3V5LA

Crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 542
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
240
Chain Sequence
GSVIDPSELTFVQEIGSGGLVHLGYWLNKDKVAIKTIMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystallographic structure-based design of selective thienopyrazole inhibitors for interleukin-2-inducible tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 75
structure length 240
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v5lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v5lA01
4JBQA 4E6AA 4PY1A 3IK3A 4X2GA 4DCAA 4IVAA 4FMQA 4LGHA 1RE8A 3UPZA 4L7SA 1UWHA 3FJQE 3W1FA 5IA1A 4BR3A 3PXZA 1JBPE 5CYIA 2WGJA 4AZTA 3F3UA 2WQEA 3E7OA 2Y4IC 4DH3A 1MRYA 2J5EA 3GC8A 4NT4A 2ITZA 2X8EA 3V5LA 3LM5A 4J1RA 5B2KA 3HAMA 4RVTA 4CG9A 4FSUA 2UZWE 3S95A 3KK8A 3VBQA 5J7HA 4F08A 1YXSA 3BCEA 3RPVA 4B8MA 3M42A 4BICA 3DDPA 2JLDA 3P9JA 3II5A 4ASXA 3IGGA 5DOSA 3P5KA 1OGUA 3VUKA 5EM5A 5M57A 4ZTRA 3QXOA 3QGYA 3U9NA 3Q2JA 2YITA 4CKIA 5IEXA 3FL5A 3PSDA 2JIVA 3ZEPA 3IPHA 3GU7A 4HYIA 5IF1A 5JRQA 2WMVA 5ACBC 3ORTA 3I60A 4U79A 2JAVA 5LWNA 5M55A 5JZNA 4F9CA 4TYHB 4KIKA 3DXPA 4H1JA 3DLZA 4UWCA 4ACDA 5HX8A 3R7GA 3IG7A 5HE1A 4O86A 3GGFA 4KBCA 3UP7A 3WF7A 4EYMA 4D4VA 2C68A 2BFXA 4C35A 4JIKA 3IS5A 4E26A 2IZUA 5H9BA 5C1QB 3F3ZA 3OCGA 3KMUA 1U59A 3VQUA 4XG9A 4QMWA 4RIOA 4ZY4A 1ZXEA 2REIA 3OWLA 3EYHA 4WBBB 4M84A 3ZZEA 3F2RA 2KULA 3I5NA 2X1NA 4X2JA 3R8VA 5FTQA 3E5AA 4Z7GA 4O7WA 3R8UA 2J6MA 3U4WA 1JKKA 4B0GA 2YA9A 3PJ8A 4ALUA 4A4LA 3EQGA 4FR4A 3ZXZA 5BYYA 3E8EA 4LM5A 3TNQB 4OAUC 4DGGA 2X6EA 3QTIA 3EQIA 3NUNA 3TIZA 2XRUA 4BBFA 4EK3A 1V0BA 2IZSA 3HAVA 3MV5A 3PUPA 3QQJA 4JRNA 2OFVA 3VAPA 2C6OA 4RFYA 4FVRA 4BHNA 1WBVA 5F20A 4A4OA 3OC1A 5CAOA 4GT4A 2YM4A 3LFFA 3BE2A 4EH6A 4GKHA 3FY0A 2CGXA 5AV0A 4L9IA 5M4CA 5I3OA 3LFEA 3D9VA 5IZFA 1BL6A 2GFSA 2PVYA 4QTCA 4QQTA 4YTIA 4ALVA 3TDWA 5E90A 4NKAA 1TQMA 4EONA 4G3FA 2X8IA 4NM5A 5AJQA 3QALE 5IMXA 5JGBA 2CKQA 5AA9A 5EI6A 1U54B 4RG0A 5EYKA 2G2IA 2XF0A 2XP2A 3SOAA 4JDJA 4EL9A 4W8EA 2VTHA 5EW8A 1YWNA 1J1CA 2J0MB 1PF8A 3QAME 2GNFA 3P7AA 4MWIA 5JH6A 3GBZA 4ENXA 3NCZA 4GG7A 5AV2A 4S30A 5DRBA 5AAGA 1DI8A 2W1ZA 2XJ0A 4LYNA 4CFNA 4JG7A 4BTFA 1PYEA 5C26A 4DFUA 4IWOA 2BTRA 3NYNA 4R5SA 5I9VA 5KMMA 1CM8A 2ZB0A 2WFYA 4IB3A 3ZONA 4IWDA 2E9UA 5AR7A 2H8HA 4DT9A 2A27A 5F95A 4NJDA 4AU8A 1F5QA 2OH4A 3NMUF 3K54A 3NNWA 1J7LA 2OK1A 1OZ1A 3LXKA 2YZAA 3Q6WA 3PVBA 4JBVA 4MK0A 4KABA 4PTCA 1B38A 2FO0A 4WRGA 4PF4A 1GZNA 1SZMA 3UODA 2O63A 4XV9A 4DGNA 3NW6A 3R6XA 1VJYA 2VWUA 2FVDA 4G6NA 5KMKA 2EXMA 2P4IA 3LZBA 4DEHA 1UV5A 3R1YA 1R0PA 3PIZA 3MJ2A 4QMVA 4AFEA 4H3BA 3TNHA 4EK8A 3BV2A 1PXNA 4BDKA 4FOBA 4JI9A 3NNUA 4MXXA 4JJRA 4DGOA 2R3OA 1R0EA 3IDBA 2FH9A 2XBAA 3QQLA 5AAEA 4TYEA 2PZ5A 3QTZA 4DH5A 3GCUA 2F2CB 3KKVA 3PSCA 5J87A 4AQCA 1M7NA 4FTIA 3PA3A 4XV1A 2W7XA 4NU1A 3PTGA 3ZSGA 4C59A 3TN8A 2VTMA 4QP4A 2QG5A 4G34A 1PXIA 3VC4A 3VRZA 4L45A 5IEVA 2CLXA 1EH4A 5E8WA 4XG2A 4FG9A 4WA9A 3NVKI 2FA2A 2GU8A 3MVJA 4DH1A 4O84A 4XCUA 4HCTA 3O7LD 3FKNA 5CZHA 5F9EA 3VBWA 4R1VA 3ELJA 5I9YA 1H1WA 2YLEA 2FSLX 5CVFA 4BKYA 4NM3A 4F65A 5I4NA 3TDVA 1ZMVA 1SM2A 5K4JA 4XBUA 3NGAA 4CD0A 3QKKA 4LGGA 2XA4A 5HI2A 1XH7A 2QU5A 3D4QA 1X8BA 3ZUVA 4FKRA 4X6RA 3FMDA 1R1WA 3DBQA 3LOKA 5KZIA 3D5WA 3EH9A 3QCQA 1VR2A 4DG0E 4JT3A 4CCUA 4YMJA 3P4KA 3WZJA 3FMHA 4QYGA 4RIYA 3UIUA 2X8DA 3FKLA 5LMAA 4DLIA 4BI1A 1RQQA 3QZHA 5AIRA 5TT7A 4BCFA 5DR2A 4GEOA 3CS9A 5HLWA 2GSFA 5AUTA 4CSVA 2VWWA 1GY3A 2P0CA 3NUPA 3TWJA 5I9WA 3R9OA 3C5UA 3PJ3A 3RALA 1ZRZA 2DQ7X 3W33A 5D9HA 3MFRA 5CLPA 2WELA 3RBWA 4ARKA 4O82A 4XH6A 3AC5A 3LHJA 2CGUA 3KN5A 3BU5A 3VS2A 4RBLA 5FM2A 3BIZA 3QD3A 3D5VA 3QHRA 1O6LA 3OT8A 3QWJA 3O2MA 3ORNA 3OVVA 4C61A 3BGZA 1AD5A 4IANA 3CC6A 3VS5A 5E8VA 4BCIA 4FKUA 4E73A 3MBLA 3KN6A 4F99A 4RT7A 5HIDA 1JSUA 1E1XA 4BYIA 3EZVA 4QMTA 2PU8A 4EK5A 4PTGA 3ZEWA 2PZYA 4E6DA 4GFGA 4W9XA 1F3MC 1V0OA 1O6YA 4H3QA 1WVXA 4LRKA 4QPSA 2VGOA 5DGZA 5EK7A 2CNUA 1UNHA 3FMJA 2X39A 5D11A 4TTHB 2ZAZA 5GINE 5AR4A 4LV5A 4CMUA 3C5IA 5IDNA 5HD4A 4IB1A 1PXLA 5CEIA 4D2SA 3JY0A 2C6IA 2J9MA 3ACKA 2IW9A 3L8VA 4WUNA 2DS1A 3UO6A 4NUSA 3OBJA 4R3CA 3QQUA 3Q3BA 3DS6A 2QOCA 4CMOA 4JQEA 4IVBA 4I5CA 3CTHA 2X2MA 5HQ0A 4WSQA 4A9RA 3FBVA 4FSMA 2X2LA 4G5JA 4DC2A 3UPXA 4IC7A 4QO9A 4CQGA 4D9UA 3OP5A 1OUKA 1FVVA 4F6SA 5JFXA 4LQMA 3R21A 4BCPA 3EQRA 3RVGA 2VV9A 3BYMA 5I5ZA 4EOIA 1MRVA 1I44A 2HK5A 2E9PA 3BBWA 4PUZA 2FGIA 3Q9ZA 3FMLA 3OW3A 4G16A 1YXVA 4PX6A 4CXAA 2R0UA 3DA6A 5J5TA 1WFCA 2CJMA 3LXLA 3DXQA 4IAIA 4HVIA 4MEDA 3NUXA 4EH9A 3ORMA 4YBKA 4AAAA 4BCJA 4JRVA 2UUEA 1U46A 4PPAA 2G9XA 2W99B 4X0MA 5LXMA 3R8LA 4J95A 4DYMA 5KBQA 3QD4A 4FTOA 2OW3A 5BMSA 4A7CA 3KULB 3QX2A 5I9XA 2UZUE 4W4WA 3QLFA 4A07A 2R2PA 4CTBA 4PTEA 5CNNA 4O7YA 2XM8A 3QQHA 4QMUA 2R3KA 1FMKA 3E64A 3LLTA 3RTPA 2EXEA 4RJ8A 5GJFA 4ANNA 3IW8A 3MH2A 3D7TA 3QUEA 4ZSEA 5FXRA 2QOLA 4KWPA 5LQFA 2EU9A 2P3GX 3CIKA 4IEBA 4FKSA 3UG1A 2Y4IB 3VUIA 3Q60A 1Q4LA 5EH0A 4RIXA 3RI1A 4M7IA 5J9ZA 2XNGA 4AS0A 1Y91A 3L9LA 3P23A 5HVJA 2HW7A 3VW6A 4PNKA 4O1OA 1TVOA 1ZZLA 2W4OA 3B8RA 3HX4A 2FB8A 3O96A 4QQ5A 2J0KA 2BAQA 4CRSA 4C4FA 4EORA 4ZLYA 3R8ZA 2XK6A 1ZOGA 2HZ0A 2Y6MA 4IH8A 4MXCA 5LCKA 2AC5A 2OZAB 3DT1A 5CAPA 2XNOA 3RK5A 1A9UA 2G01A 3QUDA 3UNKA 3D2IA 3PG1A 4GK2A 4OTFA 2P33A 4FV6A 4AT4A 5CU0A 1I09A 5JEBA 3MDYA 2FSOX 3E87A 3WIKA 3KXGA 4EUTA 4XP2A 1V0PA 4YJQA 5FLFA 4FODA 2YFXA 2C1BA 3BHVA 3S3IA 4O91A 2RL5A 2YM7A 4LV8A 4L67A 3RKBA 1KE9A 2Z7LA 3OCBA 4M15A 1H0VA 2BAJA 4Y5QA 3UJGA 1H1PA 2GS2A 4MXAA 2WHBA 2GS6A 4AGCA 4L01A 4PMSA 2BUJA 2JBPA 5KHXA 1KV1A 4G1WA 2QR7A 2WMQA 3WF9A 2OZOA 2ZOQA 3O23A 2YACA 4UMTA 2Q0NA 3NIEA 3EYGA 1K3AA 4NH1A 2WPAA 3FE3A 2UV2A 4QMZA 4U42A 3W16A 3H9RA 2QKRA 2GMXA 2VO3A 3DJ5A 3QRJA 4M8TA 4RX7A 3RK7A 1YXTA 1PRYA 4YZDA 3NCGA 2CGWA 1W98A 4EOPA 5GNKA 4L53A 4USFA 4UMQA 5AA8A 1MRUA 2FSTX 4H58A 4QTAA 1WZYA 4FL3A 4GVAA 1JNKA 3TXOA 4O0XA 1UNGA 5L2TA 4IJ9A 2C69A 3ZZWA 4BIDA 2VX1A 3R1SA 4F7NA 3MN3A 3V01A 5E8ZA 5HU3A 1KV2A 4YPSA 3A60A 5JSMA 1Y6AA 3HRCA 1Q24A 2C5NA 4X6QC 3MTLA 1KOBA 4A9SA 4D0WA 4R6VA 3OZ6A 4XLIA 5E8YA 2VO0A 4HPUE 1K9AA 5HE2A 4QYYA 2R3GA 4P2KA 5ITAA 2V62A 4YC8A 3NW5A 2WTKB 5KE0A 5T68A 4NFNA 4MTAA 2XUUA 4QMLA 1YXXA 2X7FA 3ZXTA 3OXZA 2ZM1A 1T46A 4ID7A 4IX6A 1WBTA 2EVAA 3TJCA 4BKZA 1W84A 3DLSA 4TRLA 3MIAA 3SX9A 1OI9A 1OL1A 1Q62A 3K2LA 2WEIA 3NRMA 3RGFA 3ZSHA 2VU3A 5CWZA 1Q8UA 5CAVA 4ZMEA 2YIQA 2OH0E 2J5FA 1URCA 4PPBA 3MGYA 3GOPA 4LRJA 3D5XA 3KF7A 4TZRA 5BUIA 1JPAA 2BR1A 3HMIA 4MXYA 2OIBA 5DHJA 5EYMA 3VBYA 4ALWA 3ALNA 3R2YA 2OO8X 3DAKA 1WCCA 3EFJA 3VW8A 4M14A 5L8LA 3P1AA 5E92A 4MAOA 4UMRA 4RLKA 1OIYA 3ZO3A 2GS7A 5B2LA 3PZHA 4IVCA 4LOOA 3FZ1A 4GJ3A 4EZ7A 4F70A 3RWQA 3A8XA 4E6CA 3K3JA 4TYIA 4ZS0A 2B7AA 3QZFA 4QPMA 2WOUA 5IQIA 2Y4PA 5JK3A 3COMA 2VD5A 2XJ1A 2QLUA 4OTDA 4FV9A 4O0WA 4YUQA 5M51A 4ZAUA 3BQRA 3RCJA 3HKOA 1BI7A 2BPMA 4RIWA 5EW3A 4ZSAA 3I0QA 1IR3A 3K5VA 3FI4A 3Q53A 3ORKA 2HOGA 1Q3WA 5CX9A 1PMEA 3H10A 4O0YA 4TWNA 4NCTA 3V6RA 2Y9QA 3DAJA 4F9BA 4R78A 4EHVA 2C6KA 5IDPA 3NR9A 1OB3A 4DFBA 4ZS4A 3VN9A 4JG6A 3V5TA 3QQGA 2R3LA 4S2ZA 3W2SA 3REPA 4MBJA 3DFCB 5EDRA 4ZK5A 4ZMFA 2XYNA 2YIRA 4BCHA 2QO2A 5IH4A 1GZOA 2PE0A 4L43A 3D94A 1VYZA 3G5DA 2HWPA 5FWKK 3BYUA 3LMGA 4CLIA 3AC2A 5EOLA 5IQEA 2PK9A 3KF4A 4IW0A 3TM0A 4FTMA 4BWXA 5HHWA 1PY5A 3FSFA 4EH5A 3IW4A 3R2BA 4BCGA 4GCJA 4PMTA 3R7YA 2OXDA 3A7FA 2VWBA 3DU8A 3GP0A 4WG4A 5D12A 1MUOA 3LPBA 4D2WA 1CSNA 4AF3A 3Q5IA 2V22A 4C36A 5BQ0A 4IJPA 1UVRA 4G3EA 4I41A 4OTHA 5ETAA 3U4UA 5LVLA 5CY3A 2HIWA 3BGPA 2OGVA 3OS3A 4OGRA 4FV0A 3N4VA 4FKOA 4E4LA 1H00A 5F94A 1OPLA 4FI1A 4M12A 5B2MA 4ACHA 3OTVA 3QD0A 5IA0A 5K0XA 4BRXA 4G9RA 3QC4A 4UZHA 3FI3A 1Q97A 2BROA 1QPDA 3UZTA 4AW5A 4NEUA 4TWCA 3RAKA 4D28A 4IWPA 3PG3A 4FIHA 3ZBFA 4DFZE 3W10A 4WG3A 3W55A 2WXVA 3GUBA 1O6KA 4BBMA 4YO6A 2WTCA 4RZVA 4JBOA 4AA0A 3D7ZA 3THBA 3QQKA 5CXZA 3NZ0A 3VHKA 4EWQA 3G9LX 4RIXB 4QP6A 1W0XC 4N4SA 4YC3A 2YJRA 2BCJA 4JL9A 4ZTSA 5LMKC 3TCPA 5LVPA 4YBJA 3RHXA 2CKPA 2JKMA 1CKPA 2R0IA 4IZYA 2PVRA 2PMIA 5C8MA 3ULIA 5DT4A 3TUDA 2BZIB 5CAUA 3I6WA 2ZM3A 4QT1A 2GHMA 4Z55A 2KTYA 2W1HA 5IG1A 5A6NA 1HCKA 3L9MA 5D7VA 1U4DA 3TI1A 3LFCA 3R30A 3EL8A 4M67A 3QFVA 2VWIA 5KCVA 2Z2WA 4MF1A 4TPTA 3ZTXA 2R7IA 4IDVA 4U40A 4B7TA 4E20A 4N6ZA 3MY1A 4KAOA 4FNYA 4QTDA 5BYLA 1IAHA 4MQ2A 2B9IA 4FNWA 3PDTA 3OEZA 2YIWA 3AGMA 4C37A 2P2IA 4MKCA 4K33A 2OSCA 2UW0A 4L44A 4ANSA 2XYUA 3NVMB 5EQYA 4FIJA 2GNJA 4NW6A 4PQNA 1ZZ2A 3CY2A 3D83A 5L2IA 4GW8A 4P5QA 4K0YA 2WEVA 2F7ZE 1ZLTA 2JIUA 5AP4A 2JDTA 3CY3A 3IOPA 2XH5A 3SXRA 5AFVA 5DH3A 2ERZE 3I5ZA 4JIAA 3GFEA 2RSVA 1CDKA 2OKRA 5K5NA 1Y57A 3UIXA 2WTVA 4WKQA 1OKVA 3KY2A 2B9HA 4U41A 4NKSA 4BB4A 4IVDA 5CANA 3NUAA 2WMSA 4HW7A 3CKWA 2C0OA 4DTBA 1RJBA 2O8YA 3ETAA 3NLBA 1ZWSA 2GNIA 5CU4A 4XJ0A 3VBXA 4AWIA 3KMWA 2RIOA 3CD3A 3QBNA 1YHVA 4O27B 2IW6A 4RJ3A 5I0BA 4I92A 4FE2A 4E5WA 3UP2A 4ENYA 4FT3A 4OBQA 4QRCA 4E1ZA 5CEMA 4L52A 3QYZA 5EM7A 2VGPA 4Y46A 3UNJA 4E4XA 3G6GA 5DPVA 2VX0A 3FZPA 4WUAA 1OKYA 4DG3E 2B54A 5BVEA 2XKEA 4AN9A 5EDPA 3SA0A 3EB0A 1OL2A 3EJ1A 4DITA 3A2CA 4RX8A 5DR6A 3Q4TA 3G0EA 4AZVA 4PV0A 3FKOA 5TR6A 3ZDUA 5ANGA 5HCZA 2B1PA 5CF5A 3PP1A 4ZSGA 4RWKA 4P7EA 1QPEA 1BL7A 3V8SA 4BIBA 4DFLA 3PJCA 5JKGA 4LOPA 2B0QA 4QMNA 4RWLA 3LFSA 5LOHA 4UYAA 3GEQA 2UW3A 3UVPA 5JQ8A 5M4FA 5ANJA 4BKJA 4CV9A 3QCYA 2X6DA 4J71A 2F49A 4IM0A 3WOWA 4BGHA 3G0FA 4TWOA 4AW2A 3A7IA 3Q6UA 5IMEA 2XIRA 1H4LA 5CENA 1OITA 2ITOA 3QUPA 5LMBA 4J96A 3BU6A 3FXZA 4CQEA 2ZMDA 4X21A 3OT3A 3BEGA 3FEGA 4O7VA 4KBAA 5D1JA 2XNMA 3AC4A 3V04A 2Y0AA 4YJVA 4AOIA 3POZA 4N70A 3EQBA 4I20A 4YLLA 3PE2A 3QCSA 2F7EE 3ERKA 1YOMA 2R3HA 3SD0A 5DVRA 4PL5A 3RHKA 2Y8OA 4EJNA 3HV7A 3DBEA 1IA8A 2ETMA 3H3CA 2PVJA 3R7UA 4ANBA 2WNTA 4XOYA 3GVUA 2ITUA 4HPTE 5HE3A 5HTCA 3LMIA 3MA6A 4FTKA 3NNVA 1XH5A 3SAYA 5EM8A 1Q41A 3N4TA 3AOXA 1KWPA 3F69A 1JWHA 2RG6A 4C4JA 2W1GA 1FBNA 3MFSA 5CSPA 4PDOA 2VRXA 4L68A 3ALOA 4YNOA 4G31A 2WB8A 4AZFA 2X4FA 4TY1A 5EI8A 5IEYA 3UO5A 3FSKA 4YHTA 3P7BA 4UEUA 4IACA 3B8QA 3O50A 3MFUA 5C8KA 3RNIA 4R7BA 3DNEA 3EIDA 4F4PA 3QCXA 5L8JA 4JVGA 1W82A 3FZOA 3IDCA 3KGAA 5HCYA 5LARA 4Z3VA 3QRIA 2ZV8A 2BTSA 2F4JA 4OTGA 1H27A 3U9CA 3VUGA 5KBRA 3C13A 4RQVA 3IQ7A 3JVRA 3HA8A 4FK6A 4HNIA 4MQ1A 3GC9A 4E7WA 3U6IA 4PDSA 2YIXA 4XBRA 5BNJA 5CF8A 5ETCA 3UG2A 1ZOEA 3MB7A 4AP7A 5T3QA 4FZAB 5H2UA 5AP6A 4C34A 3EFWA 5CASA 3DKFA 3OF0A 4W8DA 5HU9A 2HENA 2ITXA 4RVLA 4R3RA 4C02A 4WIHA 2BIKB 4FF8A 4IX5A 5M44A 2C6DA 5CEOA 2OI4X 1GIHA 3UIBA 3AMYA 2JKKA 1OL5A 4QQCA 3OTUA 2QOKA 2ZVAA 3CBLA 4QP3A 2YEXA 4XP0A 2W06A 3GT8A 2BMCA 3F3TA 4IZ5A 4F09A 2YDKA 3RJCA 4E4NA 4YZNA 2X9FA 3ZRMA 3ZFMA 4YP8A 4M68A 2ITWA 1XH4A 1W83A 3EQHA 3MTFA 3M1SA 4IB5A 1LEZA 3Q4CA 5AUYA 5GIPE 3TV6A 2BZJA 5HX6A 1WBPA 5CEQA 3E3PA 3RM6A 4IHPA 2WMRA 3ZRLA 4EOSA 5FRIA 2Z60A 3QGWA 5BVWA 2BVAA 3MH0A 3P79A 5IQGA 3DAEA 5M4IA 3PWYA 1H01A 1KE7A 4BZOA 5DE2A 3ZUUA 3TNPC 4ZLZA 5L6OA 4FVPA 4LUDA 1Q3DA 4UZDA 2C3LA 1OUYA 4FL2A 4A06A 2I7QA 3F82A 1JSVA 1OIQA 4IMYA 3GC0A 3MH3A 2JAMA 5CXHA 1OPKA 1Q5KA 1ZYSA 3WE4A 2UW8A 4UYNA 4V01A 5HBJA 3UO4A 1VZOA 1XQZA 2VWYA 3DOGA 4GMYA 3SDJA 3QC9A 1SYKA 4O0RA 1IG1A 2XCKA 1FQ1B 4ACCA 3VS6A 3U6HA 3LM0A 5HO7A 1PJKA 2W17A 3AD6A 2X81A 1PXMA 2A0CX 5FQDC 4CG8A 4FKIA 3BLRA 2XKFA 2AC3A 2BDFA 5LCJA 4J99A 3EN7A 2XNBA 3F3VA 2OWBA 3UOLA 4O7ZA 3UZRA 2PZRA 5HCXA 3KXNA 1P4FA 4JX3A 4YJUA 4AE9A 2OBJA 3EFLA 4K18A 5L2WA 4U7ZA 4FSNA 1JKSA 3FQHA 1V1KA 4TNBA 4ANMA 1IEPA 4EK6A 4Q2AA 5E1EA 2NNWB 4RWIA 3UMXA 1CKIA 3U87A 3HMNA 4XV2A 4NIFB 5KNJA 4CYIA 4I6HA 4QTEA 4QYHA 4AZSA 4AA5A 2J4ZA 4XNEA 3AG9A 3FLSA 3R04A 2NRYA 5D41A 3E88A 3KRWA 4I94A 4DFXE 5LWMA 3BE9A 3NYOA 4U81A 5AP2A 4RA5A 4DCEA 4IZ7A 2XIZA 3HV6A 2JGZA 4NYEA 3UOKA 4TNDA 3BHUA 3PXQA 5K0KA 4U9AA 5HORA 5CAQA 3V8WA 4EEVA 4I4EA 2BRGA 2PL0A 4M3QA 4E5AX 5E8XA 4YTCA 2GQSA 1Y8YA 3R1NA 4JS8A 2BRBA 5DLSA 4YTFA 3V51A 3EN9A 3IECA 2DWBA 5TOZA 4QP7A 1QMZA 4BCMA 5JMSA 1YI4A 1GIIA 3RCDA 3SVVA 4FKJA 1ND4A 3VIDA 3S00A 3OMVA 5HNIX 4R3PA 3H0YA 4FV7A 4UY9A 4MHAA 2R9SA 2IVTA 4EQUA 2WO6A 3OEFX 2X7GA 3AGLA 4V05A 4FNXA 3WZDA 4PL4A 2UW5A 4CFUA 4JNWA 4DGMA 4ZJVA 4K6ZA 4F7JA 4BL1A 4L3LA 4BWKA 3U55A 3BYOA 5C4LA 5LVNA 1MQBA 1H25A 3KXHA 3PYYA 4CFVA 3D14A 4KBKA 1K2PA 3N51A 4P90A 4XG8A 4IAYA 1H08A 4USEA 3W2PA 2CSNA 1AGWA 3GU8A 5AR3A 4ANQA 4QMPA 4F9WA 4H1MA 2QOIA 4DTKA 3ULZA 1IAJA 2YM3A 4B8LA 4CKRA 5IISA 4GH2A 4XG3A 5FD2A 3LW0A 3I79A 2PTKA 4MNEB 5KX8A 3ZO2A 2ITYA 2ITQA 4D9TA 4ASDA 1DI9A 5CF4A 1S9IA 3BHTA 4MBLA 4U97A 5HVKA 2C5VA 1ZY4A 2JDVA 1BYGA 2J51A 3KVXA 3PXYA 3KC3A 4ZZMA 3VJNA 4FTCA 4G3DA 1WAKA 4KIKB 2R3IA 2J90A 3IKAA 5EKNA 2X7OA 4JXFA 4N0SA 4D0XA 4PL3A 3AMAA 2WU6A 1CMKE 3H9OA 3BPRA 3C4WA 3RPOA 4Q5HA 4UMPA 1Z57A 1RW8A 3H4JA 5J9LA 4FEVA 3VS4A 1XH8A 1W8CA 5L2SA 5JGAA 4E93A 4MD9E 3PWDA 4DE4A 3SG8A 1H07A 5DEWA 5HG5A 4UWYA 4E3CA 4KS7A 4YR8A 2ITTA 3DK7A 1XWSA 1JVPP 4ZZNA 2HXLA 4D2TA 3CEKA 1PXPA 2JDOA 2W1FA 4LGDA 3KEXA 4OTRA 3QQFA 3HP2A 2HELA 3NAYA 3AC1A 2BZHB 2GPHA 5M08A 2R3PA 4OT6A 3MESA 2RF9A 5DWRA 1DS5A 4O6LA 3E63A 3E8NA 4I0RA 4PNIA 3HV4A 3LAUA 1JSTA 4LL0A 2EUFB 3NUSA 1W7HA 2B9JA 4IAZA 4RRVA 3LCOA 4KSPA 1OECA 4F6UA 3LFNA 4J53A 2JIIA 2XBJA 4S31A 2GFCA 2PMNX 2OJIA 2SRCA 3HRBA 5CU3A 3F2NA 5HOAA 1HOWA 1E9HA 4BCOA 5M09A 2OF2A 2C3IB 4C0TA 4C4GA 3ZO1A 3ROCA 3EMGA 4FKQA 3W2RA 3AD5A 3E8CA 3MW1A 4DEIA 2YLFA 5JGDA 3KREA 5EHLA 1RDQE 3EN4A 3H30A 4FTJA 4EI4A 4DEDA 4H05A 3L8XA 4KKEA 2UW9A 3C4ZA 4ANLA 3MVHA 4O6EA 1E1VA 4UALA 3EQFA 2W1EA 4FVQA 1H0WA 2PE2A 4GSBA 5HTBA 3Q5ZA 3N4UA 2C6MA 4FG8A 2F7XE 2CHLA 4RPVA 5AX3A 5T6KA 3JR1A 3CLYA 2ETKA 5FEEA 3VRYA 5A4QA 4DH8A 3S1HA 1ZAOA 1FINA 1R78A 4Y85A 1KOAA 4CKJA 3ZUTA 1OL6A 2QVSE 3I7CA 2PMLX 4JLCA 4E8AA 2GTMA 3LFBA 3UE4A 3KXXA 1PMNA 2A2AA 1XR1A 1BUHA 2R64A 3HV3A 3AD4A 4YURA 3GFWA 4F1MA 2HXQA 4YHJA 3TTIA 4EOQA 1JKLA 1WVYA 1PKDA 3C1XA 4YC6A 2VO6A 4GYGA 4N6YA 3RWPA 3NUYA 2C5OA 4GYIA 5M06A 2VTAA 5AMNA 4A4XA 3KQ7A 3KULA 4FEUA 4CRLA 4QQJA 5DT0A 5CVHA 5DT3A 4YU2A 1M17A 4OTPA 2QO7A 4L6QA 3H0ZA 4YNEA 5EQEA 2VWXA 4DH7A 3R7OA 2W4JA 3F7WA 5IQCA 4W4XA 1Q8ZA 4D4SA 3RNYA 3EN6A 3RK9A 3EQPA 3ORZA 2QC6A 4S34A 5AP5A 4BTKA 5AUXA 5HESA 2OJFE 5AUVA 3UVQA 2YCQA 1YQJA 1U5RA 5AP3A 3CSVA 4RA4A 3C4FA 1GZ8A 3QXPA 4EBWA 5IQFA 3A61A 5K5XA 1UU8A 4BCQA 3SW7A 3AT4A 4Y83A 1ZYCA 4F1TA 1O9UA 1ZMWA 3UZPA 4QPAA 5C03A 2PVMA 3VULA 4EOLA 4WSYA 3FXWA 3ZM9A 4OTWA 2XKDA 5FM3A 1ZYDA 4ANOA 5L4QA 4QNYA 2R5TA 3FPMA 4DBXA 2UVZA 1MQ4A 5CNOA 1FVTA 4HZSA 4BDFA 5HBEA 2HYYA 2XKCA 1PMUA 2B9FA 3V5PA 5BVOA 3OXIA 3LFAA 3CCNA 1WBWA 3UGCA 3CD8A 4W4VA 2G15A 2GDOA 5F4NA 4YJSA 4U44A 1PHKA 4ZXTA 3VHEA 4C4EA 1UU7A 2R3FA 2CMWA 2CN8A 2VWVA 4BCNA 4N57A 3ZLYA 1ZY5A 2WTDA 2HAKA 4QMYA 1NXKA 2XM9A 1M14A 3FMKA 5FEQA 2AUHA 4ZTNA 4C57A 3GOKA 3R9HA 2YDJA 4EH8A 4FZ6A 4MVFA 3GI3A 2J2IB 1PXKA 4O0TA 3LJ2A 3QZGA 2WMUA 4M69B 3MWUA 4MWHA 4RX9A 2RFDA 4BDDA 3GXLA 2RGPA 5CSWA 5M56A 5A14A 4UX9A 4IE9A 3WF5A 3HECA 1ERKA 3PLSA 3G33A 2Z7RA 1PW2A 5CT0A 1NW1A 4FG7A 5JT2A 1KE6A 4C2VA 1SMHA 4EHGA 1G5SA 3PA4A 4L7FA 4O0VA 4EOOA 4YJPA 2V55A 4QYEA 4C3FA 3MPMA 3RPSA 2HWOA 4O2ZA 3ZLXA 2OJ9A 4UBAA 2BHEA 2WMBA 3FLQA 4DLJA 1KUTA 2IG7A 2I0HA 4FV5A 4FZ7A 4YJNA 4F6WA 4J52A 5DNRA 2ZV7A 2BIYA 4DF3A 4E5BA 4FEWA 2QHMA 4ZY5A 1OM1A 5AX9A 3UMWA 2W1CA 5DEYA 4AW0A 4U3YA 4FKWA 3DPKA 3I7BA 5AUWA 2J50A 3ZS5A 4MF0A 2B4SB 3QD2B 4BY9E 2UW7A 3MFTA 1SNUA 3R73A 5CZIA 3CQWA 4LG4A 3F61A 3WARA 4IX4A 3ID6C 4GRBA 3CTJA 5GJGA 3VUDA 3W18A 2W1IA 5AM7A 5BUEA 3G51A 4HYSA 3PRIA 1FPUA 1J1BA 2JEDA 3A4OX 4I0TA 3QTQA 4HYHA 1YW2A 5EHYA 2YWPA 4I21A 5AM6A 2GQGA 4GVJA 4TL0A 1H28A 1TQPA 3E8DA 5CSVA 4AUAA 1XHAA 4HJOA 3I6UA 4L00A 4WO5A 4YZMA 5TO8A 3KK9A 3UQCA 3EKNA 2VTLA 2OJGA 3DQXA 5JFWA 4K9YA 4Y73A 2DYLA 3HMMA 4C58A 3QTRA 2F2UA 2JD5A 4EZ3A 1BMKA 3FLWA 3JY9A 3WF6A 4EH2A 4AW1A 4BCKA 2C3JA 4O7SA 4UXQA 4L46A 4NM0A 4BFMA 3Q96A 5I3RA 2J0IA 4O0SA 4FTRA 5IA2A 3KMMA 4NSTA 4PDPA 5C27A 5ANEA 1A06A 2YDIA 3UC3A 4JR3A 2E2BA 3E62A 3P7CA 1PXOA 4D1SA 4FX3A 4XX9A 3BU3A 2XB7A 4YZ9A 4ZEGA 5JFSA 3KRXA 5BVFA 5CT7A 4NK9A 1ZYJA 2J0JA 3QRUA 4GFOA 1XO2B 3MPAA 5GHVA 4NWMA 2QOFA 4TYJA 1GNGA 5ANOA 5GZ9A 2WU7A 2RG5A 3ZM4A 4YGAA 2BRHA 3BQCA 4AGUA 5BVDA 4U43A 1SVEA 4BDEA 4ZOGA 2OFUA 2BDJA 1ZARA 4L8MA 2G2FA 2V7OA 4G6OA 4M0YA 4D4RA 5KKRB 1URWA 4P5ZA 2Z02A 3CE3A 3PXRA 2XK3A 4WNPA 2H6DA 2WAJA 4YZBA 3WI6A 4D2PA 2AYPA 3AMBA 3O8PA 3V3VA 3OWPA 3LCSA 2VTPA 3E93A 3LFQA 3PY3A 4ZSJA 3HUCA 4FOCA 5LJJA 4G5PA 5A9UA 2RFSA 3DY7A 4HCVA 4UXLA 4UB7A 3FQEA 3NNXA 3OG7A 4MCVA 1OMWA 3WZUA 3Q9XA 2YJSA 3QKLA 4TYGA 5D10A 4L3PA 4KSQA 3B2WA 3ORIA 2ZMCA 3PJ2A 4IC8A 4C62A 3F9NA 3UYTA 5CSHA 3PE1A 2O5KA 4BHZA 5EI2A 2XJ2A 3QU0A 2WQBA 3GCVA 4WRSA 3ZFXA 3SW4A 4GFMA 4TWPA 4BZNA 2HZIA 1YI6A 5CI6A 1T45A 3C4XA 4EWHA 4FSRA 3OWJA 4I4FA 4X7QA 5BYZA 2ZYBA 2XS0A 2XIYA 3GENA 4KRCA 2WTIA 1SNXA 1YHSA 4HYUA 2CNVA 2XEZA 2XRWA 5JN2A 4WOVA 3RZBA 4FEXA 2QOBA 3LKMA 4IAAA 2OU7A 5FTOA 2CKOA 4A9TA 4C3PA 3BELA 1P4OA 3CXWA 4S32A 1XBCA 2W9ZB 4F1OA 4TW9A 5HLPA 5A54A 2OLCA 1UA2A 3SHEA 4I24A 3FI2A 4X2KA 3ENHA 1YDTE 1M2QA 3HUBA 4FIIA 1DAWA 2UZVA 5EM6A 2C0IA 3T9TA 3R8MA 4XG7A 4RIWB 4Y5HA 3F2AA 4L3JA 5FP5A 4ERKA 2UZOA 5L6PA 2XK7A 2QKWB 3BYSA 4U5JA 3T8OA 3UNZA 2QI8A 5ETFA 1M2RA 1NA7A 4A9YA 2QU6A 1R39A 2WMWA 4F0FA 4GU6A 5JRSA 2XK9A 1H1SA 2WMAA 2WTWA 3O8UA 5CU6A 4CT2A 1OBGA 2VTSA 5B0XA 1QCFA 2YCRA 4EH3A 2PVNA 3ATTA 3FMNA 2ONLC 3ZOSA 4R8QA 4JDKA 5M4UA 2PPQA 3ZSIA 2QONA 4EYJA 5EW9A 4XP3A 5E8UA 2IJMA 4F9AA 4B9DA 4BDIA 2PZPA 5CTPA 4LMNA 3FWQA 3F66A 1J7UA 2CPKE 5BVKA 2X2KA 3ENMA 2A4LA 3POOA 4DEGA 4DEEA 4MYGA 3TZ8A 2UZLA 4NCTC 3R83A 1XBAA 4BGGA 2W5BA 4RVMA 3VS3A 4Z16A 4V0GA 5DG5A 1H26A 3SLSA 5HBHA 3UC4A 3GQLA 3S4QA 2IVUA 3DV3A 2HCKA 4BIEA 3O51A 4GKIA 4ORKA 5KO1A 4C2WA 2OIDA 2WTKC 4K8AA 4Y8DA 3LE6A 3KL8A 4F64A 3LIJA 2DUVA 4IWQA 1BKXA 4UV0A 3U8WA 3BHHA 4GK4A 5J5SA 4GG5A 4QP8A 5FUTA 3WBLA 1J91A 4FKLA 3FZSA 5ANDA 3QA0A 4IFCA 2G2HA 1H24A 1DM2A 3LLAA 3DK3A 3NYXA 4K2RA 3F5XA 4PP9A 2WTJA 4WD5A 1OL7A 2NPQA 2V5QA 2W9FB 2XK8A 2ZM4A 3OBGA 4FTAA 4D2RA 2IPXA 3DK6A 4PRJA 1FGKA 1QPJA 3BLQA 3MY5A 1YVJA 4IQ6A 4GU9A 5IQBA 4FV4A 3R28A 1H1RA 2OXXA 4J97A 1L3RE 4RC2A 3TEIA 4BN1A 2C3KA 3QTWA 4CVAA 4MD7E 3UBDA 4KUJA 4E4MA 2H34A 5E9EA 1YDSE 3QHWA 2X0GA 1B39A 5HE0A 4NIFA 3VUHA 2HY0A 2C0TA 3R22A 4UWBA 4FV8A 5IQHA 2BZKB 4GV1A 2H96A 2ITNA 4WBOA 4O1PA 3LFDA 4AT5A 3ATSA 2O0UA 3ZMMA 4BDJA 4DFYA 2QR8A 5HNBA 4YLKA 3WILA 4AN3A 4DA5A 2XIKA 4YLJA 5I9ZA 3NAXA 4O7TA 3CPCA 1OPJA 3HDMA 3HEGA 5C8NA 2CN5A 3CKXA 3CQUA 4JG8A 4O22A 3V5WA 1OBDA 3MB6A 4LRMA 4R7HA 4FK3A 3V8TA 2VTIA 3LCKA 5IH5A 5BVNA 3DQWA 3MH1A 3JPVA 5J1WA 3NDMA 3C4CA 4XMOA 4F0GA 5KHWA 2XIXA 1J3HA 4LOQA 2XK4A 4Y95A 5AV3A 2PULA 2W0JA 2Q0BA 3GB2A 4YSMA 3OROA 5HKMA 3M2WA 5LMKA 3AC8A 3KXZA 3RPYA 2R7BA 1LUFA 3I0OA 1JKTA 4J8NA 4AFJA 2W5HA 3FZTA 3LQ8A 5HIEA 4O0UA 5C01A 2PY3A 3DB6A 3HZTA 2VAGA 1VYWA 3VS1A 4U8ZA 4C3RA 1Q61A 2R3NA 4RZWA 4KNBA 4FZFB 3F5GA 2UZDA 3BI6A 3ORLA 5FEDA 4O7NA 4PMMA 5AAFA 3R71A 5AIKA 3DGKA 4EH7A 4G9CA 1LP4A 4OUCA 4IZAA 4FTLA 3EZRA 4C4IA 4FGBA 3VS7A 1WBNA 2GHLA 2BFYA 3RZFA 3FPQA 2F57A 3EQDA 3TJDA 3BBTB 5BPYA 4FKGA 2PWLA 3I81A 3COKA 3NSZA 4YO4A 2YCSA 3CGFA 2CCHA 3G15A 3KA0A 4AACA 2QQ7A 3ACJA 2YISA 4U0IA 5G6VA 2JFMA 4ZY6A 4F7SA 3VBTA 2ITVA 3DB8A 4GT3A 4XHKB 4FUYA 1KE5A 3HP5A 4HZRA 5E8TA 1VEBA 3UYSA 2OG8A 3A4PA 5LVOA 4H36A 1GOLA 3PVUA 4DHFA 1NVQA 4J98A 4IX3A 1Q8YA 4HCUA 2WIPA 4JAIA 4RWJA 4M97A 2W5AA 1GAGA 3VBVA 5G1XA 2UW6A 3EHAA 3R1QA 4WHZA 4U3ZA 5GZAA 3R8PA 5E8SA 2I40A 4IADA 3PXFA 2RFNA 1IASA 4MH7A 2ERKA 3R02A 5IA5A 4QMQA 2PVKA 3IOKA 5HTIA 3R01A 4LUEA 3A7JA 3AC3A 4RFZA 4QP9A 5GJDA 5BUJA 1NT2A 2JKOA 4TT7A 4BBEA 5IQAA 4JOAA 3MPTA 1PKGA 2OZAA 2QNJA 3FLZA 5IUIA 1WBOA 4LI5A 4DBNA 1XJDA 3JVSA 1FVRA 1U5QA 5AUUA 2VNWA 3LVPA 4APCA 4OTIA 4FIEA 2E9NA 5HEZA 3W2CA 4XEYA 2R4BA 1TKIA 3RAWA 2O3PA 3EFKA 3ET7A 4HGLA 3WYYA 3NIZA 4XOZA 3GCSA 1OKZA 1WVWA 3MA3A 2QOQA 2E9OA 3O17A 3QTXA 4AOTA 2Y7JA 3HV5A 1TQIA 2R3QA 2ZV9A 2R3JA 3PFQA 4FIFA 3TNWA 1AQ1A 2V0DA 4CFFA 3BYVA 2G1TA 4IFGA 4BF2A 4RQKA 1YWRA 5AP7A 4ZJIA 3SGCA 3VUTA 5KMOA 1M52A 3EKKA 3FYJX 3D7TB 3CR0A 3DKOA 5DFPA 4BDCA 2VTOA 2LAVA 3TZ9A 2OIQA 5H8BA 2WMTA 3D2KA 5CU2A 1P5EA 1Z9XA 2BKZA 2H9VA 4E6QA 5IPJA 4FT7A 3P86A 1OIUA 2VUWA 5CS6A 2CLQA 1REKA 3L8SA 5FTGA 3C0IA 1Y6BA 3LXNA 5L8KA 2UZBA 2VN9A 4X3JA 5J9YA 4RJ5A 4YJOA 4FSQA 3AT2A 3QWKA 4USDA 3ITZA 4APPA 3HYHA 4EOKA 5FDPA 4D1ZA 3M11A 2WKMA 5IU2A 5FBNC 2IZRA 5A4LA 2VWZA 3WF8A 4CZYB 3L8PA 3TTJA 5CALA 2XZSA 3ZFYA 3GU5A 2YM6A 3W8LA 1BI8A 4IM3A 4KA3A 4ACMA 2WIHA 4ZJJA 1YHWA 3OCTA 2HZ4A 2XNPA 3V5QA 5IA3A 2QURA 3SG9A 4FSZA 4I3ZA 3OOMA 4XRLA 5EYCA 3Q52A 4DT8A 4XRJA 4RC3A 5FXQA 1UKHA 3PZEA 4J7BA 4FZDB 2V7AA 3K3IA 5DRDA 4RFMA 5EG3A 4ITHA 5HNGA 4GS6A 3FI8A 2EB3A 4ZTHA 4I5HA 2EB2A 2CDZA 2GCDA 4Q9SA 4IIRA 4YTHA 4QTBA 2IVSA 1FGIA 2HZNA 4BDGA 4FUXA 3O7LB 4FT9A 1BX6A 2PVHA 4KIPA 3OW4A 3OHTA 1H8FA 3OUKA 3R9NA 4F63A 4O7LA 4FC0A 3PA5A 1YI3A 4PWNA 3UTOA 1STCE 4HVHA 2VTJA 3VO3A 3BX5A 4KB8A 1DAYA 2IZTA 3W2QA 3OWKA 3GC7A 3RAIA 3BZ3A 3FDNA 4FSTA 1PXJA 2ZV2A 3MYGA 5A6OA 3FL4A 3LQ3A 3MI9A 2JKQA 2YHVA 5FXSA 2YWVA 3QZIA 3DCVA 5KMLA 3NX8A 2CGVA 1LR4A 2PE1A 3OY3A 4FYOA 2QLQA 4K77A 4ZTQA 4ZTMA 5CF6A 3WZKA 3GU6A 1JLUE 2J0LA 5HZNA 5CSXA 4CTCA 2QODA 1QL6A 3A7GA 3A7HA 4QYFA 1YRPA 4O2PA 1CTPE 4ZP5A 5E1SA 5H3QA 3JUHA 3R7EA 4GIIA 4DEBA 4RMZA 5FGKA 3TG1A 3UIMA 2Z7QA 4V0GB 1Z5MA 1ZMUA 3KB7A 3VS0A 4EZ5A 4I1ZA 4YSJA 4FTTA 4IBMA 3ZLWA 2CCIA 2CKEA 4RVKA 4EOJA 4OW8A 2Q83A 2BRMA 4I6QA 1NVRA 2I0EA 3AT3A 3PPJA 2A1AB 4GK3A 3LJ1A 4AE6A 4RJ6A 4EC8A 3Q32A 1OVEA 3TKUA 2WQMA 4RJ7A 5KUPA 1REJA 3KU2A 4XUFA 3OD6X 4LMUA 2YZLA 4R77A 1YOLA 5A4EA 5DMZA 3PSBA 4O83A 1MP8A 3C7QA 4U80A 2FYSA 3LCDA 3JS2A 3SV0A 2VO7A 3SRVA 4BC6A 2XEYA 5I9UA 3TKHA 4D58A 2CNQA 4RIYB 4O96A 3V6SA 3DJ7A 3PPZA 4FKVA 5HG9A 3ZYAA 3Q2MA 4IAFA 5DR9A 5KMIA 4WNMA 4MD8E 3IW6A 4MNEA 3GCQA 4Y72A 4EBVA 2VNYA 4Q9ZA 2WQNA 1GZKA 3FV8A 4KKGA 2UZEA 4HVGA 3FC2A 5GIOE 2NO3A 1NY3A 3O71A 3FMEA 5FDXA 3LMHA 4EHZA 2ACXA 2UZNA 2ITPA 3A99A 2VTQA 4V04A 5TE0A 5L3AA 2C6EA 3E3BX 3DKGA 2WD1A 4KIOA 3FC1X 4NJ3A 1LEWA 5A4TA 2PVFA 3ZU7A 1U54A 2IVVA 3CQEA 2GNGA 3EWHA 3PXKA 3N9XA 2X4ZA 3PPKA 4FSYA 4CFMA 3QRTA 3S0OA 4EH4A 5IUHA 4FT0A 2I6LA 2PMOX 3UVRA 4AZWA 3OCSA 4PMPA 2QCSA 3G90X 4JDHA 4FKTA 3KXMA 1JOWB 3IW5A 1JAMA 4C33A 2W05A 3AXWA 4G2FA 3DBDA 4DTAA 2C47A 5E7RA 4EQCA 1LPUA 5AR8A 2JDRA 4XG4A 4XLVA 5EKOA 3VNTA 1L8TA 1XBBA 4FNZA 3NS9A 4QMOA 2ZJWA 2JDSA 3NW7A 4EOMA 4O38A 5HLNA 3MS9A 5M07A 4FSWA 3F88A 4I5MA 3WYXA 4KINA 3ZH8A 2F9GA 2RKUA 3KRLA 4OLIA 3ZLSA 1G8SA 4RJ4A 3ANRA 4G3GA 3DFAA 3FMMA 3Q4ZA 2R3RA 2C1AA 1APME 3DNDA 3KFAA 2VTRA 4KRDA 4CFXA 4Z7HA 3FUPA 2PVLA 3SC1A 4UMUA 3HMPA 3FXXA 1ZOHA 3TACA 5K9IA 5CI7A 5FP6A 2GHGA 4YZCA 4G6LA 4DG2E 2YABA 3ZC5A 4F0IA 4EJ7A 3E7VA 3VJOA 2ETRA 1Q8WA 2A19B 4PPCA 3HDNA 4AGWA 1YOJA 2JC6A 2C5XA 2WOTA 3QTSA 4TYHA 4F7LA 3MVMA 4AA4A 5TKDA 3D15A 3R00A 5H8EA 3F5PA 4QD6A 3L1SA 5HG7A 3DJ6A 4ASEA 4R7IA 4BI2A 3TIYA 4X2NA 4X2FA 5IH6A 3TNIA 5DYJA 4H39A 4X3FC 4B99A 3HRFA 3ORXA 4FGRA 1Y8GA 4NFMA 3PVGA 3QKMA 2QOOA 4WNOA 1WMKA 5CEPA 3JYAA 2YM5A 3GU4A 4W4YA 5HVYA 3U51A 3OY1A 1J7IA 2FSMX 5A3XA 5GZ8A 1NVSA 4BI0A 5AV4A 3BV3A 3F6XA 5ANIA 4UN0C 5KZ0A 1GJOA 2C6LA 2FUMA 3SXFA 3BLHA 4D1XA 1UU3A 4CGAA 3OFMA 4DAWA 4AZEA 2YN8A 3U54A 1BLXA 1UKIA 4GUEA 3MJ1A 4BTMA 2I0VA 2Y6OA 3COIA 1P14A 4MXZA 4QMMA 4H3PA 2HY81 2ONLA 4K1BA 1YWVA 1M2PA 3LXPA 4BYJA 4KS8A 3FHIA 5TF9A 3K5UA 3BWFA 4D5HA 4CV8A 4CLJA 4FT5A 3C50A 1UU9A 4ONAA 3JXWA 3FZRA 3EOCA 3SXSA 3L9PA 3ODZX 4XS2A 3A62A 2YERA 5AV1A 4NTTA 2QOHA 5DA3A 3DDQA 3WZEA 4C38A 2PUIA 2Z7SA 4DFNA 1XH9A 4NW5A 2PSQA 3ZHPC 4TXCA 4AG8A 4HOKA 2O2UA 4A9UA 2JITA 3NPCA 3DBCA 4IM2A 4MXOA 5FBOA 2PZIA 3SRVB 4U45A 4ZIMA 1M7QA 4ACGA 2EXCX 2VZ6A 2W4KA 3HNGA 5F1ZA 5A46A 1S9JA 4FTQA 5K4IA 3NEWA 3PLAE 3IONA 4OR5A 2OJJA 2BILB 5K3YA 3DZOA 3VF9A 3IW7A 4AX8A 4EK4A 2ZB1A 3OUNB 3CGOA 3PJ1A 3QA8A 4JX7A 4YJRA 5HO6A 2IN6A 4GT5A 5E91A 4I93A 3UOHA 4OAVB 5BX0A 3O8TA 3SKCA 5IA4A 3LCTA 4LFIA 4BDAA 2IW8A 4QMSA 4XG6A 5FG8A 1PMVA 2XNEA 3QLGA 2W1DA 2GNHA 2ZDUA 4I6FA 3W8QA 3TUBA 3FAAA 5AADA 1G8AA 5ANKA 4I22A 2OICA 4QMXA 3C0GA 3GNIB 5EHOA 3TZMA 2RFEA 2YAKA 2C30A 4JR7A 5ETIA 2B52A 2I0YA 4BWPA 1UWJA 4HGEA 4M69A 4R5YA 3BGQA 3I1AA 4ZZOA 3Q04A 1SVGA 4ITIA 2ESMA 4JAJA 4F9YA 2UVXA 3KRJA 2NRUA 3QF9A 5CEKA 3HGKA 3OOGA 3VVHA 3DKCA 3BHYA 5HD7A 2LGCA 3COHA 5DBXA 3ZDIA 5M53A 3RPRA 2WQOA 4II5A 3QYWA 3GCPA 5HGIA 4IAKA 2PUNA 2B55A 4RC4A 5AUZA 4FBXA 3PIXA 3V5JA 3TT0A 2VTNA 4FTUA 4DN5A 3PRFA 3VWAA 3PP0A 3A8WA 4X3FB 3CTQA 3BRBA 4FYNA 4G3CA 3NYVA 4OTQA 5ACKA 4GIHA 3IO7A 3DTCA 3MY0A 4M66A 4BGQA 5HICA 2QG7A 4AN2A 4FICA 2HW6A 2XCHA 3W2OA 4J8MA 3WE8A 4BVUA 5IKWA 2XVDA 2BAKA 4PP7A 4HVDA 3SQQA 3FLNC 3RAHA 4CYJA 4DEAA 1WBSA 3QRKA 5J95A 4HGTA 4BTJA 3L9NA 3ROYA 2GTNA 2W96B 4HGSA 3B2TA 3VF8A 4JBPA 3D5UA 3TKIA 3BEAA 4G17A 4CNHA 3P08A 4LL5A 4D5KA 2UW4A 2ZDTA 4XYFA 5H8GA 4S33A 4I5PA 5EDQA 4MNFA 4D55A 4YHFA 3BKBA 4O81A 5KMNA 2XNNA 3ORPA 1UNLA 3VUMA 5HIBA 5EFQA 5L2QA 4RSSA 4R1YA 3G2FA 3NWWA 4D4YA 4EC9A 1XKKA 3MSSA 5DIAA 3PY0A 4FTNA 3ODYX 4QP1A 1GIJA 3TZ7A 2BRNA 3SOCA 4GJ2A 1HCLA 4RGJA 2JFLA 2GNLA 4O21A 3KVWA 2IWIA 3CPBA 4AT3A 3ZBXA 3C9WA 3RM7A 3LJ0A 3F3WA 3ZO4A 3CJGA 4KD1A 5IQDA 2E9VA 4JQ7A 3BWJA 3UDBA 5AP0A 2C5YA 2X9EA 2OF4A 4I6BA 1FMOE 3O0GA 3R7IA 3HMOA 4DGLC 4TKSA 3QX4A 4ITJA 2UVYA 4AOJA 4EKKA 2O65A 5AR2A 1PYXA 4O7RA 4NTSA 1YXUA 4L42A 3MVLA 5C4KA 4Q5EA 4AXAA 4FV1A 4Z9LA 1JQHA 3EL7A 2QO9A 3C4EA 3D0EA 4HNFA 2QD9A 4C7TA 1OKWA 4XV3A 5JQ5A 3WIGA 3T3VA 3R7VA 3UQGA 1P2AA 1OIRA 4CT1A 1Q99A 3DZQA 4WNKA 3UOJA 1Q8TA 4U6RA 3PY1A 4JQ8A 4B4LA 4CMTA 4FL1A 3TV7A 5J79A 3DTWA 4I23A 4W9WA 3U6JA 4QOXA 3G6HA 4MBIA 1IRKA 5B7VA 3Q9WA 4OBOA 4ASZA 4EQMA 1F0QA 4ZTLA 4RX5A 2QHNA 4RLLA 3R0TA 4IDTA 2C6TA 5HG8A 4NL0A 5KKRC 3TL8A 5J1VA 3ANQA 4FIGA 3FQSA 4EHEA 3HVCA 1YKRA 4NM7A 2BALA 2YCFA 4GUBA 3R9DA 3CP9A 3UQFA 4GL9A 5ICPA 2EWAA 5JFVA 2YIYA 2PHKA 3AQVA 1XH6A 3FLYA 3H9FA 4QNAA 5DN3A 2OXYA 4EUUA 4OBPA 2WMXA 2P55A 1KE8A 1ATPE 3MIYA 3IDPA 4CFWA 3TUCA 4AGDA 2YAAA 5L6WL 5LVMA 3HA6A 4DINA 2NP8A 4C4HA 3S2PA 4YPDA 5J8IA 4D2VA 1FOTA 3ZCLA 5JZJA 3ZRKA 3E92A 1IA9A 3DXNA 3P0MA 3T9IA 5EOBA 5AP1A 4JDIA 5CVGA 3FHRA 3TV4A 3HL7A 2JBOA 3T3UA 3G9NA 2B53A 1A48A 4FV2A 3IGOA 4CZUA 2IO6A 1R3CA 2WZJA 4PDYA 2YM8A 1YDRE 2VX3A 2GQRA 4ERWA 2BDWA 3C51A 4FA2A 3Q9YA 5E4HA 1QPCA 1B6CB 1SVHA 2I1MA 2J7TA 3HLLA 4FKPA 4P4CA 3KCFA 3PVWA 4K11A 4KKHA 2O64A 4OT5A 4WG5A 5AR5A 2XMYA 3QL8A 4ZSLA 3ZC6A 4BZDA 5IUGA 5C9CA 2PUUA 4M0ZA 3VQHA 4BDBA 3EQCA 5D7AA 2Z8CA 5AEPA 2BHHA 4M13A 2BKKA 3RP9A 5CQUA 3W32A 4BDHA 5J7BA 3GQIA 5AWMA 4I0SA 1ZYLA 2PUPA 4KIQA 5EYDA 5BMMA 5HO8A 3RINA 3FYKX 5DI1A 1G3NA 4CZTA 2PYWA 4IXPA 3R9RA 2C4GA 3KCKA 4CCBA 4ZLOA 3P78A 2UZTA 2P2HA 5KMJA 4FV3A 3RMFA 3R63A 2VTTA 5CQWA 3I4BA 4WT6A 3DBFA 1CKJA 3Q4UA 5EQPA 1H1QA 4C8BA 4TN6A 1KSWA 3F5UA 3EN5A 4FEQA 4HVSA 4X3FA 3OXTA 2R3MA 3NUUA 4EKLA 4QP2A 4MX9A 4NZWB 3FY2A 3PIYA 3C0HA 5A4CA 3KRRA 3F7ZA 4YJTA 3CJFA 3LQ5A 3QTUA 4IB0A 4B6LA 4CEGA
chains in the Genus database with same CATH superfamily
4JBQA 4E6AA 4PY1A 3IK3A 4QEBA 4X2GA 4DCAA 4IVAA 4FMQA 4LGHA 1RE8A 3UPZA 4L7SA 1UWHA 3FJQE 3W1FA 5IA1A 4BR3A 3PXZA 1JBPE 5CYIA 2WGJA 4AZTA 3F3UA 2WQEA 3E7OA 2Y4IC 4DH3A 1MRYA 2J5EA 3GC8A 4NT4A 2ITZA 2X8EA 3V5LA 3LM5A 4J1RA 5B2KA 3HAMA 4RVTA 4CG9A 4FSUA 2UZWE 3S95A 3KK8A 3VBQA 5J7HA 4F08A 1YXSA 3BCEA 3RPVA 4B8MA 3M42A 4BICA 3DDPA 2JLDA 3P9JA 3II5A 4ASXA 3IGGA 5DOSA 3P5KA 1OGUA 3VUKA 5EM5A 5M57A 4ZTRA 3QXOA 3QGYA 3U9NA 3Q2JA 2YITA 4CKIA 5IEXA 3FL5A 3PSDA 2JIVA 3ZEPA 3IPHA 3GU7A 4HYIA 5IF1A 5JRQA 2WMVA 5ACBC 3ORTA 3I60A 4U79A 2JAVA 5LWNA 5M55A 5JZNA 4F9CA 4TYHB 4KIKA 3DXPA 4H1JA 3DLZA 4UWCA 4ACDA 5HX8A 3R7GA 3IG7A 5HE1A 4O86A 3GGFA 4KBCA 3UP7A 3WF7A 4EYMA 4D4VA 2C68A 2BFXA 4C35A 4JIKA 3IS5A 4E26A 2IZUA 5H9BA 5C1QB 3F3ZA 3OCGA 3KMUA 1U59A 3VQUA 4XG9A 4QMWA 4RIOA 4ZY4A 1ZXEA 2REIA 3OWLA 3EYHA 4WBBB 4M84A 3ZZEA 3F2RA 2KULA 3I5NA 2X1NA 4X2JA 3R8VA 5FTQA 3E5AA 4Z7GA 4O7WA 3R8UA 2J6MA 3U4WA 1JKKA 4B0GA 2YA9A 3PJ8A 4ALUA 4A4LA 3EQGA 4FR4A 3ZXZA 5BYYA 3E8EA 4LM5A 3TNQB 4OAUC 4DGGA 2X6EA 3QTIA 3EQIA 3NUNA 3TIZA 2XRUA 4BBFA 4EK3A 1V0BA 2IZSA 3HAVA 3MV5A 3PUPA 3QQJA 4JRNA 4AXDA 2OFVA 3VAPA 2C6OA 4RFYA 4FVRA 4BHNA 1WBVA 5F20A 4A4OA 3OC1A 5CAOA 4GT4A 2YM4A 3LFFA 3BE2A 4EH6A 4GKHA 3FY0A 2CGXA 5AV0A 4L9IA 5M4CA 5I3OA 3LFEA 3D9VA 5IZFA 1BL6A 2GFSA 2PVYA 4QTCA 4QQTA 4YTIA 4ALVA 3TDWA 5E90A 4NKAA 1TQMA 4EONA 4G3FA 2X8IA 4NM5A 5AJQA 3QALE 5IMXA 5JGBA 2CKQA 5AA9A 5EI6A 1U54B 4RG0A 5EYKA 2G2IA 2XF0A 2XP2A 3SOAA 4JDJA 4EL9A 4W8EA 2VTHA 5EW8A 1YWNA 1J1CA 2J0MB 1PF8A 3QAME 2GNFA 3P7AA 4MWIA 5JH6A 3GBZA 4ENXA 3NCZA 4GG7A 5AV2A 4S30A 5DRBA 5AAGA 1DI8A 2W1ZA 2XJ0A 4LYNA 4MUQA 4CFNA 4JG7A 4BTFA 1PYEA 5C26A 4DFUA 4IWOA 2BTRA 3NYNA 4R5SA 5I9VA 5KMMA 1CM8A 2ZB0A 2WFYA 4IB3A 3ZONA 4IWDA 2E9UA 5AR7A 2H8HA 4DT9A 2A27A 5F95A 4NJDA 4AU8A 1F5QA 2OH4A 3NMUF 3K54A 3NNWA 1J7LA 2OK1A 1OZ1A 3LXKA 2YZAA 3Q6WA 3PVBA 4JBVA 4MK0A 4KABA 4PTCA 4QDVA 1B38A 2FO0A 4WRGA 4PF4A 1GZNA 1SZMA 3UODA 2O63A 4XV9A 4DGNA 3NW6A 3R6XA 1VJYA 2VWUA 2FVDA 4G6NA 5KMKA 2EXMA 2P4IA 3LZBA 4DEHA 1UV5A 3R1YA 1R0PA 3PIZA 3MJ2A 4QMVA 4AFEA 4H3BA 3TNHA 4EK8A 3BV2A 1PXNA 4BDKA 4FOBA 4JI9A 3NNUA 4MXXA 4JJRA 4DGOA 2R3OA 1R0EA 3IDBA 2FH9A 2XBAA 3QQLA 5AAEA 4TYEA 2PZ5A 3QTZA 4DH5A 3GCUA 2F2CB 3KKVA 3PSCA 5J87A 4AQCA 1M7NA 4FTIA 3PA3A 4XV1A 2W7XA 4NU1A 3PTGA 3ZSGA 4C59A 3TN8A 2VTMA 4QP4A 2QG5A 4G34A 1PXIA 3VC4A 3VRZA 4L45A 5IEVA 2CLXA 1EH4A 5E8WA 4XG2A 4FG9A 4WA9A 3NVKI 2FA2A 2GU8A 3MVJA 4DH1A 4O84A 4XCUA 4HCTA 3O7LD 3FKNA 5CZHA 5F9EA 3VBWA 4R1VA 3ELJA 5I9YA 1H1WA 2YLEA 2FSLX 5CVFA 4BKYA 4NM3A 4F65A 5I4NA 3TDVA 1ZMVA 1SM2A 5K4JA 4XBUA 3NGAA 4CD0A 3QKKA 4LGGA 2XA4A 5HI2A 1XH7A 2QU5A 3D4QA 1X8BA 3ZUVA 4FKRA 4X6RA 3FMDA 1R1WA 3W0SA 3DBQA 3LOKA 5KZIA 3D5WA 3EH9A 3QCQA 1VR2A 4DG0E 4JT3A 4CCUA 4YMJA 3P4KA 3WZJA 3FMHA 4QYGA 4RIYA 3UIUA 2X8DA 3FKLA 5LMAA 4DLIA 4BI1A 1RQQA 3QZHA 5AIRA 5TT7A 4BCFA 5DR2A 4GEOA 3CS9A 5HLWA 2GSFA 5AUTA 4CSVA 2VWWA 1GY3A 2P0CA 3NUPA 3TWJA 5I9WA 3R9OA 3C5UA 3PJ3A 3RALA 1ZRZA 2DQ7X 3W33A 5D9HA 3MFRA 5CLPA 2WELA 3RBWA 4ARKA 4O82A 4XH6A 3AC5A 3LHJA 2CGUA 3KN5A 3BU5A 3VS2A 4RBLA 5FM2A 3BIZA 3QD3A 3D5VA 3QHRA 1O6LA 3OT8A 3QWJA 3O2MA 3ORNA 3OVVA 4C61A 3BGZA 1AD5A 4IANA 3CC6A 3VS5A 5E8VA 4BCIA 4FKUA 4E73A 3MBLA 3KN6A 4F99A 4RT7A 5HIDA 1JSUA 1E1XA 4BYIA 3EZVA 4QMTA 2PU8A 4EK5A 4PTGA 3ZEWA 2PZYA 4E6DA 4GFGA 4W9XA 1F3MC 1V0OA 1O6YA 4H3QA 1WVXA 4LRKA 4QPSA 2VGOA 5DGZA 5EK7A 2CNUA 1UNHA 3FMJA 2X39A 5D11A 4TTHB 2ZAZA 5GINE 5AR4A 4LV5A 4CMUA 3C5IA 5IDNA 4AAYA 5HD4A 4IB1A 1PXLA 5CEIA 4D2SA 3JY0A 2C6IA 2J9MA 3ACKA 2IW9A 3L8VA 4WUNA 2DS1A 3UO6A 4NUSA 3OBJA 4R3CA 3QQUA 3Q3BA 3DS6A 2QOCA 4CMOA 1W2FA 4JQEA 4IVBA 4I5CA 3CTHA 2X2MA 5HQ0A 4WSQA 4A9RA 3FBVA 4FSMA 2X2LA 4G5JA 4DC2A 3UPXA 4IC7A 4QO9A 4CQGA 4D9UA 3OP5A 1OUKA 1FVVA 4F6SA 5JFXA 4LQMA 3R21A 4BCPA 1VLRA 3EQRA 3RVGA 2VV9A 3BYMA 5I5ZA 3UDSA 4EOIA 1MRVA 1I44A 2HK5A 2E9PA 3BBWA 4PUZA 2FGIA 3Q9ZA 3FMLA 3OW3A 4G16A 1YXVA 4PX6A 4CXAA 2R0UA 3DA6A 5J5TA 1WFCA 2CJMA 3LXLA 3DXQA 4IAIA 4HVIA 4MEDA 3NUXA 4EH9A 3ORMA 4YBKA 4AAAA 4BCJA 4JRVA 2UUEA 1U46A 4PPAA 2G9XA 2W99B 4X0MA 5LXMA 3R8LA 4J95A 4DYMA 5KBQA 3QD4A 1W2CA 2OW3A 4FTOA 5BMSA 4A7CA 3KULB 3QX2A 5I9XA 2UZUE 4W4WA 3W0QA 3QLFA 4A07A 2R2PA 4CTBA 4PTEA 5CNNA 4O7YA 2XM8A 3QQHA 4QMUA 2R3KA 1FMKA 3E64A 3LLTA 3RTPA 2EXEA 4RJ8A 5GJFA 4ANNA 3IW8A 3MH2A 3D7TA 3QUEA 4ZSEA 5FXRA 2QOLA 3W0NA 4KWPA 5LQFA 2EU9A 2P3GX 3CIKA 4IEBA 4FKSA 3UG1A 2Y4IB 3VUIA 3Q60A 1Q4LA 5EH0A 4RIXA 3RI1A 4M7IA 5J9ZA 2XNGA 4AS0A 1Y91A 3L9LA 3P23A 5HVJA 2HW7A 3VW6A 4PNKA 4O1OA 1TVOA 1ZZLA 2W4OA 3B8RA 3HX4A 2FB8A 3O96A 4QQ5A 2J0KA 2BAQA 4CRSA 4C4FA 4EORA 4ZLYA 3R8ZA 2XK6A 1ZOGA 2HZ0A 2Y6MA 4IH8A 4MXCA 5LCKA 2AC5A 2OZAB 2IEWA 3DT1A 5CAPA 2XNOA 3RK5A 1A9UA 2G01A 3QUDA 3UNKA 3D2IA 3PG1A 4GK2A 4OTFA 2P33A 4FV6A 4AT4A 5CU0A 1I09A 5JEBA 3MDYA 2FSOX 3E87A 3WIKA 3KXGA 4EUTA 4XP2A 1V0PA 4YJQA 5FLFA 4FODA 2YFXA 3P5JC 2C1BA 3BHVA 3S3IA 4O91A 2RL5A 2YM7A 4AXCA 4LV8A 4L67A 3RKBA 1KE9A 2Z7LA 3OCBA 4M15A 1H0VA 2BAJA 4Y5QA 3UJGA 1H1PA 2GS2A 4MXAA 2WHBA 2GS6A 4AGCA 4L01A 4PMSA 2BUJA 2JBPA 5KHXA 1KV1A 4G1WA 2QR7A 2WMQA 3WF9A 2OZOA 2ZOQA 3O23A 2YACA 4UMTA 2Q0NA 3NIEA 3EYGA 1K3AA 4NH1A 2WPAA 3FE3A 2UV2A 4QMZA 4U42A 3W16A 3H9RA 2QKRA 2GMXA 2VO3A 3DJ5A 3QRJA 4M8TA 4RX7A 3RK7A 1YXTA 1PRYA 4YZDA 3NCGA 2CGWA 1W98A 4EOPA 5GNKA 4L53A 4USFA 4UMQA 5AA8A 1MRUA 2FSTX 4H58A 4QTAA 2X0QA 1WZYA 4FL3A 4GVAA 1JNKA 3TXOA 4O0XA 1UNGA 5L2TA 4IJ9A 2C69A 3ZZWA 4BIDA 2VX1A 3R1SA 4F7NA 3MN3A 3V01A 5E8ZA 5HU3A 1KV2A 4YPSA 3A60A 5JSMA 4FJVA 1Y6AA 3HRCA 1Q24A 2C5NA 4X6QC 3MTLA 1KOBA 4A9SA 4D0WA 4R6VA 3OZ6A 4XLIA 5E8YA 2VO0A 4HPUE 1K9AA 5HE2A 4QYYA 2R3GA 4P2KA 5ITAA 2XAOA 2V62A 4YC8A 3NW5A 2WTKB 5KE0A 5T68A 4NFNA 4MTAA 2XUUA 4QMLA 1YXXA 2X7FA 3ZXTA 3OXZA 2ZM1A 1T46A 4ID7A 4IX6A 1WBTA 2EVAA 3TJCA 4BKZA 1W84A 3DLSA 4TRLA 3MIAA 3SX9A 1OI9A 1OL1A 1Q62A 3K2LA 2WEIA 3NRMA 3RGFA 3ZSHA 3W0OA 2VU3A 5CWZA 1Q8UA 5CAVA 4ZMEA 2YIQA 2OH0E 2J5FA 1URCA 4PPBA 3MGYA 3GOPA 4LRJA 3D5XA 3KF7A 4TZRA 5BUIA 1JPAA 2BR1A 3HMIA 4MXYA 2OIBA 5DHJA 5EYMA 3VBYA 4ALWA 3ALNA 3R2YA 2OO8X 3DAKA 1WCCA 3EFJA 3VW8A 4M14A 5L8LA 3P1AA 5E92A 4MAOA 4UMRA 4RLKA 1OIYA 3ZO3A 2GS7A 5B2LA 4QDEA 3PZHA 4LDTA 4IVCA 4LOOA 3FZ1A 4GJ3A 4EZ7A 4F70A 3RWQA 3A8XA 4E6CA 3K3JA 4TYIA 4ZS0A 2B7AA 3QZFA 4QPMA 2WOUA 5IQIA 2Y4PA 5JK3A 3COMA 2VD5A 2XJ1A 2QLUA 4OTDA 4FV9A 4O0WA 4YUQA 5M51A 4ZAUA 3BQRA 3RCJA 3HKOA 1BI7A 2BPMA 4RIWA 5EW3A 4ZSAA 3I0QA 1IR3A 3K5VA 4JMQA 3FI4A 3Q53A 3ORKA 2HOGA 1Q3WA 5CX9A 1PMEA 3H10A 4O0YA 4TWNA 4NCTA 3V6RA 2Y9QA 3DAJA 4F9BA 4R78A 4EHVA 2C6KA 5IDPA 3NR9A 1OB3A 4DFBA 4ZS4A 3VN9A 4JG6A 3V5TA 3QQGA 2R3LA 4S2ZA 3W2SA 3REPA 4MBJA 3DFCB 5EDRA 4ZK5A 4ZMFA 2XYNA 2YIRA 4BCHA 2QO2A 5IH4A 1GZOA 2PE0A 4L43A 3D94A 1VYZA 3G5DA 2HWPA 5FWKK 3BL9A 3BYUA 3LMGA 4CLIA 3AC2A 5EOLA 5IQEA 2PK9A 3KF4A 3ML1A 4IW0A 3TM0A 4FTMA 3BLAA 4BWXA 5HHWA 1PY5A 3FSFA 4EH5A 3IW4A 3R2BA 4BCGA 4GCJA 4PMTA 3R7YA 2OXDA 3A7FA 2VWBA 3DU8A 3GP0A 4WG4A 5D12A 1MUOA 3LPBA 4D2WA 1CSNA 4AF3A 3Q5IA 2V22A 4C36A 5BQ0A 4IJPA 1UVRA 4G3EA 4I41A 4OTHA 5ETAA 3U4UA 5LVLA 5CY3A 2HIWA 3BGPA 2OGVA 3OS3A 4OGRA 4FV0A 3N4VA 4FKOA 4E4LA 1H00A 5F94A 1OPLA 4FI1A 4M12A 5B2MA 4ACHA 3OTVA 3QD0A 5IA0A 5K0XA 4BRXA 4G9RA 3QC4A 4UZHA 3FI3A 1Q97A 2BROA 1QPDA 3UZTA 4AW5A 4NEUA 4TWCA 3RAKA 4D28A 4IWPA 3PG3A 4FIHA 3ZBFA 4DFZE 3W10A 4WG3A 3W55A 2WXVA 3GUBA 1O6KA 4BBMA 4YO6A 2WTCA 4RZVA 4JBOA 4AA0A 3D7ZA 3THBA 3QQKA 5CXZA 3NZ0A 3VHKA 4EWQA 3G9LX 4RIXB 4QP6A 1W0XC 4N4SA 4YC3A 2YJRA 2BCJA 4JL9A 4ZTSA 5LMKC 3TCPA 5LVPA 4YBJA 4F78A 3RHXA 2CKPA 2JKMA 1CKPA 2R0IA 4IZYA 2PVRA 2PMIA 5C8MA 3ULIA 5DT4A 3TUDA 2BZIB 5CAUA 3I6WA 2ZM3A 4QT1A 2GHMA 4Z55A 2KTYA 2W1HA 5IG1A 5A6NA 1HCKA 3L9MA 5D7VA 1U4DA 3TI1A 3LFCA 3R30A 3EL8A 4M67A 3QFVA 4BJJB 2VWIA 5KCVA 2Z2WA 4MF1A 4TPTA 3ZTXA 2R7IA 4IDVA 4U40A 4B7TA 4E20A 4N6ZA 3MY1A 4KAOA 4FNYA 4QTDA 5BYLA 1IAHA 4MQ2A 2B9IA 4FNWA 3PDTA 3OEZA 2YIWA 3AGMA 4C37A 2P2IA 4MKCA 4K33A 2OSCA 2UW0A 4L44A 4ANSA 2XYUA 3NVMB 5EQYA 4FIJA 2GNJA 4NW6A 4PQNA 1ZZ2A 3CY2A 3D83A 5L2IA 4GW8A 4P5QA 4K0YA 2WEVA 2F7ZE 1ZLTA 2JIUA 5AP4A 2JDTA 3CY3A 3IOPA 2XH5A 3SXRA 5AFVA 5DH3A 2ERZE 3I5ZA 4JIAA 3GFEA 2RSVA 1CDKA 2OKRA 5K5NA 1Y57A 3UIXA 2WTVA 4WKQA 1OKVA 3KY2A 2B9HA 4U41A 4NKSA 4BB4A 4IVDA 5CANA 3NUAA 2WMSA 4HW7A 3CKWA 2C0OA 2ZFYA 4DTBA 1RJBA 2O8YA 3ETAA 3NLBA 1ZWSA 2GNIA 5CU4A 4XJ0A 3VBXA 4AWIA 3KMWA 2RIOA 3CD3A 3QBNA 1YHVA 4O27B 2IW6A 4RJ3A 5I0BA 4I92A 4FE2A 4E5WA 3UP2A 4ENYA 4FT3A 4OBQA 4QRCA 4E1ZA 5CEMA 1ST0A 4L52A 3QYZA 5EM7A 2VGPA 4Y46A 3UNJA 4E4XA 3G6GA 5DPVA 2VX0A 3FZPA 4WUAA 1OKYA 4DG3E 2B54A 5BVEA 2XKEA 4O4EA 4AN9A 5EDPA 3SA0A 3EB0A 1OL2A 3EJ1A 4DITA 3A2CA 4RX8A 5DR6A 3Q4TA 3G0EA 4AZVA 4PV0A 3FKOA 5TR6A 3ZDUA 5ANGA 5HCZA 2B1PA 5CF5A 2XANA 3PP1A 4ZSGA 4RWKA 4P7EA 1QPEA 1BL7A 3V8SA 4BIBA 4DFLA 3PJCA 5JKGA 4LOPA 2B0QA 4QMNA 4RWLA 3LFSA 5LOHA 4UYAA 3GEQA 2UW3A 3UVPA 5JQ8A 5M4FA 5ANJA 4BKJA 4CV9A 3QCYA 2X6DA 4J71A 2F49A 4IM0A 3WOWA 4BGHA 3G0FA 4TWOA 4AW2A 3A7IA 3Q6UA 5IMEA 4LV7A 2XIRA 1H4LA 5CENA 1OITA 2ITOA 3QUPA 5LMBA 4J96A 3BU6A 3FXZA 4CQEA 2ZMDA 4X21A 3OT3A 3BEGA 3FEGA 4O7VA 4KBAA 5D1JA 2XNMA 3AC4A 3V04A 1XMLA 2Y0AA 4YJVA 4AOIA 3POZA 4N70A 3EQBA 4I20A 4YLLA 3PE2A 2XARA 3QCSA 2F7EE 3ERKA 1YOMA 2R3HA 3SD0A 5DVRA 4PL5A 3RHKA 2Y8OA 4EJNA 3HV7A 3DBEA 1IA8A 2ETMA 3H3CA 2PVJA 3R7UA 4ANBA 2WNTA 4XOYA 3GVUA 2ITUA 4HPTE 5HE3A 5HTCA 3LMIA 3MA6A 4FTKA 3NNVA 1XH5A 3SAYA 5EM8A 1Q41A 3N4TA 3AOXA 1KWPA 3F69A 1JWHA 2RG6A 4C4JA 4O4CA 2W1GA 1FBNA 3MFSA 5CSPA 4PDOA 2VRXA 4L68A 3ALOA 4YNOA 4G31A 2WB8A 4AZFA 2X4FA 4TY1A 5EI8A 5IEYA 3UO5A 3FSKA 4YHTA 3P7BA 4UEUA 4IACA 3B8QA 3O50A 3MFUA 5C8KA 3RNIA 4R7BA 3DNEA 3EIDA 4F4PA 3QCXA 5L8JA 4JVGA 1W82A 3FZOA 3IDCA 3KGAA 5HCYA 5LARA 4Z3VA 3QRIA 2ZV8A 2BTSA 2F4JA 4OTGA 1H27A 3U9CA 3VUGA 5KBRA 3C13A 4RQVA 4AQKA 3IQ7A 3JVRA 3HA8A 4FK6A 4HNIA 4MQ1A 3GC9A 4E7WA 3U6IA 4PDSA 2YIXA 4XBRA 5BNJA 5CF8A 5ETCA 3UG2A 1ZOEA 3MB7A 4AP7A 5T3QA 4FZAB 5H2UA 5AP6A 4C34A 3EFWA 5CASA 3DKFA 3OF0A 4W8DA 5HU9A 2HENA 2ITXA 4RVLA 4R3RA 4C02A 4WIHA 2BIKB 2IF8A 4FF8A 4IX5A 5M44A 2C6DA 5CEOA 2OI4X 1GIHA 3UIBA 3AMYA 2JKKA 1OL5A 4QQCA 3OTUA 2QOKA 2ZVAA 1W2DA 3CBLA 4QP3A 2YEXA 4XP0A 2W06A 3GT8A 2BMCA 3F3TA 4IZ5A 4F09A 2YDKA 3RJCA 4E4NA 4YZNA 2X9FA 3ZRMA 3ZFMA 4YP8A 4M68A 2ITWA 1XH4A 1W83A 3EQHA 3MTFA 3M1SA 4IB5A 1LEZA 3Q4CA 5AUYA 5GIPE 3TV6A 2BZJA 5HX6A 1WBPA 5CEQA 3E3PA 3RM6A 4IHPA 2WMRA 3ZRLA 4EOSA 5FRIA 2Z60A 3QGWA 5BVWA 2BVAA 3MH0A 3P79A 5IQGA 3DAEA 5M4IA 3PWYA 1H01A 1KE7A 4BZOA 5DE2A 3ZUUA 3TNPC 4ZLZA 5L6OA 4FVPA 4LUDA 1Q3DA 4UZDA 2C3LA 1OUYA 4FL2A 4A06A 2I7QA 3F82A 1JSVA 1OIQA 4IMYA 3GC0A 3MH3A 2JAMA 5CXHA 1OPKA 1Q5KA 1ZYSA 3WE4A 2UW8A 4UYNA 4V01A 5HBJA 3UO4A 1VZOA 1XQZA 2VWYA 3DOGA 4GMYA 3SDJA 3QC9A 1SYKA 4O0RA 1IG1A 2XCKA 1FQ1B 4ACCA 3VS6A 3U6HA 3LM0A 5HO7A 2AEGA 1PJKA 2W17A 3AD6A 2X81A 1PXMA 2A0CX 5FQDC 4CG8A 4FKIA 3BLRA 2XKFA 2AC3A 2BDFA 5LCJA 4DDIA 4J99A 2AQXA 3EN7A 2XNBA 3F3VA 2OWBA 3UOLA 4O7ZA 3UZRA 2PZRA 5HCXA 3KXNA 1P4FA 4JX3A 4YJUA 4AE9A 2OBJA 3EFLA 4K18A 5L2WA 4U7ZA 4FSNA 1JKSA 3FQHA 1V1KA 4TNBA 4ANMA 1IEPA 4EK6A 4Q2AA 5E1EA 2NNWB 4RWIA 3UMXA 1CKIA 3U87A 3HMNA 4XV2A 4NIFB 5KNJA 4CYIA 4I6HA 4QTEA 4QYHA 4AZSA 4AA5A 3AKLA 2J4ZA 4XNEA 3AG9A 3FLSA 3R04A 2NRYA 5D41A 3E88A 3KRWA 4I94A 4DFXE 5LWMA 3BE9A 3NYOA 4U81A 5AP2A 4RA5A 4DCEA 4IZ7A 2XIZA 3HV6A 2JGZA 4NYEA 3UOKA 4TNDA 3BHUA 3PXQA 5K0KA 4U9AA 5HORA 5CAQA 3V8WA 4EEVA 4I4EA 2BRGA 2PL0A 4M3QA 4E5AX 5E8XA 4YTCA 2GQSA 1Y8YA 3R1NA 4JS8A 2BRBA 5DLSA 4YTFA 3V51A 3EN9A 3IECA 2DWBA 5TOZA 4QP7A 1QMZA 4BCMA 5JMSA 1YI4A 1GIIA 3RCDA 3SVVA 4FKJA 1ND4A 3VIDA 3S00A 3OMVA 5HNIX 4R3PA 3H0YA 4FV7A 4UY9A 4MHAA 2R9SA 2IVTA 4EQUA 2WO6A 3OEFX 2X7GA 3AGLA 4V05A 4FNXA 3WZDA 4PL4A 2UW5A 4CFUA 4JNWA 4DGMA 4ZJVA 4K6ZA 3TYKA 4F7JA 4BL1A 4L3LA 4BWKA 3U55A 3BYOA 5C4LA 5LVNA 1MQBA 1H25A 3KXHA 3PYYA 4CFVA 3D14A 4KBKA 1K2PA 3N51A 4P90A 4XG8A 4IAYA 1H08A 4USEA 3W2PA 2CSNA 1AGWA 3GU8A 5AR3A 4ANQA 4QMPA 4F9WA 4H1MA 2QOIA 4DTKA 3ULZA 1IAJA 2YM3A 4B8LA 4CKRA 5IISA 4GH2A 4XG3A 5FD2A 3LW0A 3I79A 2PTKA 4MNEB 5KX8A 3ZO2A 2ITYA 2ITQA 4D9TA 4ASDA 1DI9A 5CF4A 1S9IA 3BHTA 4MBLA 4U97A 5HVKA 2C5VA 1ZY4A 2JDVA 1BYGA 2J51A 3KVXA 3PXYA 3KC3A 4ZZMA 3VJNA 4FTCA 4G3DA 1WAKA 4KIKB 2R3IA 2J90A 3IKAA 5EKNA 2X7OA 4JXFA 4N0SA 4D0XA 4PL3A 3AMAA 2WU6A 1CMKE 3H9OA 3BPRA 3C4WA 3RPOA 4Q5HA 4UMPA 1Z57A 1RW8A 3H4JA 5J9LA 4FEVA 3VS4A 1XH8A 1W8CA 5L2SA 5JGAA 4E93A 4MD9E 3PWDA 4DE4A 3SG8A 1H07A 5DEWA 5HG5A 4UWYA 4E3CA 4KS7A 4YR8A 2ITTA 3DK7A 1XWSA 1JVPP 4ZZNA 2HXLA 4D2TA 3CEKA 1PXPA 3O5AA 2JDOA 2W1FA 4LGDA 3KEXA 4OTRA 3QQFA 3PFYA 3HP2A 2HELA 3NAYA 3AC1A 2BZHB 2GPHA 5M08A 2R3PA 4OT6A 3MESA 2RF9A 5DWRA 1DS5A 4O6LA 3E63A 3E8NA 4I0RA 4PNIA 3HV4A 3LAUA 1JSTA 4LL0A 2EUFB 3NUSA 1W7HA 2B9JA 4IAZA 4RRVA 3LCOA 4KSPA 1OECA 4F6UA 3LFNA 4J53A 3W0MA 2JIIA 2XBJA 4S31A 2GFCA 2PMNX 2OJIA 2SRCA 3HRBA 5CU3A 3F2NA 5HOAA 1HOWA 1E9HA 4BCOA 5M09A 2OF2A 2C3IB 4C0TA 4C4GA 3ZO1A 3ROCA 3EMGA 4FKQA 3W2RA 3AD5A 3E8CA 3MW1A 4DEIA 2YLFA 5JGDA 3KREA 5EHLA 1RDQE 3EN4A 3H30A 4FTJA 4EI4A 4DEDA 4H05A 3L8XA 4KKEA 2UW9A 3C4ZA 4ANLA 3MVHA 4O6EA 1E1VA 1ST4A 4UALA 3EQFA 2W1EA 4FVQA 1H0WA 2PE2A 4GSBA 5HTBA 3Q5ZA 3N4UA 2C6MA 4FG8A 2F7XE 2CHLA 4RPVA 5AX3A 5T6KA 3JR1A 3CLYA 2ETKA 5FEEA 3VRYA 5A4QA 4DH8A 2X0OA 3S1HA 1ZAOA 1FINA 1R78A 4Y85A 1KOAA 4CKJA 3ZUTA 1OL6A 2QVSE 3I7CA 2PMLX 3NFFB 4JLCA 4E8AA 2GTMA 3LFBA 3UE4A 3KXXA 1PMNA 2A2AA 1XR1A 1BUHA 2R64A 3HV3A 3AD4A 4YURA 3GFWA 4F1MA 2HXQA 4YHJA 3TTIA 3W0RA 4EOQA 1JKLA 1WVYA 1PKDA 3C1XA 4YC6A 2VO6A 4GYGA 4N6YA 3RWPA 3NUYA 2C5OA 4GYIA 5M06A 2VTAA 5AMNA 4A4XA 3KQ7A 3KULA 4FEUA 4CRLA 4QQJA 5DT0A 5CVHA 5DT3A 4YU2A 1M17A 4OTPA 2QO7A 4L6QA 3H0ZA 4YNEA 5EQEA 2VWXA 4DH7A 3R7OA