4MBJA

Human b-raf kinase domain in complex with an imidazopyridine-based inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
269
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Imidazo[4,5-b]pyridine inhibitors of B-Raf kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 62
structure length 269
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mbjA01
2GNHA 4C0TA 4KD1A 5I9ZA 1ZYLA 4FGBA 3FL5A 4S34A 5HNGA 4BCOA 4QMVA 4RLLA 4FTTA 4NFNA 4D2RA 4CG8A 4ACDA 3MTFA 3CKXA 2ZM4A 4AZWA 3F3WA 2R5TA 4WSQA 3C9WA 5HO8A 5KKRC 4F08A 4U8ZA 1TQMA 4LL5A 5JFVA 2WELA 4U3YA 2QLQA 3VUMA 5ANIA 3RZBA 4OR5A 3GNIB 4AOTA 4AZTA 4IBMA 4L3JA 3MA6A 1BI8A 2IZRA 1KOBA 4IH8A 4BBFA 1REKA 3DDQA 2C6EA 4NJDA 3QZFA 3A7IA 2J6MA 2ITVA 3FLNC 1MQ4A 4HPUE 4O6LA 3R30A 2PVRA 4X2NA 1Y8GA 2Q0BA 3SRVA 4FTUA 4BKYA 4MKCA 1YHVA 2YM5A 3GFEA 4I0RA 3S00A 3V8TA 4O0VA 4DINA 5H9BA 4NFMA 3UVQA 1R78A 3HMMA 2C0IA 4DFXE 4DG3E 4U97A 4YPDA 3ZUTA 5IA1A 1M14A 2IWIA 2WAJA 3NYNA 4IJ9A 5D7VA 3CC6A 4DYMA 4NEUA 2Y4IB 5HE3A 3O23A 2W1FA 4DGMA 2XK9A 4RC3A 3GU6A 3FMHA 4MD9E 5HZNA 3SHEA 4BDEA 5HLNA 5M56A 5GZ8A 4FVQA 3R04A 3MB7A 1CM8A 3RCJA 5CSVA 1JOWB 5BPYA 2GPHA 5GHVA 4EUUA 3WZJA 2OSCA 3G9LX 3ZFXA 4HW7A 1BUHA 5KBRA 3ORMA 5I9VA 1PYEA 2ZM1A 1J7IA 4Q2AA 4YZNA 3AMAA 4LMUA 5CAQA 3BU6A 5LVPA 5CNNA 3VN9A 4AA5A 2HZ0A 3LM5A 4EOKA 1YXTA 2BCJA 2OKRA 4FT7A 3E87A 4DEBA 3CSVA 4QP1A 3V5WA 4F1OA 3TIYA 4F64A 2XUUA 3TDWA 4EK6A 5IMEA 3R2BA 4JL9A 5DVRA 3CKWA 4DH5A 3MBLA 3CJFA 3S3IA 3GC7A 2VTMA 5ACBC 3RALA 2GHGA 2UW8A 3BLQA 2EVAA 2PVLA 3V04A 4V0GB 2C30A 4A9SA 3KMUA 3DBCA 4I93A 4RVLA 5C8MA 1W84A 4XS2A 3LFEA 4FIFA 3MH2A 3LM0A 3UGCA 4O7NA 2FGIA 2ZAZA 3P78A 4DLIA 5HX6A 3D2IA 3ALOA 2YACA 4K1BA 3DU8A 3F66A 4HNIA 2JEDA 2PUUA 3I79A 3R1NA 3V5PA 4F6WA 4BDHA 1JKTA 4HGEA 5CEMA 4D4RA 2QVSE 4ANOA 4QMYA 4HYSA 3C4FA 4WUNA 4EK3A 4BI1A 3CPCA 3ZRMA 4PWNA 4RA5A 3LJ2A 4XUFA 4F6SA 4ZSGA 4BBMA 4H3QA 2RFNA 3P7BA 2VWWA 3QLFA 1SVGA 4EH8A 2Q83A 3QALE 5JGBA 3PSCA 2OH4A 3EFJA 3HEGA 4HVIA 3TZ9A 4OAUC 5FP6A 2YDJA 2RFDA 3K2LA 3HMNA 4JBQA 5H8EA 1OIRA 3SDJA 4BYIA 3FZRA 3MH1A 2WOUA 3B8RA 1ZMWA 3EJ1A 3VBTA 1OBGA 4DLJA 3C50A 3MH3A 5AMNA 4OTDA 4PF4A 4ANMA 4MXCA 4IC8A 3DK6A 4Q5EA 4AUAA 5I5ZA 3V8WA 2C6LA 5FRIA 5DR9A 3CLYA 3NVKI 4PPAA 3DAEA 5HU9A 2B54A 4RIXB 5JQ5A 2YCQA 3PY1A 3ZRLA 4ANBA 2Z7LA 2YFXA 3GU4A 1YXVA 3PY3A 2YCSA 3QD3A 2BRBA 2R3FA 3LJ0A 1A9UA 1JKSA 1Y91A 3FSFA 4IZYA 3ZONA 2JKQA 4GYGA 4RIWB 5EI8A 3TXOA 3ZYAA 1PXKA 4QTDA 2WU6A 4P2KA 4NCTC 5FTGA 3PXZA 4O83A 2SRCA 2JFLA 2XK4A 2J0MB 1UKIA 1W7HA 3OCGA 2IW8A 3HX4A 3CS9A 5J95A 4BR3A 5JGAA 5L8JA 4CFWA 5KMJA 5AV3A 2B9IA 3O8PA 4YZBA 5ETCA 3QRTA 4O7RA 1QMZA 2ITXA 3HKOA 1OIQA 4C8BA 3TNHA 3QUDA 4IVAA 3ID6C 2JIVA 2XIYA 1SYKA 4GCJA 3VULA 2BVAA 4FEWA 2HWPA 5IKWA 3JPVA 4IAFA 4BICA 4BIEA 4MNEB 2UV2A 2WQOA 3SLSA 4EQCA 3Q4TA 3R1YA 3IPHA 4BDIA 2GNJA 5HBEA 4MF1A 4FV4A 3RGFA 4XV2A 4ALUA 4ZAUA 4D1XA 4M69B 3ATTA 2WTJA 1GNGA 3QHWA 1T45A 4G3FA 3R22A 4YLLA 2AUHA 2G9XA 3VS3A 4EH6A 4TXCA 4BN1A 4DITA 4BIBA 3ALNA 3D4QA 3GC0A 3P5KA 5FM3A 2CKOA 3NLBA 2UZDA 4L3LA 4QPMA 5AX3A 5D12A 3UO6A 2IZSA 3BGQA 1I44A 4WRSA 3MPAA 1Y6BA 3VUGA 1SVEA 4IWPA 3FXZA 3FI3A 4GIIA 4EK5A 4YURA 4MXZA 2A1AB 5LVMA 5CVFA 4MQ1A 2BAKA 3WYYA 3OXTA 5IQFA 3FXWA 1OB3A 3BKBA 3AC2A 4ERKA 5EYCA 1K2PA 3QRUA 4FL2A 3PA3A 3JVRA 5EHLA 4BI2A 3GOKA 2I0HA 2W5BA 4AGCA 3W33A 4FKUA 5ANJA 2QO7A 5KZIA 5KO1A 3O8TA 2DUVA 1LEWA 4KUJA 3CQWA 4IAYA 3BU5A 3R73A 5CZHA 2PE1A 3U51A 4CZUA 2CNQA 4GG7A 5GIOE 2PUIA 2BRGA 3GP0A 3QGWA 4GH2A 3TIZA 2QKRA 4AF3A 4HVGA 5L8LA 3FI8A 5CTPA 3PVWA 2ZV9A 3U4WA 2JGZA 4YPSA 5M44A 3S0OA 2O64A 5DWRA 3MI9A 3FC2A 5FP5A 4OTIA 4MNFA 4XEYA 5IQGA 5EQPA 2VWVA 2XMYA 4K0YA 4Y95A 3GBZA 3ZMMA 3Q6WA 4YJPA 1HOWA 5KHXA 5BVOA 2O63A 1QPDA 4XV1A 5F20A 3ZLYA 3POZA 3UYTA 3GC8A 4IJPA 4JBVA 2VZ6A 4YO4A 4L00A 4BKJA 5IQCA 2IVSA 2YM3A 4C4FA 1SZMA 2BDWA 4M14A 2VWBA 4E4NA 5FXQA 3E5AA 5CF5A 1APME 3M11A 4EUTA 5IG1A 5AA9A 5IA3A 4WNOA 3U54A 3FPMA 4FKLA 2R7BA 3FZOA 2OK1A 2OW3A 3FV8A 3EN6A 5HLWA 3MVMA 3EH9A 5B7VA 4FSWA 3GU8A 3QKLA 2HELA 4UXLA 3AC4A 4O84A 2CGVA 4JI9A 3PG3A 3TCPA 3IDBA 4NKSA 2BDFA 3OVVA 1GIIA 3DQXA 4FK6A 2WMSA 1JSTA 5DN3A 2Y0AA 3RAIA 4BBEA 3BHHA 2BR1A 3PY0A 5AP6A 2YDKA 4QYGA 3A7JA 3FHIA 1E1XA 4QQCA 2XNEA 4M84A 4FV1A 4DFNA 4QPAA 5CF4A 4ZK5A 2ZV2A 3I1AA 4QP6A 4DHFA 4OTFA 4LOPA 4FICA 3ZO1A 3KQ7A 3VNTA 3IKAA 5IH4A 1J91A 5M57A 4I5PA 3LCOA 1WAKA 3F2RA 5HESA 3PG1A 1IR3A 2R3QA 3UG1A 4WNPA 4D2TA 2OXDA 2C5YA 3A7GA 4ANNA 4GK3A 4O0WA 1ZOEA 4JXFA 4KABA 1SNXA 4IAZA 4ZY5A 5TT7A 4M68A 4Z9LA 3KVXA 2C3LA 3RPOA 3VIDA 3O96A 2OFVA 1YDTE 3ULZA 3KRWA 3UNZA 4TT7A 2ITPA 2REIA 4USEA 2J5EA 2YCFA 2WQMA 4E6CA 3SW7A 3DAKA 2ONLA 4ZXTA 3V5QA 3R8VA 4BRXA 2XS0A 3FLWA 3FJQE 4JQEA 3SRVB 3ZEWA 3JS2A 5AP7A 5BNJA 3IW7A 3OUKA 4KNBA 2W4OA 2BZIB 1GZKA 3G6HA 3ITZA 4KBKA 4AA0A 2JIUA 4FTIA 5BVFA 2HENA 4BCJA 3E88A 4B9DA 4BFMA 2PYWA 3LFBA 1NVSA 3LCSA 4M13A 3ORXA 4EHGA 1XBAA 5EYKA 5HVKA 1H08A 5E8YA 4TZRA 2X1NA 4IZAA 2P2HA 4YC6A 3TV6A 4QQTA 1OUKA 1R1WA 1O6LA 4CGAA 2UZBA 3MY1A 3P23A 2V7OA 4LGDA 3KXNA 4APCA 3G0EA 4AZEA 4U43A 4EH3A 4IDTA 3LQ8A 2Q0NA 3ENMA 4L9IA 3W55A 1KV2A 2B9JA 4FV6A 4FVRA 4R3RA 2VTAA 3F5PA 5J1VA 2XP2A 4FF8A 3R63A 1ATPE 4O7ZA 2PVJA 2OI4X 1FPUA 3NIEA 2ESMA 5CANA 3F69A 4FUYA 5CEQA 1T46A 5HEZA 5M4CA 1H07A 3PLSA 5BX0A 3DTCA 3NW5A 1PXPA 3DJ6A 2FSMX 4FTRA 2Z02A 3EQDA 2FSTX 3FUPA 4YLJA 3O8UA 5E8WA 5HBHA 4F1MA 2I40A 2WO6A 4E6DA 5CSHA 3N51A 4FZ6A 3A4PA 3BYVA 2XYNA 4BGHA 3K3JA 2JKOA 2XK7A 3RPVA 4C3FA 4FYNA 4FSMA 4OTQA 4EOIA 4MXAA 4RX5A 3PJCA 2GMXA 3EB0A 3GVUA 3ORKA 4XCUA 4ZP5A 4DEHA 3RNYA 3RP9A 4DGGA 2Y4IC 2PULA 5CAVA 3S95A 5H8BA 4TKSA 1Q99A 2ZJWA 4ZTHA 4MBIA 3TNPC 2XNOA 5CEKA 2R3JA 4XG7A 2WMAA 3EQGA 4R77A 3HDMA 4IB1A 4KKHA 4OT6A 3ZFMA 3I81A 2UZWE 4P7EA 2OFUA 4WG3A 5E1SA 1FOTA 2VO3A 3Q4ZA 3SXFA 5L8KA 2PZYA 2YM8A 5DEWA 2A4LA 4E1ZA 3BE2A 4F70A 5AM7A 3MESA 2R3NA 3TNQB 2A0CX 4OUCA 2BAJA 3AC3A 5A6NA 2A2AA 3MJ2A 3VUHA 3F7WA 2EB3A 3QXOA 3LMGA 2PE0A 1XHAA 2JDSA 5EW8A 1JAMA 4PDPA 4IAKA 3I4BA 3UZRA 1VEBA 3U87A 2XIKA 4LM5A 2QODA 3SAYA 4M0YA 4R6VA 3R00A 1DAYA 4O0YA 2VTNA 2WZJA 4U81A 4DEAA 1GOLA 4GU6A 5L6WL 5A46A 3WIGA 2C0TA 3N4UA 2G2FA 3P79A 5KUPA 3ANRA 4XG3A 4EHVA 1PMNA 4XG2A 1Q8UA 3SOAA 1H1SA 2O2UA 4NM7A 5B0XA 4BF2A 3CQUA 2XA4A 3OEZA 4FNWA 2XKEA 5L3AA 3PXYA 5HICA 4RC2A 5JEBA 1PXLA 3DAJA 1WVYA 2RSVA 4Y5QA 5FM2A 4H58A 4XV9A 2ITQA 1J3HA 5K3YA 3SC1A 3FKLA 4C62A 1JVPP 4LG4A 4P4CA 5E4HA 4KIOA 4YJUA 3P9JA 4J8NA 3EQCA 2ZMCA 4UV0A 5CAUA 5HG8A 3ORPA 2IZUA 3LFCA 2V22A 3E3PA 2PZ5A 3FY0A 5AR4A 4GVAA 3VBXA 2BKKA 5FXSA 2WOTA 4QTAA 3PVGA 1L8TA 1WBNA 2PHKA 1H24A 4IX3A 4EOQA 1OL6A 4ZS4A 3RVGA 2R3KA 3SD0A 3I0QA 2VTTA 3P0MA 3C51A 4BHZA 4BZOA 5JFXA 2YERA 3NZ0A 3AC8A 4K8AA 2XBJA 3IGOA 2JD5A 2F9GA 4OTRA 4X3FA 3TNIA 3WOWA 3OG7A 3TUCA 3NVMB 4JRNA 4DF3A 4XG9A 1XBBA 2UZLA 2BHEA 3FQSA 5EDPA 1WZYA 3BZ3A 3HV7A 4JIKA 1UNGA 4YC3A 3OCTA 3FAAA 4RZWA 4AFJA 3O71A 5BVDA 4I6HA 2KTYA 3NW6A 2R9SA 4RJ5A 1CTPE 1Q8ZA 3UODA 3RK9A 4M15A 5TOZA 4XJ0A 3MN3A 5EQYA 4EJ7A 3NUYA 3GCQA 4NIFA 4ACHA 3OF0A 4W4VA 3RI1A 1OKZA 4BTMA 3R6XA 3R02A 2ITNA 2OJIA 2ZB1A 3TKIA 4BCNA 3I0OA 5CXZA 2LGCA 5HLPA 4DC2A 3VHEA 4QP2A 1ZOHA 2HY0A 4JG6A 1Z9XA 4BDGA 1XH6A 2XNMA 3NIZA 5CEPA 4LI5A 3FMKA 4G31A 1OMWA 2P33A 3D5WA 2PVKA 3BYSA 4EWQA 4MHAA 2CKQA 3PYYA 4PMTA 4C33A 5CALA 3QQFA 3AD4A 2XJ1A 3NUNA 4FZDB 3KF4A 4N6ZA 4IQ6A 1OIUA 4OW8A 4UMUA 3OZ6A 2B1PA 3VUDA 2XM8A 4C37A 4C4JA 3FEGA 4YSMA 4FBXA 4YR8A 3LLAA 3DB6A 2VO6A 3QA8A 4NWMA 3EL7A 3QTWA 3NNUA 2PVYA 3QZGA 3O50A 4XHKB 5FUTA 5AR8A 4BCKA 4ITHA 4YZCA 2JBPA 4YJRA 1U46A 2IZTA 2XBAA 3CIKA 2V62A 3ORLA 3Q4CA 2RFSA 4ACGA 3HAMA 4GJ3A 2RIOA 3C0GA 4MTAA 5GJGA 3V8SA 2UZNA 2X2MA 4NM0A 1MRYA 5TF9A 2J0JA 4RLKA 4XOYA 1CKPA 3FMDA 5DR2A 2WMQA 2UVYA 1BYGA 4QMOA 3ZRKA 2HCKA 3EKKA 3Q6UA 1JPAA 5I3RA 3DB8A 4FODA 4HCVA 4XP3A 3UQFA 3BHVA 1Z5MA 4K33A 3FMMA 1Q3WA 3LIJA 3Q60A 3K5VA 4FKQA 3FXXA 4WBBB 5HG5A 4O2ZA 4FIEA 3GQLA 3O2MA 1QL6A 3I60A 4HPTE 3FL4A 2HIWA 2PY3A 2UZVA 3L9MA 3QHRA 4W8DA 2G2IA 3ORNA 4FSNA 2BZJA 3PXKA 5EHOA 1W0XC 3CPBA 5EHYA 5EI2A 4CZYB 2XK8A 2HK5A 3DBEA 3PSBA 4KIQA 4YP8A 5BVWA 4RX9A 2ZB0A 5ANOA 4JLCA 2C3JA 3U4UA 4USFA 3MJ1A 1S9IA 3Q96A 3COMA 1M52A 2YM6A 3I5NA 3NYVA 3WILA 1YI3A 5HKMA 4A4XA 2CCIA 5AIRA 3FLSA 1W82A 4GYIA 1HCLA 3MIYA 4CFNA 2C5VA 4WNKA 3RK5A 4AZVA 4C57A 4IM3A 2EUFB 1B39A 4FT3A 3D83A 4GFOA 2J7TA 2QG7A 2WU7A 2NO3A 4F9BA 3CBLA 4HVDA 2WMVA 4DTAA 2OBJA 4QQ5A 3H10A 1PXIA 4AE6A 4JT3A 4EZ5A 5H3QA 4GJ2A 5K4IA 4H3BA 4FKSA 4IAIA 4N6YA 2PMOX 3K5UA 4PTEA 3KN5A 4G6OA 1H01A 4F4PA 2QOBA 3DKGA 4YJNA 3EFLA 4FUXA 4PMSA 4EZ3A 4IFGA 1GY3A 3G0FA 1HCKA 4W4XA 3Q32A 4PNIA 4O81A 4FX3A 4RWKA 1OBDA 3UIXA 4JG7A 5DOSA 3AGMA 2QOKA 4G5JA 5IUHA 2IVUA 3AG9A 4E4MA 4QMPA 4YJOA 4JIAA 1TQPA 2ITWA 4L3PA 5HHWA 2JDTA 3WARA 3PP1A 4G2FA 2VWXA 5EG3A 1UWHA 3RNIA 4EKLA 4CCBA 3L8PA 3BRBA 1FVTA 4O96A 5DRBA 2C0OA 3THBA 5CYIA 2BRMA 2VTSA 3PVUA 5AEPA 4YNOA 3MY5A 4UWBA 3UOLA 1XQZA 3NEWA 3D0EA 4LRKA 1ZMUA 3AQVA 3WZEA 1H1PA 4FV3A 4FV8A 4F0IA 3WZUA 4NYEA 2JDOA 4FE2A 4ZS0A 2C3KA 5HIBA 5HO6A 1WBWA 5AR7A 4ACCA 4OLIA 3QBNA 5AUZA 3PPKA 2Z7RA 3F5UA 4H36A 4U41A 3RZFA 4J98A 3TM0A 5AAGA 4ZZMA 1PYXA 3D7TA 3A7HA 3Q5IA 4I3ZA 4Z7GA 5LQFA 2C4GA 4BCGA 4BCMA 5JSMA 4I22A 1MP8A 1YOJA 5CT7A 3ATSA 1PMVA 1JWHA 2BHHA 3UZTA 4GKIA 3AMYA 3DFAA 3M42A 3TUDA 4EK8A 5IEVA 4O1PA 3KRRA 2J5FA 3P86A 2W0JA 3I7BA 4CXAA 3MVLA 4UYNA 4U42A 3PXRA 3KULA 3HDNA 5AJQA 3UNKA 4KSQA 4F9AA 3WF5A 3HGKA 3JR1A 3HV5A 1UU3A 3R9DA 2VAGA 3V5JA 3D5UA 4Y72A 3RHKA 2C1AA 3BI6A 3FYKX 1Q8WA 4WG4A 4YTHA 3VF8A 5CASA 4X7QA 4FV5A 5KX8A 4FNYA 4Y73A 5IH6A 4C4HA 3OD6X 4R5YA 3EN4A 1Y8YA 2HW7A 2PTKA 4CKRA 1J7UA 5IF1A 4JQ8A 3ZBFA 2JIIA 4X3JA 2BDJA 2UUEA 4IEBA 4AXAA 4B7TA 4B8MA 5CAOA 5IU2A 3ERKA 2QOFA 3A8XA 3UJGA 4BKZA 5AA8A 4CZTA 1F5QA 3SW4A 4DN5A 4QNYA 1YXXA 4TRLA 1R39A 4IMYA 4R7BA 2F49A 1NVRA 1SM2A 3TJCA 2GNIA 4E6AA 2WD1A 4HGLA 4FZAB 5IQEA 3TZ8A 4P5ZA 2C47A 2GHLA 2OH0E 1PXNA 2O65A 3ACKA 3BELA 3IW8A 1YXUA 2ZDUA 3AT3A 3FZTA 1NT2A 5IMXA 4FI1A 3FZSA 2X4ZA 3O51A 4E5BA 1PRYA 4J99A 3NRMA 2F7EE 2C6OA 5HI2A 4PL4A 4ZSJA 3PE2A 1AGWA 3BHYA 3WF7A 2R3RA 2FVDA 2NPQA 3W2RA 3QZIA 4RBLA 4ACMA 3II5A 4S33A 3NNVA 4W9WA 2C5OA 4ZSLA 2WNTA 5JRQA 3DA6A 5ICPA 1JSVA 2Y9QA 5EDQA 3N9XA 3FC1X 5CU2A 5BQ0A 4DH8A 3C4EA 5CENA 3OW4A 3LOKA 4OGRA 3G2FA 3PP0A 5I9XA 3MTLA 4FKOA 4P90A 3G6GA 4BVUA 4NK9A 4WD5A 2XIXA 2XEZA 4XBRA 3QQJA 4RJ8A 5JH6A 4UBAA 3E7VA 5CXHA 5L2WA 1FGKA 3LMHA 2JKMA 2QHNA 2XH5A 2QCSA 4NJ3A 4FTNA 4YTCA 1A48A 2GNLA 3UOKA 5ANKA 1TQIA 2YWPA 3IDPA 5GJFA 5HQ0A 3VO3A 1MUOA 2E2BA 2ERKA 4JAIA 4W9XA 2GSFA 4O91A 3AT2A 3OP5A 1ZZ2A 4H1JA 2CSNA 4FG9A 4G3DA 3OT3A 4K2RA 5AR2A 2WXVA 3B2WA 3LVPA 1FINA 2YM7A 3HV4A 3DBQA 3MGYA 5IEXA 2YDIA 1OGUA 3FMLA 3GOPA 5CU0A 4M67A 5B2MA 5HO7A 3MSSA 1BMKA 2C6IA 2R0UA 2C69A 3KK9A 2X9FA 3ZBXA 2W5HA 3QF9A 3UG2A 2XIZA 3Q2MA 3AC5A 4RFMA 3ORZA 4G34A 4CKJA 5EKNA 1TKIA 4NL0A 4L68A 4FIJA 4FV7A 3KVWA 4B99A 2OXYA 5A4CA 3GCPA 4L45A 4X3FB 1ZARA 3L9NA 3QA0A 3VRYA 2UW5A 1IA9A 3NAYA 2CMWA 3CE3A 3H30A 5B2KA 5T6KA 4EH5A 2XEYA 5F9EA 1PXJA 4OBOA 2YZLA 2VNWA 3UTOA 5F4NA 2JDRA 2F7XE 3ZXZA 3BYMA 3EQIA 3F9NA 2PVNA 4QTEA 2EXEA 2JBOA 3BYOA 3KK8A 3L1SA 3VW8A 4XV3A 3NR9A 2W99B 3UIBA 2PZIA 3S2PA 1ND4A 3BV3A 2R3OA 4NIFB 4L7SA 4QP9A 4Y46A 2PK9A 1V1KA 3FDNA 3E64A 4ZY6A 4A7CA 4ASEA 1NW1A 3OWPA 5ANEA 4UWYA 5LCJA 1L3RE 3HL7A 3TI1A 3DKCA 4JG8A 5BUEA 5CEIA 5KBQA 5DLSA 5AP4A 1LR4A 5I3OA 5CT0A 2ZYBA 1XH7A 3AT4A 3UP2A 2J51A 4L43A 5EOBA 3Q9YA 5EQEA 3ZHPC 1KV1A 3LQ5A 3W2QA 1LUFA 1CSNA 3QU0A 4YNEA 3HP2A 2VWZA 4HGTA 2IW6A 4O0UA 5DT4A 4AG8A 4EQUA 2XK6A 4RQVA 2ETRA 4TYIA 2QLUA 2J4ZA 4FOBA 3BGZA 5L6OA 1IAJA 4F6UA 2OLCA 3PJ3A 3HRBA 3TN8A 5A4EA 4UX9A 3QD2B 2XJ2A 3LHJA 3SA0A 4CLIA 4J95A 5EW9A 3KXZA 4UXQA 3ZU7A 4AW5A 4TWCA 4L7FA 2JAMA 1WVXA 3GFWA 4YZ9A 5EOLA 3QWJA 3Q53A 3QCYA 4IC7A 2VRXA 4WOVA 3U9CA 2PWLA 3MDYA 4QMLA 3WIKA 3ZC5A 4XP0A 4XX9A 4PRJA 5I4NA 2CHLA 3D14A 2ZV7A 4ZZNA 4EH7A 3E93A 5C8NA 3V6SA 3R01A 5HOAA 4BDBA 4LGHA 4C3PA 4EI4A 5D7AA 2R2PA 4DCEA 4QT1A 2B52A 2QC6A 3FLQA 5LARA 2I0VA 3KF7A 3W10A 2YITA 5K0KA 1PKDA 5DT3A 1OKYA 4IAAA 4YJQA 3UMXA 4BTJA 3NGAA 3GXLA 1FMOE 4USDA 3RPRA 3C4XA 4RVKA 4AOJA 4YGAA 1LEZA 4ITIA 3NNXA 2VV9A 5EYDA 4QMXA 5I9UA 3RWPA 3EHAA 4EWHA 2ZDTA 3U8WA 3IG7A 3LFSA 4UALA 4KSPA 2WMBA 3PRIA 5K5NA 3EMGA 3ZO3A 3C1XA 4JX7A 3W32A 2CPKE 3SG8A 5M07A 2DQ7X 4JRVA 3JUHA 3RWQA 2XYUA 3I7CA 2J50A 3DFCB 1XH5A 2ZV8A 4ANLA 4MD8E 1XR1A 2E9PA 4X0MA 2H8HA 2XRWA 3F3VA 1XH9A 3NMUF 3SXRA 3U6JA 2OJGA 5CU6A 4HYUA 3QQKA 4O22A 4K11A 3LW0A 2R3PA 2PZRA 4U79A 2YIQA 3WE4A 1H0VA 1H00A 4AW2A 1WVWA 1UKHA 2WHBA 4G6NA 5CVHA 4R8QA 5G1XA 5FGKA 4C2VA 1XH4A 2HXQA 5EM7A 4XG8A 1GAGA 4M7IA 5DFPA 4BI0A 3W2CA 3OWJA 4CV9A 1H0WA 3PVBA 4BC6A 4GL9A 2VWYA 3KXGA 5EM8A 2CCHA 4AAAA 4EBVA 3DLZA 4YTFA 3SGCA 4ZMEA 3EL8A 3VQUA 3QC9A 4HNFA 3COKA 4N4SA 2GQSA 1ZXEA 5DIAA 4TYEA 4ASZA 3T9TA 2C6MA 3GGFA 2ETKA 3NUXA 1Q61A 1XH8A 2XRUA 5EK7A 2I6LA 2WIHA 3D5XA 3DDPA 1PXOA 2QOLA 1G3NA 3ODYX 4JNWA 4EOMA 5HX8A 5IA2A 3C5IA 3MW1A 4IVBA 5CI7A 1Q24A 3NW7A 4I5MA 3QD4A 1P4OA 1KE8A 2YEXA 4FK3A 5J9LA 2HXLA 2X6DA 3TT0A 4V04A 2B55A 4AS0A 3GUBA 3IONA 4JJRA 4EH4A 4G9RA 4ZTNA 3DS6A 3HV3A 3D94A 4CMTA 2XNPA 2WMWA 3KL8A 1U4DA 4AT4A 4CFFA 1KE7A 3SOCA 3ORTA 1OIYA 4MCVA 4ARKA 3P4KA 4WKQA 4YJSA 4CFXA 4RC4A 5LVLA 5KMKA 3C4ZA 3TZ7A 4FV0A 3NUAA 1KE5A 1OPJA 3NNWA 4WUAA 2VTOA 5CVGA 4KKEA 4AA4A 1WBTA 3QCXA 5K4JA 4DT9A 2W7XA 5BVKA 3OWLA 3IECA 4NM3A 5TR6A 3D7TB 3UO5A 2XKCA 3D5VA 3KC3A 4EYMA 3EQHA 4FVPA 3OEFX 4YZMA 3F7ZA 4CNHA 4D2WA 4GEOA 3UIMA 3BEGA 4M97A 4XYFA 4QP3A 3F2NA 1M2PA 3A61A 4UWCA 3KULB 3QCSA 2W4JA 5HG7A 3JY0A 3PPZA 2VTRA 2EB2A 3PSDA 4EC8A 3HA6A 2Z2WA 2ONLC 3NWWA 4KAOA 1XKKA 4Q9ZA 3W2SA 4YMJA 3C7QA 3L9LA 4PP9A 4BIDA 3QQUA 4FT5A 5A3XA 1KE9A 5IQDA 3QYZA 1WBVA 2CKEA 2XNGA 3DQWA 4RIOA 3QQLA 3A7FA 4ALWA 4GS6A 4HGSA 3BCEA 4E8AA 4RX8A 4QQJA 2QOHA 2ZVAA 2O3PA 3KGAA 3BWFA 5A4TA 4FKIA 2FSOX 4CMUA 3RM6A 2VU3A 4KB8A 4X2FA 3EKNA 3KY2A 3H0ZA 4EOLA 2PVMA 4A4LA 4RA4A 4BDAA 4F7NA 4FIGA 4J96A 5IZFA 4J53A 2XK3A 3BX5A 5ACKA 5LOHA 2OIDA 4GG5A 4CTBA 1IRKA 4PP7A 4GW8A 3ZEPA 4D4YA 5DT0A 5AX9A 4BB4A 2HYYA 1ZY4A 3KB7A 3MYGA 4GFGA 5DG5A 3ZZWA 1Y6AA 2R0IA 3MFSA 1YVJA 3HRCA 4I1ZA 2ZM3A 3C4WA 3G15A 3R7GA 2BRNA 3CXWA 4LUDA 2W5AA 3UIUA 4FEUA 4PTCA 5M4IA 2AYPA 5B2LA 4XP2A 4FKGA 2UZOA 3DXNA 5DPVA 4GK4A 4RGJA 4B0GA 5IEYA 4DCAA 3D7ZA 2R64A 4O1OA 1EH4A 2X7OA 3LFFA 4FNZA 1E1VA 2QQ7A 2YLEA 4RG0A 5LMAA 2RFEA 2O8YA 4RPVA 3UO4A 4DG0E 4DH3A 3OOMA 2B0QA 1J1CA 4R3PA 3R7UA 3ZS5A 3MA3A 2B9HA 3F3ZA 3DCVA 5E8UA 3CQEA 3FZPA 2PUNA 3F5GA 4QMMA 3UC4A 2GS2A 3CTHA 2IN6A 2CJMA 3H9OA 3ZTXA 2C6DA 4F1TA 4HYIA 3CEKA 4LV5A 1BX6A 3GU5A 4MQ2A 5H2UA 1H26A 3FWQA 2J90A 4C58A 5E9EA 4ZIMA 4BCIA 1LPUA 3V5TA 3EQBA 1F3MC 4D2VA 4HVHA 3F88A 5ANDA 5LXMA 1G8SA 5IUIA 5CX9A 2FO0A 3TWJA 3C0HA 5D11A 1PKGA 4CLJA 5GIPE 1UVRA 1OM1A 2UW4A 3SG9A 3VRZA 5FBOA 2F2CB 3B8QA 3A62A 4ONAA 4F7LA 4JDHA 3FPQA 2W1HA 5KMIA 3VBYA 3DK3A 2BMCA 3S4QA 4IB3A 3EOCA 3PIYA 4TL0A 1U54A 3ROCA 3IGGA 3ZLWA 4E4LA 3Q5ZA 3UOHA 4FKPA 2VWUA 3MFRA 3Q9WA 4RQKA 2RF9A 3OC1A 1R0EA 2VTHA 3LMIA 3GCVA 5HTBA 2WQEA 4I92A 5HTIA 4O7WA 4MX9A 4X2KA 1REJA 2VGPA 5DEYA 3EN7A 4U5JA 4C02A 4HOKA 2B9FA 3ZDUA 4C61A 4W8EA 3AXWA 3BEAA 3VC4A 2QR8A 5CY3A 3VS5A 3BLRA 5FDXA 4AZFA 1Q4LA 2C68A 2OG8A 2W1GA 1UWJA 5FTOA 4MXXA 3M1SA 3BV2A 4HCUA 1OL5A 5DGZA 4PDYA 4N70A 4V0GA 4AN2A 1YKRA 1ZMVA 4YHTA 4L01A 2VN9A 4J71A 3VHKA 3SQQA 3VS2A 3H0YA 4R5SA 5C03A 5HE1A 2JC6A 3P7CA 4TTHB 3BHUA 4DG2E 2PMNX 2X9EA 5EW3A 1U5RA 3FQHA 2W1DA 3JY9A 3TZMA 1M7QA 2IJMA 2FSLX 2OIBA 3ZUVA 4S32A 4RVMA 5H8GA 5C26A 2BIYA 1CKIA 2X8IA 2BZKB 5E1EA 3ZO4A 4XG6A 3KXXA 1M17A 4XNEA 4ANQA 2YISA 4CQEA 4EOJA 1JLUE 3FLYA 4B8LA 4CYIA 3UDBA 3OTVA 1Q41A 2UW6A 4GUBA 5GNKA 5A14A 3COIA 4TPTA 2JLDA 3D2KA 3POOA 4A9UA 4D2PA 3OHTA 1UNHA 3BQRA 4MBLA 5KNJA 2UW7A 4X3FC 3SX9A 3QCQA 3MPMA 2B4SB 1M2QA 5CI6A 3BGPA 1B6CB 3VJNA 4ZJVA 2XJ0A 3AD5A 4ENXA 3FQEA 3ET7A 1JNKA 1XBCA 4E26A 1BL6A 3GC9A 4JDJA 3PA4A 1DM2A 2BIKB 2FYSA 4FSQA 5IQBA 5J7BA 3E8CA 3CD3A 2XCKA 4F99A 4D4VA 1ZYCA 4Q9SA 4O0TA 4NU1A 4J1RA 5CQUA 4RJ7A 5J87A 4D0XA 3DK7A 3RHXA 3ANQA 1IAHA 5LMBA 5KMMA 3LXKA 4FC0A 3HMOA 3QL8A 2WEVA 4UZHA 5K5XA 4EONA 2OGVA 2YABA 2XKFA 1WBOA 1JBPE 5D41A 5JFSA 3EYGA 1WBSA 1NA7A 3BPRA 4J8MA 3NSZA 4M3QA 5AR3A 2YIRA 2OIQA 2UZUE 3E8EA 5HE0A 4IANA 5T68A 4F0GA 3A4OX 4KA3A 5FDPA 4EORA 5KMLA 4D55A 2R7IA 3NYXA 4X21A 4D1ZA 1JKKA 5JKGA 1RW8A 4O27B 4BCQA 4UB7A 3NUSA 1RJBA 4O0XA 4QD6A 4XH6A 3RAHA 4GSBA 5ANGA 4E4XA 4E7WA 3HZTA 3TL8A 2OJFE 3QX2A 2ETMA 4DFUA 3VWAA 4ZEGA 4NSTA 2YLFA 4J52A 4F65A 1GJOA 4FT0A 4QPSA 4MNEA 4CCUA 5AUXA 1P2AA 4FL1A 4Z7HA 2VO0A 3T3UA 4O7YA 5HD7A 1NXKA 3LLTA 5CF8A 3P08A 1OKWA 3QRKA 1OPKA 2CN5A 4F9YA 3IDCA 5D9HA 3S1HA 4DH7A 5IA5A 2GDOA 3OW3A 4AGDA 5K9IA 1ZYJA 2I1MA 3BE9A 3PDTA 4DEDA 3LCDA 3QTUA 1URWA 3DNEA 3OROA 3GEQA 4JVGA 2J9MA 3BBWA 5CF6A 2W96B 3F5XA 4C7TA 3DNDA 2OU7A 3QTRA 4TN6A 4PDSA 5HTCA 3R71A 3DZQA 2BROA 2H9VA 2IPXA 4TNBA 4WIHA 4IB0A 2LAVA 3UVPA 3WE8A 3R9NA 1SNUA 3PJ1A 3R83A 2OZAA 3FMJA 4XRJA 4L53A 4RIYA 4TWPA 5I0BA 4DGOA 2VTPA 1YHSA 4FTAA 2QOOA 2Z7QA 4IZ7A 4DBNA 2UW0A 2GCDA 5HIEA 4DTBA 4X6RA 4MWHA 4FA2A 2YN8A 3HV6A 3LZBA 4FSUA 4FSTA 3OBGA 1H1QA 5AWMA 5JFWA 3PXQA 2WTWA 3W18A 1H27A 4GT3A 3PA5A 4WSYA 2QOQA 3G5DA 3C4CA 3IO7A 4NH1A 4YHFA 3V5LA 1IASA 1M7NA 3ZSHA 5IDNA 1H28A 4BY9E 4JBOA 5C8KA 3PRFA 5E92A 4D58A 2EWAA 4I21A 4GT4A 4EC9A 3C13A 4WBOA 5CAPA 3AD6A 4P5QA 5FXRA 1G8AA 1VR2A 3BBTB 3NUUA 5LMKA 3IOKA 4R1YA 5M09A 4BTFA 1M2RA 4QMZA 1FVRA 2VGOA 2CNVA 2ZOQA 4Y5HA 4BZNA 3E8NA 4A07A 4ZJJA 5CU4A 4H3PA 3RK7A 3ZCLA 4RMZA 2XM9A 4FSRA 1AD5A 4ZTSA 1YDSE 3DY7A 3PIXA 4K9YA 4FIIA 3KU2A 4RVTA 4XLVA 4S30A 4C35A 1ZAOA 4O0SA 1R0PA 5BVEA 3R8PA 3R1QA 3MB6A 3KKVA 4TWNA 3UE4A 4CG9A 1PMUA 2DS1A 5CU3A 4C4EA 3LFNA 5L2SA 4MEDA 1W83A 2A27A 2CGWA 3DZOA 1BLXA 1RE8A 3VVHA 4RRVA 4EOOA 3OXIA 5L2TA 4AWIA 4GT5A 3Q3BA 4IVCA 5HNBA 3KCKA 4D4SA 5EYMA 4DFYA 4DEEA 3MY0A 5EDRA 4CV8A 4D2SA 1Y57A 1OL2A 1PMEA 5LVNA 2E9NA 1QPCA 1A06A 3KMWA 2P55A 3TKUA 5IH5A 4CFMA 2WTVA 4FGRA 2ITUA 2GTMA 1DAWA 4PMMA 4B6LA 4FV2A 2JITA 2X8EA 2V7AA 1WBPA 1K9AA 1KE6A 4NW5A 1UU7A 2R3HA 4J7BA 4DEIA 5HU3A 4DA5A 3A2CA 4BTKA 4WNMA 3EZVA 2CGXA 1H25A 2W9ZB 3QQGA 4BDCA 4H05A 1URCA 4G5PA 5FTQA 3UVRA 3WBLA 4R7IA 4LRJA 5T3QA 4MK0A 5HVJA 3HYHA 2QI8A 2X4FA 4OT5A 5ITAA 3QC4A 3AC1A 3KA0A 4H1MA 4I5HA 4IXPA 4L52A 3OTUA 4LYNA 4BYJA 3UQGA 4FKJA 2EU9A 4D1SA 5CNOA 3KRLA 4O2PA 3FHRA 3CY3A 4KRDA 5M53A 3DXQA 1O6YA 3IOPA 1QPJA 4IZ5A 3R8UA 2CLQA 1Z57A 3OFMA 4IHPA 4MYGA 1OVEA 2BTRA 1H4LA 3A60A 5KCVA 4O7SA 4S2ZA 3CY2A 2X2LA 3FZ1A 2GFSA 4PQNA 5E8VA 5CSWA 4OBPA 3PLAE 5JMSA 2G01A 4FTJA 4TWOA 2H34A 4NM5A 4MXYA 2UZEA 2VX0A 3NYOA 2QU5A 3C0IA 3PUPA 5EM5A 4AN9A 3R7OA 4A9RA 5E7RA 2HY81 2FB8A 5J8IA 3ZC6A 4ID7A 4GKHA 3DJ7A 2YJRA 5AM6A 1GZOA 2IO6A 3DGKA 3NPCA 3PJ2A 3WF8A 2P3GX 4IWDA 5E8ZA 4QYEA 1XJDA 3F3UA 3RAWA 4AT5A 2GS7A 1VJYA 4A4OA 3HP5A 4MAOA 4GV1A 3CD8A 2HAKA 4D5KA 2YIWA 4BWKA 4FEQA 3VBWA 2F2UA 4OBQA 4UMTA 5I9YA 4BCPA 1U54B 4LOOA 3ZXTA 2W1CA 3EWHA 3NS9A 4BCHA 4AW1A 3KMMA 3F3TA 4Y85A 3T3VA 4EOPA 4G16A 3V3VA 2XZSA 3QX4A 3ENHA 2O5KA 4YTIA 2G2HA 2R3IA 3MH0A 3RM7A 5HORA 1JKLA 2BRHA 4NZWB 4FT9A 5KZ0A 4C36A 4PUZA 3QTZA 3L8SA 2RG5A 5CQWA 4DBXA 4YU2A 5DI1A 5DBXA 2BAQA 2EXMA 3TG1A 4E5AX 4YLKA 3OMVA 4ENYA 2E9OA 3KN6A 4A06A 4AFEA 4E3CA 3LQ3A 2CKPA 5A6OA 3GI3A 2QD9A 4PL3A 4G3GA 2GNGA 2J2IB 3LPBA 4KRCA 4QOXA 1YI6A 3TEIA 4D9TA 4YSJA 3W16A 1YW2A 5E8SA 4PV0A 5CSXA 1NVQA 4PTGA 4Q5HA 5JN2A 3GCSA 4TYGA 5GINE 4DH1A 4RX7A 4F9CA 2OO8X 2WTKB 3AGLA 3FE3A 4H39A 4KINA 2OWBA 4NUSA 4FL3A 1CKJA 1PW2A 1BI7A 1NY3A 2X0GA 2GS6A 3W1FA 2PU8A 3VUIA 4S31A 5HBJA 3HUCA 4O82A 3O7LD 3RKBA 2Z7SA 3PTGA 2CGUA 3MFUA 4JOAA 3BQCA 3OT8A 5G6VA 1ZWSA 4NTSA 2JFMA 3GU7A 5ETFA 5HCZA 4O7VA 3DBFA 4JDKA 4FG7A 2WTCA 4TYHA 4E6QA 3V51A 3IS5A 4O21A 2O0UA 3UYSA 1OZ1A 2JAVA 2RGPA 3FBVA 3RTPA 2E9UA 4QP7A 4IB5A 3C5UA 4IIRA 4C59A 1DI8A 1RDQE 3QLGA 5FD2A 3RMFA 1O9UA 4E93A 2V0DA 2FH9A 2UZTA 2GNFA 5JZNA 4GUEA 2VTIA 3QTQA 1QPEA 4HVSA 3QTIA 5J9ZA 3KXHA 4Y8DA 5F94A 3R9HA 3IW6A 4PPCA 2YWVA 3E7OA 2QR7A 4JAJA 3EN9A 2PL0A 5E91A 1R3CA 3RJCA 4U7ZA 2YAAA 5HCYA 3O0GA 5BMSA 3U55A 4QMWA 4U9AA 4GU9A 2Y6MA 4AX8A 4DGNA 3B2TA 4CD0A 4O86A 2QKWB 4E5WA 4Z55A 4M12A 4QTBA 1GIHA 4EOSA 3DV3A 1MRVA 2BTSA 4L44A 3WF6A 4CQGA 3UOJA 4FTMA 5AUWA 3NX8A 4UEUA 4NCTA 4NW6A 3DBDA 2Y4PA 2C6TA 4FZFB 5LJJA 3W8QA 3ZH8A 4AN3A 2X7FA 2E9VA 4JDIA 3KCFA 4PL5A 5FBNC 3ZFYA 2Y8OA 1ZZLA 4CEGA 5CSPA 5BYZA 3QKMA 2X8DA 3BU3A 2F4JA 4DAWA 1YXSA 2QOIA 3E62A 4LL0A 5FQDC 3HMIA 5AIKA 4E73A 4Z16A 3R7YA 4M0ZA 5EFQA 1OITA 4EL9A 5AUTA 4QMNA 2CDZA 3LXNA 4RJ3A 3FKOA 1V0BA 4K77A 5DE2A 1YI4A 2P2IA 3TV4A 4TY1A 3R9OA 4IM2A 2UVZA 4WG5A 3RCDA 4IE9A 5AUYA 3PIZA 5DR6A 3QUPA 1OECA 2Y7JA 3ACJA 4ZTMA 5BUJA 3PZEA 4UY9A 5AV4A 3EQRA 4YUQA 4A9TA 3ZM9A 4AZSA 3R7IA 2RG6A 3BLHA 1CMKE 3VQHA 4RWJA 2Z60A 1LP4A 4O38A 5LVOA 3I5ZA 4BDFA 5E8TA 4IW0A 4F63A 4Y83A 5FEDA 2BUJA 3PE1A 3T8OA 2NP8A 4FNXA 3LKMA 2QONA 4FKVA 3DLSA 3OS3A 3F82A 3QFVA 4DTKA 1XWSA 5EKOA 2GTNA 4FKRA 3CGFA 4HZRA 4L42A 3WYXA 3MV5A 3VJOA 3OY3A 3WZKA 2PVHA 3MVJA 4I23A 3OOGA 5AP1A 4U40A 4E20A 3UMWA 2OZAB 5AAEA 5AV2A 2YAKA 2RL5A 4QRCA 4RIYB 1IEPA 1E9HA 1AQ1A 4GFMA 4EH9A 5M08A 2WQNA 1VYZA 4OTWA 3E8DA 3D15A 5JK3A 4HCTA 3MVHA 3ZSGA 4IACA 4CT1A 5IPJA 3QXPA 1KOAA 2IW9A 4ASDA 5GJDA 2WKMA 2YZAA 4I0TA 4IADA 3EQPA 1WCCA 5AV1A 3Q04A 2F57A 1G5SA 2WIPA 3GCUA 3PWDA 4JX3A 4PDOA 1B38A 2BILB 4O7LA 3W2OA 4AGWA 5M55A 1PJKA 3G51A 4DE4A 4DFBA 3ORIA 4QMSA 1YWVA 1Q62A 1CDKA 5C4KA 3Q4UA 3TTJA 2UW9A 4OTPA 1ZRZA 3LE6A 3HUBA 3ODZX 4KIKA 5AP5A 1GZNA 3W2PA 5BUIA 1UV5A 3LCKA 4RWIA 2X2KA 3TJDA 4V01A 5A4LA 3JXWA 4KS8A 3PPJA 1SMHA 1DI9A 1YHWA 3HLLA 3PXFA 4IWOA 5IUGA 4CFUA 2OXXA 4ZLYA 5KE0A 5BYLA 3EYHA 5DRDA 5C4LA 4J97A 3GQIA 2P0CA 3EN5A 1ZY5A 3HA8A 4L8MA 3WZDA 5GZAA 3UPZA 4FSYA 3ZOSA 2R3LA 4ZOGA 5FWKK 4IM0A 5HIDA 1STCE 1TVOA 4I5CA 5AFVA 5FEQA 3R28A 3NAXA 4I0SA 4ZTRA 5TKDA 4I6BA 3R8ZA 3DJ5A 5AP0A 2VD5A 2XVDA 5JRSA 4FEVA 4F7SA 1PXMA 1YWRA 2C1BA 2YJSA 3LXPA 4BDJA 4EHZA 4ZLOA 5KMOA 2A19B 1YOMA 1I09A 4QO9A 4X2GA 3VS4A 4C4IA 4M8TA 3SXSA 3EFWA 5J5TA 3G33A 4M66A 3FMNA 5KKRB 4QNAA 3IQ7A 4CVAA 3KRXA 4LOQA 4I6QA 3N4VA 1Q3DA 3ZM4A 4U0IA 4RFYA 5DNRA 4XLIA 2ITZA 4XOZA 3JVSA 4BHNA 4O0RA 3DXPA 3UBDA 4BWXA 4UMQA 3Q9ZA 5CWZA 2BALA 4LGGA 3MS9A 4BCFA 3TTIA 3GB2A 1K3AA 1YQJA 4U3ZA 4L67A 3UQCA 3GT8A 4R78A 2ITOA 3CGOA 3FLZA 3FSKA 3TACA 3QD0A 5A9UA 1XO2B 5HD4A 5E8XA 3CTQA 5C27A 1JSUA 2C5NA 4K6ZA 5IQHA 3HMPA 5HCXA 4OTHA 4NKAA 2UVXA 4FTKA 5DHJA 2F7ZE 5DA3A 1O6KA 2J0KA 4QP8A 2WQBA 3AMBA 2BFYA 5AP2A 4KBCA 4YHJA 3JYAA 2W1IA 3RPSA 2HWOA 1FGIA 2PVFA 3SV0A 3ZUUA 4QYHA 3TNWA 3LJ1A 2CLXA 3FY2A 4MH7A 4UMRA 2WMUA 2GU8A 1PHKA 1VYWA 2XKDA 4FSZA 3QRJA 4YC8A 2HW6A 3V01A 5JQ8A 2G15A 4JR7A 3VUKA 4PPBA 3COHA 4FTCA 4RJ4A 2OJJA 4FEXA 3UC3A 4G1WA 3LCTA 4QP4A 1FQ1B 3R8MA 1ZYSA 2YIXA 3FYJX 4RJ6A 5F1ZA 5JGDA 2PMIA 1P14A 1PY5A 4X6QC 4OAVB 5CS6A 2ACXA 5EM6A 3QTSA 1VZOA 2GQRA 2OF2A 2BZHB 3L8XA 3T9IA 4FR4A 3SVVA 2W17A 2DYLA 4FG8A 5IDPA 4TW9A 5HE2A 3U6IA 3EIDA 3H3CA 3P7AA 2VNYA 4WO5A 3TKHA 4F0FA 3L9PA 1MQBA 4ZSEA 2UW3A 3KEXA 2B7AA 4BDDA 2IG7A 3ROYA 3ZO2A 1GZ8A 4R7HA 4V05A 4ZY4A 5L2QA 2I7QA 4W4WA 2VTLA 2W1ZA 2YHVA 4NT4A 5JT2A 1UNLA 3DT1A 4YZDA 4UZDA 4N57A 2WB8A 3VS6A 3QKKA 2I0YA 4IX6A 4QMQA 4U45A 3QTXA 4CYJA 2X7GA 4ALVA 5C01A 4R1VA 4B4LA 4RWLA 2GFCA 2XIRA 4HJOA 2PZPA 3HECA 2OZOA 3VUTA 5DYJA 2X81A 3ZLXA 3OCSA 3Q9XA 5FLFA 3HNGA 3ELJA 5BMMA 5HNIX 2AC5A 5F95A 3TDVA 2KULA 4KBAA 3PFQA 2QURA 2QU6A 4IVDA 3LXLA 3GENA 4LQMA 3VAPA 3VF9A 2WTDA 2NNWB 5K0XA 3F61A 2HOGA 3BHTA 2RKUA 3P1AA 4ANSA 4RT7A 2W06A 1H1RA 4CTCA 3ZZEA 3I6UA 3MIAA 3R21A 4TYHB 4FYOA 4YO6A 4EYJA 2VTQA 2G1TA 3VS7A 3U6HA 3DKOA 4FIHA 2CNUA 4IX5A 1X8BA 5AUUA 2QNJA 4DFZE 2NRYA 3W8LA 4CKIA 4MXOA 3NDMA 2OF4A 1DS5A 2GQGA 4C3RA 4G3CA 5EH0A 3Q2JA 5M06A 4EQMA 4BZDA 4C2WA 5JZJA 4U80A 4G9CA 4QMTA 1W98A 3MFTA 2IVTA 5ETAA 2W1EA 3QZHA 5E90A 5HG9A 4XRLA 4D0WA 2VUWA 2EXCX 4C38A 4JQ7A 4YJTA 4QYYA 3H4JA 4MF0A 2YA9A 3A99A 5DH3A 5HVYA 3WF9A 3MPTA 3QGYA 4FTQA 4JS8A 2H6DA 2WTKC 4DFLA 3LAUA 4PMPA 4FTOA 1OKVA 1U5QA 3UP7A 2ITYA 3I6WA 2P4IA 5TE0A 2PMLX 4YBJA 2AC3A 4FMQA 3IW5A 1YRPA 1Q8TA 4AP7A 2I0EA 4G6LA 4LV8A 3VBQA 1P4FA 3VW6A 2B53A 1IA8A 4UN0C 2CN8A 3AOXA 4GVJA 5IQIA 1OL1A 4HZSA 4OTGA 2R4BA 2J0IA 3F2AA 4MBJA 2HZ4A 5LWNA 3HVCA 5M4FA 3OY1A 5BVNA 4CFVA 5J7HA 3OWKA 2H96A 2XF0A 1RQQA 3QWKA 4FTLA 4FOCA 4TNDA 4MVFA 2BPMA 2DWBA 5J5SA 4N0SA 3ETAA 3NUPA 4U44A 2OICA 4LFIA 1WMKA 3D9VA 5IISA 5ETIA 3REPA 3V6RA 4F09A 3EFKA 5IA0A 3G90X 3ZSIA 1OL7A 5L6PA 2FA2A 3N4TA 3K54A 4I4EA 4RIXA 1KUTA 1S9JA 4JBPA 2WGJA 5AAFA 3SKCA 1ERKA 1OUYA 2ERZE 1FMKA 1KSWA 2BFXA 1Q8YA 2HZIA 3FKNA 4FV9A 4ITJA 2WMTA 3R0TA 5C9CA 2GHMA 4DGLC 1KWPA 4BL1A 4F9WA 3R9RA 5M51A 2C6KA 2QHMA 2YIYA 3K3IA 5FEEA 4ERWA 4Z3VA 4ZSAA 1MRUA 1BL7A 1SVHA 2VX3A 3H9RA 4QTCA 1Q5KA 4HYHA 4RIWA 5L2IA 1WFCA 3LFAA 4CRLA 1FBNA 5KHWA 4KIPA 2PE2A 3A8WA 1JQHA 2C5XA 2XNBA 2QOCA 3CR0A 3E63A 5TO8A 4C34A 4IDVA 4KWPA 3OUNB 4RSSA 3O17A 4GMYA 2WMRA 4MD7E 5AUVA 3RPYA 2XB7A 2PPQA 2QO2A 3E3BX 2QO9A 4PX6A 5A54A 1ZYDA 3R2YA 5LCKA 2W05A 2ITTA 3PWYA 1OPLA 3DOGA 3IW4A 4D5HA 3BIZA 4XMOA 1H8FA 3O7LB 4CSVA 3QQHA 1PF8A 4LUEA 1UU8A 2R3GA 4I24A 4I20A 3M2WA 2VWIA 3ZLSA 4FKTA 2NRUA 4QYFA 5HGIA 4GK2A 4CT2A 1ZOGA 4I94A 4TYJA 3E92A 1H1WA 3DKFA 4GIHA 4KS7A 2BKZA 4RZVA 4YJVA 3QUEA 4AGUA 4BGGA 4EZ7A 3LFDA 2C3IB 5CEOA 4CMOA 3VS1A 1W8CA 3MWUA 3WI6A 3KRJA 4G3EA 4PY1A 4YBKA 4O7TA 2W9FB 1UA2A 4I6FA 1F0QA 5I9WA 4IFCA 2VO7A 4BGQA 5FG8A 5C1QB 4M69A 4A9YA 4IWQA 3RAKA 1BKXA 4II5A 3LFQA 3PZHA 4AW0A 3FMEA 4F7JA 4L6QA 1UU9A 3UZPA 4WHZA 4AT3A 5KMNA 4KIKB 4W4YA 5J1WA 1Q97A 4FZ7A 4R3CA 3R7EA 1OI9A 4I41A 3KFAA 4ZJIA 4KKGA 2V5QA 3VS0A 5D10A 2QG5A 2WTIA 4ZZOA 5A4QA 5IQAA 2YM4A 3U9NA 2WPAA 4O6EA 2X6EA 4ORKA 4XG4A 3NCZA 2W4KA 4AOIA 4D28A 1GIJA 3NCGA 1YDRE 2IVVA 2Z8CA 3H9FA 4LRMA 3Q52A 4G17A 2OJ9A 4ZTLA 3DPKA 2HZNA 5AADA 4WRGA 3ULIA 3DTWA 5M4UA 4AACA 3BYUA 5AV0A 5D1JA 3EZRA 5CZIA 4APPA 5IA4A 5DMZA 2R3MA 3TUBA 2PUPA 5AP3A 5LWMA 3OBJA 3R7VA 3KXMA 1U59A 1J1BA 2PSQA 2WFYA 3VBVA 5J9YA 2VTJA 3RINA 1ZLTA 3L8VA 4IX4A 1V0OA 4CRSA 3QYWA 3ZDIA 5BYYA 3FI2A 3F6XA 3IK3A 4K18A 3UNJA 3PJ8A 4L46A 4XBUA 4ZTQA 3KREA 1YWNA 2WMXA 2VX1A 5LMKC 2YCRA 1IG1A 2ZMDA 3CP9A 4UYAA 5EI6A 4UMPA 4LMNA 4EK4A 4EKKA 4MWIA 4AE9A 2Y6OA 2JKKA 4ASXA 4AU8A 3OCBA 1YOLA 3G9NA 4U6RA 4ZLZA 3HAVA 2V55A 4DT8A 3FI4A 4FKWA 5J79A 3RBWA 2FUMA 4D9UA 2X39A 4NTTA 4RFZA 3QRIA 5CLPA 2XNNA 1FVVA 4X2JA 4EHEA 4WA9A 4EH2A 4EEVA 3CCNA 3OXZA 1P5EA 3CJGA 3QAME 4WT6A 1V0PA 4EJNA 2WEIA 3R8LA 4I4FA 4ZMFA 4QMUA 4C4GA 1J7LA 4AQCA 4EBWA 4JR3A 3TV7A 4BWPA 4BDKA 2XCHA 3R1SA 4GRBA 5L4QA 2J0LA 3UPXA 4DEGA 3BWJA 5GZ9A 4PNKA 1QCFA 5AR5A 3EQFA 3HRFA 2JDVA 3CTJA
chains in the Genus database with same CATH superfamily
2GNHA 4C0TA 4KD1A 5I9ZA 1ZYLA 4FGBA 3FL5A 4S34A 5HNGA 4BCOA 3UDTA 4QMVA 2X0OA 4RLLA 4FTTA 4NFNA 4D2RA 4CG8A 4ACDA 3MTFA 3CKXA 2ZM4A 4AZWA 3F3WA 2R5TA 4WSQA 3C9WA 5HO8A 5KKRC 4F08A 4U8ZA 1TQMA 4LL5A 5JFVA 2WELA 4U3YA 2QLQA 3VUMA 5ANIA 3RZBA 4OR5A 4DHIB 3GNIB 4AOTA 4AZTA 4O4DA 4IBMA 4L3JA 3MA6A 1BI8A 2IZRA 1KOBA 4IH8A 4BBFA 1REKA 3DDQA 2C6EA 4NJDA 3QZFA 3A7IA 2J6MA 2ITVA 3FLNC 1MQ4A 4HPUE 4O6LA 3R30A 2PVRA 4X2NA 1Y8GA 2Q0BA 3SRVA 4FTUA 4BKYA 4MKCA 1YHVA 2YM5A 3GFEA 4I0RA 3S00A 3V8TA 4O0VA 4DINA 5H9BA 4NFMA 3UVQA 1R78A 3HMMA 2C0IA 4DFXE 4DG3E 4U97A 4YPDA 3ZUTA 5IA1A 1M14A 2IWIA 2WAJA 3NYNA 4IJ9A 5D7VA 3CC6A 4DYMA 4NEUA 2Y4IB 5HE3A 3O23A 2W1FA 4DGMA 2XK9A 4RC3A 3GU6A 3FMHA 4MD9E 5HZNA 3SHEA 4BDEA 2XAOA 5HLNA 5M56A 5GZ8A 4FVQA 3R04A 3MB7A 1CM8A 3RCJA 5CSVA 1JOWB 5BPYA 2GPHA 5GHVA 4EUUA 3WZJA 2OSCA 3G9LX 3ZFXA 4HW7A 1BUHA 1TZDA 5KBRA 3ORMA 5I9VA 1PYEA 2ZM1A 1J7IA 4Q2AA 4YZNA 3AMAA 4LMUA 5CAQA 3W0MA 3BU6A 4QDVA 5LVPA 5CNNA 3VN9A 4AA5A 2HZ0A 3LM5A 4EOKA 1YXTA 2BCJA 2OKRA 4FT7A 3E87A 4DEBA 3CSVA 4QP1A 3V5WA 4F1OA 3TIYA 4F64A 2XUUA 3TDWA 4EK6A 5IMEA 3R2BA 4JL9A 5DVRA 3CKWA 4DH5A 3MBLA 3CJFA 3S3IA 3GC7A 2VTMA 5ACBC 3RALA 2GHGA 2UW8A 3BLQA 2EVAA 2PVLA 3V04A 4V0GB 2C30A 4A9SA 3KMUA 3DBCA 4I93A 4RVLA 5C8MA 1W84A 4XS2A 3LFEA 4FIFA 3MH2A 3LM0A 3UGCA 4O7NA 2FGIA 2ZAZA 3P78A 4DLIA 5HX6A 3D2IA 3ALOA 2YACA 4K1BA 4AXEA 3DU8A 3F66A 4HNIA 2JEDA 2PUUA 3I79A 4AQKA 3R1NA 3V5PA 4F6WA 4BDHA 1JKTA 4HGEA 5CEMA 4D4RA 2QVSE 4ANOA 4QMYA 4HYSA 3C4FA 4WUNA 4EK3A 4BI1A 3CPCA 3ZRMA 4PWNA 4RA5A 3LJ2A 4XUFA 4F6SA 4ZSGA 4BBMA 4H3QA 2RFNA 3P7BA 2VWWA 3QLFA 1SVGA 4EH8A 2Q83A 3QALE 5JGBA 3PSCA 2OH4A 3EFJA 3HEGA 4HVIA 3TZ9A 4OAUC 5FP6A 2YDJA 2RFDA 3K2LA 3HMNA 4JBQA 5H8EA 1OIRA 3SDJA 4BYIA 3FZRA 3MH1A 2WOUA 3B8RA 1ZMWA 3EJ1A 3VBTA 1OBGA 4DLJA 3C50A 3MH3A 5AMNA 4OTDA 4PF4A 4ANMA 4MXCA 4IC8A 3DK6A 4Q5EA 4AUAA 5I5ZA 3V8WA 2C6LA 5FRIA 5DR9A 3CLYA 3NVKI 4PPAA 3DAEA 5HU9A 2B54A 4RIXB 5JQ5A 2YCQA 3PY1A 3ZRLA 4ANBA 2Z7LA 2YFXA 3GU4A 1YXVA 3PY3A 2YCSA 3QD3A 2BRBA 2R3FA 3LJ0A 1A9UA 1JKSA 1Y91A 3FSFA 4IZYA 3ZONA 2JKQA 4GYGA 4RIWB 5EI8A 3TXOA 3ZYAA 1PXKA 4QTDA 2WU6A 3TMOA 4P2KA 4NCTC 5FTGA 3PXZA 4O83A 2SRCA 3UDZA 2JFLA 2XK4A 2J0MB 1UKIA 1W7HA 3OCGA 2IW8A 3HX4A 3CS9A 5J95A 4BR3A 5JGAA 5L8JA 4CFWA 5KMJA 5AV3A 2B9IA 3O8PA 4YZBA 5ETCA 3QRTA 4O7RA 1QMZA 2ITXA 3HKOA 1OIQA 4C8BA 3TNHA 3QUDA 4IVAA 3ID6C 2JIVA 2XIYA 1SYKA 4GCJA 3VULA 2BVAA 4FEWA 2HWPA 5IKWA 3JPVA 4IAFA 4BICA 4BIEA 4MNEB 2UV2A 2WQOA 3SLSA 4EQCA 3Q4TA 3R1YA 3IPHA 4BDIA 2GNJA 5HBEA 4MF1A 4FV4A 3RGFA 4XV2A 4ALUA 4ZAUA 4D1XA 4M69B 3ATTA 2WTJA 1GNGA 3QHWA 1T45A 4G3FA 3R22A 4YLLA 2AUHA 2G9XA 3VS3A 4EH6A 4TXCA 4BN1A 4DITA 4BIBA 3ALNA 3D4QA 3GC0A 3P5KA 5FM3A 2CKOA 3NLBA 2UZDA 4L3LA 4QPMA 5AX3A 5D12A 4AXCA 3UO6A 2IZSA 3BGQA 1I44A 4WRSA 3MPAA 1Y6BA 3VUGA 1SVEA 4IWPA 3FXZA 3FI3A 4GIIA 4EK5A 4YURA 4MXZA 2A1AB 5LVMA 5CVFA 4MQ1A 2BAKA 3WYYA 3OXTA 5IQFA 3FXWA 1OB3A 3BKBA 3AC2A 4ERKA 5EYCA 1K2PA 3QRUA 4FL2A 3PA3A 3JVRA 5EHLA 4BI2A 3GOKA 2I0HA 2W5BA 4AGCA 3W33A 4FKUA 5ANJA 2QO7A 5KZIA 5KO1A 3O8TA 2DUVA 1LEWA 4KUJA 3CQWA 4IAYA 3BU5A 3R73A 5CZHA 2PE1A 3U51A 4CZUA 2CNQA 4GG7A 5GIOE 2PUIA 2BRGA 3GP0A 3QGWA 4GH2A 3TIZA 2QKRA 4AF3A 4HVGA 5L8LA 3FI8A 5CTPA 3PVWA 2ZV9A 3U4WA 2JGZA 4YPSA 5M44A 3S0OA 2O64A 5DWRA 3MI9A 3FC2A 5FP5A 4OTIA 4MNFA 4XEYA 5IQGA 5EQPA 2VWVA 2XMYA 4K0YA 4Y95A 3GBZA 3ZMMA 3Q6WA 4YJPA 1HOWA 5KHXA 5BVOA 2O63A 1QPDA 4XV1A 5F20A 3ZLYA 3POZA 3UYTA 3GC8A 4IJPA 4JBVA 2VZ6A 4YO4A 4L00A 4BKJA 5IQCA 2IVSA 2YM3A 4C4FA 1SZMA 2BDWA 4M14A 2VWBA 4E4NA 5FXQA 3E5AA 5CF5A 1APME 3M11A 4EUTA 5IG1A 5AA9A 5IA3A 4WNOA 3U54A 3FPMA 4FKLA 2R7BA 3FZOA 3TYKA 2OK1A 2IF8A 2OW3A 3FV8A 3EN6A 5HLWA 3MVMA 3EH9A 5B7VA 4FSWA 3GU8A 3QKLA 2HELA 4UXLA 3AC4A 4O84A 2CGVA 4JI9A 3PG3A 3TCPA 3IDBA 4NKSA 2BDFA 3OVVA 1GIIA 3DQXA 4FK6A 2WMSA 1JSTA 5DN3A 2Y0AA 3RAIA 4BBEA 3BHHA 2BR1A 3PY0A 5AP6A 2YDKA 4QYGA 3A7JA 3FHIA 1E1XA 4QQCA 2XNEA 4M84A 4FV1A 4DFNA 4QPAA 5CF4A 4ZK5A 2ZV2A 3I1AA 4QP6A 4DHFA 4OTFA 4LOPA 4FICA 3ZO1A 3KQ7A 3VNTA 3IKAA 5IH4A 1J91A 5M57A 4I5PA 3LCOA 1WAKA 3F2RA 5HESA 3PG1A 1IR3A 2R3QA 3UG1A 4WNPA 4D2TA 3W0NA 2OXDA 2C5YA 3A7GA 4ANNA 4GK3A 4O0WA 1ZOEA 4JXFA 4KABA 1SNXA 4IAZA 4ZY5A 5TT7A 4M68A 4Z9LA 3KVXA 2C3LA 3RPOA 3VIDA 3O96A 2OFVA 1YDTE 3ULZA 3KRWA 3UNZA 4TT7A 2ITPA 2REIA 4USEA 2J5EA 2YCFA 2WQMA 4E6CA 3SW7A 3DAKA 2ONLA 4ZXTA 3V5QA 3R8VA 4BRXA 2XS0A 3FLWA 3FJQE 4JQEA 3SRVB 3ZEWA 3JS2A 5AP7A 5BNJA 3IW7A 3OUKA 4KNBA 2W4OA 2BZIB 1GZKA 3G6HA 3ITZA 4KBKA 4AA0A 2JIUA 4FTIA 5BVFA 2HENA 4BCJA 3E88A 4B9DA 4BFMA 2PYWA 3LFBA 1NVSA 3LCSA 4M13A 3ORXA 4EHGA 1XBAA 5EYKA 5HVKA 1H08A 5E8YA 4TZRA 2X1NA 4IZAA 2P2HA 4YC6A 3TV6A 4QQTA 1OUKA 1R1WA 1O6LA 4CGAA 2UZBA 3MY1A 3P23A 2V7OA 4LGDA 3KXNA 4APCA 3G0EA 4AZEA 3PUFC 4U43A 4EH3A 4IDTA 3LQ8A 2Q0NA 2XAMA 3ENMA 4L9IA 3W55A 1KV2A 2B9JA 4FV6A 4FVRA 4R3RA 2VTAA 3F5PA 5J1VA 2XP2A 4FF8A 3R63A 1ATPE 4O7ZA 2PVJA 2OI4X 1FPUA 3NIEA 2ESMA 5CANA 3F69A 4FUYA 5CEQA 1T46A 5HEZA 5M4CA 1H07A 3PLSA 5BX0A 3DTCA 3NW5A 1PXPA 3DJ6A 2FSMX 4FTRA 2Z02A 3EQDA 2FSTX 3FUPA 4YLJA 3O8UA 5E8WA 5HBHA 4F1MA 2I40A 2WO6A 4E6DA 5CSHA 3N51A 4FZ6A 3A4PA 3BYVA 2XYNA 4BGHA 3K3JA 2JKOA 2XK7A 3RPVA 4C3FA 4FYNA 4FSMA 4OTQA 4EOIA 4MXAA 4RX5A 3PJCA 2GMXA 3EB0A 3GVUA 3ORKA 4XCUA 4ZP5A 4DEHA 3RNYA 3RP9A 4DGGA 2Y4IC 2PULA 5CAVA 3S95A 5H8BA 4TKSA 1Q99A 2ZJWA 4ZTHA 4MBIA 4O4FA 3TNPC 2XNOA 5CEKA 2X0QA 2R3JA 4XG7A 2WMAA 3EQGA 4R77A 3HDMA 4IB1A 4KKHA 4OT6A 3ZFMA 3I81A 2UZWE 4P7EA 2OFUA 4WG3A 5E1SA 1FOTA 2VO3A 3Q4ZA 3SXFA 5L8KA 2PZYA 2YM8A 5DEWA 2A4LA 4E1ZA 3BE2A 4F70A 5AM7A 3MESA 2R3NA 3TNQB 2A0CX 4OUCA 2BAJA 3AC3A 5A6NA 2A2AA 3MJ2A 3VUHA 3F7WA 2EB3A 3QXOA 3LMGA 2PE0A 1XHAA 2JDSA 5EW8A 1JAMA 4PDPA 4IAKA 3I4BA 3UZRA 1VEBA 3U87A 2XIKA 4LM5A 2QODA 3SAYA 4M0YA 4R6VA 3R00A 1DAYA 4O0YA 2VTNA 2WZJA 4U81A 4DEAA 1GOLA 4GU6A 5L6WL 5A46A 3WIGA 2C0TA 3N4UA 2G2FA 3P79A 5KUPA 3ANRA 4XG3A 4EHVA 1PMNA 4XG2A 4QEBA 1Q8UA 3SOAA 1H1SA 2O2UA 4NM7A 5B0XA 4BF2A 3CQUA 2XA4A 3W0PA 3OEZA 4FNWA 2XKEA 5L3AA 3PXYA 5HICA 4RC2A 5JEBA 1PXLA 3DAJA 1WVYA 2RSVA 4Y5QA 5FM2A 4H58A 4XV9A 2ITQA 1J3HA 5K3YA 3SC1A 3FKLA 4C62A 1JVPP 4LG4A 4P4CA 5E4HA 4KIOA 4YJUA 3P9JA 4J8NA 3EQCA 2ZMCA 4UV0A 5CAUA 5HG8A 3ORPA 2IZUA 3LFCA 2V22A 3E3PA 2PZ5A 3FY0A 5AR4A 4GVAA 3VBXA 2BKKA 5FXSA 2WOTA 4QTAA 3PVGA 1L8TA 1WBNA 2PHKA 1H24A 4IX3A 4EOQA 1OL6A 4ZS4A 3RVGA 2R3KA 3SD0A 3I0QA 2VTTA 3P0MA 3C51A 4BHZA 4BZOA 5JFXA 2YERA 3NZ0A 3AC8A 4K8AA 2XBJA 3IGOA 2JD5A 2F9GA 4OTRA 4X3FA 3TNIA 3WOWA 3OG7A 3TUCA 3NVMB 4JRNA 4DF3A 4XG9A 1XBBA 2UZLA 2BHEA 3FQSA 5EDPA 1WZYA 3BZ3A 3HV7A 4JIKA 1UNGA 4YC3A 3OCTA 3FAAA 4RZWA 4AFJA 3O71A 5BVDA 4I6HA 2KTYA 3NW6A 2R9SA 4RJ5A 3UDSA 1CTPE 1Q8ZA 3UODA 3RK9A 4M15A 5TOZA 4XJ0A 3MN3A 5EQYA 4EJ7A 3NUYA 3GCQA 4NIFA 4ACHA 3OF0A 4W4VA 3RI1A 1OKZA 4BTMA 3R6XA 3R02A 2ITNA 2OJIA 2ZB1A 3TKIA 4BCNA 3I0OA 5CXZA 2LGCA 5HLPA 4DC2A 3VHEA 4QP2A 1ZOHA 2HY0A 4JG6A 1Z9XA 4BDGA 1XH6A 2XNMA 3NIZA 5CEPA 4LI5A 3FMKA 4G31A 1OMWA 2P33A 3D5WA 2PVKA 3BYSA 4EWQA 4MHAA 2CKQA 3PYYA 4PMTA 4C33A 5CALA 3QQFA 3AD4A 2XJ1A 3NUNA 4FZDB 3KF4A 4N6ZA 4IQ6A 1OIUA 4OW8A 4UMUA 3OZ6A 2B1PA 3VUDA 2XM8A 4C37A 4C4JA 3FEGA 4YSMA 4FBXA 4YR8A 3LLAA 4F78A 3DB6A 2VO6A 3QA8A 4NWMA 3EL7A 3QTWA 3NNUA 2PVYA 3QZGA 3O50A 4XHKB 5FUTA 5AR8A 4BCKA 4ITHA 4YZCA 2JBPA 4YJRA 1U46A 2IZTA 2XBAA 3CIKA 2V62A 3ORLA 3Q4CA 2RFSA 4ACGA 3HAMA 4GJ3A 2RIOA 3C0GA 4MTAA 5GJGA 3V8SA 2UZNA 2X2MA 4NM0A 1MRYA 5TF9A 2J0JA 4RLKA 4XOYA 1CKPA 3FMDA 5DR2A 2WMQA 2UVYA 1BYGA 4QMOA 3ZRKA 2HCKA 3EKKA 3Q6UA 1JPAA 3P5JC 5I3RA 3DB8A 4FODA 4HCVA 4XP3A 3UQFA 3BHVA 1Z5MA 4K33A 3FMMA 1Q3WA 3LIJA 3Q60A 1G8KA 3K5VA 4FKQA 3FXXA 4WBBB 5HG5A 4O2ZA 4FIEA 3GQLA 3O2MA 1QL6A 3O5AA 3I60A 4HPTE 3FL4A 2HIWA 2PY3A 2UZVA 3L9MA 3QHRA 4W8DA 2G2IA 3ORNA 4FSNA 2BZJA 3PXKA 5EHOA 1W0XC 3CPBA 5EHYA 5EI2A 4CZYB 2XK8A 2HK5A 3DBEA 3PSBA 4KIQA 4YP8A 5BVWA 4DHZA 4RX9A 2ZB0A 5ANOA 4JLCA 2C3JA 3U4UA 4USFA 3MJ1A 1S9IA 3Q96A 3COMA 1M52A 2YM6A 3I5NA 3NYVA 3WILA 1YI3A 5HKMA 4A4XA 2CCIA 5AIRA 3FLSA 1W82A 4GYIA 1HCLA 3MIYA 4CFNA 2C5VA 4WNKA 3RK5A 4AZVA 4C57A 4IM3A 4FRFA 2EUFB 1B39A 4FT3A 3D83A 4GFOA 2J7TA 2QG7A 2WU7A 2NO3A 4F9BA 3CBLA 4HVDA 2WMVA 4DTAA 2OBJA 4QQ5A 3H10A 1PXIA 4AE6A 4JT3A 4EZ5A 5H3QA 4GJ2A 5K4IA 4H3BA 4FKSA 4IAIA 4N6YA 2PMOX 3K5UA 4PTEA 3KN5A 4G6OA 1H01A 4F4PA 2QOBA 3DKGA 4YJNA 3EFLA 4FUXA 4PMSA 4EZ3A 4IFGA 1GY3A 3G0FA 1HCKA 4W4XA 3Q32A 4PNIA 4O81A 4FX3A 4RWKA 1OBDA 3UIXA 4O4BB 4JG7A 5DOSA 3AGMA 2QOKA 4G5JA 5IUHA 2IVUA 3AG9A 4E4MA 4QMPA 4YJOA 4JIAA 1TQPA 2ITWA 4L3PA 5HHWA 2JDTA 3WARA 3PP1A 4G2FA 2VWXA 5EG3A 1UWHA 3RNIA 4EKLA 4CCBA 3L8PA 3BRBA 1FVTA 4O96A 5DRBA 2C0OA 3THBA 5CYIA 2BRMA 2VTSA 3PVUA 5AEPA 4YNOA 3MY5A 4UWBA 3UOLA 1XQZA 3NEWA 3D0EA 4LRKA 1ZMUA 3AQVA 3WZEA 1H1PA 4FV3A 4FV8A 4F0IA 3WZUA 4NYEA 2JDOA 4FE2A 4ZS0A 2C3KA 5HIBA 5HO6A 1WBWA 5AR7A 4ACCA 4OLIA 3QBNA 5AUZA 3PPKA 2Z7RA 3F5UA 4H36A 4U41A 3RZFA 4J98A 3TM0A 5AAGA 4ZZMA 1PYXA 3D7TA 3A7HA 3Q5IA 4I3ZA 4Z7GA 5LQFA 2C4GA 4BCGA 4BCMA 5JSMA 4I22A 1MP8A 1YOJA 5CT7A 3ATSA 1PMVA 1JWHA 2BHHA 3UZTA 4GKIA 3AMYA 3DFAA 3M42A 3TUDA 4EK8A 5IEVA 4O1PA 3KRRA 2J5FA 3P86A 2W0JA 3I7BA 4CXAA 3MVLA 4UYNA 4U42A 3PXRA 4DHJA 3KULA 3HDNA 5AJQA 3UNKA 4KSQA 4F9AA 3WF5A 3HGKA 3JR1A 3HV5A 1UU3A 3R9DA 2VAGA 3V5JA 3D5UA 4Y72A 3RHKA 2C1AA 3BI6A 3FYKX 1Q8WA 4WG4A 4YTHA 3VF8A 5CASA 4X7QA 4FV5A 5KX8A 4FNYA 4Y73A 5IH6A 4C4HA 3OD6X 4R5YA 3EN4A 1Y8YA 2HW7A 2PTKA 4CKRA 1J7UA 5IF1A 4JQ8A 3ZBFA 2JIIA 4X3JA 2BDJA 2UUEA 4IEBA 4AXAA 4B7TA 4B8MA 5CAOA 5IU2A 3ERKA 2QOFA 3A8XA 3UJGA 4BKZA 5AA8A 4CZTA 1F5QA 3SW4A 4DN5A 4QNYA 1YXXA 4TRLA 1R39A 4IMYA 4R7BA 2F49A 1NVRA 1SM2A 3TJCA 2GNIA 4E6AA 2WD1A 4HGLA 4FZAB 5IQEA 3TZ8A 4P5ZA 2C47A 2GHLA 4LV7A 2OH0E 1PXNA 2O65A 3ACKA 3BELA 3IW8A 1YXUA 2ZDUA 3AT3A 3FZTA 1NT2A 5IMXA 4FI1A 3FZSA 2X4ZA 3O51A 4E5BA 1PRYA 4J99A 3NRMA 2F7EE 2C6OA 5HI2A 4PL4A 4ZSJA 3PE2A 1AGWA 3BHYA 3WF7A 2R3RA 2FVDA 2NPQA 3W2RA 3QZIA 4RBLA 4ACMA 3II5A 4S33A 3NNVA 4W9WA 2C5OA 4ZSLA 2WNTA 5JRQA 3DA6A 5ICPA 1JSVA 2Y9QA 5EDQA 3N9XA 3FC1X 5CU2A 5BQ0A 4DH8A 3C4EA 5CENA 3OW4A 3LOKA 4OGRA 3G2FA 3PP0A 5I9XA 3MTLA 4FKOA 4P90A 3G6GA 4BVUA 4NK9A 4WD5A 4MUQA 2XIXA 2XEZA 4XBRA 3QQJA 4RJ8A 5JH6A 4UBAA 3E7VA 5CXHA 5L2WA 1FGKA 3LMHA 2JKMA 2QHNA 2XH5A 2QCSA 4NJ3A 4FTNA 4YTCA 1A48A 2GNLA 3UOKA 5ANKA 1TQIA 2YWPA 3IDPA 5GJFA 5HQ0A 3VO3A 1MUOA 2E2BA 2ERKA 4JAIA 4W9XA 2GSFA 4O91A 3AT2A 3OP5A 1ZZ2A 4H1JA 2CSNA 4FG9A 4G3DA 3OT3A 4K2RA 5AR2A 2WXVA 3B2WA 3LVPA 1FINA 2YM7A 3HV4A 3DBQA 3MGYA 5IEXA 2YDIA 1OGUA 3FMLA 3GOPA 5CU0A 4M67A 5B2MA 5HO7A 3MSSA 1BMKA 2C6IA 2R0UA 2C69A 3KK9A 2X9FA 3ZBXA 2W5HA 3QF9A 3UG2A 2XIZA 3Q2MA 3AC5A 4RFMA 3ORZA 4G34A 4CKJA 5EKNA 1TKIA 4NL0A 4L68A 4FIJA 4FV7A 3KVWA 4B99A 2OXYA 5A4CA 3BLAA 3GCPA 4L45A 4X3FB 1ZARA 3L9NA 3QA0A 3VRYA 2UW5A 1W2DA 1IA9A 3NAYA 2CMWA 3CE3A 3H30A 5B2KA 5T6KA 4EH5A 2XEYA 5F9EA 1PXJA 4OBOA 2YZLA 2VNWA 3UTOA 5F4NA 2JDRA 2F7XE 3ZXZA 3BYMA 3EQIA 3F9NA 2PVNA 4QTEA 2EXEA 2JBOA 3BYOA 3KK8A 3L1SA 3VW8A 4XV3A 3NR9A 2W99B 3UIBA 2PZIA 3S2PA 1ND4A 3BV3A 2R3OA 4NIFB 4L7SA 4QP9A 4Y46A 2PK9A 1V1KA 3FDNA 3E64A 4ZY6A 4A7CA 4ASEA 1NW1A 3OWPA 5ANEA 4UWYA 5LCJA 1L3RE 3HL7A 3TI1A 3DKCA 2X0PA 4JG8A 5CEIA 5BUEA 5KBQA 5DLSA 5AP4A 1LR4A 5I3OA 5CT0A 2ZYBA 1XH7A 3AT4A 3UP2A 2J51A 4L43A 5EOBA 3Q9YA 5EQEA 3ZHPC 1KV1A 3LQ5A 3W2QA 1LUFA 1CSNA 3QU0A 4YNEA 3HP2A 2VWZA 4HGTA 2IW6A 4O0UA 5DT4A 4AG8A 4EQUA 2XK6A 4RQVA 2ZFYA 2ETRA 4TYIA 2QLUA 2J4ZA 4FOBA 4DDGA 3BGZA 5L6OA 1IAJA 4F6UA 2OLCA 3PJ3A 3HRBA 3TN8A 5A4EA 4UX9A 3QD2B 2XJ2A 3LHJA 3SA0A 4CLIA 4J95A 5EW9A 3KXZA 4UXQA 3ZU7A 4AW5A 4TWCA 4L7FA 2JAMA 1WVXA 3GFWA 4YZ9A 5EOLA 3QWJA 3Q53A 3QCYA 4IC7A 2VRXA 4WOVA 3U9CA 2PWLA 3MDYA 4QMLA 3WIKA 3ZC5A 4XP0A 4XX9A 4PRJA 5I4NA 2CHLA 3D14A 2ZV7A 4ZZNA 4EH7A 3E93A 5C8NA 3V6SA 3R01A 5HOAA 4BDBA 4LGHA 4C3PA 4EI4A 5D7AA 2R2PA 4DCEA 4QT1A 2B52A 2QC6A 3FLQA 5LARA 2I0VA 3KF7A 3W10A 2YITA 5K0KA 1PKDA 5DT3A 1OKYA 4IAAA 4YJQA 3UMXA 4BTJA 3NGAA 3GXLA 1FMOE 4USDA 3RPRA 3C4XA 4RVKA 4AOJA 4YGAA 1LEZA 4ITIA 3NNXA 2VV9A 5EYDA 4QMXA 5I9UA 3RWPA 3EHAA 4EWHA 2ZDTA 3U8WA 3IG7A 3LFSA 4UALA 4KSPA 2WMBA 3PRIA 5K5NA 3EMGA 3ZO3A 3C1XA 4JX7A 3W32A 2CPKE 3SG8A 5M07A 2DQ7X 4JRVA 3JUHA 3RWQA 2XYUA 3I7CA 2J50A 3DFCB 1XH5A 2ZV8A 4ANLA 2XANA 4MD8E 1XR1A 2E9PA 4X0MA 2H8HA 2XRWA 3F3VA 1XH9A 3NMUF 3SXRA 3U6JA 2OJGA 5CU6A 4HYUA 3QQKA 4O22A 4K11A 3LW0A 2R3PA 2PZRA 4U79A 2YIQA 3WE4A 1H0VA 1H00A 4AW2A 1WVWA 1UKHA 2WHBA 4G6NA 5CVHA 4R8QA 5G1XA 5FGKA 4C2VA 1XH4A 2HXQA 5EM7A 4XG8A 1GAGA 4M7IA 5DFPA 4BI0A 3W2CA 3OWJA 4CV9A 1H0WA 3PVBA 4BC6A 4GL9A 2VWYA 3KXGA 5EM8A 2CCHA 4AAAA 4EBVA 3DLZA 4YTFA 3SGCA 4ZMEA 3EL8A 3VQUA 3QC9A 4HNFA 3COKA 4N4SA 2GQSA 1ZXEA 5DIAA 4TYEA 4ASZA 3T9TA 2C6MA 3GGFA 2ETKA 3NUXA 1Q61A 1XH8A 2XRUA 5EK7A 2I6LA 2WIHA 3D5XA 3DDPA 1PXOA 2QOLA 1G3NA 3ODYX 4JNWA 4EOMA 5HX8A 5IA2A 3C5IA 3MW1A 4IVBA 5CI7A 4I6LA 1Q24A 3NW7A 4I5MA 3QD4A 1P4OA 1KE8A 2YEXA 4FK3A 5J9LA 2HXLA 2X6DA 3TT0A 4V04A 2B55A 4AS0A 3GUBA 3IONA 4JJRA 4EH4A 4G9RA 4ZTNA 3DS6A 3HV3A 3D94A 4CMTA 2XNPA 2WMWA 3KL8A 1U4DA 4AT4A 4CFFA 1KE7A 3SOCA 3ORTA 1OIYA 4MCVA 4ARKA 1XMMA 3P4KA 4WKQA 4YJSA 4CFXA 4RC4A 5LVLA 5KMKA 3C4ZA 3TZ7A 4FV0A 3NUAA 1KE5A 1OPJA 3NNWA 4WUAA 2VTOA 5CVGA 4KKEA 4AA4A 1WBTA 3QCXA 5K4JA 4DT9A 2W7XA 5BVKA 3NFGB 3OWLA 3IECA 4NM3A 5TR6A 3D7TB 3UO5A 2XKCA 3D5VA 3KC3A 4EYMA 3EQHA 4FVPA 3OEFX 4YZMA 3F7ZA 4CNHA 4D2WA 4GEOA 3UIMA 3BEGA 4M97A 4XYFA 4QP3A 3F2NA 1M2PA 3A61A 4UWCA 3KULB 3QCSA 2W4JA 5HG7A 3JY0A 3PPZA 2VTRA 2EB2A 3PSDA 4EC8A 3HA6A 2Z2WA 2ONLC 3VONA 3NWWA 4KAOA 1XKKA 4Q9ZA 3W2SA 4YMJA 3C7QA 3L9LA 4PP9A 4BIDA 3QQUA 4FT5A 5A3XA 1KE9A 5IQDA 3QYZA 1WBVA 2CKEA 2XNGA 3DQWA 4RIOA 3QQLA 3A7FA 4ALWA 4GS6A 4HGSA 3BCEA 4E8AA 4RX8A 4QQJA 2QOHA