3V5LA

Crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 542
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
240
Chain Sequence
GSVIDPSELTFVQEIGSGGLVHLGYWLNKDKVAIKTIMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title X-ray crystallographic structure-based design of selective thienopyrazole inhibitors for interleukin-2-inducible tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 240
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v5lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v5lA01
5M4IA 4LMUA 2J0KA 5FXSA 1H1PA 3I1AA 1PXJA 3I0QA 4D1XA 3REPA 3CPBA 2PVFA 3EHAA 4AUAA 2WQEA 5CAOA 5L2SA 3NAYA 1R3CA 4IZAA 4ZTMA 2ONLA 2WGJA 4MXAA 4WNMA 3LM0A 3KF4A 5CF8A 5IA5A 3Q2JA 2OO8X 3TZ7A 3ZH8A 3OROA 3EFJA 2HCKA 3G33A 4IDVA 4PPCA 4UMRA 4CKRA 4FV6A 5J8IA 4EH5A 3RALA 2WTKB 2R3RA 4P2KA 4GU9A 3FV8A 1F0QA 1M7NA 5IA4A 3FKNA 2ITTA 1CKIA 2YFXA 5ANDA 4HCVA 4RRVA 5E1EA 4H1JA 4QTAA 3NW7A 1KE5A 3H10A 4NIFA 2P33A 4OTIA 3QD0A 4PPBA 1M2PA 2XCKA 5TT7A 3SAYA 4KD1A 2EUFB 4FL2A 3FQEA 2UVYA 3QC9A 4YJVA 3PG3A 3BGQA 4PL5A 2W06A 2BR1A 2YZAA 3PVUA 5E92A 3FLQA 4AA0A 1VEBA 3LJ2A 4JR7A 4DF3A 3CGFA 5EK7A 5BVDA 1ZYJA 4G34A 2CKPA 2UZTA 3IGGA 3A62A 2WD1A 3QBNA 5IEYA 1I09A 3QYWA 4FKGA 2WMVA 1FMKA 3OY3A 4K33A 3UPXA 3V01A 4IX4A 4B7TA 5F20A 4FNYA 4O81A 2WTDA 2WTVA 4YHJA 2VTNA 4DT8A 4Y85A 2GCDA 1CKJA 3EB0A 3TZ8A 4LQMA 3SKCA 4O7YA 4QNAA 4RA5A 3DKCA 4XRJA 5ETIA 5KZ0A 5JFSA 5CY3A 1UNLA 3R83A 4AZFA 3R2YA 4RMZA 5GJDA 3EFKA 4AACA 1HCLA 1YI3A 3PWDA 4GIHA 4F09A 2H8HA 5L2IA 3A4OX 1FVRA 3ACJA 2ZMCA 3CS9A 5IQGA 2XIYA 2F7EE 5EDQA 3P0MA 5JGBA 1BMKA 4UN0C 2VGOA 1WBTA 4CZUA 1MQ4A 1LUFA 2Y6MA 3GC7A 1T45A 5L8JA 3POZA 4O86A 3HRFA 1YXUA 4KAOA 1ZYDA 3A7JA 1H0WA 1QPJA 2OJ9A 5ANGA 4DFUA 1PYEA 3BQRA 4Y5HA 1IAHA 4EK8A 3DA6A 3UZPA 3I79A 3B8RA 2UUEA 3Q4UA 4GEOA 2QG5A 5HO6A 3ZO3A 3H9RA 4B0GA 5E8ZA 4IJ9A 4QMQA 3HV4A 2G01A 4ZY4A 2NNWB 3E64A 3R1QA 4S2ZA 2FYSA 2WOTA 4O7LA 5HVKA 4F9YA 3MFUA 4PP9A 5DT0A 5E90A 3DBDA 4ZJIA 4FEUA 4W4YA 5DE2A 4A7CA 3QKLA 3ZSHA 1ZAOA 3BIZA 1H8FA 2EVAA 2VWIA 2W9FB 3I6UA 4NT4A 4X21A 5GZAA 5TF9A 1APME 2VWUA 5CVHA 3FXZA 3TTIA 4C4IA 4NW6A 2C5VA 4U3ZA 4OTHA 3NNWA 2O0UA 4IWPA 5AAGA 2X6DA 1S9IA 4UWBA 2BZIB 3UIMA 4A07A 1XH9A 3VBXA 3BEAA 3ORZA 4R1YA 4J96A 3WZUA 5HTCA 2CKEA 4HVHA 4ZTRA 3R9OA 4BCIA 2YN8A 3CD3A 2PUPA 3JS2A 3FMEA 2UW0A 3ZHPC 4C2WA 3LXNA 4U81A 4L3PA 5DR2A 4F70A 5AV4A 3OCBA 4GT4A 1ZLTA 4CYIA 4IE9A 4RSSA 5DEWA 5EDPA 1STCE 5HX6A 3NVKI 3MB7A 3VHEA 4IBMA 4AFJA 4C35A 3GXLA 2HYYA 5L2WA 3CTQA 4UX9A 1OMWA 2Q83A 5A4QA 2BKKA 4EJNA 4KRDA 4FV1A 2VAGA 3GOKA 4HYHA 4JX3A 4WRSA 3R7EA 3QQFA 4YJUA 5AP7A 5IPJA 4O7ZA 2HY0A 3CQUA 3G0FA 2Y4PA 3MY1A 3RAHA 1ZRZA 4KIKB 3PLAE 4HYSA 3KVWA 4ANQA 5CENA 2BHHA 3P4KA 3BGZA 4Y95A 2V55A 4LM5A 3ZS5A 3HVCA 3VUTA 5JT2A 4USDA 4U42A 4EOKA 3NZ0A 2Z7SA 4YBJA 4IM0A 3QHRA 3TJCA 2YLFA 4A4OA 5FGKA 4YTCA 2IVUA 1BUHA 4ZK5A 1TQPA 3PZHA 3SLSA 3ALOA 4D55A 1NVSA 5AP2A 3PP1A 3OEFX 4G9RA 4Z16A 3GCUA 4BDAA 4ID7A 2HXQA 4YMJA 3TM0A 4QMUA 4ASXA 4QQTA 1YDSE 3ATTA 2YISA 3HV3A 2IWIA 2XIRA 2XYNA 3Q53A 4KABA 3QTXA 4X2KA 4D0XA 3HRCA 5HCZA 1ZOHA 5DWRA 2HZNA 5A14A 3AC5A 2BFXA 3EKKA 1QPDA 4DHFA 4X2JA 3VS2A 1DAWA 4A9UA 3MJ1A 3A7FA 3WF6A 1PYXA 1XO2B 5E8UA 5KMIA 4YJTA 2C6KA 4AE9A 5IH6A 2ETMA 3LXKA 5EOBA 2ZV2A 2OJFE 4NYEA 5DFPA 2V7AA 2C3LA 4XX9A 4JBVA 4OTRA 4YLJA 3W8LA 4IX5A 1NVRA 4QP8A 4RIWA 5K0KA 4F7JA 2PWLA 5IQDA 4DINA 2F9GA 2RKUA 5F4NA 2B53A 3Q52A 4UALA 4ZTSA 5HICA 3CR0A 4CEGA 3RPYA 3GFEA 1LEZA 3DU8A 3HMNA 4BZDA 4DTKA 1U54A 3EQIA 3AXWA 4DEIA 3NX8A 4IX3A 5A46A 5FXRA 4JX7A 3CD8A 4YZDA 3QKMA 4CNHA 4YP8A 4KIOA 4EKLA 1WCCA 4BFMA 3ORNA 4L46A 3ZLWA 5LMKA 1B39A 4JG8A 4GKHA 1B38A 4DGLC 2R64A 3BYSA 3ID6C 4NZWB 3FE3A 2IG7A 3WZEA 3FC1X 3T9TA 5IQHA 4DCAA 1DS5A 4LUEA 3UOKA 4D2SA 5HU9A 3IDCA 3MFTA 3F3TA 4IVDA 4I41A 1OGUA 5HE3A 3BX5A 3R7IA 3EZVA 2Y4IC 4XP3A 5D7AA 1GZOA 3QRJA 3TIYA 1KE6A 4IAAA 2E9NA 2WHBA 5T3QA 2BZHB 2JFMA 4U43A 3DY7A 4UMPA 3DLZA 4C4JA 4CQGA 5I4NA 5T68A 3FZSA 5A6NA 3QZFA 3PSCA 2FH9A 3QHWA 3PPZA 3DPKA 2YCRA 3M2WA 3A7IA 3GNIB 3ZEWA 4D58A 5AV2A 3VWAA 3ZLYA 3EQCA 1H4LA 3F2AA 4TYEA 5J5SA 2PE1A 3AMBA 4C0TA 1SMHA 3PRFA 2W7XA 4UXQA 2FB8A 2ITWA 4GYGA 5J87A 5BYZA 5JMSA 4DEGA 1JKSA 3TIZA 4HW7A 3IECA 4FK3A 4CD0A 2UW9A 3ROYA 2YDIA 3S2PA 3NYXA 1XH7A 4V01A 1UNHA 2X8EA 5EDRA 4U97A 1VZOA 3OXIA 4QMLA 3FI8A 3O7LD 4O0VA 5C03A 4F0FA 3V6RA 3E63A 2O2UA 3A8XA 4ZZMA 3OBJA 4I20A 5EYDA 3DK7A 5FBNC 1MQBA 4DGMA 1AD5A 2DQ7X 5AV1A 5IH4A 3FSFA 3LAUA 4U8ZA 1TKIA 3HMOA 4PRJA 4X0MA 5IUIA 4Y72A 5AP5A 3F82A 4I0RA 5CWZA 3OWJA 5CYIA 3WF7A 3TZ9A 2IZRA 3VULA 3VRZA 3D94A 5TKDA 3SOCA 3NUSA 1K3AA 4PX6A 4GT5A 2VTRA 5C4KA 2X0GA 4BCNA 5IF1A 3C0GA 2PMNX 5I3OA 2JDSA 2ZV7A 4H58A 1FPUA 1KV2A 2YABA 3EN5A 3PE1A 4QMYA 4DC2A 4E26A 4EH7A 4GJ3A 4PF4A 4FIEA 4GL9A 4U7ZA 4ANLA 5IQCA 3LCSA 2VWZA 3GC8A 3NEWA 3OBGA 4QMSA 4RX9A 3RNIA 5E8YA 4H3PA 3I5ZA 2C1AA 5EYMA 5FRIA 3RM6A 1CTPE 3KB7A 4FT3A 1KV1A 2XCHA 3BE9A 2XM8A 4IHPA 5HVJA 4BWPA 2GQRA 2UW3A 3G9NA 1OPLA 3E3PA 1IEPA 4YTIA 3DXQA 4E93A 3NUNA 4RJ4A 4XYFA 5AM6A 4R3CA 4CZTA 1OL2A 3THBA 3DNDA 1O6KA 3U4WA 3O17A 3ZRLA 4WBBB 2OF2A 2IW9A 4NSTA 5C9CA 4EOPA 3Q6UA 3DBCA 3Q3BA 5K4JA 4AGDA 4F4PA 3OP5A 2OGVA 3RAWA 1UKIA 3R7GA 5BUJA 4FKSA 3D4QA 2YCQA 3QQLA 3E88A 4OTWA 1JOWB 2B55A 3AD4A 2PY3A 3PUPA 5EQEA 3NGAA 2AC3A 1S9JA 1M2QA 1TQIA 3FSKA 5HU3A 3MS9A 4O84A 2XKCA 1OPJA 3A4PA 3MFRA 5HESA 3DXNA 3HDNA 3KGAA 3WIGA 5HX8A 5CANA 4IB0A 5LMAA 4FX3A 5LVOA 3GCQA 4FSTA 4DLIA 2OFUA 2IVSA 4FEWA 3QWKA 3F3UA 3QQKA 2ACXA 3EL7A 3EOCA 3GBZA 3NCZA 4G3FA 4YPSA 4FKIA 4QYEA 4EONA 2JDRA 3CBLA 5ETFA 5KZIA 4EH6A 3PTGA 4U44A 1XR1A 4PMPA 3ZSIA 1Y8GA 2YM4A 3LVPA 2HZ0A 4QTCA 3QRUA 4MTAA 4NM5A 4DA5A 4QO9A 5BUIA 1PMNA 2R3IA 4RJ5A 4MD7E 2VTIA 4IZYA 4I0SA 4C2VA 5ICPA 2ZYBA 3PIZA 5DR6A 2X7GA 3DZOA 3IO7A 3UOHA 3MY5A 3CTHA 3IOKA 4FTLA 4N0SA 4O96A 3CEKA 5EI8A 1H08A 4ZTQA 2Y0AA 3QD4A 4EKKA 1JAMA 1PXMA 4F7SA 3OS3A 2B9IA 2HW6A 3VBTA 2BIKB 2BKZA 2W1FA 4FV0A 2A2AA 3UC4A 2E9UA 4XNEA 4M0YA 2XEZA 4ZJVA 2DWBA 3HA6A 4UZDA 2B54A 3BHTA 3MGYA 4IADA 4O7RA 2JD5A 2YJRA 4TYJA 2XM9A 3QLFA 3U87A 4EYJA 3HRBA 4Z9LA 3PVWA 3Q96A 1YHSA 1A06A 3BHVA 2B7AA 2QHMA 4RLKA 2HELA 4H3QA 4ZOGA 5L6WL 3VAPA 4APPA 4EQUA 2W5BA 2DUVA 4C4FA 3TCPA 1H1WA 1TVOA 5AUTA 5M55A 4ZZOA 5HCXA 3I5NA 4GYIA 2O5KA 4PWNA 4TXCA 4MXOA 4P5ZA 4LV8A 4RT7A 3PDTA 1KSWA 4BTKA 4DYMA 2RFNA 4DH1A 5A6OA 3HA8A 3KMWA 3FMDA 1GIHA 2H9VA 3QLGA 4NKAA 4BZNA 2E9PA 4RIXB 3DZQA 1DI8A 4XP2A 2HENA 2NRUA 5EI6A 5AR5A 3AT4A 2ZV9A 4Z7HA 4K2RA 3UG2A 3V04A 3ZZEA 3PPJA 1DAYA 4JG7A 4TY1A 4TW9A 4BDBA 3S0OA 4O0RA 1JKTA 4GVAA 4I6BA 3FI4A 4I5MA 4HPUE 2BILB 4EH3A 3QC4A 4HVIA 2BDFA 2ONLC 2REIA 4IAYA 2OK1A 5M51A 2CNVA 1LEWA 4KS7A 3TKHA 2X6EA 2ZMDA 2JBPA 2LGCA 2X1NA 3MA3A 5HG8A 3W55A 3HAVA 4DBXA 1ZOGA 2PHKA 3KXZA 3QYZA 4P5QA 4PTEA 4FUXA 4IEBA 4RZWA 4A4XA 4BWKA 2XK4A 4BDFA 3ETAA 5LWNA 4XG7A 4FSMA 5FWKK 4EK3A 1XHAA 3WARA 3TT0A 3GGFA 1W83A 4FL3A 3C4FA 3LCKA 2XRWA 4KSQA 4CFNA 4I22A 3DJ7A 4X6QC 5K3YA 3NUYA 3T3VA 4P7EA 4CFWA 5HE2A 2QOKA 3KXXA 4CT1A 3CE3A 3ZC5A 2W96B 3FMKA 4FNXA 3DQWA 2F7ZE 4QQ5A 2VNYA 3D7TB 1OUYA 2P55A 2OW3A 3MSSA 1HCKA 3Q32A 4I5CA 4XH6A 4YC8A 4G5JA 4RIWB 3W2RA 5IEXA 3FC2A 3PA3A 4M67A 4DGOA 5HOAA 2W1HA 4MBIA 5F9EA 2PUIA 4GJ2A 5M53A 4O82A 3FZTA 2EU9A 3MB6A 1Q8UA 4K6ZA 4O22A 3GUBA 3PA5A 3FLSA 4O27B 4UV0A 4H39A 5CU3A 3BBWA 3VO3A 3ORXA 5IA2A 3EIDA 2I6LA 3RJCA 4RFMA 5CS6A 3G0EA 1X8BA 4C4EA 1Q8WA 1OBGA 2ZOQA 4AZSA 2PVMA 2XKDA 3SW7A 4DTBA 4IH8A 3OCTA 3BYOA 5A54A 4DEAA 2YDKA 4O0WA 4FTRA 3NIZA 3EFWA 3GCVA 3KXNA 4JJRA 4DFXE 4IC8A 5DEYA 4BZOA 4TTHB 4FGBA 4RIYA 1G8SA 3DAKA 5M09A 2A1AB 2JC6A 4NTTA 4QP7A 4UEUA 1J7UA 1BI7A 3B2TA 5AAFA 4ZY5A 1FVTA 4EORA 4YNEA 5JGAA 4W4VA 1UV5A 4RFZA 1LPUA 5AUVA 2VN9A 4F6WA 2BPMA 4FV7A 1ZYLA 4AW0A 4D4YA 4LYNA 3RVGA 2G2HA 4B8MA 4F7LA 2HW7A 3U54A 4J52A 3EYHA 2R3OA 3F5XA 4AW5A 4EOIA 2CJMA 2F7XE 3VUGA 3ORIA 1JQHA 1PXKA 3NYOA 4IB5A 3TJDA 5CAPA 4NM0A 4JVGA 5H8BA 3M1SA 4E5BA 1JWHA 1H25A 3I0OA 2GS2A 4CGAA 4EK4A 2CNUA 5CU0A 3MWUA 4AGUA 4AQCA 4U5JA 2X8DA 4EK5A 5L6PA 3U6JA 3ZFMA 2XUUA 2G15A 5HTIA 4G3EA 4I4FA 5DT3A 2XB7A 2X39A 2R2PA 5CF6A 1ZMVA 4JQEA 3DT1A 5DOSA 2SRCA 3BHYA 2C6OA 4H1MA 3VBYA 5B2MA 3FEGA 4EI4A 3MH2A 4E1ZA 4A9RA 3NAXA 4YLLA 1ND4A 5AUXA 2I7QA 2Z7RA 3QFVA 4J95A 4YC6A 5D7VA 5FDXA 5FP6A 4AA4A 5BVFA 5KKRB 1ERKA 4CFVA 3HL7A 5LQFA 3K54A 3EJ1A 2PSQA 3PE2A 5HIDA 2GU8A 3VS5A 2OG8A 4XV9A 4FVRA 4MHAA 4ERWA 5M06A 2NPQA 2BAJA 5HG9A 2VTQA 4CCUA 3F88A 3IW7A 4C02A 5CEOA 4CG8A 2YIXA 4UBAA 1Q61A 3OW3A 4EH4A 4FIJA 2OKRA 4AG8A 3HAMA 2BZKB 5M44A 1U5RA 4G3DA 2XMYA 2OSCA 3KEXA 3T8OA 3SA0A 3C51A 1A9UA 4JBQA 2C6TA 4G6OA 4R5YA 3BHUA 5I9XA 2X9FA 3KRXA 2HY81 3LFEA 4IAKA 4O1OA 3NR9A 1OL1A 2ETRA 2WMTA 3O51A 3LFQA 4BWXA 2QONA 2VUWA 4GK2A 3LCOA 4MCVA 4RC2A 3ZXTA 4YR8A 5J5TA 3D9VA 3KKVA 4HVSA 1H1RA 3KULB 2YWVA 4UY9A 5KBRA 3ATSA 4PDYA 2IJMA 3LCTA 3RMFA 1Q8ZA 1VYWA 4NU1A 4U41A 5A9UA 5BMSA 4YBKA 5J7BA 5KBQA 4O0UA 1FOTA 3DB8A 2OIBA 2Z2WA 4HGTA 4IAZA 4FTCA 4P90A 4M68A 4DG3E 4XV2A 5DT4A 4F1MA 5IA1A 3ZO1A 4GS6A 2W99B 4O7NA 2XIZA 3AOXA 3BQCA 4TWCA 4D4RA 3RTPA 5JQ5A 3II5A 3IGOA 2YITA 4IDTA 3ZFXA 3UYTA 4HZRA 4G17A 2FSTX 4FK6A 1P4OA 1Q62A 4L00A 4QYFA 2CCIA 3JY9A 4IFCA 3R9DA 4GV1A 4WT6A 4H3BA 3BYMA 4F9CA 4ZZNA 3GFWA 3SX9A 2C1BA 4C62A 2YWPA 4GSBA 5ETCA 4IAIA 1J3HA 1G3NA 2UW8A 3OUNB 5E8SA 4ZEGA 3RNYA 3WF5A 3OG7A 2WKMA 5K0XA 2C5OA 5HLWA 2B4SB 4TL0A 5DRBA 2C68A 2J5FA 3PFQA 2WTCA 3I4BA 2ITNA 2BZJA 2PZPA 2JIVA 4MYGA 2XK6A 1U5QA 3UIBA 5KMJA 3MDYA 4NH1A 5JSMA 4TWPA 3KRRA 4EOJA 4K18A 1OECA 2GTNA 3IW8A 4ACHA 2ZM4A 3A2CA 4KUJA 2UZUE 3OFMA 2E2BA 3R00A 3D2IA 4XG4A 2Q0NA 2QLUA 5DLSA 3EQDA 3PXQA 5HLPA 3QGWA 4EOSA 4QTEA 2PUNA 2JKMA 3M42A 5CI6A 5A4LA 2XIKA 4GRBA 2BRNA 4YLKA 4D2PA 3VIDA 3HEGA 3FY0A 4G6NA 4ASEA 3ZUUA 3C4ZA 3TDVA 2W0JA 3R22A 4JDHA 1OZ1A 3VS0A 4DT9A 2ITXA 3UIUA 4EYMA 1YHWA 4E4NA 4GKIA 2PE2A 4C3FA 5FEEA 3PXFA 3UO4A 3QXOA 3VJNA 4QRCA 4OGRA 5LMKC 2EXCX 2UVZA 4G5PA 3CCNA 2YDJA 1OL7A 3QZHA 2ZM3A 1UKHA 3TV6A 4CYJA 5BYYA 4CV9A 5CU2A 1SYKA 5CU6A 2C0OA 4JDJA 4NUSA 4S34A 2FVDA 3C1XA 5HBEA 3G90X 4ALUA 2WQBA 4LFIA 2C5XA 3VF9A 2HK5A 3RPOA 3FZRA 4MXCA 5CXHA 3C7QA 3EWHA 3HKOA 3K5VA 2OH0E 4QMZA 5H3QA 4XHKB 2XNMA 3U55A 3OOGA 2ESMA 2GPHA 3QUDA 1Q4LA 4MWIA 2RGPA 2VWXA 2YAKA 4WHZA 5JEBA 4R1VA 4JDIA 3NPCA 3ODYX 5HGIA 2W1ZA 1SVEA 5CSHA 5IISA 3UBDA 3U9CA 3RGFA 4UXLA 4F9BA 3DAEA 3F66A 2QU5A 1Q24A 4G3CA 1PXLA 4BDDA 2XNNA 3KN5A 4FTTA 4ZS4A 4IB3A 3LZBA 2AC5A 1GAGA 3TUBA 3FL4A 3QQJA 4KBKA 5AUYA 4ZIMA 3CKWA 3Q4CA 3G51A 4RPVA 3W33A 4ANSA 2R3GA 2QOHA 4Y5QA 3F2NA 3FXWA 3LXPA 2UZOA 4MQ2A 4QOXA 4C4GA 4BCKA 4AZVA 5BPYA 3SRVA 5HIEA 4KSPA 5KKRC 2H34A 2V5QA 2JKOA 4MXYA 4FTNA 4GCJA 5E8VA 2QOIA 2QQ7A 3ZMMA 2QI8A 3RI1A 1GZKA 4R7BA 1MP8A 2Y4IB 3FUPA 4JT3A 5EG3A 3UVQA 3MFSA 2R3FA 4EOLA 5HEZA 3W16A 5CAQA 4QMMA 5CEPA 4FTAA 1CKPA 2PPQA 4GFOA 4FSUA 4M0ZA 4B4LA 5L8KA 1PXOA 2CGVA 4RFYA 3EQPA 4FKTA 5AMNA 4EWHA 4RWIA 4F08A 2EWAA 5BVOA 5E8WA 1PXIA 3LIJA 3UP7A 4AS0A 3AC1A 4OBPA 4QMXA 1KE9A 4CMOA 2VTHA 1IA9A 3GB2A 3O96A 4OT5A 2J0MB 3TTJA 4BL1A 3E5AA 3E8DA 4I6QA 4L44A 2WEVA 4XV3A 2CPKE 3VBQA 4BDIA 4C34A 2GTMA 1MRUA 1ZXEA 2P0CA 2R3LA 4AE6A 3AC2A 3NIEA 2E9OA 4NL0A 1ZMUA 3ALNA 4I0TA 1OPKA 1PKDA 3HP5A 1J7LA 1BL7A 4FI1A 3GQIA 2RFSA 2JAVA 3ORPA 3R30A 2GMXA 1AGWA 3F2RA 2R3KA 3OWLA 1FVVA 4AN3A 5GIPE 1YWRA 2Q0BA 3O23A 3R04A 5LJJA 4J97A 4E6QA 2BRHA 3FQSA 4FKUA 4JOAA 3P08A 4U3YA 1VYZA 3RWQA 4ZLZA 2UW6A 5AX9A 2JIIA 4AZEA 4J7BA 4RVKA 5DR9A 4Y83A 3OUKA 5KHXA 3P9JA 1GIIA 3NNUA 4XLIA 2CSNA 3PVGA 4WG5A 5B7VA 2VX3A 3R21A 4CKIA 3DK3A 4UYAA 5GJGA 5KMNA 1R39A 4IXPA 3UPZA 4HJOA 1SM2A 4XG6A 3GU5A 5LVLA 4L7FA 5IQEA 4Z55A 3D0EA 3CLYA 4O0XA 2W4OA 2J6MA 2PL0A 2O63A 1NY3A 2OU7A 4HNIA 5AM7A 5KO1A 3F7WA 4R7HA 4LOQA 3TKIA 4RC4A 3KRWA 3LM5A 5CX9A 4RIYB 4MK0A 3UNKA 3RZFA 3QTWA 1QL6A 2ITQA 3T9IA 3SG8A 4K8AA 3JVSA 4LRMA 4MXXA 3VN9A 4FR4A 3FWQA 2WEIA 3UZRA 1Y8YA 2AUHA 2X7OA 4FT7A 3FL5A 4FNWA 5CZIA 4A06A 1ZYSA 4BBEA 3ZBXA 5M07A 3L9LA 2UZEA 2PK9A 5FTGA 4GT3A 4QP1A 1SNUA 4WNOA 2XNBA 4FSWA 4E6CA 3UTOA 4IWOA 3V8SA 4QMVA 2C30A 4IVAA 3WYXA 1CDKA 4ITHA 4K9YA 5AR2A 2ETKA 1PXNA 4RQVA 3MIAA 4X6RA 1DM2A 4LOPA 4CFMA 3UO5A 3KC3A 4BTFA 2KTYA 4X3FA 4D2TA 3F61A 1J1BA 3Q2MA 4E3CA 4W9XA 4HGLA 4S32A 5B2LA 3P7AA 3QGYA 3Q4TA 2GNHA 3D2KA 4MX9A 2X4FA 4RX5A 3SGCA 5HCYA 4U80A 3G5DA 2BRMA 2OJGA 3AT2A 3ULZA 2PULA 1GOLA 2HIWA 3VRYA 4F0IA 4XP0A 4CKJA 3PWYA 4M8TA 1UA2A 2G2IA 5FG8A 5DA3A 5E9EA 3QKKA 3V5PA 3IQ7A 4ACDA 5LCKA 3H3CA 1Z5MA 3NWWA 4BDCA 4C38A 4F7NA 4Q9ZA 5K5NA 2WMUA 3ZM4A 4WKQA 3LFCA 4FTUA 2IVTA 3IOPA 5DYJA 2OXXA 3WBLA 3ZLSA 3G6GA 5IMXA 2QURA 3FPMA 4M97A 4AAAA 5D9HA 5I3RA 5TE0A 4AF3A 3UNZA 2CHLA 4XG9A 4YJSA 3EQFA 3BCEA 4A4LA 5EQPA 1PJKA 3SOAA 5M57A 4HYIA 3GU4A 2Y9QA 2UVXA 2ZVAA 3PA4A 4FMQA 5I9WA 4IJPA 4ACCA 3LQ5A 2JDTA 3RPRA 3W2SA 3TUDA 5D10A 2OH4A 4EZ7A 5M08A 1WBWA 1M17A 4IZ7A 3TEIA 4EH9A 2CGXA 4CFXA 5CAVA 4DH5A 2WMWA 4J8NA 4HPTE 2XEYA 3BV3A 2OZOA 4FZAB 2PVJA 2ITVA 5JRSA 1PRYA 4JIKA 3LXLA 5CEIA 5KNJA 3A60A 2JGZA 4GUEA 4U6RA 5G1XA 2VX1A 3TV7A 4KS8A 5EQYA 3BPRA 4BKYA 3KREA 5DPVA 3D5UA 2W9ZB 3FZPA 3OWKA 1H01A 4DEHA 2XF0A 4JLCA 3ZLXA 4X7QA 4DBNA 5ETAA 1R1WA 5JFXA 1GNGA 5KMKA 2CNQA 1XQZA 2ITUA 1IA8A 4AP7A 3U6HA 4QP4A 5A4EA 4H36A 5CQWA 2R3HA 4FTMA 4MF0A 2IN6A 4ERKA 3ODZX 4BIDA 2RL5A 3M11A 3BRBA 4J1RA 3PG1A 4MNEB 4J53A 3QD2B 4FKLA 5J79A 2FSOX 3HP2A 5CQUA 3EQGA 2QO2A 3QTUA 2P4IA 3P7BA 5IUHA 3DTCA 3NS9A 4GFGA 3VS6A 4EL9A 4NCTA 4EH8A 2QG7A 4DH3A 2V22A 3RM7A 1K9AA 4QMPA 4BN1A 4M3QA 4QMWA 4BYJA 2VTLA 3GU6A 3LFAA 2OXYA 4O6EA 3DS6A 3LW0A 2F57A 2VU3A 3PY0A 3U51A 2Z02A 4X2GA 4EJ7A 2XKEA 2OJIA 3KF7A 3RK9A 4DN5A 1JSUA 3HV7A 3MBLA 3ORTA 5I9ZA 4GH2A 4FYOA 4B99A 3SDJA 3VQHA 4N4SA 5BNJA 4A9TA 1K2PA 4FT5A 5C8MA 3TXOA 4EC8A 2EB2A 2R3QA 2YIRA 4J99A 3MTLA 3EMGA 4WSYA 2B9HA 3SVVA 3CXWA 4D2RA 2WMRA 3VJOA 4OTPA 3L1SA 3QA8A 3QRIA 4NIFB 3E7VA 2YHVA 4BHNA 4EH2A 5BVWA 3UGCA 4S33A 3Q5IA 4YJOA 4F64A 4BI2A 1FBNA 3F3ZA 1KOAA 3PVBA 5CALA 4OBOA 3MY0A 4BBMA 2GNFA 2JDVA 3SV0A 4CRLA 2J5EA 1Y6AA 3E93A 2VO0A 2GFCA 4CQEA 2BALA 3OVVA 4FF8A 4GK4A 3NDMA 5AP1A 1GZ8A 1P14A 3VS3A 4AA5A 3QCSA 2XZSA 2IPXA 3VW8A 4L3LA 2CDZA 4AN2A 3WE8A 3O8PA 3WF9A 3MN3A 1HOWA 1XJDA 1G8AA 4DFZE 3SG9A 5GINE 2UZNA 5EM7A 3MYGA 4UB7A 4EOMA 2YLEA 1U46A 4QMTA 4ALWA 2QCSA 5IA0A 2G1TA 3LCDA 4LGHA 5H8EA 4II5A 2A19B 2O3PA 2XK9A 4YJRA 1UU9A 2VTPA 4W8DA 4ZXTA 5LARA 2PMOX 3VW6A 1YXTA 2J9MA 4HVGA 5HZNA 5FTQA 5CVFA 3B8QA 3KFAA 2VTSA 4I94A 4C3RA 2VGPA 3OCGA 2BHEA 4MD9E 3U8WA 3ORKA 4RX8A 5ANJA 1W84A 3PIYA 3TNWA 4O2PA 4TYHA 5FLFA 4XG2A 3GENA 4YSJA 4MEDA 3K2LA 4BKJA 4O38A 2QLQA 4HVDA 3LMHA 2PZIA 1P4FA 4ONAA 5IZFA 3WE4A 3AC4A 4OT6A 1WBSA 4YJQA 4ZS0A 3EFLA 2WELA 3DKOA 4M15A 5KMMA 4K1BA 2CCHA 2BTSA 3HGKA 4RG0A 3VQUA 3BLQA 4I1ZA 4AZWA 4FTOA 2YACA 3IG7A 4RLLA 2I0YA 1O9UA 3C4XA 4G6LA 4Q2AA 3ZU7A 3ACKA 3OEZA 1CM8A 2PVYA 4D0WA 1WVYA 1ZZLA 1OIRA 2IW6A 3C4EA 3QRTA 2XVDA 2ZM1A 2F4JA 3R9NA 4HOKA 4IAFA 5AIKA 2C5NA 4GMYA 3RK5A 4FIGA 5F1ZA 2Z7LA 2Z7QA 4EBWA 5KUPA 4BY9E 3FXXA 4EUTA 3HV6A 2GFSA 2R3NA 2ITPA 3CY2A 3HZTA 4L45A 4Y46A 4IQ6A 5CEQA 4RZVA 3ZEPA 1IR3A 4HGEA 2O64A 4RC3A 1MRVA 3BYUA 4YZNA 5KCVA 2YM5A 3DJ6A 4J98A 3I60A 4H05A 1WBOA 3MW1A 4RIOA 4FTKA 4FKPA 4O91A 3COKA 4FOBA 4MXZA 3UMWA 3KRJA 3VS7A 4AX8A 1J7IA 3KXHA 1YXSA 3VUKA 4BTJA 1R0PA 1BYGA 2WU6A 2OBJA 2PE0A 2X2MA 4QTDA 3QUPA 4MF1A 2IW8A 3WZKA 2J0JA 4BIEA 1REJA 4D4VA 4FZ6A 3GC9A 4BCHA 4F6UA 2GNJA 4LRJA 2JDOA 3RAIA 3MESA 3VHKA 2EXMA 3Q60A 3R8LA 3RINA 5C8NA 3VUDA 4ZY6A 3OOMA 1JKKA 4AW1A 3S00A 2W1IA 4KWPA 2QKWB 2BRGA 4X2NA 4AFEA 2Z60A 1I44A 3QD3A 3ZUVA 4FG7A 4AW2A 1B6CB 3DBEA 1UU7A 4AGWA 2BROA 3FMNA 3O50A 3I6WA 4ACGA 2C6DA 3DJ5A 2QO7A 3ZONA 3R71A 3KY2A 4DGNA 3DCVA 2RF9A 3CC6A 4USEA 1VR2A 4JI9A 3TNQB 4C8BA 2A4LA 1GZNA 3O8TA 3SQQA 3CPCA 4PMTA 2PZRA 4BHZA 4FA2A 5CI7A 3KQ7A 4ZTNA 3I81A 5JZJA 3RHKA 4DG2E 4QNYA 4MH7A 1ZY4A 2BUJA 3SW4A 4E6DA 1J91A 5F94A 2E9VA 3ORLA 3TV4A 2HWPA 3DV3A 2OFVA 2NP8A 3F6XA 3UNJA 5CSPA 4AT5A 4ASZA 4YO6A 2QR7A 3LQ3A 2RFDA 4FE2A 3FHRA 5EW9A 3SXFA 4KIQA 2R3JA 1JSVA 4FIHA 4AZTA 2QU6A 2BTRA 2WAJA 3VS1A 1IASA 1U54B 2UW5A 2YIWA 2X7FA 2PZYA 2YM7A 3R28A 5A4CA 4XG3A 3RHXA 4OTGA 3MVMA 4FUYA 4BCPA 2H6DA 4WO5A 5CNOA 3GCSA 3LFDA 4FKWA 2OIDA 4HGSA 4EOQA 5FQDC 3LFNA 4MVFA 5DMZA 3MPTA 3RPVA 2PMIA 4BDHA 3NUXA 4ENYA 5CXZA 1YW2A 3UC3A 3K3JA 1E1XA 2C6MA 3Q9WA 3C13A 1XKKA 3HLLA 4TRLA 3K5UA 3QZIA 4BDGA 4IANA 2OICA 3TL8A 2R4BA 4RJ7A 4BDKA 4CZYB 3UQFA 3MTFA 4U40A 3R6XA 4KKHA 4D5KA 2FSLX 3ZM9A 3MH1A 4DAWA 5M4UA 3QL8A 3TWJA 5G6VA 4YZBA 4E20A 2HAKA 4N57A 4G1WA 3QCYA 4RJ6A 2NRYA 3H4JA 3QWJA 4M69A 5DN3A 2OJJA 1FINA 2HOGA 3BI6A 4EEVA 3C4WA 1U59A 4KIKA 5HD7A 4PUZA 4EUUA 4LI5A 4FV9A 4FVPA 4E73A 2VO7A 3CKXA 1LP4A 5IQBA 3EKNA 4DEEA 2XBJA 3LLAA 2QOBA 3R7YA 3GQLA 1KE8A 3L9MA 3NW6A 1V0PA 4W9WA 3NYNA 3OTUA 2C5YA 4XV1A 2ERZE 2W1DA 5EYCA 3POOA 4NM7A 4I21A 2VWVA 4A9SA 4YZCA 4FSZA 4AOTA 2XBAA 3EQBA 4IVCA 3LLTA 2QD9A 3NMUF 3OT8A 4DH8A 2WTWA 3IK3A 2QOCA 4C58A 3LOKA 2YIQA 1Q8YA 4E4MA 5H2UA 3E8NA 3FMLA 2C3JA 3RZBA 4ZSLA 3EQRA 5L8LA 3KL8A 2W17A 3BYVA 3WIKA 2A27A 4BDJA 3UE4A 4O0TA 4WD5A 5FTOA 3UVRA 3R9HA 4CV8A 1QPCA 4S30A 3S95A 2B9JA 3CIKA 3TN8A 3IS5A 1E9HA 4Z7GA 5DHJA 5HNBA 3DK6A 1NVQA 1JLUE 5AP6A 3AT3A 4JBOA 2OLCA 3L8VA 3IONA 4DFBA 2ITOA 3R63A 4N6YA 4RWKA 5BVNA 4PNKA 1MRYA 4MBLA 2J0IA 1BX6A 4C57A 2PVHA 3D7ZA 3D83A 3ZO4A 5AR8A 4E5AX 4I92A 3DFAA 4R7IA 3R8ZA 5J1VA 3OXZA 1UWHA 4OTQA 4ZJJA 3PJ2A 4I24A 1SVGA 5JN2A 4NJ3A 5L2TA 1O6LA 4TYGA 4NJDA 4FODA 5LVPA 2XK8A 2J4ZA 2I1MA 3DAJA 1WZYA 2QOFA 4C36A 2C4GA 2WQMA 2EB3A 4YO4A 5IMEA 2RFEA 2VTAA 2PTKA 3NNXA 3SD0A 1Q41A 4JL9A 3T3UA 1Q8TA 2W1CA 3WYYA 1M7QA 1W98A 2ZDTA 2WB8A 3BHHA 3V51A 2C69A 5K9IA 5BVEA 1Y6BA 4B8LA 4OLIA 4NFNA 4DFNA 1OKZA 3COMA 3P1AA 4NWMA 3ZFYA 3ZO2A 1M14A 1OIQA 1H26A 2NO3A 3OTVA 1YOLA 4ANNA 5HNGA 2QR8A 4GUBA 3IDPA 3W2CA 2QVSE 4LMNA 5DNRA 3HECA 5DI1A 3QQUA 3EYGA 4BICA 3DXPA 2ZB1A 4DE4A 4O7TA 3I7CA 1OBDA 4FG8A 3G9LX 3P7CA 4X3FC 3TNIA 3BKBA 2JBOA 4FSRA 3HUBA 2PU8A 2GS6A 2GHGA 2HWOA 5HVYA 4RJ8A 5EW8A 3QX4A 3UIXA 5LMBA 4FEXA 5B0XA 5AUUA 3CJFA 3MIYA 3NUUA 3N4UA 3FZ1A 1L3RE 4I93A 5LCJA 3JXWA 5FUTA 4PMSA 5FM3A 3CP9A 4YZ9A 3VUIA 5EI2A 2WU7A 2OZAA 3GU7A 4UMUA 3CJGA 1ZZ2A 5GZ8A 3U9NA 1PY5A 2W05A 3HV5A 3V5JA 2RG5A 4WRGA 3F5GA 4BR3A 2YCFA 3MVLA 3ZC6A 3MH0A 4QPAA 3KU2A 4D5HA 4KA3A 4XCUA 5F95A 3E3BX 4IWDA 3PJ1A 3W8QA 5AA9A 4HNFA 3ULIA 4DTAA 3R2BA 3EL8A 4EBVA 5J9LA 3SXRA 5C27A 4YTHA 2WOUA 4RA4A 4ANBA 5E7RA 2C0TA 1YOMA 2WO6A 4L67A 3EN6A 5HE0A 2YEXA 4ANMA 4KINA 4F63A 4IVBA 4NFMA 3OY1A 4D28A 4Q9SA 2JKKA 4ORKA 3LMGA 3S3IA 3P23A 3V5QA 4BVUA 4WG4A 2JFLA 2JAMA 4JS8A 5HI2A 5HD4A 2YCSA 3FQHA 4IZ5A 4WG3A 3WZJA 2QOQA 3KMMA 2F2CB 3D5VA 1NT2A 5IQAA 4ZP5A 4BGQA 2R7IA 3WZDA 2BIYA 5I9UA 4ZLYA 2Y7JA 3UQCA 3L9PA 3JUHA 4FIFA 1OIUA 4FL1A 3FBVA 3PSBA 3IW6A 1ZOEA 4EHGA 3H9OA 1AQ1A 4CTCA 3OW4A 4LL5A 5GNKA 3GEQA 3L8XA 5M4FA 5E8XA 2WZJA 2XJ2A 2ZJWA 5EM8A 5GZ9A 4YTFA 2PVNA 5JQ8A 1OKYA 2YERA 4PP7A 3ENHA 4F9AA 3N9XA 5A3XA 2J0LA 4D1SA 2I0VA 3AC3A 4FZ7A 3SXSA 5LWMA 2C3IB 5L2QA 4F1TA 4FZDB 4FTJA 5AR4A 2B1PA 1Q3DA 2H96A 4NCTC 4GW8A 4OBQA 3UOJA 3D15A 3PXYA 4TNBA 5EM6A 1JPAA 4OTDA 2CKOA 3PIXA 3W32A 3PYYA 2ERKA 3COIA 4ITJA 3OHTA 5BVKA 5AA8A 2AYPA 3E7OA 3LPBA 3Q5ZA 3BWFA 5KX8A 5BX0A 3QTIA 3LFBA 4V0GA 4U79A 4I5HA 4IACA 4F65A 5J9ZA 1GIJA 4ZTHA 4PQNA 3MVHA 3UDBA 1L8TA 3S1HA 2B0QA 5TO8A 2JIUA 4O0SA 3KXGA 3DGKA 2CLQA 2WPAA 4ANOA 1PKGA 3BGPA 3QCXA 3MVJA 4W4WA 3OWPA 3E62A 3UZTA 2XK3A 3RCJA 3ZTXA 2BDJA 4CRSA 3FLZA 3HDMA 2WQNA 3OD6X 1JBPE 3P78A 2PVLA 4DFLA 3QA0A 2QNJA 5ANIA 2GQSA 4O6LA 4D2WA 3HNGA 5J9YA 4U0IA 3BZ3A 3CY3A 4ALVA 4Y73A 2X9EA 3VF8A 5K4IA 1RQQA 2YA9A 4A9YA 3IPHA 1CSNA 3H30A 4OAVB 5EW3A 2V62A 1URCA 4G2FA 5AAEA 4GVJA 3RPSA 5J1WA 2IZSA 2R7BA 2JLDA 2QKRA 2HZ4A 4KNBA 1XH6A 2IVVA 2RSVA 4BCMA 2XNPA 4FGRA 3KCFA 3E8CA 4EC9A 4GFMA 3LHJA 1WBPA 1FGIA 2J7TA 2RG6A 5C1QB 5CAUA 2HXLA 4CVAA 2WNTA 2R0IA 1O6YA 4FC0A 5HG7A 4JNWA 4QPSA 3BV2A 4CLJA 1Q3WA 4JQ8A 2UW4A 4FNZA 1URWA 3KN6A 3QQHA 4IMYA 1BI8A 3OF0A 3A7HA 5FBOA 3R7UA 4C59A 3FJQE 5AV3A 1P5EA 2QC6A 4I3ZA 3R7VA 4BRXA 1Y57A 3AGLA 1P2AA 1JSTA 1YXXA 2VX0A 2XRUA 2A0CX 2C6EA 4M69B 3L8PA 4J8MA 4RIXA 4GIIA 4QD6A 5CVGA 4DCEA 3V8TA 5EM5A 4BCQA 4MQ1A 4QP2A 3W2OA 4BF2A 4ZMFA 2O65A 4V05A 1H28A 4XS2A 3PY1A 2CKQA 3LFSA 5C26A 1YDTE 2XA4A 4PV0A 1PMUA 3H9FA 1YWVA 4IC7A 4K0YA 3W2QA 3OMVA 4BBFA 4D9UA 2C0IA 5IDPA 2YAAA 2CGUA 3AG9A 4JAJA 5HKMA 3SC1A 2QO9A 5IQFA 3TI1A 5CF4A 4RWLA 3W1FA 2CN8A 3DDPA 4L52A 3QTQA 1XWSA 1JNKA 2R3PA 1H27A 5JFWA 3FLYA 2J2IB 4DITA 4O7SA 4R3PA 3BELA 5EHLA 2WTKC 4E8AA 1OITA 5JZNA 3PSDA 3ITZA 3R1YA 3ZRKA 5IUGA 1EH4A 1VJYA 4FTIA 4DH7A 3R8MA 4WUNA 1Z57A 5D1JA 5ACBC 2B52A 3CQEA 4R8QA 5CSXA 3DDQA 3HYHA 4YSMA 4EHZA 2V7OA 4L3JA 4TNDA 4M84A 3D7TA 4BCGA 4EQMA 5CEMA 2C6LA 5JK3A 4I6HA 3FYJX 4QQJA 3E92A 4CT2A 2XK7A 1IRKA 4TWNA 5E8TA 5HLNA 3U6IA 3ORMA 2GS7A 4XLVA 2BFYA 5FM2A 2QOLA 4AGCA 3JVRA 4BGGA 5BUEA 1UVRA 5I5ZA 4I23A 3NRMA 3RCDA 2WMQA 3QZGA 2G9XA 2F2UA 4KRCA 4O21A 5LXMA 5C8KA 2W1EA 3I7BA 3R9RA 4ZMEA 4EWQA 2Y8OA 4QQCA 3U4UA 3TUCA 2GNGA 4ASDA 2PZ5A 2ITZA 2BRBA 2XKFA 2UZVA 3MPAA 4LUDA 1ZMWA 2XNOA 1CMKE 4LV5A 3NLBA 3RP9A 5AFVA 4E5WA 2VNWA 3GI3A 2VTMA 4YC3A 4AN9A 3DQXA 4XUFA 1R0EA 4YNOA 3C9WA 4JRVA 1YKRA 2VO3A 4WNPA 4IWQA 3DFCB 4XOZA 2J51A 3AMYA 4AOIA 2OWBA 4M12A 5CSVA 4MWHA 4OR5A 1W8CA 5IDNA 3EQHA 4BI1A 4DG0E 4OUCA 1IAJA 3A8WA 4FT0A 3JPVA 3FPQA 4P4CA 4LOOA 1UNGA 4CMTA 4UWCA 3R8UA 3FMMA 1V0BA 3HMMA 4FV2A 4JDKA 4ZTLA 3CQWA 4CFFA 4IM2A 1QCFA 3FI3A 3F3WA 4FOCA 4WSQA 2KULA 4I6FA 1ZARA 2W4JA 4TWOA 2C3KA 4N70A 1NA7A 4ARKA 2HZIA 1OKWA 5E91A 5HNIX 1QPEA 1T46A 3PJCA 3R0TA 4RWJA 4E4LA 1OI9A 1PF8A 3E8EA 3FMHA 4PDPA 3F69A 2PVKA 3PP0A 4JG6A 5E1SA 3ZYAA 1OL6A 2WIHA 1W82A 1M52A 3VS4A 4AXAA 2OZAB 3V5WA 1XH4A 3G6HA 2VTOA 4DFYA 5J7HA 3LMIA 4BKZA 4FKQA 4QP9A 1Q5KA 3FHIA 2IO6A 4WA9A 5GIOE 3ZBFA 2J50A 4RVMA 5HIBA 4BTMA 3JYAA 1E1VA 3IW5A 3LFFA 2YZLA 1H1QA 1F5QA 4UWYA 2GHMA 5KE0A 3FLWA 3ZDIA 2O8YA 1ZWSA 2RIOA 4GK3A 1SZMA 4M66A 4Q5EA 3SHEA 2YM8A 2PUUA 3KK8A 4OTFA 1YOJA 3FLNC 4LRKA 4UZHA 2PMLX 4C3PA 5IQIA 2BVAA 2XIXA 1PXPA 3GC0A 3FI2A 4YHFA 5D12A 3NUPA 4FTQA 4YGAA 5EFQA 2ZDUA 3FZOA 1G5SA 5AADA 3FKLA 3OZ6A 4FEQA 4TT7A 4W4XA 4D9TA 5AIRA 4MD8E 3TG1A 3TNPC 5D41A 2JITA 1YRPA 3ZCLA 5FP5A 2VZ6A 4IB1A 3KULA 2XNGA 3BLHA 4IX6A 5DIAA 5IA3A 1XH5A 1ZY5A 2VTJA 4QP6A 3N4TA 3GU8A 2BDWA 3CTJA 3RK7A 3V3VA 4FV3A 4QPMA 3HX4A 3P86A 4MBJA 4YHTA 3RAKA 4BGHA 1GJOA 4K11A 4HCTA 3VC4A 2I0EA 4BCOA 4BYIA 3UMXA 4G9CA 1XH8A 5CASA 5DBXA 5HO7A 4CLIA 5H8GA 2GQGA 4QTBA 3GCPA 4FG9A 3ZRMA 2X2KA 4YU2A 1Q97A 2X2LA 3IW4A 5ANEA 3BU6A 3MPMA 3HUCA 3W2PA 1WBVA 4KB8A 2WTJA 5HORA 1ATPE 4JIAA 3UOLA 4S31A 3UG1A 3TDWA 4PL3A 3SRVB 1XBCA 4XMOA 3R8PA 3FMJA 4FSQA 4I4EA 4L53A 3QALE 2FSMX 4NW5A 5I9YA 1ZYCA 3C5IA 2R3MA 1Q99A 4PMMA 3W18A 4QMNA 5HTBA 2YM6A 3PY3A 3IKAA 2YM3A 4WUAA 5DH3A 1PMVA 5B2KA 1GY3A 4JR3A 1QMZA 3LJ1A 4QMOA 2WIPA 1YXVA 2FGIA 3NW5A 4ITIA 4AU8A 1BKXA 2P3GX 4L43A 3ZZWA 3V6SA 2PVRA 5JGDA 3LE6A 1FQ1B 4CTBA 2CN5A 4F9WA 2VV9A 3UYSA 4Z3VA 3HMIA 2VD5A 3S4QA 4Q5HA 1WFCA 5L3AA 4UMTA 4FZFB 4M7IA 4V0GB 1W7HA 2QHNA 3LKMA 1WVXA 4V04A 3ANRA 3KA0A 4R78A 2R9SA 3GVUA 2DS1A 4YJNA 3Q4ZA 4UYNA 2R5TA 5CNNA 3UVPA 5DRDA 1M2RA 4FV5A 4TKSA 4C37A 4ZAUA 2WTIA 3RKBA 2WMBA 3P5KA 4PTGA 3C50A 2R0UA 2WMXA 5ITAA 4ZSAA 1FGKA 3H0ZA 2GNLA 2W5HA 3FKOA 2XJ0A 3FAAA 2VWWA 3Q04A 4G16A 4L42A 5AR7A 3VUMA 1UU3A 4TPTA 4FEVA 3ERKA 5HE1A 2ZV8A 4GG5A 4WBOA 2UW7A 3AGMA 4NM3A 4AOJA 2FA2A 1OIYA 4IM3A 3TNHA 4EQCA 3QTSA 2FO0A 4JXFA 1DI9A 3PJ3A 4WIHA 3EZRA 3R73A 4QYHA 4YUQA 4XRLA 4GU6A 4D4SA 3QTZA 3E87A 1BLXA 2BAKA 5H9BA 4JBPA 5LOHA 4KKEA 5A4TA 2P2HA 4RVLA 4E7WA 4CXAA 4R77A 3LJ0A 2X81A 2I0HA 3C5UA 1REKA 4I5PA 1IG1A 1JKLA 2GSFA 3QCQA 2JKQA 2VTTA 4Y8DA 3B2WA 2UV2A 3F9NA 3F5PA 4FIIA 3WILA 3A7GA 4EZ5A 2C47A 3BU3A 1WMKA 4LGGA 3A99A 3VNTA 4D1ZA 2XJ1A 2IZUA 4FYNA 4FV8A 3UQGA 1H00A 3UODA 4FVQA 2QOOA 4RGJA 5AJQA 2VWBA 4B6LA 2F49A 2WMSA 5T6KA 4PDSA 2XNEA 3C4CA 3ELJA 3GP0A 4E6AA 5DG5A 3QTRA 1YI4A 4QP3A 2J90A 5LVNA 5AP0A 5E4HA 3R7OA 1W0XC 3ENMA 3WF8A 1KUTA 3G2FA 1OKVA 3ZSGA 1R78A 3Q9XA 3D5WA 3O7LB 2X8IA 3ET7A 2EXEA 3NYVA 4RBLA 4AT3A 3CSVA 1PMEA 3AQVA 4L01A 3D14A 5CEKA 5EH0A 4YZMA 1H07A 5IG1A 2BAQA 4ZSGA 4DEBA 5C01A 3ROCA 4GG7A 4KKGA 4NTSA 1KOBA 1TQMA 4LGDA 4X3FB 5CZHA 1KE7A 2OF4A 3P79A 5EHOA 3WI6A 4FSNA 4U45A 1YVJA 3N4VA 5IH5A 1V0OA 3VUHA 4XBRA 4M14A 5D11A 3AC8A 5HHWA 4APCA 3EN9A 4XG8A 3F5UA 4O2ZA 4F6SA 3MH3A 2LAVA 4XOYA 4FBXA 4MNFA 4KBCA 4BC6A 1FMOE 4UMQA 4JAIA 4EHEA 3DNEA 5K5XA 3RBWA 1SNXA 1WVWA 5HBHA 2VRXA 2ZB0A 4W8EA 4XJ0A 3KVXA 4BCJA 4IFGA 3ZXZA 5GJFA 2Z8CA 2FUMA 4FT9A 1SVHA 2UZBA 4L7SA 4CFUA 1XBAA 3TKUA 3KXMA 2OI4X 2ZAZA 3DOGA 4MKCA 3ZDUA 2XH5A 4FKOA 2OXDA 3DKGA 3PRIA 5EKNA 1YQJA 4BCFA 3R02A 4ENXA 5I0BA 2CLXA 3PXKA 3MV5A 2IZTA 2X4ZA 4YPDA 2JEDA 5ANKA 5DVRA 1WBNA 3F3VA 4DGGA 4C61A 3QU0A 3LQ8A 3FYKX 1Y91A 4R5SA 4RX7A 3O8UA 2GNIA 3VBWA 3DB6A 3L9NA 3OC1A 3UO6A 4ZSJA 4C7TA 4MAOA 3EH9A 3DLSA 1YI6A 4RVTA 1RW8A 4ZLOA 3OXTA 5JRQA 2XYUA 2UZLA 5L4QA 3NCGA 4CCBA 5HG5A 4PY1A 1H1SA 3FY2A 3WOWA 3COHA 4PL4A 3BBTB 4TYIA 3MA6A 3VBVA 3RWPA 5LVMA 5AP4A 5CF5A 4F1OA 4O7VA 5I9VA 5JKGA 1OM1A 3DKFA 4CSVA 3GT8A 5FDPA 4FV4A 1RJBA 2G2FA 4EK6A 1A48A 3R1NA 4PTCA 3R1SA 4F99A 4BB4A 4E4XA 4IW0A 3PPKA 5TR6A 4BI0A 2QODA 3PJ8A 4U9AA 5CU4A 2UZDA 2UZWE 1LR4A 2ITYA 4QYYA 4TZRA 5CSWA 5AP3A 2W4KA 3OT3A 2GDOA 2DYLA 4R3RA 5EYKA 5TOZA 2CMWA 2B9FA 5EKOA 3KK9A 4D2VA 3UP2A 5FEDA 4BDEA 4C33A 3BWJA 3MJ2A 1OUKA 4G31A 1NW1A 4O83A 2WXVA 5JFVA 2VO6A 3QQGA 5HQ0A 4TN6A 5IU2A 3EN7A 2CGWA 1XBBA 3MI9A 4HYUA 5C4LA 5JH6A 5AUWA 5DGZA 5IEVA 5GHVA 3C0HA 4L8MA 4WOVA 2XP2A 5FEQA 5KMLA 4O7WA 2P2IA 3AMAA 4YURA 2YJSA 1WAKA 4XBUA 3JR1A 3O71A 3OCSA 1RE8A 2WFYA 1YDRE 4KIPA 3NVMB 3UJGA 4AT4A 1PHKA 2W1GA 4IIRA 4NK9A 4ZSEA 4KBAA 1UU8A 3EN4A 3HMPA 3K3IA 5HO8A 5HBJA 4PDOA 5AWMA 4EHVA 1JVPP 3L8SA 4USFA 4F0GA 4FICA 4C4HA 3N51A 4WNKA 4O1PA 2Y6OA 3JY0A 4FKRA 4ACMA 2WQOA 1OL5A 4QT1A 4RJ3A 5AV0A 2WMAA 4R6VA 5AX3A 3AD5A 3Q9ZA 4AWIA 3IDBA 3QX2A 1J1CA 4M13A 2GHLA 4EZ3A 3V8WA 4BIBA 1BL6A 4HCUA 5CT7A 4QYGA 3ZUTA 5M56A 3KCKA 4FKVA 4B9DA 3QAME 4CMUA 5BYLA 3NSZA 4PNIA 5FD2A 3Q9YA 5ACKA 5IKWA 4DEDA 2OIQA 4RQKA 3ANQA 2I40A 2BMCA 4FSYA 3DBFA 3Q6WA 2V0DA 1PW2A 3KMUA 1Z9XA 4LL0A 5AUZA 2XS0A 1YWNA 1V1KA 1H24A 4LG4A 2PYWA 3AD6A 1MUOA 4X2FA 3PZEA 4HZSA 4NEUA 3PXRA 2W5AA 4OW8A 1OVEA 3BE2A 5KHWA 3NUAA 4NKSA 5CTPA 5BMMA 3ZOSA 4CG9A 4O0YA 5ANOA 3TZMA 4JRNA 3QXPA 3TACA 5L6OA 4OAUC 3G15A 4L6QA 5BQ0A 4JQ7A 4EOOA 3CGOA 3VVHA 1UWJA 3O2MA 1H0VA 3D5XA 5M4CA 3F7ZA 5CLPA 3PLSA 4K77A 3V5LA 3O0GA 1F3MC 1YHVA 2C6IA 3KRLA 4FKJA 4PPAA 5KMOA 3W10A 4L68A 5FXQA 3GOPA 4X3JA 3DTWA 4TYHB 4G3GA 2BCJA 5CT0A 3R8VA 4N6ZA 4DLJA 3C0IA 3QRKA 4YJPA 4XEYA 3QUEA 3DBQA 1U4DA 3BEGA 3FDNA 3H0YA 3NNVA 4MNEA 3PXZA 5EHYA 5AR3A 1NXKA 5AEPA 3A61A 2YIYA 4L9IA 3BLRA 2VWYA 1OB3A 3BU5A 1KWPA 1RDQE 3QF9A 4J71A 5J95A 3V5TA 3R01A 5EOLA
chains in the Genus database with same CATH superfamily
5M4IA 4LMUA 2J0KA 5FXSA 1H1PA 3I1AA 1PXJA 3I0QA 4D1XA 3REPA 3CPBA 2PVFA 3EHAA 4AUAA 2WQEA 5CAOA 5L2SA 2X0PA 3NAYA 5BV3A 1R3CA 4IZAA 4ZTMA 2ONLA 2WGJA 4QDEA 4MXAA 4WNMA 3LM0A 3KF4A 5CF8A 5IA5A 3Q2JA 2OO8X 3TZ7A 3ZH8A 3OROA 3EFJA 2HCKA 3G33A 4IDVA 4PPCA 4UMRA 4CKRA 4FV6A 5J8IA 4EH5A 3RALA 2WTKB 2R3RA 4P2KA 4GU9A 3FV8A 1F0QA 1M7NA 5IA4A 3FKNA 2ITTA 1CKIA 2YFXA 5ANDA 4HCVA 4RRVA 5E1EA 4H1JA 4QTAA 3NW7A 1KE5A 3H10A 4NIFA 2P33A 4OTIA 3QD0A 4PPBA 1M2PA 2XCKA 5TT7A 3SAYA 4KD1A 2EUFB 4FL2A 3FQEA 2UVYA 3QC9A 4YJVA 3PG3A 3BGQA 4PL5A 2W06A 2BR1A 2YZAA 3PVUA 5E92A 3FLQA 4AA0A 1VEBA 3LJ2A 4JR7A 4DF3A 3CGFA 5EK7A 5BVDA 1ZYJA 4G34A 2CKPA 2UZTA 3IGGA 3A62A 2WD1A 3QBNA 5IEYA 1I09A 3QYWA 4FKGA 2WMVA 1FMKA 3OY3A 4K33A 3UPXA 3V01A 2XALA 4IX4A 4B7TA 5F20A 4FNYA 4O81A 2WTDA 2WTVA 4YHJA 2VTNA 4DT8A 4Y85A 2GCDA 1CKJA 3EB0A 3TZ8A 4LQMA 3SKCA 4O7YA 4QNAA 4RA5A 3DKCA 4XRJA 5ETIA 5KZ0A 5JFSA 5CY3A 1UNLA 3R83A 4AZFA 3R2YA 4RMZA 5GJDA 3EFKA 4AACA 1HCLA 1YI3A 3PWDA 4GIHA 4F09A 2H8HA 5L2IA 3A4OX 1FVRA 3ACJA 2ZMCA 3CS9A 5IQGA 2XIYA 2F7EE 5EDQA 3P0MA 5JGBA 1BMKA 4UN0C 2VGOA 1WBTA 4CZUA 1MQ4A 1LUFA 2Y6MA 3GC7A 1T45A 5L8JA 3POZA 4O86A 3HRFA 1YXUA 4KAOA 1ZYDA 3A7JA 1H0WA 1QPJA 2OJ9A 5ANGA 4DFUA 1PYEA 3BQRA 4Y5HA 1IAHA 4EK8A 3DA6A 3UZPA 3I79A 3B8RA 2UUEA 3Q4UA 4GEOA 2QG5A 5HO6A 3ZO3A 3H9RA 4B0GA 5E8ZA 4IJ9A 4QMQA 3HV4A 2G01A 4ZY4A 2NNWB 3E64A 3R1QA 4S2ZA 2FYSA 2WOTA 4O7LA 5HVKA 4F9YA 3MFUA 4PP9A 5DT0A 5E90A 3DBDA 4ZJIA 4FEUA 4W4YA 5DE2A 4A7CA 3QKLA 3ZSHA 1ZAOA 3BIZA 1H8FA 2EVAA 2VWIA 2W9FB 3I6UA 4NT4A 4X21A 5GZAA 5TF9A 1APME 2VWUA 5CVHA 3FXZA 3TTIA 4C4IA 4NW6A 2C5VA 4U3ZA 4OTHA 3NNWA 2O0UA 4IWPA 5AAGA 2X6DA 1S9IA 4UWBA 2BZIB 3UIMA 4A07A 1XH9A 3VBXA 3BEAA 3ORZA 4R1YA 4J96A 3WZUA 5HTCA 2CKEA 4HVHA 4ZTRA 3R9OA 4BCIA 2YN8A 3CD3A 2PUPA 3JS2A 3FMEA 2UW0A 3ZHPC 4C2WA 3LXNA 4U81A 4L3PA 5DR2A 4F70A 5AV4A 3OCBA 4GT4A 1ZLTA 4CYIA 4IE9A 4RSSA 5DEWA 5EDPA 1STCE 5HX6A 3NVKI 3MB7A 3VHEA 4IBMA 4AFJA 4C35A 3GXLA 2HYYA 3W0PA 5L2WA 3CTQA 4UX9A 1OMWA 2Q83A 5A4QA 2BKKA 4EJNA 4KRDA 4FV1A 2VAGA 3GOKA 4HYHA 4JX3A 4WRSA 3R7EA 3QQFA 4YJUA 5AP7A 5IPJA 3TYKA 4O7ZA 2HY0A 3CQUA 3G0FA 2Y4PA 3MY1A 3RAHA 1ZRZA 4KIKB 3PLAE 4HYSA 3KVWA 4ANQA 5CENA 2BHHA 3P4KA 3BGZA 4Y95A 2V55A 4LM5A 3ZS5A 3HVCA 3VUTA 5JT2A 4USDA 4U42A 4EOKA 3NZ0A 2Z7SA 4YBJA 4IM0A 3QHRA 3TJCA 2YLFA 4A4OA 5FGKA 4YTCA 2IVUA 1BUHA 4ZK5A 1TQPA 3PZHA 3SLSA 3ALOA 4D55A 1NVSA 5AP2A 3PP1A 3OEFX 4G9RA 4Z16A 3GCUA 4BDAA 4ID7A 2HXQA 4YMJA 3TM0A 4QMUA 4ASXA 4QQTA 1YDSE 3ATTA 2YISA 3HV3A 2IWIA 2XIRA 2XYNA 3Q53A 4KABA 3QTXA 4X2KA 4D0XA 3HRCA 5HCZA 1ZOHA 5DWRA 2HZNA 5A14A 3AC5A 2BFXA 3EKKA 1QPDA 4DHFA 4X2JA 3VS2A 1DAWA 4A9UA 3MJ1A 3A7FA 3WF6A 1PYXA 1XO2B 5E8UA 5KMIA 4YJTA 3UDZA 2C6KA 4AE9A 5IH6A 2ETMA 3LXKA 5EOBA 2ZV2A 2OJFE 2XAOA 4NYEA 5DFPA 2V7AA 2C3LA 4XX9A 4JBVA 4OTRA 4YLJA 3W8LA 4IX5A 1NVRA 4QP8A 4RIWA 5K0KA 4F7JA 2PWLA 5IQDA 4DINA 2F9GA 2RKUA 5F4NA 2B53A 3Q52A 4UALA 4ZTSA 5HICA 3CR0A 4CEGA 3RPYA 3GFEA 1LEZA 3DU8A 3HMNA 4BZDA 4DTKA 1U54A 3EQIA 3AXWA 4DEIA 3NX8A 4IX3A 5A46A 5FXRA 4JX7A 3CD8A 4YZDA 3QKMA 4CNHA 4YP8A 4KIOA 4EKLA 1WCCA 4BFMA 3ORNA 4L46A 3ZLWA 5LMKA 1B39A 4JG8A 4GKHA 1B38A 4DGLC 4AQKA 2R64A 3BYSA 3ID6C 4NZWB 3FE3A 2IG7A 3WZEA 3FC1X 3T9TA 5IQHA 4DCAA 4AAYA 1DS5A 4LUEA 3UOKA 4D2SA 5HU9A 3IDCA 3MFTA 3F3TA 4IVDA 4I41A 1OGUA 5HE3A 3BX5A 3R7IA 3EZVA 2Y4IC 4XP3A 5D7AA 1GZOA 3QRJA 3TIYA 1KE6A 4IAAA 2E9NA 2WHBA 5T3QA 2BZHB 2JFMA 4U43A 3W0OA 3DY7A 4UMPA 3DLZA 4C4JA 4CQGA 5I4NA 5T68A 3FZSA 5A6NA 3QZFA 3PSCA 2FH9A 3QHWA 3PPZA 3DPKA 2YCRA 3M2WA 3A7IA 3GNIB 3ZEWA 4D58A 5AV2A 3VWAA 3ZLYA 3EQCA 1H4LA 2AEGA 3F2AA 4TYEA 5J5SA 2PE1A 3AMBA 4C0TA 1SMHA 3PRFA 2W7XA 4UXQA 2FB8A 2ITWA 4GYGA 5J87A 5BYZA 5JMSA 4DEGA 1JKSA 3TIZA 4HW7A 3IECA 4FK3A 4CD0A 2UW9A 3ROYA 2YDIA 3S2PA 3NYXA 1XH7A 4V01A 1UNHA 2X8EA 5EDRA 4U97A 1VZOA 3OXIA 4QMLA 3FI8A 3O7LD 4O0VA 5C03A 4F0FA 3V6RA 3E63A 2O2UA 3A8XA 4ZZMA 3OBJA 4I20A 5EYDA 3DK7A 5FBNC 1MQBA 4DGMA 1AD5A 2DQ7X 5AV1A 5IH4A 3FSFA 3LAUA 4U8ZA 1TKIA 3HMOA 4PRJA 4X0MA 5IUIA 4Y72A 5AP5A 3F82A 4I0RA 5CWZA 3OWJA 5CYIA 3WF7A 3TZ9A 2IZRA 3VULA 3VRZA 3D94A 5TKDA 3SOCA 3NUSA 1K3AA 4PX6A 4GT5A 2VTRA 5C4KA 2X0GA 4BCNA 5IF1A 3C0GA 2PMNX 5I3OA 2JDSA 2ZV7A 4H58A 1FPUA 1KV2A 2YABA 3EN5A 3PE1A 4QMYA 4DC2A 4E26A 4EH7A 4GJ3A 4PF4A 4FIEA 4GL9A 4U7ZA 4ANLA 3ML1A 5IQCA 3LCSA 2VWZA 3GC8A 3NEWA 3OBGA 4QMSA 4RX9A 3RNIA 5E8YA 4H3PA 3I5ZA 2C1AA 5EYMA 5FRIA 3RM6A 1CTPE 3KB7A 4FT3A 1KV1A 2XCHA 3BE9A 2XM8A 4IHPA 5HVJA 4BWPA 2GQRA 2UW3A 3G9NA 1OPLA 3E3PA 1IEPA 4YTIA 3DXQA 4E93A 3NUNA 4RJ4A 4XYFA 5AM6A 4R3CA 4CZTA 1OL2A 3THBA 3DNDA 1O6KA 3U4WA 3O17A 3ZRLA 4WBBB 2OF2A 2IW9A 4NSTA 5C9CA 4EOPA 3Q6UA 3DBCA 3Q3BA 5K4JA 4AGDA 4F4PA 3OP5A 2OGVA 3RAWA 1UKIA 3R7GA 5BUJA 4FKSA 3D4QA 2YCQA 3QQLA 3E88A 4OTWA 1JOWB 2B55A 3AD4A 2PY3A 3PUPA 5EQEA 3NGAA 2AC3A 1S9JA 1M2QA 1TQIA 3FSKA 5HU3A 3MS9A 4O84A 2XKCA 1OPJA 3A4PA 3MFRA 5HESA 3DXNA 3HDNA 3KGAA 3WIGA 5HX8A 5CANA 4IB0A 5LMAA 4FX3A 5LVOA 3GCQA 4FSTA 4DLIA 2OFUA 2IVSA 4FEWA 3QWKA 3F3UA 4FRFA 3QQKA 2ACXA 3EL7A 3EOCA 3GBZA 3NCZA 4G3FA 4YPSA 2IF8A 4FKIA 4QYEA 4EONA 2JDRA 3CBLA 5ETFA 5KZIA 4EH6A 3PTGA 4U44A 1XR1A 4PMPA 3ZSIA 1Y8GA 2X0OA 2YM4A 3LVPA 2HZ0A 4QTCA 3QRUA 4MTAA 4NM5A 4DA5A 4QO9A 5BUIA 1PMNA 2R3IA 4RJ5A 4MD7E 2VTIA 4IZYA 4I0SA 4C2VA 5ICPA 2ZYBA 3PIZA 5DR6A 2X7GA 3DZOA 3IO7A 3UOHA 3MY5A 3CTHA 3IOKA 4FTLA 4N0SA 4O96A 3CEKA 5EI8A 1H08A 4ZTQA 2Y0AA 3QD4A 4EKKA 1JAMA 1PXMA 4F7SA 3OS3A 2B9IA 2HW6A 3VBTA 2BIKB 2BKZA 2W1FA 4FV0A 2A2AA 3UC4A 2E9UA 4XNEA 4M0YA 2XEZA 4ZJVA 2DWBA 3HA6A 4UZDA 2B54A 3BHTA 3MGYA 4IADA 4O7RA 2JD5A 2YJRA 4TYJA 2XM9A 3QLFA 3U87A 4EYJA 3HRBA 4Z9LA 3PVWA 3Q96A 1YHSA 1A06A 3BHVA 2B7AA 2QHMA 4RLKA 2HELA 4H3QA 4ZOGA 5L6WL 3VAPA 4APPA 4EQUA 2W5BA 2DUVA 4C4FA 3TCPA 1H1WA 1TVOA 5AUTA 5M55A 4ZZOA 5HCXA 3I5NA 4GYIA 2O5KA 4PWNA 4TXCA 4MXOA 4P5ZA 4LV8A 4RT7A 3PDTA 1KSWA 4BTKA 4DYMA 2RFNA 4DH1A 5A6OA 3HA8A 3KMWA 3FMDA 1GIHA 2H9VA 3QLGA 4NKAA 4BZNA 2E9PA 4RIXB 3DZQA 1DI8A 4XP2A 2HENA 2NRUA 5EI6A 5AR5A 3AT4A 2ZV9A 4Z7HA 4K2RA 3UG2A 3V04A 3ZZEA 3PPJA 1DAYA 4JG7A 4TY1A 4TW9A 4BDBA 3S0OA 4O0RA 1JKTA 4GVAA 4I6BA 3FI4A 4I5MA 4HPUE 2BILB 4EH3A 3QC4A 4HVIA 2BDFA 2ONLC 2REIA 4IAYA 2OK1A 5M51A 2CNVA 1LEWA 4KS7A 3TKHA 2X6EA 2ZMDA 2JBPA 2LGCA 2X1NA 3MA3A 5HG8A 3W55A 3HAVA 4DBXA 1ZOGA 2PHKA 3KXZA 3QYZA 4P5QA 4PTEA 4FUXA 4IEBA 4RZWA 4A4XA 4BWKA 2A98A 2XK4A 4BDFA 3ETAA 5LWNA 4XG7A 4FSMA 5FWKK 4EK3A 1XHAA 3WARA 3TT0A 3GGFA 1W83A 4FL3A 3C4FA 3LCKA 2XRWA 4KSQA 4CFNA 4I22A 3DJ7A 4X6QC 5K3YA 3NUYA 3T3VA 4P7EA 4CFWA 5HE2A 2QOKA 3KXXA 4CT1A 3CE3A 3ZC5A 2W96B 3FMKA 4FNXA 3DQWA 2F7ZE 4QQ5A 2VNYA 3D7TB 1OUYA 2P55A 2OW3A 3MSSA 1HCKA 3Q32A 4I5CA 4XH6A 4YC8A 4G5JA 4RIWB 3W2RA 5IEXA 3FC2A 3PA3A 4M67A 4DGOA 1W2CA 5HOAA 2W1HA 4MBIA 5F9EA 2PUIA 4GJ2A 5M53A 1TFFA 4O82A 3FZTA 2EU9A 3MB6A 1Q8UA 4K6ZA 4O22A 3GUBA 3PA5A 3FLSA 4O27B 4UV0A 4H39A 5CU3A 3BBWA 3VO3A 3ORXA 5IA2A 3EIDA 2I6LA 3RJCA 4RFMA 5CS6A 3G0EA 1X8BA 4C4EA 1Q8WA 1OBGA 2XANA 2ZOQA 4AZSA 2PVMA 2XKDA 3SW7A 4DTBA 4IH8A 3OCTA 3BYOA 5A54A 4DEAA 2YDKA 4O0WA 4FTRA 3NIZA 3EFWA 3GCVA 3KXNA 4JJRA 4DFXE 4IC8A 5DEYA 4BZOA 4TTHB 4FGBA 4RIYA 1G8SA 3DAKA 5M09A 2A1AB 2JC6A 4NTTA 4QP7A 4UEUA 1J7UA 1W2DA 1BI7A 3B2TA 5AAFA 4ZY5A 1FVTA 4EORA 4YNEA 5JGAA 4W4VA 1UV5A 4RFZA 1LPUA 5AUVA 2VN9A 4F6WA 2BPMA 4FV7A 1ZYLA 4AW0A 4D4YA 4LYNA 3RVGA 2G2HA 4B8MA 4F7LA 2HW7A 3U54A 4J52A 3EYHA 2R3OA 3F5XA 4AW5A 4EOIA 2CJMA 2F7XE 3VUGA 3ORIA 1JQHA 1PXKA 3NYOA 4IB5A 3TJDA 5CAPA 4NM0A 2XAMA 4JVGA 5H8BA 3M1SA 4E5BA 1JWHA 1H25A 3I0OA 2GS2A 4CGAA 4EK4A 2CNUA 5CU0A 3MWUA 4AGUA 4AQCA 4U5JA 2X8DA 4EK5A 5L6PA 3U6JA 3ZFMA 2XUUA 2G15A 5HTIA 4G3EA 4I4FA 5DT3A 2XB7A 2X39A 2R2PA 5CF6A 1ZMVA 4JQEA 3DT1A 5DOSA 2SRCA 3BHYA 2C6OA 4H1MA 3VBYA 5B2MA 3FEGA 4EI4A 3MH2A 4E1ZA 4A9RA 3NAXA 4YLLA 1ND4A 5AUXA 2I7QA 2Z7RA 3QFVA 4J95A 4YC6A 5D7VA 5FDXA 5FP6A 4AA4A 5BVFA 5KKRB 1ERKA 4CFVA 3HL7A 5LQFA 3K54A 3EJ1A 2PSQA 3PE2A 5HIDA 2GU8A 3VS5A 2OG8A 4XV9A 4FVRA 4MHAA 4ERWA 5M06A 2NPQA 2BAJA 5HG9A 2VTQA 4CCUA 3F88A 3IW7A 4C02A 5CEOA 4CG8A 2YIXA 4UBAA 1Q61A 3OW3A 4EH4A 4FIJA 2OKRA 4AG8A 3HAMA 2BZKB 5M44A 1U5RA 4G3DA 2XMYA 2OSCA 3KEXA 3T8OA 3SA0A 3C51A 1A9UA 4JBQA 2C6TA 4G6OA 4R5YA 3BHUA 5I9XA 2X9FA 3KRXA 2HY81 3LFEA 4IAKA 4O1OA 3NR9A 1OL1A 2ETRA 2WMTA 3O51A 3LFQA 4O4CA 4BWXA 2QONA 2VUWA 4GK2A 3LCOA 4MCVA 4RC2A 3ZXTA 4YR8A 5J5TA 3D9VA 3KKVA 4HVSA 1H1RA 3KULB 2YWVA 4UY9A 5KBRA 3ATSA 4PDYA 2IJMA 3LCTA 3RMFA 1Q8ZA 1VYWA 4NU1A 4U41A 5A9UA 5BMSA 4YBKA 5J7BA 5KBQA 4O0UA 1FOTA 3DB8A 2OIBA 2Z2WA 4HGTA 4IAZA 4FTCA 4P90A 4M68A 4DG3E 4XV2A 5DT4A 4F1MA 5IA1A 3ZO1A 4GS6A 2W99B 4O7NA 2XIZA 3AOXA 3BQCA 4TWCA 4D4RA 3RTPA 5JQ5A 3II5A 3IGOA 2YITA 4IDTA 3ZFXA 3UYTA 4HZRA 4G17A 2FSTX 4FK6A 1P4OA 1Q62A 4L00A 4QYFA 2CCIA 3JY9A 4IFCA 3R9DA 4GV1A 4WT6A 4H3BA 3BYMA 4F9CA 4ZZNA 3GFWA 3SX9A 2C1BA 4C62A 2YWPA 4GSBA 5ETCA 4IAIA 1J3HA 1G3NA 2UW8A 3OUNB 5E8SA 4ZEGA 3RNYA 3WF5A 4AXCA 3OG7A 2WKMA 5K0XA 2C5OA 5HLWA 2B4SB 4TL0A 5DRBA 2C68A 2J5FA 3PFQA 2WTCA 3I4BA 2ITNA 2BZJA 2PZPA 2JIVA 4MYGA 2XK6A 1U5QA 3UIBA 5KMJA 3MDYA 4NH1A 5JSMA 4TWPA 3KRRA 4EOJA 4K18A 1OECA 2GTNA 3IW8A 4ACHA 2ZM4A 3A2CA 4KUJA 2UZUE 3OFMA 2E2BA 3R00A 3D2IA 4XG4A 2Q0NA 2QLUA 5DLSA 3EQDA 3PXQA 5HLPA 3QGWA 4EOSA 4QTEA 2PUNA 2JKMA 3M42A 5CI6A 3O5AA 5A4LA 2XIKA 4GRBA 2BRNA 4YLKA 4D2PA 3VIDA 3HEGA 3FY0A 4G6NA 4ASEA 3ZUUA 3C4ZA 3TDVA 2W0JA 3R22A 4JDHA 1OZ1A 3VS0A 4DT9A 2ITXA 3UIUA 4EYMA 1YHWA 4E4NA 4GKIA 2PE2A 4C3FA 5FEEA 3PXFA 3UO4A 3QXOA 3VJNA 4QRCA 4OGRA 5LMKC 2EXCX 2UVZA 4G5PA 3CCNA 2YDJA 1OL7A 3QZHA 2ZM3A 1UKHA 3TV6A 4CYJA 5BYYA 4CV9A 5CU2A 1SYKA 5CU6A 2C0OA 4JDJA 4NUSA 4S34A 2FVDA 3C1XA 1G8KA 5HBEA 3G90X 4ALUA 2WQBA 4LFIA 2C5XA 2ZFYA 3VF9A 2HK5A 3RPOA 3FZRA 4MXCA 5CXHA 3C7QA 3EWHA 3HKOA 3K5VA 2OH0E 4QMZA 5H3QA 4XHKB 2XNMA 3U55A 3OOGA 2ESMA 2GPHA 3QUDA 1Q4LA 4MWIA 2RGPA 2VWXA 2YAKA 4WHZA 5JEBA 4R1VA 4JDIA 3NPCA 3ODYX 5HGIA 2W1ZA 1SVEA 5CSHA 5IISA 3UBDA 3U9CA 3RGFA 4UXLA 4F9BA 3DAEA 3F66A 2QU5A 1Q24A 1TZDA 4G3CA 1PXLA 4BDDA 2XNNA 3KN5A 4FTTA 4ZS4A 4IB3A 3LZBA 2AC5A 1GAGA 3TUBA 3FL4A 3QQJA 4KBKA 5AUYA 4ZIMA 3CKWA 3Q4CA 3G51A 4RPVA 3W33A 4ANSA 3W0MA 4DDGA 2R3GA 2QOHA 4Y5QA 3F2NA 3FXWA 3LXPA 2UZOA 4MQ2A 4QOXA 4C4GA 4BCKA 4AZVA 5BPYA 3SRVA 5HIEA 4KSPA 5KKRC 2H34A 2V5QA 2JKOA 4MXYA 4FTNA 4GCJA 5E8VA 2QOIA 2QQ7A 3ZMMA 2QI8A 3RI1A 1GZKA 4R7BA 1MP8A 2Y4IB 3FUPA 4JT3A 5EG3A 3UVQA 3MFSA 2R3FA 4EOLA 5HEZA 3W16A 5CAQA 4QMMA 5CEPA 4FTAA 1CKPA 2PPQA 4GFOA 4FSUA 4M0ZA 4B4LA 5L8KA 1PXOA 2CGVA 4RFYA 3EQPA 4FKTA 5AMNA 4EWHA 4RWIA 4F08A 2EWAA 5BVOA 5E8WA 1PXIA 3LIJA 3UP7A 4AS0A 3AC1A 4OBPA 4QMXA 1KE9A 4CMOA 2VTHA 1IA9A 3GB2A 3O96A 4OT5A 2J0MB 3TTJA 4BL1A 3E5AA 3E8DA 4I6QA 4L44A 2WEVA 4XV3A 2CPKE 3VBQA 4BDIA 4C34A 2GTMA 1MRUA 1ZXEA 2P0CA 2R3LA 4AE6A 3AC2A 3NIEA 2E9OA 4NL0A 1ZMUA 3ALNA 4I0TA 1OPKA 1PKDA 3HP5A 1J7LA 1BL7A 4FI1A 3GQIA 2RFSA 2JAVA 3ORPA 3R30A 2GMXA 1AGWA 3F2RA 2R3KA 3OWLA 1FVVA 4AN3A 5GIPE 1YWRA 4DHJA 2Q0BA 3O23A 3R04A 5LJJA 4J97A 4E6QA 2BRHA 3FQSA 4FKUA 4JOAA 3P08A 4O4EA 4U3YA 1VYZA 3RWQA 4ZLZA 2UW6A 5AX9A 2JIIA 4AZEA 4J7BA 4RVKA 5DR9A 4Y83A 3OUKA 5KHXA 3P9JA 1GIIA 3NNUA 4XLIA 2CSNA 3PVGA 4WG5A 5B7VA 2VX3A 3R21A 4CKIA 3DK3A 4UYAA 5GJGA 5KMNA 1R39A 4IXPA 3UPZA 4HJOA 1SM2A 4FJVA 4XG6A 3GU5A 5LVLA 4L7FA 5IQEA 4Z55A 3D0EA 3CLYA 4O0XA 2W4OA 2J6MA 2PL0A 2O63A 1NY3A 2OU7A 4HNIA 5AM7A 5KO1A 3F7WA 4R7HA 4LOQA 3TKIA 4RC4A 3KRWA 3LM5A 5CX9A 4RIYB 4MK0A 3UNKA 3RZFA 3QTWA 1QL6A 2ITQA 3T9IA 3SG8A 4K8AA 3JVSA 4LRMA 4MXXA 3VN9A 4FR4A 3FWQA 2WEIA 3UZRA 1Y8YA 2AUHA 2X7OA 4FT7A 3FL5A 4FNWA 5CZIA 4A06A 1ZYSA 4BBEA 3ZBXA 5M07A 3L9LA 2UZEA 2PK9A 5FTGA 4GT3A 4QP1A 1SNUA 4WNOA 2XNBA 4FSWA 4E6CA 3UTOA 4IWOA 3V8SA 4QMVA 2C30A 4IVAA 3WYXA 1CDKA 4ITHA 4K9YA 5AR2A 2ETKA 1PXNA 4RQVA 3MIAA 4X6RA 1DM2A 4LOPA 4CFMA 3UO5A 3KC3A 4BTFA 2KTYA 4X3FA 4D2TA 3F61A 1J1BA 3Q2MA 4E3CA 4W9XA 4HGLA 4S32A 5B2LA 3P7AA 3QGYA 3Q4TA 2GNHA 3D2KA 4MX9A 2X4FA 4RX5A 3SGCA 5HCYA 4U80A 3G5DA 2BRMA 2OJGA 3AT2A 3ULZA 2PULA 1GOLA 2HIWA 3VRYA 4F0IA 4XP0A 4CKJA 3PWYA 4M8TA 1UA2A 2G2IA 5FG8A 5DA3A 5E9EA 3QKKA 3V5PA 3IQ7A 4ACDA 5LCKA 3H3CA 1Z5MA 3NWWA 4BDCA 4C38A 4F7NA 4Q9ZA 5K5NA 2WMUA 3ZM4A 4WKQA 3LFCA 4FTUA 2IVTA 3IOPA 5DYJA 2OXXA 3WBLA 3ZLSA 3G6GA 5IMXA 2QURA 3FPMA 4M97A 4AAAA 5D9HA 5I3RA 5TE0A 4AF3A 3UNZA 2CHLA 4XG9A 4YJSA 3EQFA 3BCEA 4A4LA 5EQPA 1PJKA 3SOAA 5M57A 2IEWA 4HYIA 3GU4A 2Y9QA 2UVXA 2ZVAA 3PA4A 4FMQA 5I9WA 4IJPA 4ACCA 3LQ5A 2JDTA 3RPRA 3W2SA 3TUDA 5D10A 2OH4A 4EZ7A 5M08A 1WBWA 1M17A 4IZ7A 3TEIA 4EH9A 2CGXA 4CFXA 5CAVA 4DH5A 2WMWA 4J8NA 4HPTE 2XEYA 3BV3A 2OZOA 4FZAB 2PVJA 2ITVA 5JRSA 1PRYA 4JIKA 3LXLA 5CEIA 5KNJA 3A60A 2JGZA 4GUEA 4U6RA 5G1XA 2VX1A 3TV7A 4KS8A 5EQYA 3BPRA 4BKYA 3KREA 5DPVA 3D5UA 2W9ZB 3FZPA 3OWKA 1H01A 4DEHA 2XF0A 4JLCA 3ZLXA 4X7QA 4DBNA 1W2FA 3NFFB 5ETAA 1ST0A 1R1WA 5JFXA 1GNGA 5KMKA 2CNQA 1XQZA 2ITUA 1IA8A 4AP7A 3U6HA 4LV7A 4QP4A 5A4EA 4H36A 5CQWA 2R3HA 4FTMA 4MF0A 2IN6A 4ERKA 3ODZX 4BIDA 2RL5A 3M11A 3BRBA 4J1RA 3PG1A 4MNEB 4J53A 3QD2B 4FKLA 5J79A 2FSOX 3HP2A 5CQUA 3EQGA 2QO2A 3QTUA 2P4IA 3P7BA 5IUHA 3DTCA 3NS9A 4GFGA 3VS6A 4EL9A 4NCTA 3W0RA 4EH8A 2QG7A 4DH3A 2V22A 3RM7A 1K9AA 4QMPA 4BN1A 4M3QA 4QMWA 4BYJA 2VTLA 3GU6A 3LFAA 2OXYA 4O6EA 3DS6A 3LW0A 2F57A 2VU3A 3PY0A 3U51A 2Z02A 4X2GA 4EJ7A 2XKEA 2OJIA 3KF7A 3RK9A 4DN5A 1JSUA 3HV7A 3MBLA 3ORTA 5I9ZA 4GH2A 4FYOA 4B99A 3SDJA 3VQHA 4N4SA 5BNJA 4A9TA 1K2PA 4FT5A 5C8MA 3TXOA 4EC8A 2EB2A 2R3QA 2YIRA 4J99A 3MTLA 3EMGA 4WSYA 2B9HA 3SVVA 3CXWA 4D2RA 2WMRA 3VJOA 4OTPA 3L1SA 3QA8A 3QRIA 4NIFB 3E7VA 2YHVA 4BHNA 4EH2A 5BVWA 3UGCA 4S33A 3Q5IA 4YJOA 4F64A 4BI2A 1FBNA 3F3ZA 1KOAA 3PVBA 5CALA 4OBOA 3MY0A 4BBMA 2GNFA 2JDVA 3SV0A 4CRLA 2J5EA 4AXDA 1Y6AA 3E93A 2VO0A 2GFCA