JSVA 4Z16A 3VS2A 4FGBA 3GCPA 4EOOA 5AADA 3RHXA 4L53A 3UG2A 5LVOA 2OJGA 1XBBA 2Y9QA 4C4JA 5KKRB 3S0OA 2O65A 3KN6A 4IWDA 5BYYA 2YABA 4ZS4A 1Q61A 3OEFX 1NA7A 2QHMA 3ZRMA 4HPUE 4BDIA 4O22A 5J9LA 4J7BA 3NNVA 4FA2A 4DEEA 5IUHA 2HOGA 4OT5A 3W1FA 4PWNA 2BZHB 3KL8A 5FQDC 2XK7A 5IQEA 4RA4A 1AGWA 3OWKA 1BL6A 3NUNA 4FTQA 3MFUA 5FG8A 4BTFA 4A7CA 4IAAA 2JEDA 4PV0A 4R3PA 3FLWA 4EHZA 4J8MA 4GUBA 2C0TA 3OY1A 3F7ZA 4AUAA 5AP1A 2J7TA 2VV9A 4Y46A 3QX4A 3MN3A 1YQJA 4WA9A 4WG4A 3TNIA 3ET7A 1W82A 4S30A 3VBVA 4Z3VA 3DNDA 1LR4A 1UU8A 4F6WA 2QG5A 1P2AA 3NAYA 4AWIA 1ZY5A 3D0EA 5ANIA 5ANKA 3TKHA 3WIGA 4FNXA 3NX8A 2OJFE 4LRMA 3EQGA 4XG8A 4D1XA 3R7GA 5LVPA 3LZBA 1PMEA 3D4QA 3N51A 4FV2A 4EHEA 3HKOA 4NT4A 3FZTA 5FXSA 2C30A 4FVQA 4LI5A 2F7ZE 3ZDIA 2JDVA 4FZFB 3M42A 3RWQA 2B0QA 4RG0A 2W5AA 3E62A 1E9HA 3KY2A 2HZNA 2BDFA 5IUIA 2PK9A 2IG7A 3TL8A 3Q9ZA 4E5BA 5DEYA 4O6EA 4ZTLA 5FDPA 5DI1A 4DFBA 2RGPA 1X8BA 5J87A 4DH3A 4CZUA 5JN2A 2LAVA 3W16A 4YSJA 3K3IA 2X7GA 4WG3A 4I92A 3QTRA 4AZTA 3OVVA 4WBOA 2W5HA 5AV2A 1Q8UA 3MIYA 4RPVA 2EXMA 1PYXA 2F9GA 2GHMA 4UZDA 3ZO1A 4ARKA 3S95A 4C0TA 2WFYA 4CTCA 3A7JA 4Q5HA 2CLXA 2XS0A 3AKJA 1FMKA 5AP3A 4EK6A 4YUQA 1KV1A 2OJ9A 4QRCA 2XNNA 4DEGA 5DNRA 4BDCA 4D4YA 1Q4LA 1XH5A 2A1AB 1QL6A 2X8IA 4K18A 4YC3A 2AC5A 2R3HA 5CY3A 5F4NA 3ODZX 3GVUA 4IXPA 2XCKA 4I22A 4M3QA 2F7XE 3G0EA 3ZDUA 3HECA 3HMPA 2CCHA 3P08A 4GVAA 4RFZA 4IVAA 2NNWB 5LCKA 4QEBA 1H1QA 3TMOA 3EL7A 1FGIA 3L9PA 3G9NA 4K6ZA 3MWUA 4YU2A 2R3IA 1P14A 3QTZA 3L9MA 4KAOA 4P2KA 2UVZA 1E1VA 4KB8A 3ZM9A 1H07A 4ZY5A 2QOOA 4PTEA 5LARA 3TV6A 2OWBA 2VTNA 4AZSA 2PUUA 2W17A 2YDJA 3Q96A 2ITOA 2WMXA 3VS5A 5T68A 3W8QA 1JKTA 3H3CA 2ETKA 3LCKA 4MK0A 1RQQA 2DWBA 3NWWA 4FIGA 5E8TA 4QMWA 1QCFA 1SYKA 4A9SA 4D2TA 3ITZA 2WTJA 3KULB 3E93A 3NGAA 4ASZA 4AQCA 4DFXE 1FGKA 4ZMFA 3F6XA 2EWAA 2J5FA 3LXPA 1OZ1A 3ORKA 4B0GA 3VULA 5TKDA 2EUFB 1MQ4A 2HY81 5AP7A 2ONLC 4BRXA 4KSQA 1ND4A 3ZO4A 4KS7A 5M56A 2Y8OA 3KF7A 4C62A 3BV2A 4BCOA 3ZC6A 2XMYA 4P5QA 2XAOA 3IDCA 2W9ZB 4QQ5A 4V0GB 4XCUA 3F3WA 4QMXA 3KC3A 3LXLA 4G3CA 3GU5A 4AZVA 1U59A 3ZH8A 2X81A 2WIHA 3ZTXA 3R83A 3FMHA 4R1YA 3PA3A 4F0IA 4I21A 2BZJA 3H9RA 3T9IA 5C03A 3R21A 4AT5A 1Q8YA 5CU6A 4XUFA 2IWIA 2ITZA 4I5PA 4AT3A 2OZAB 2QOHA 4DCEA 4XG7A 4OTFA 4HCTA 1M2PA 4E4MA 4DDIA 3FI4A 3GQLA 2XYUA 4FIIA 4RJ8A 3PPZA 4E4NA 3TKIA 4KWPA 3C1XA 5JRQA 3VUTA 4AGDA 1CM8A 4U8ZA 4FG7A 5K4IA 3WE4A 3C13A 1Q8WA 3ALNA 3FI2A 3P9JA 4IACA 3ANQA 3CP9A 2OICA 3EYHA 4QMZA 5IA5A 5DR9A 4FTRA 4RIWB 4YLLA 4RIXB 4U45A 4JXFA 2JKKA 1GNGA 4IZAA 2IVSA 4TWCA 3EKNA 4V04A 3TV7A 5D7AA 3Q4UA 3AGLA 1PYEA 3D5WA 4I0SA 5DLSA 5B2KA 4JRNA 5JFXA 4XEYA 3EQFA 3LMGA 3FL4A 4K77A 4FGRA 3CIKA 3CTHA 4LOPA 4LQMA 2QOFA 4G2FA 4S33A 5BVKA 5LVNA 1GAGA 2JLDA 3EFJA 5DIAA 5FRIA 5J95A 2EB3A 3AG9A 3UMXA 1XMLA 2CKPA 4YC6A 4JDIA 3O0GA 5HG9A 2PVNA 1H08A 2VTTA 1UV5A 3OBGA 3R9OA 1OPKA 4MXZA 4RJ6A 2WOUA 4FI1A 3SD0A 2OF4A 2IN6A 3BWJA 3UG1A 4ERWA 3KXNA 5IQAA 3ENMA 3MA6A 5AP5A 3JVRA 2R3MA 3I0OA 3PIXA 2FSTX 3QD3A 3QTXA 1U46A 4FMQA 2I1MA 3PVGA 4EK4A 4UB7A 1GOLA 3NR9A 3QCXA 1GY3A 2XK8A 4EH5A 2WMUA 4IAZA 4UZHA 4N6ZA 5KBRA 4GIIA 4USFA 2VWBA 4CCUA 4LRJA 4E5WA 4TWPA 4MD7E 2OF2A 1YWRA 4X3JA 1Z57A 3D7TA 4JQEA 3UOHA 5HLWA 5B2LA 1YWVA 3ZLXA 2XJ1A 3JUHA 2OFUA 4TXCA 2IW9A 3V6RA 3QCQA 4MQ1A 3FY2A 3QZIA 5I9UA 4D2SA 2C3LA 3DJ7A 4Q2AA 5HD4A 2V55A 2VGOA 3BLQA 4L7SA 4BCIA 3QF9A 3VN9A 3ZUUA 5CSVA 4CMOA 3CEKA 4CQGA 1UKIA 1AQ1A 1V1KA 3DLSA 1ATPE 2WQNA 5DG5A 5CS6A 3HEGA 2J6MA 2PHKA 3COHA 3R9HA 5H8EA 4CLJA 4OAVB 4FYOA 2JGZA 4B8LA 2XIZA 4BWXA 3LXNA 4FBXA 2X0PA 4YJOA 4M8TA 3TACA 2JBOA 4XOZA 1OKWA 1VEBA 5F1ZA 3GUBA 1T45A 4E73A 4WD5A 2PE1A 4YTIA 1YDRE 4ZTQA 2ZVAA 4W4VA 1ST4A 4F9BA 4C8BA 2WMTA 3LQ8A 3NLBA 5HKMA 3L8VA 3MIAA 3RCDA 5DVRA 3IGOA 3AT4A 4C33A 5CXZA 3EFWA 2B53A 4HGTA 3R9NA 4AZFA 1XWSA 1AD5A 4FNYA 2WQBA 4F1TA 3VO3A 1PF8A 4MXCA 3UZTA 4I6QA 2KTYA 3PLSA 2PPQA 1ZYLA 4ZJIA 3V8WA 4GFOA 2YM5A 4EWQA 5H3QA 3SAYA 1FBNA 2VTPA 4LL0A 3E63A 3U9CA 1FQ1B 3U6HA 3Q52A 5HNBA 3CKXA 4CZYB 5CEKA 3A2CA 4O1OA 3BLAA 2E9VA 3O7LB 3SHEA 3GC7A 2IPXA 4ANLA 3BCEA 3D15A 4J8NA 3C4ZA 5EW3A 4FT9A 4Z7HA 4D28A 3BHVA 5CAPA 5I9VA 3QL8A 4K9YA 5HG8A 1TKIA 3NYVA 4MHAA 4HNFA 4KNBA 1J7UA 1UU3A 4XG3A 1HCKA 4FTNA 3C0GA 4YPDA 4FEUA 2WQMA 4ZEGA 4ZLYA 4HZSA 1TQMA 3P78A 4GS6A 4FIHA 4CKRA 3H30A 3Q4TA 2Y6MA 3DKGA 3E88A 3Q6WA 2O5KA 4RIYA 4DT8A 3VBWA 3MA3A 4D9UA 3ORNA 3MVLA 3FV8A 2WPAA 4OAUC 5B2MA 1YI3A 2JIIA 2VNWA 2YM7A 2GQGA 3G2FA 4FT0A 1UA2A 4LGDA 4U40A 5JZNA 5HNIX 4KBKA 3E5AA 5CXHA 4IHPA 4X2GA 1U4DA 5FGKA 1UWJA 5HCZA 1FVVA 2VTLA 2IVTA 4QP1A 5DT4A 4ZSAA 5LCJA 4E8AA 3FI8A 2C6OA 2KULA 2VNYA 5C01A 4H1JA 3MVMA 4LYNA 4Z7GA 3SVVA 4BIBA 1JKSA 2O0UA 3NYXA 3O8UA 4C4IA 3SOAA 1G8JA 3H9OA 3K3JA 3T8OA 3PRIA 4FKRA 4QP6A 1MRVA 3NFGB 5L8LA 3BBWA 2A2AA 3ALOA 3QKLA 4B6LA 2BROA 4EH4A 2NRUA 3DB6A 3DXNA 3OXIA 2H8HA 3HDMA 3UDBA 3F82A 3IW6A 3R22A 3BEGA 4BZNA 5E9EA 3AXWA 1KE6A 2IJMA 4YHTA 3HX4A 4KIOA 5AR4A 5FP6A 4PP9A 4QMSA 3PVUA 3QRUA 3VBQA 4JG8A 3JPVA 4RLKA 3BYUA 4W9XA 5A14A 1OIUA 3LM5A 3R8LA 4RX7A 1A06A 4TKSA 2BZKB 4TNDA 1OVEA 4AG8A 3LW0A 2ZV9A 3EQRA 3ZXTA 5AUVA 3GC0A 3FKLA 3U4WA 5IH4A 3FHIA 5ANJA 5JQ8A 3Q4CA 5LMAA 3IO7A 4U41A 4O84A 3E8NA 2NRYA 3Q6UA 3F2RA 4EOSA 5CEIA 3FLNC 1ZYDA 2VTIA 4DLIA 3UOJA 3EN7A 3VRYA 5HVKA 3QWJA 2A98A 2YITA 4M69B 4ITIA 1U54A 1QPEA 4FSZA 4WKQA 3UP7A 3UJGA 3RPOA 4WNMA 3R02A 4E4XA 4JBQA 5HZNA 5I0BA 5KX8A 2ZOQA 1W2FA 3D94A 3R9RA 4KBCA 4ACGA 2VWXA 4I4FA 2R64A 2X4FA 3DDQA 5TT7A 1XBAA 4BBMA 2QOBA 3EQBA 4ZP5A 2VWYA 5AFVA 2GS7A 3P7AA 5K4JA 3E8DA 4CV8A 3HAVA 1IRKA 3DBQA 3BL9A 1OI9A 2UZUE 5DOSA 3NZ0A 4KIPA 4RMZA 4XJ0A 3PJ3A 4QPMA 1YVJA 3SQQA 3HVCA 4M66A 3COMA 3NS9A 3IOKA 3UVQA 3PPJA 5ICPA 2WU7A 2OZOA 3OWPA 2BTRA 5CWZA 4FV3A 4K1BA 1RE8A 4BKZA 4LUDA 3VUMA 4E26A 4FTIA 3IW5A 5DEWA 4WNOA 3BLRA 2UZDA 3PE1A 1W98A 3QQGA 4OUCA 4RC3A 4K0YA 4EOKA 1NVSA 2IEWA 4L46A 5JRSA 4ZMEA 3C0HA 4F9AA 3QAME 5HCXA 2E9UA 3OD6X 1WCCA 3OOMA 4IAKA 3ZO3A 4FV4A 3EN5A 4LMUA 4O0VA 5D11A 4UMQA 4L42A 1OL1A 3CY2A 2Y7JA 3DT1A 4O27B 4OTHA 2BZIB 2C5NA 3BHUA 5CALA 3RAIA 4AXDA 2EXEA 4NK9A 2IZSA 4FEVA 2WQOA 4BZOA 2XK9A 4PTGA 5LJJA 4E6CA 1YKRA 3AC4A 2XA4A 2GS6A 4G6NA 4W4XA 3KXMA 3FSKA 3BE2A 3JY9A 4IZYA 4HVSA 3CC6A 1J1BA 3LJ1A 5DE2A 2GQSA 5GIPE 5EDRA 3OG7A 4K11A 2QOIA 4IE9A 4BKYA 3EN4A 4I6HA 2W1HA 3OROA 3WE8A 1QPDA 3B2WA 4A07A 2YJRA 4OTIA 3R30A 4R3CA 3OWJA 4RZVA 3LQ5A 3SRVA 4GH2A 3V6SA 4FSYA 4AE6A 3QALE 2BAKA 3SDJA 2YZAA 3U54A 3VQUA 3KKVA 2C3IB 3O2MA 5ANEA 3HLLA 5AP4A 3BL7A 3I6WA 3ZCLA 4YP8A 2UZOA 5DRDA 5HTBA 2ITYA 5CX9A 2P2HA 4I24A 4FC0A 3NYOA 3HZTA 2UW9A 2CNQA 3ZXZA 4FL3A 4BZDA 5FM3A 5JGDA 5JH6A 3H0ZA 4XNEA 1ZZ2A 3C4WA 4R7IA 2YIYA 1JLUE 5GNKA 4F7NA 1LP4A 5I5ZA 4JS8A 5TE0A 2XP2A 4EC8A 3PXFA 2WMAA 3WF8A 2A4LA 4EOIA 2UW0A 3MVHA 3ELJA 3DXPA 4NEUA 3CPCA 4M14A 4W4YA 3MB7A 3EMGA 5EG3A 4FSMA 4H39A 5HNGA 2OKRA 4F99A 3OCGA 4YZDA 5HBEA 3AMAA 3QCYA 3PY1A 4KABA 5L6PA 3Q9YA 1PKDA 2OO8X 4FKLA 2LGCA 1P5EA 3RNYA 2ETRA 3HP2A 2CKQA 5CT0A 4BTJA 2PUIA 4V05A 1MRYA 3S00A 2VUWA 4RWLA 5AR3A 3THBA 3TZ7A 2O8YA 1JWHA 4UWCA 2XAMA 4QPAA 4IDTA 1YI6A 3VS4A 5J7BA 3I5NA 3DZQA 1GZ8A 4X0MA 4JBVA 5HBJA 2ZV7A 5EI8A 4M13A 2ITUA 3NNXA 4WSYA 5KMLA 5EFQA 5DRBA 3R7VA 3KXZA 2ZYBA 2BILB 4NFMA 3UOLA 3UNZA 5C1QB 3C5IA 3A7HA 4YGAA 5AAEA 1LEZA 4BWKA 1CMKE 4F9CA 5DR6A 2CN5A 4EUTA 4J99A 4O38A 2J0LA 3OS3A 5DA3A 1FVRA 4M12A 5A46A 4YO6A 4AT4A 3V5LA 4CGAA 4YHJA 5AA8A 3UNKA 1VYWA 5M44A 3Q3BA 3R0TA 4FT5A 4X2NA 3WILA 4R5SA 3NW5A 4PPCA 2HZ4A 1W0XC 4FV8A 1L3RE 5HG7A 4CSVA 3O7LD 4CT1A 3D2IA 3DK3A 2E2BA 3EZVA 3QU0A 4F7SA 4QOXA 2BDWA 2DUVA 4DEBA 3BBTB 2BFXA 1BI8A 4QMTA 3OOGA 2NYAA 2E9PA 3BI6A 1PXLA 5FDXA 1BMKA 4XOYA 4GV1A 2BRNA 2XM9A 3PVBA 3BWFA 3TNWA 5AV4A 2C6TA 4E20A 3V5JA 3PWYA 1URWA 4L6QA 4MKCA 4DHZA 4PNIA 3I5ZA 4YLJA 2HYYA 2VN9A 3RM7A 1XH7A 2H9VA 4GKIA 3KQ7A 2JFMA 3DBEA 4MH7A 4EH7A 4Y85A 4JL9A 1ZOEA 1GIHA 4FTUA 3PFQA 1W83A 5A4TA 3CD8A 1H1RA 3FUPA 2IZUA 3OCBA 3ZS5A 3PP1A 1WFCA 4BGQA 5IH6A 4FKUA 5JFWA 3U6IA 1ZWSA 2BDJA 3PUPA 4BYIA 3E92A 3P23A 4G6OA 2CJMA 5BUJA 4KS8A 1SM2A 3R63A 4S31A 4FUYA 5J5TA 5E1EA 3QRIA 4YJQA 2J9MA 1Q8ZA 3VHEA 2I0HA 5IA2A 4XV9A 4X2KA 3FQEA 3GI3A 3VQHA 4WG5A 2OU7A 3C4CA 3ZFMA 2W1ZA 2GSFA 4RWIA 4ANSA 4BBFA 2OXXA 4DH7A 4LV5A 1ZOGA 4E3CA 4LV7A 1XO2B 4FSWA 3CS9A 3ZRKA 3IW7A 3TXOA 4B99A 3MI9A 4AAYA 3UIUA 5CF5A 2J0JA 4YJVA 5HLNA 2B9HA 2PY3A 4QP4A 1RJBA 5JEBA 2YCQA 4J96A 5KCVA 1ZLTA 3FBVA 3F7WA 4G3EA 1UNLA 2PMOX 4ZK5A 2XIYA 2XKFA 4IZ5A 5HO6A 3GCQA 4BKJA 2JDOA 3EHAA 4GT3A 5K3YA 3RPVA 5A3XA 1J7LA 3O96A 3KRLA 2CDZA 5EW9A 4IADA 5CENA 5D1JA 4IMYA 4FNWA 5HOAA 4GFGA 4KIQA 2XARA 4GK2A 4R7BA 5AA9A 2HWOA 2CPKE 4TWNA 4JBOA 3UTOA 5IUGA 4FTMA 2PVLA 3RAKA 2BIYA 4HYSA 4JT3A 4S34A 4FTKA 4MYGA 2B4SB 2OBJA 4IEBA 4L67A 5IDPA 3ZHPC 5M07A 4OGRA 4D4SA 4AW5A 3EFLA 5JK3A 3AC5A 4FSUA 5DT0A 2PE2A 5CEOA 3PJ2A 2C5YA 3TIYA 4M15A 2AYPA 2RFEA 4XV3A 4BVUA 3F3UA 2OXDA 4UXLA 4ALWA 3IK3A 3NCZA 5LXMA 5AWMA 4JLCA 3E3BX 4DHJA 3QKMA 3R8VA 4L45A 2AUHA 3UGCA 4FTJA 5AR2A 4F1OA 5ETIA 2QO9A 3IW4A 3MJ1A 4HNIA 5EW8A 3TJDA 4DEIA 5FBNC 3HA6A 2I0VA 4W8EA 5EKOA 4BDFA 1VJYA 3TIZA 1KOBA 3JVSA 3LIJA 4RX8A 4FEXA 5M06A 4IDVA 3ZFYA 5HIEA 5T3QA 5GIOE 2BKZA 2GHLA 2OIDA 2O2UA 4HVIA 3JYAA 3CQWA 3PJCA 4MQ2A 3U6JA 5H9BA 3RP9A 2ZV8A 4I5HA 5AUTA 2JDRA 4JR3A 2FH9A 3LCDA 4NSTA 2RFDA 3KMWA 4O83A 5C26A 5HD7A 3DNEA 4QP2A 4N6YA 2NP8A 4WNKA 4E6AA 4F9YA 2GQRA 4I6BA 4R77A 4HOKA 3R9DA 4KRCA 4TYHB 3QD4A 3VUGA 4U3YA 4C58A 3I6UA 1G8AA 3W33A 4MNFA 4AXCA 3EJ1A 3PUFC 1XQZA 5FP5A 3O51A 2I0YA 3ACKA 4MXAA 4H58A 2BKKA 3ULZA 2X9EA 2YCRA 5IQGA 2VO3A 4IM2A 4CKIA 5EM5A 3CLYA 4AGCA 5CF8A 5DN3A 2PMIA 4WRSA 4XRLA 2C5OA 2WTVA 1G8KA 4GRBA 3D5UA 3ZM4A 4A4LA 2BHHA 3CQEA 4QMUA 4RIOA 4NM3A 3KB7A 2J2IB 3C7QA 5AV3A 2OJIA 3D7TB 3LFBA 2W4KA 2G2IA 3BRBA 3OTVA 4FSTA 4D55A 1O6LA 4FUXA 1XH8A 3UIMA 4C38A 4PL5A 4BCMA 4ZOGA 5FBOA 5IH5A 5KZ0A 4LG4A 1YOJA 2CMWA 4F6SA 4XH6A 4FTLA 2PU8A 2R9SA 2JFLA 2OH0E 1M14A 4FRFA 2XNOA 4L3PA 4PNKA 5E8YA 4RGJA 1G8SA 4FODA 4ANOA 2CNVA 2H6DA 2X2KA 4EZ5A 1YHWA 3QZHA 5GINE 1DAWA 1GIJA 2PMNX 3UMWA 2VO7A 3DV3A 3HP5A 5AEPA 4YJPA 5CSXA 4ZAUA 2RKUA 3NUUA 4O96A 3DXQA 4EOQA 3IQ7A 3GQIA 3DBCA 4EK3A 3W0NA 5B0XA 2VTJA 2RFNA 5HE3A 1XR1A 2R0UA 5AAGA 3TG1A 1PHKA 4ASEA 2NPQA 3LQ3A 1WBTA 3UYSA 1M2RA 2PYWA 2ZAZA 1ZXEA 3D5XA 2CGWA 4NM7A 3FL5A 3NVMB 3HDNA 4HPTE 2OJJA 5H2UA 4CV9A 5CVHA 4NU1A 3O8TA 4X3FA 4IWQA 4FIEA 1W2DA 4IB0A 4LOOA 3SV0A 4KUJA 4I3ZA 4NM5A 4ENYA 3O23A 4RFYA 5C4KA 1ZOHA 3HA8A 3KXXA 4A4OA 1OPJA 3LLTA 5HX6A 3VIDA 4NIFA 3A99A 4O1PA 3SXRA 2Q83A 4JVGA 3C4EA 4UYAA 4ONAA 4KSPA 4IW0A 4L00A 3CXWA 3CE3A 2OH4A 4EH2A 3MH3A 3D9VA 5M4UA 1YRPA 5EQPA 2FSOX 4CFUA 2WU6A 4FF8A 4GT5A 1O6KA 4ZSJA 5HO8A 3BLHA 3SLSA 1UWHA 4DA5A 4TY1A 1H27A 4JX7A 3TUCA 3A8WA 2XZSA 4J71A 4YPSA 3AC3A 3COIA 4ZS0A 3BX5A 3DKFA 2VTAA 3QA0A 4I6FA 3KREA 4XV1A 5CAOA 3EIDA 3VW6A 2X7OA 3OFMA 4ID7A 3O50A 4YNEA 3FAAA 3ZSIA 5FWKK 2XF0A 3PWDA 3AOXA 4QYYA 2J50A 5AR8A 2IW8A 3W2CA 4RIYB 4PY1A 4L01A 4MCVA 3KMMA 3R7YA 5EKNA 3HL7A 4DTAA 2WMQA 5FLFA 3HRBA 3TDWA 3P5KA 5J9YA 3ZUVA 5AX3A 5K5NA 3CBLA 3ORIA 4F1MA 4RWKA 4EOPA 2WAJA 3E64A 3RNIA 5LMKA 3G6GA 1H8FA 2HELA 4ZTSA 2GDOA 4DN5A 1DS5A 1M7QA 4BCQA 4N0SA 3C4FA 4RVLA 4MWHA 4DFYA 4PPBA 3LMIA 4AXEA 5HQ0A 1Q62A 4ZTRA 3W2RA 3C0IA 4ANMA 5I3RA 3EWHA 4H3BA 4PMMA 2DYLA 2FVDA 1UU9A 5C27A 3SXSA 2V7AA 3U87A 5CASA 4DEDA 4O4EA 4M97A 4OT6A 5HCYA 3VONA 2HZ0A 4JIAA 3FMMA 4FIFA 1H1SA 5I9ZA 2QG7A 2WEIA 4TYGA 3CQUA 2QKRA 1KE8A 3VS6A 4MXYA 1BKXA 2FB8A 5A6OA 2R3FA 2XALA 2QOLA 4WOVA 4EQMA 2QOQA 3B8QA 4JNWA 5CAQA 4CMTA 3UZRA 4HVHA 3Q5ZA 3UBDA 4BDDA 2UW5A 3F3VA 1ZYJA 3TN8A 5KMJA 3U8WA 4EOLA 5CU3A 4Y5QA 3RM6A 2QI8A 4F63A 2R3GA 2WD1A 3A60A 4C3RA 3F2NA 3GOPA 1JSUA 1S9IA 2BR1A 4O0TA 3I79A 2X0OA 4DBNA 3LM0A 4C36A 3PDTA 2GTNA 4RRVA 4I6LA 4FKIA 4IJ9A 5EYCA 3DB8A 3GCSA 2ITPA 3A61A 3CPBA 3RTPA 4ORKA 1T46A 1VR2A 4U42A 5AP6A 3DDPA 4EKLA 4AP7A 1U54B 1XH4A 4JRVA 3QLGA 2QO7A 4U80A 2RL5A 5CLPA 5LOHA 4YZNA 2YM6A 3GENA 5FUTA 3QBNA 3CCNA 3H10A 2C47A 3NAXA 4IB1A 2QLUA 3F3ZA 2HIWA 4C57A 5IG1A 3W0MA 5DWRA 3DAKA 2Y4IC 3W2QA 3FEGA 1JKLA 4FK3A 3OXZA 4R1VA 4DTBA 3FDNA 1ZMUA 4UN0C 4KINA 4G6LA 4MEDA 4YZCA 4O7YA 3MH0A 1R0PA 2WMWA 4O21A 5HICA 3FZSA 4IX3A 4JMQA 3JY0A 1Z9XA 3KIOC 3MPAA 4O4BB 3M11A 1OIRA 2J4ZA 2WXVA 3CD3A 2A19B 4QNYA 5HU3A 1OB3A 2C6EA 4PMTA 1K2PA 3F61A 4KKGA 5IMEA 5CANA 1WBWA 3HV4A 2GNIA 5KE0A 3VNTA 4AACA 1XMMA 3RJCA 2CGVA 4QNAA 4Y8DA 2FYSA 5IA1A 3MFRA 5AIRA 3TEIA 3QYZA 3WIKA 4ACCA 2ETMA 5BUEA 5T6KA 5JFVA 5CU4A 3FYJX 3BKBA 3DBFA 4MBIA 5LWMA 2CHLA 4QP9A 4X2JA 5E90A 1YWNA 5AUYA 3ZEPA 4D0WA 4F0GA 1J1CA 4BHNA 4PMSA 4UV0A 4B4LA 3DU8A 1P4OA 2YWPA 3D5VA 4U43A 1JOWB 3UQFA 3MV5A 2YACA 1F0QA 3BE9A 4FV7A 4BCFA 5JZJA 3SOCA 5AP0A 3QTUA 4AA5A 4AN2A 4P4CA 4NFNA 2QNJA 4EWHA 3KRRA 4D5HA 4O0WA 2X8DA 3PY3A 2J5EA 5CTPA 1BX6A 4IIRA 4E1ZA 4EC9A 1OMWA 4TL0A 4DGOA 3QQLA 1OM1A 2WMSA 2WTKC 1Y57A 5HO7A 5AJQA 2IW6A 2BRBA 2AQXA 4WO5A 1G5SA 2QU6A 2V62A 2HENA 3FLYA 4KIKB