2UW0A

Structure of pka-pkb chimera complexed with 6-(4-(4-(4-chloro-phenyl) -piperidin-4-yl)-phenyl)-9h-purine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B Through Structure-Based Design
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 107
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw0A02
3K2LA 4FEVA 4EYJA 3GCUA 3HVCA 3D0EA 2UZTA 3DY7A 4XBRA 3RK7A 1WZYA 4I94A 4YR8A 4MBLA 2UZOA 5JKGA 3EZRA 5EHYA 5E8SA 4A9RA 4RVKA 3CS9A 5IA4A 5HTCA 3OCBA 1SNXA 4IAZA 5F94A 2FA2A 3QUEA 4ACCA 2BRBA 3EKKA 5C27A 5G1XA 2F2UA 4L44A 1XBCA 5A4QA 2XJ1A 4BL1A 4KKHA 4O0VA 3BWFA 1M52A 2VX1A 4QQJA 2HZ0A 4YBKA 3PVBA 4JT3A 4YBJA 1ZWSA 2XEZA 5HG5A 2A19B 3VBQA 3DS6A 4GU6A 5GZAA 3R8LA 4XEYA 2XP2A 3QBNA 4KAOA 1OIRA 2PVLA 2YCQA 4FZ6A 4S30A 5AM7A 1NXKA 2F7XE 2Z2WA 2UZNA 3QGWA 4ZLYA 3PXYA 4R7IA 5JT2A 4FV1A 5H8GA 5LMBA 5E1EA 4FNZA 4O2ZA 2WU7A 5ANJA 3WF6A 4RFZA 4C34A 4PV0A 2R3PA 1R3CA 2PVKA 4WRGA 4YO6A 4AZWA 4NCTA 4D5HA 1JSVA 2CGWA 3UIMA 2VWXA 5CU6A 4GK2A 5I9WA 3IW7A 3KK9A 4H3BA 4KINA 4FSTA 2DUVA 2OWBA 4K33A 4V05A 2JITA 2ZV8A 3F3TA 4K8AA 2X9FA 4BIEA 2GTNA 3OVVA 3P7AA 4C35A 4RFYA 5J79A 5AP0A 3KXGA 4RIYA 5ANEA 2QOFA 2YM8A 3ZZWA 5CVGA 1CMKE 4IVBA 4CG8A 4AGCA 3WF8A 1KOAA 4HVSA 3W55A 2JIIA 1FGIA 4A9TA 4CG9A 2QI8A 3LCOA 2O8YA 4FIJA 4I0TA 2YDKA 3QQUA 5IH5A 5DRBA 3EN9A 3CPCA 3V8SA 2PZRA 5CQUA 2F7EE 4ITJA 2FSTX 4G2FA 5M4FA 5FQDC 3PIYA 3DV3A 2UW4A 3ODZX 3OMVA 5C9CA 4D2SA 1YW2A 2VTAA 3OWPA 1YI6A 3V5PA 4FIGA 4PRJA 5AAGA 1DM2A 2QD9A 4QMOA 2JFLA 4DFLA 4J96A 5AR8A 5JQ5A 5JQ8A 5M44A 4G5JA 5CQWA 2XNGA 5KZ0A 3RPOA 2BAJA 3EIDA 4CKJA 3SOAA 2YM3A 4DFYA 4O0UA 3EFLA 5FP5A 5K4JA 3AC2A 4ZEGA 3PUPA 2XJ0A 3WARA 4DGOA 4DGGA 2W5AA 3HV5A 3Q9YA 4YNEA 4R5SA 3ID6C 3MB7A 5DLSA 1H07A 4M7IA 1IASA 2Z8CA 4EH3A 1R78A 4FTUA 4D28A 4GV1A 5GZ8A 3CTQA 1Q61A 3DK7A 3KU2A 2F57A 3DAEA 3UMWA 5H8EA 4BKYA 5A6NA 3QUDA 4IBMA 5LVNA 2RGPA 4L6QA 2VTPA 3P9JA 4FKRA 5C1QB 3V6SA 3R7VA 1OPKA 2OFUA 2OGVA 2YIYA 4XG8A 2J50A 4I5HA 3TJCA 1JVPP 1G8SA 3E63A 2IZRA 3TDWA 2QO9A 4EBVA 2WOTA 3HV7A 1PHKA 1P4FA 2JD5A 3PJ8A 4RVLA 3GENA 4CCUA 3C50A 4E5BA 4F0GA 4OAVB 2C0IA 4IVCA 4KS7A 1MUOA 2ERZE 3R63A 5CT7A 3QFVA 2X7OA 2OW3A 5I9VA 2YACA 5HE0A 5L2TA 5L6OA 3EQGA 4FTCA 3H4JA 1JKLA 2BHEA 4OT6A 4O0RA 2YZLA 3FY0A 3LFFA 4UX9A 3UE4A 3R7UA 1A9UA 2BIKB 2J0JA 3A4PA 2XBJA 3QQJA 4GRBA 3ROCA 5CXZA 4FTMA 5AP5A 3OXIA 2ITWA 4EQMA 1E1XA 4QMSA 5DNRA 3MY1A 4AX8A 1A48A 3KMMA 3QKLA 4F63A 5AUTA 4PQNA 2WMXA 2ITOA 3RBWA 4DH8A 4FE2A 3A8XA 5TT7A 4FIHA 5K9IA 4MXAA 3BIZA 3SC1A 3VW8A 4AOJA 4S31A 3UJGA 2VNWA 1BYGA 1RDQE 2YITA 4MVFA 5IA1A 5KUPA 5ANIA 4YZCA 3RK9A 4GG7A 4QYHA 4BCJA 3A7FA 3A7JA 4Y83A 4D5KA 4UYAA 3BV2A 3Q3BA 2QR7A 3NAYA 2XBAA 5CEMA 2EB3A 2XB7A 3R1NA 5CEIA 4ZS4A 3HNGA 3EQBA 3GI3A 3HV6A 4JBPA 3V01A 4CXAA 1Q8UA 2W06A 5DN3A 2CGVA 2IZUA 5FEDA 3OBGA 4DFUA 2W1IA 4FV3A 4BIDA 2PUUA 1BUHA 3QTRA 4J8MA 3TZ7A 4QMTA 5CAUA 4JI9A 4BY9E 4G6LA 4U3YA 5L6WL 5GIPE 5AP1A 5A6OA 4MCVA 4E3CA 4F0IA 2OXDA 3OWLA 1J91A 3AXWA 1ZYDA 1CKIA 3PXKA 1OL7A 5ANKA 2WKMA 2CSNA 1OBGA 4TZRA 4NEUA 3TNWA 5IA5A 2HXLA 3QTQA 3OS3A 4C4HA 3UIBA 2J4ZA 2ITQA 3FL5A 3C4XA 1YXVA 4ANNA 3OW3A 4LOOA 4BCMA 3R30A 4EL9A 2W9ZB 5CALA 5H8BA 4C36A 1H1PA 1ZYLA 2ZAZA 2X39A 4EOJA 4DT9A 3LFBA 3TEIA 1PXMA 3DA6A 3DTCA 3NR9A 2FO0A 3C0HA 3D7TA 3ZUUA 2I7QA 5CT0A 4JQ8A 4FV4A 4QYGA 5HBHA 2X4ZA 5J5TA 4CZUA 3GFWA 5BVWA 5CY3A 4ZJJA 4ZSAA 5BVDA 1LEZA 4ALVA 2W7XA 2EWAA 2X0GA 5GJDA 4KRCA 2WTIA 4J52A 4IADA 1SVHA 4QMQA 2YCRA 3HRFA 4EH6A 2BRNA 4I3ZA 3BCEA 2R2PA 1YHSA 1F5QA 4NFNA 3CLYA 3KN5A 4QNAA 5EI2A 5AV3A 4Y5QA 3CQUA 4QPAA 2OBJA 4WBBB 3V6RA 4RX9A 3VIDA 4ZZNA 3I7CA 4V0GB 5CWZA 3S2PA 4IX5A 4QQCA 1PMEA 4DCAA 2W1CA 4OT5A 2QNJA 2UVXA 2OZOA 3GC9A 4ZJIA 2J51A 2YDIA 1SVEA 3MV5A 2V22A 2FSMX 4LOPA 2BRGA 3TG1A 4C7TA 3F7ZA 4GFOA 3ZHPC 3G9NA 3NIZA 3NW6A 4R77A 3PWDA 3A61A 4E73A 3KXHA 3BLHA 4EH9A 3ZO4A 1M2QA 2ETMA 3QTUA 4E4LA 3ZFYA 2UV2A 4U6RA 4NTSA 4UMUA 2R7IA 5AP6A 4FG7A 3OTUA 5HGIA 1L3RE 5TR6A 5T6KA 2XKEA 5AP7A 2JKOA 2VTSA 2CN8A 2R3FA 3CC6A 3FZSA 2R7BA 4YZMA 2R3KA 4FIIA 3ATTA 3KREA 2GS2A 2ZDUA 4GW8A 2HZIA 2BRMA 3HV3A 2GU8A 4GT4A 2BMCA 3EQIA 3TNPC 3ZO2A 4UWCA 2ITXA 4LL0A 4AZSA 2OJJA 4FZDB 2UZDA 4JBVA 1OECA 3O96A 4CCBA 4BBFA 3O0GA 4AN9A 1J1CA 3LAUA 4FSUA 4AN3A 5M09A 2BZKB 5G6VA 5M53A 5D7AA 3LFNA 4QTBA 5A14A 4HYHA 2XYUA 2UW6A 4D4RA 5HG9A 3FKNA 1JKSA 2R3LA 4YO4A 1PKDA 2R5TA 4K9YA 2QOHA 4BWXA 2C5OA 3E88A 1PW2A 3MFTA 5CAQA 3QTSA 4LV8A 5C03A 4UMRA 3A7IA 3HRBA 4P4CA 3RPVA 2XNOA 3LXLA 2BILB 4FKOA 1SNUA 3NCGA 3SVVA 4EWHA 5IEVA 4RIOA 2VN9A 4IZAA 3DCVA 4BFMA 3QD4A 4BTMA 3U6IA 3NUPA 4EI4A 3CGOA 4IZ5A 3DNDA 5M4CA 4M13A 3EOCA 3R22A 2WMQA 3EQCA 3R8PA 4AT3A 2PUPA 1UU9A 5A46A 4BDAA 1KE6A 3E5AA 3GB2A 4O6LA 4D9UA 2GNJA 3D5XA 1KE9A 5HLNA 3EL8A 5ETCA 2Z02A 1WFCA 1OKZA 4LGHA 4MD7E 4UALA 3JVRA 5EDRA 2X81A 4ZZMA 4BI0A 1Q3WA 3IDCA 3NUAA 2XF0A 1W7HA 2R0IA 3PG3A 3TWJA 1CTPE 2E9PA 4PWNA 5LQFA 2QG7A 4NUSA 4CMOA 3VN9A 2ZB1A 2IG7A 3DOGA 1IR3A 3OP5A 3TL8A 4N0SA 4LL5A 4MK0A 3N4VA 4EZ5A 3SXRA 5IISA 3OXTA 5DI1A 4O81A 4RLKA 4HYUA 3TT0A 3ZEWA 3COKA 5FTOA 4PUZA 4U0IA 5AV0A 4TRLA 2ZMDA 4QP7A 5HQ0A 5HCZA 3QTIA 4GUEA 1KWPA 3V04A 2QR8A 3FSKA 4AGWA 3CR0A 4BN1A 2XJ2A 2Y4PA 5LCKA 2YLFA 4QP8A 4TWNA 4CKRA 4I1ZA 3SLSA 3W2RA 4S2ZA 4DEGA 2HW6A 4DG3E 4P90A 1B39A 2Z60A 5M08A 3KVWA 4FV6A 4YZBA 5KCVA 3FHRA 1VR2A 2WMBA 4YURA 5B2LA 4LOQA 2IVSA 2J2IB 1O6YA 2YIQA 4FKWA 4ACMA 3TDVA 2XK7A 4EOOA 4TWPA 5BUEA 5CVHA 3WYYA 5K0KA 3TZMA 4Z7HA 4EKLA 4ZY6A 1XQZA 3DBQA 4CFXA 3UZPA 2C1BA 4RPVA 2OO8X 1H01A 2IO6A 3ZDIA 4J97A 4LRJA 3RAKA 3DXQA 2P0CA 4P2KA 4NL0A 3GU8A 5L6PA 2YWPA 3Q5IA 5ICPA 2HOGA 1E1VA 1H0VA 3FBVA 5DPVA 1TQMA 3CD8A 5D11A 1ZYSA 2XNNA 3RP9A 3W1FA 2PY3A 4EHEA 3AT2A 3AMBA 4IXPA 3T3UA 5CSPA 2OIDA 3VS4A 4D0WA 5BYYA 5FTQA 4BVUA 3HDMA 1Q24A 2O64A 4W4YA 3VUTA 1QPCA 1WBSA 3D7ZA 1X8BA 5KMNA 3BLRA 4RJ8A 3EFWA 4CTBA 4FGRA 4R78A 2XRUA 2EXCX 2VO7A 3CKWA 2PZYA 4ACDA 4WHZA 5D12A 3PDTA 1PXIA 2VUWA 1J7LA 2W1FA 2FH9A 3ZFXA 4IAFA 3PXQA 4X7QA 3OW4A 3O7LB 4FKTA 5J8IA 4E8AA 3R01A 1U46A 2KTYA 3F3VA 3KF7A 3BYSA 3QYZA 4GYIA 3ZBXA 2B52A 3F3UA 4OBQA 4QMPA 1F3MC 4FG9A 3VS7A 4A4OA 1PMUA 2XNMA 5BYLA 2XIYA 4DGLC 3H10A 4KABA 1W8CA 2W1ZA 4OTPA 1KE7A 2VTRA 4X3JA 3HP5A 4IVDA 3VQUA 2BR1A 5E1SA 4IC7A 4MEDA 3WE8A 4TWOA 1E9HA 1HCKA 2VWBA 4LRMA 5FM2A 5HU3A 1JLUE 2WEIA 4MWHA 5CAVA 4DCEA 3NX8A 4FL3A 4FODA 4P7EA 1MQ4A 2GPHA 4PL4A 5AP4A 4BZNA 5K0XA 2VGPA 2WQMA 3BBTB 3PA4A 4JX3A 1ZMUA 4FTTA 3NGAA 3KCKA 1K9AA 3E7VA 4RX8A 3F5GA 4NJDA 3F5UA 4FV8A 4M69B 3QLFA 4PMSA 4EH4A 4C2WA 2AYPA 5L2QA 2R3OA 4CFVA 4DFNA 5FEEA 5E8YA 4APPA 1ZLTA 5L2IA 2JLDA 2X2KA 3C51A 2GSFA 2QCSA 3B8RA 2C6IA 4IJPA 4PDSA 2GMXA 3DLSA 5CNOA 4I41A 5KBRA 4S33A 3P7CA 1Q4LA 3BGQA 2YM5A 3FPMA 4A06A 4AW0A 4XYFA 3QHRA 1U4DA 1PXJA 2HW7A 3LXPA 2BRHA 2J5EA 2JBPA 4HYIA 1UNHA 4I24A 3OCTA 2HY0A 3SKCA 2OIBA 4RJ5A 2XNBA 3CIKA 1GIJA 3ROYA 3KN6A 3ZO1A 2CMWA 5EOLA 2R0UA 3ZS5A 3ZXZA 3A60A 4MQ2A 4Y5HA 1W0XC 4LMUA 4O7SA 1YXSA 2C0TA 3MTFA 5I0BA 4R7HA 3SW4A 4OAUC 1UU8A 5HI2A 1FVRA 3B2WA 4IJ9A 5KKRB 4C57A 3DK6A 4D2WA 3ZXTA 5FBOA 3FJQE 5DFPA 5DMZA 4YSJA 3BHHA 5BMMA 2HIWA 3ORKA 2VTTA 4JNWA 3HMIA 3C0IA 2X7FA 3G0EA 2BDFA 4L7SA 2CLQA 3WZJA 5JZJA 2NRUA 3MFRA 2VZ6A 2C6TA 5EQYA 2HAKA 2PVJA 3P08A 5DR9A 5IUGA 3LFDA 2Z7SA 5AR4A 2A1AB 4CT2A 4H1JA 4P5QA 5I5ZA 1MRYA 4RIWB 4BI1A 5DR2A 4WSYA 3OWKA 3KQ7A 2QLUA 4AA5A 4JLCA 3NZ0A 2GNFA 4C3RA 4EHZA 5HX6A 4EQCA 4DT8A 3KL8A 5AX3A 2WTWA 2AUHA 2E2BA 3PRIA 4ZXTA 1M7NA 4AA0A 4KIPA 2HWPA 5CANA 4KIQA 3RVGA 3L8PA 1H28A 2JIUA 4E20A 3UPZA 1Z9XA 3VS5A 4I5PA 1AQ1A 5ACKA 3COIA 2F9GA 4RMZA 5CS6A 2YN8A 1MP8A 4G9RA 2GNLA 3GFEA 3KB7A 2ZM1A 2C3LA 3NNWA 4FVQA 2F4JA 4G3DA 3ZLXA 4BF2A 4AZVA 4LGGA 3RI1A 4MH7A 1B6CB 4Q2AA 2BUJA 2OIQA 4RJ6A 4YPSA 5HG7A 3RPYA 5AUWA 3CCNA 4BDCA 4QP2A 4RFMA 5CAOA 3FWQA 4ZMFA 4G3GA 2BVAA 5KX8A 2XNEA 4K0YA 3VW6A 2J0LA 3M11A 4II5A 5E4HA 4HCVA 3P79A 3TN8A 1K2PA 1WBNA 4H58A 4A7CA 4O7LA 1YRPA 5HE3A 3KULA 3N4UA 1NVRA 4Y85A 5AP2A 3R71A 3T9TA 3ZO3A 2BAKA 2PVMA 3ZSHA 4CGAA 4CSVA 2FSLX 2XKCA 3E7OA 2WTDA 3LCDA 3QUPA 3DZOA 4Y8DA 1YHWA 4GIHA 3CQWA 3E93A 2WOUA 3IECA 5EQEA 4RZVA 3H9RA 1VZOA 4G3CA 5AUVA 4D4YA 4RZWA 4YJUA 2OH4A 5FWKK 5E91A 3M2WA 3L9LA 4GJ2A 3CE3A 3HMOA 3MVLA 4G31A 1PF8A 5TKDA 2RG6A 3C4ZA 4CD0A 3PXFA 4AT5A 5M51A 3WOWA 2XS0A 1O9UA 2Y7JA 4LI5A 3NYOA 2ZJWA 4OTWA 1XH4A 3E62A 3QTZA 4QP6A 3HMNA 2H9VA 1IA8A 3ORZA 1PMVA 5C8MA 4FEUA 2CKEA 3KC3A 2FYSA 4BCIA 5GZ9A 3QCYA 1G3NA 3UQCA 3IO7A 2W99B 2IW6A 2QURA 3OEZA 3ZM4A 4LFIA 4M3QA 5IA2A 4AA4A 4YC3A 3V5QA 5A4TA 4B6LA 4ZTLA 4EH2A 2GNIA 2HZ4A 2PE0A 3NAXA 1M2RA 2J7TA 2ZYBA 3C7QA 3FZTA 4O0XA 1OKWA 4Q5EA 4ENXA 5JN2A 4OUCA 2QU5A 4N57A 1OGUA 4ORKA 3UNJA 2I1MA 5AV2A 3RNYA 1XH5A 3L9NA 4RRVA 1BKXA 3LFQA 3R7IA 1Q99A 2UZWE 3IOPA 1TQPA 3RCDA 3V8TA 2OKRA 3NCZA 5CF4A 5HD4A 3U6HA 4O83A 1P5EA 3C13A 3HP2A 5I9UA 3HUBA 5C4KA 3W2SA 3QZGA 1XH9A 3MH2A 3HX4A 5LMKC 1U5QA 4U43A 2XVDA 2CGUA 2I0HA 4EKKA 4EJ7A 3W32A 4XJ0A 2XIRA 4BDDA 2HXQA 4C0TA 4RIXA 5FM3A 4ANQA 3RTPA 2F7ZE 2JAMA 5B2KA 2GQSA 3DXPA 2PHKA 2DQ7X 1TKIA 1JPAA 5CU2A 5AP3A 2R4BA 4FOBA 2WMAA 4F7SA 3PSBA 5M06A 1FPUA 4PMMA 3ORLA 4FX3A 4QMMA 3FI3A 5L2WA 4PTEA 3ZMMA 2HK5A 4HGSA 2UUEA 1JKTA 1H8FA 3R04A 3V5LA 2WAJA 3HGKA 2VWIA 2UZLA 2E9VA 4FNXA 4C2VA 5HE1A 1XH8A 4YJQA 2R3RA 4EBWA 4ZTMA 4HZRA 3C4CA 2PMOX 5CF6A 5A3XA 3V51A 3WF7A 5AJQA 4ACHA 3D5WA 4EK6A 5K4IA 1H1SA 4MNEB 5I3RA 1R1WA 4FBXA 3V8WA 2W1HA 4O0YA 3MIYA 1PMNA 3RAIA 4EOSA 4QD6A 5T3QA 4AU8A 3SXFA 4BCOA 4EZ3A 1SMHA 2WTJA 4WBOA 3ZC6A 3ELJA 5DGZA 3R9OA 2QKWB 2PULA 2WTCA 1J7IA 2A4LA 5ITAA 4QMXA 3LE6A 4CKIA 4AUAA 4DGMA 3ZTXA 1CKJA 2I6LA 3LLAA 3D15A 2VD5A 4BCGA 4XG2A 2NPQA 4ITIA 4DLIA 5KHXA 1FOTA 3W2QA 4OTGA 2WEVA 5E8ZA 5HO6A 2R3HA 3ULZA 4O7YA 5IMXA 4IB3A 3ANRA 3QZIA 2XK9A 1ZXEA 4FNWA 4CZYB 1DAWA 3CJGA 5J87A 4W9WA 3I6UA 5DG5A 4C02A 4ZSJA 1B38A 4TT7A 4FKVA 1YXUA 3LVPA 3R6XA 3OT3A 4TKSA 2B55A 4FEQA 3UODA 4I23A 3OZ6A 4FA2A 2O63A 5BMSA 3A99A 2QKRA 2OG8A 4Y73A 4XG3A 2WMUA 2OU7A 3ALNA 2IW8A 1ZMVA 4KSQA 3ZRLA 4C3FA 4WSQA 2Y6OA 5FXRA 1FMKA 3IDBA 3WF9A 5EYKA 4USEA 1OL2A 3POZA 4C37A 4MWIA 3TZ8A 3FLSA 5J9LA 3QKMA 2W96B 3P23A 1H24A 3LJ0A 5EH0A 4G34A 4MKCA 4IX4A 4EK5A 3QHWA 2E9UA 3D7TB 3UPXA 3P7BA 2OZAA 3BGPA 2YLEA 4AGDA 4R7BA 4L42A 3KGAA 3VS1A 3BHYA 2B9HA 4D4VA 3KK8A 2PMIA 2XRWA 5EW3A 3R7YA 3FZ1A 2I0VA 3DNEA 3PZEA 2VX3A 4HJOA 3W8QA 2KULA 3R7GA 4PF4A 1UWJA 1V1KA 3LKMA 5E8TA 4RGJA 4A9UA 2JKMA 1PYEA 2WQEA 4NZWB 4BKZA 3UNKA 4DEDA 1M17A 2YERA 5ACBC 4F1TA 3BLQA 3P4KA 3PPZA 2Y8OA 3UG1A 3LCTA 5CF5A 5C8NA 3AC5A 4DGNA 1H27A 1P4OA 3DAJA 3O51A 4EOIA 3MYGA 5AV1A 1KOBA 2W05A 3LZBA 4ERKA 2C0OA 2YJRA 4ARKA 5AA9A 3TKIA 2C69A 4A4XA 1OZ1A 2HYYA 1BLXA 4MXZA 3SAYA 3R2BA 4RA4A 3EFKA 4M8TA 5CVFA 2C5VA 3RHXA 4QMZA 4M12A 2X8IA 3FC1X 3FV8A 1UKHA 3FLWA 4HCUA 1XWSA 4RC2A 4ZIMA 1RE8A 3ZLYA 5BVFA 3KY2A 5L3AA 4JS8A 3JR1A 4JG7A 3VAPA 3S1HA 3LQ3A 5HVYA 4QOXA 2C1AA 3RZBA 4RC3A 4C61A 4J98A 5DIAA 2C3JA 3I1AA 2H6DA 3TTJA 5CASA 3R02A 3GXLA 2O2UA 2Y4IC 3UZRA 1OIQA 3QQKA 4NWMA 4O7RA 1JKKA 1H0WA 4R6VA 3IKAA 4JRNA 4LYNA 5IEYA 3MH1A 1Z57A 4OTHA 4IVAA 3JS2A 4E6CA 3F9NA 3DFCB 3FQHA 1W82A 2G9XA 4NM5A 5CEQA 3RJCA 5KKRC 4UZHA 4FL1A 1BL7A 3LOKA 4PMTA 3CQEA 3Q4ZA 3Q9XA 4YHTA 3AOXA 5J95A 4AACA 4DHFA 2V5QA 4AOIA 3S95A 1UKIA 1ND4A 3I0OA 2YCFA 4G16A 3O2MA 4O6EA 3WBLA 1JSTA 4G3FA 4ZY5A 3OT8A 4LUEA 2ZV9A 3GOKA 2C3IB 3VO3A 3I5ZA 2GHGA 3FMLA 3FLNC 5A4EA 1URWA 3G6GA 3PPKA 3BYUA 3UG2A 5LARA 3Q60A 2OFVA 3LFAA 4PPCA 4ANLA 4BDBA 3FZOA 3GT8A 4KD1A 4E5AX 4R1VA 2ZB0A 3W2CA 4K1BA 3ENMA 1OITA 1U59A 3FDNA 3GQLA 3PA5A 5LJJA 4DN5A 3L9PA 3OTVA 4U9AA 4LRKA 4FK6A 4DFZE 4FSQA 2OLCA 2CLXA 1NW1A 5ETFA 5C4LA 3KRLA 3PE1A 3IDPA 3F69A 4XP3A 4L46A 5AAEA 5KZIA 1W98A 3OY3A 3DPKA 4QP3A 3VJNA 5HICA 1ZZ2A 4FV5A 3BYOA 3FL4A 2YM7A 3ANQA 2WMSA 3GVUA 4HOKA 3UMXA 4ALUA 5J7HA 1PXPA 2BTRA 4K6ZA 4JDJA 2YHVA 4FKJA 2RFDA 4BCKA 4AN2A 4XG9A 1OPJA 4WNOA 5JGAA 4YC8A 2GHLA 3NYXA 4M14A 4L3JA 4FI1A 1WBWA 3TTIA 3VBYA 5L8LA 2XMYA 3D94A 4PL3A 3MTLA 3QYWA 3A7HA 3RZFA 2VTNA 3ZCLA 2VTHA 2O65A 3CY2A 3OFMA 4M0YA 3VHEA 4F09A 3Q96A 3HL7A 3A2CA 5JFVA 5ANGA 4NIFB 4WUAA 4U44A 4AQCA 1PY5A 3EB0A 5J7BA 3QLGA 4RJ7A 4RT7A 3ZEPA 4D2VA 3ZUTA 4HPTE 2YJSA 5L4QA 5DT4A 2XH5A 3H3CA 2J9MA 3ZLWA 3E8EA 5IUIA 3NUUA 2CCHA 5F9EA 3NVMB 3GUBA 4ANOA 3BHVA 2VTOA 3W16A 4B7TA 4HPUE 4KIOA 3JPVA 1UV5A 3T9IA 4AW1A 5B2MA 3PJ3A 2BZIB 1FBNA 3F82A 2PZ5A 1RQQA 1AGWA 1EH4A 1LP4A 1QPDA 1Y91A 4WG5A 4X2KA 4ANMA 5IQAA 4IMYA 1VYZA 3QA0A 4DTBA 5KE0A 3G33A 3TUBA 3PZHA 5BVOA 2WB8A 3LLTA 4WG4A 1TVOA 4C4GA 4GT5A 2PVFA 4BCNA 3HV4A 4YJVA 2W4JA 3O7LD 4ZMEA 4AXAA 5LXMA 4FYOA 1ERKA 4ZJVA 5F4NA 3O8PA 2Q0BA 2QO2A 4BC6A 5LVOA 3VBXA 4UWYA 5HX8A 3SG9A 4J53A 1M7QA 2GNHA 1H1WA 2YZAA 1APME 3MA6A 3PWYA 4ACGA 3HAMA 4PX6A 4EOLA 5F1ZA 2PTKA 4EEVA 2JC6A 4L43A 3AD4A 3MS9A 3RAHA 4AS0A 5HORA 3QWKA 3ZSIA 2JDSA 5HE2A 4QTEA 4D1ZA 2ITZA 4X2JA 4D0XA 1AD5A 4UWBA 4L45A 3MFSA 4U79A 1REJA 3RINA 4HW7A 5BNJA 4BIBA 4Y72A 4IAYA 3FZRA 5GJFA 2H96A 5ETIA 2QHMA 4LM5A 2G2IA 4L01A 4DEIA 4DYMA 2EB2A 4YJTA 4AG8A 5E7RA 3Q4UA 5CLPA 2B9FA 1Q41A 3QKKA 4FT7A 2A0CX 4KWPA 1OL5A 5CU3A 3R1YA 4IAIA 2P55A 4TYIA 4EOMA 2JFMA 1WVWA 2H8HA 3S0OA 3NPCA 3WE4A 4HNIA 2WTKB 2OF2A 4IDTA 5IDPA 3ZOSA 3B8QA 2JGZA 1SZMA 3COMA 3AGLA 2C5NA 2QG5A 3EWHA 4I4EA 3F2AA 4XH6A 1WBOA 4JAIA 4FT5A 4C4FA 3KF4A 4F4PA 1G5SA 4GSBA 1CM8A 4XMOA 3QXOA 3HDNA 3ZUVA 3PJCA 2QLQA 4ASDA 4AWIA 5GHVA 4TTHB 2PU8A 4KIKB 3ZRKA 3R9RA 2Z7RA 1QL6A 4LV5A 3NRMA 1UU7A 2NO3A 2J0KA 4M67A 4D2TA 5FG8A 4IWDA 4RQKA 1S9JA 3OROA 3M1SA 3BQCA 3Q9WA 4EC8A 5JK3A 2X2LA 4FT3A 3MY0A 3BU3A 2XEYA 3FMDA 2BDWA 3RKBA 2GHMA 3DDPA 3EZVA 4PL5A 2UZBA 4F7LA 5KMJA 2R64A 4GFMA 2X8EA 3FMMA 2YIWA 3NUSA 2OJIA 4O86A 5T68A 4I21A 4FZAB 2WIPA 2PL0A 1OB3A 2IZSA 5I9ZA 3EQHA 5LVLA 4UXQA 1OPLA 3LCSA 4JIKA 4RG0A 3R83A 3G15A 3EYHA 4FUXA 4RJ3A 4C62A 5ANDA 2GFCA 3PXRA 4ASEA 1KUTA 1ZOEA 2BTSA 3FKLA 4BDGA 2P2HA 2V7AA 3FYJX 4X6QC 3QXPA 4DEBA 2A27A 2B7AA 4MNFA 4IX3A 4PTGA 3WF5A 2LGCA 4NSTA 5L8KA 4NT4A 2OXYA 3MVMA 3E3BX 2ETKA 2QHNA 4NK9A 3BGZA 4QTDA 5I3OA 4AE6A 4H3QA 4W8DA 4E4NA 3OD6X 3QCXA 4YJPA 3EQFA 2UW5A 2VRXA 3AMYA 4JR7A 4BRXA 3F88A 3I0QA 3OG7A 4F7NA 1XBBA 5TF9A 4CT1A 3CD3A 2F49A 2B0QA 3IPHA 3L8VA 2BHHA 3AG9A 2SRCA 4BGQA 4UYNA 2Z7QA 4AZTA 2OXXA 4V0GA 4U42A 4WG3A 1YDRE 3FI8A 4QQ5A 4AW5A 3DAKA 4DH5A 2OJ9A 5IH6A 5HO8A 5DT0A 2GDOA 2NP8A 5JZNA 2WMVA 5I4NA 2PVHA 3LMGA 5BQ0A 3F2NA 2CKOA 2GFSA 4JAJA 4E4XA 3SRVB 2VWZA 1URCA 1GZ8A 3R1QA 4F65A 3F2RA 4IEBA 4C38A 2JDTA 3HA8A 3FMKA 1R0EA 3DXNA 3WZEA 2ZMCA 5CSWA 1U54B 2XKFA 3R9HA 5AA8A 5H2UA 4QYEA 3N4TA 3FXWA 2PVRA 4M84A 4B9DA 4JL9A 4K11A 5EDQA 3NVKI 4GVJA 4FZFB 2VTMA 3O8TA 2UVZA 4O7WA 1W84A 4LQMA 2XCKA 3R00A 3QQFA 3NW5A 5TOZA 4DTKA 4EOQA 4Q9ZA 2GQRA 1P2AA 2R3IA 5LVPA 4AAAA 4EJNA 4NW6A 4DG2E 4MBIA 2QU6A 2C4GA 2J0MB 4IM3A 4N4SA 5DVRA 3BRBA 3ORMA 3PY1A 4U7ZA 5AR5A 4CNHA 3TNQB 1ZYCA 3AMAA 4QMYA 4MBJA 4YJSA 3RPSA 2IPXA 3AD6A 5J5SA 4F7JA 4TNDA 2PE2A 1REKA 3VUGA 5CAPA 1PYXA 3JXWA 3AC8A 3OXZA 3GEQA 3TKHA 3H9FA 1OUKA 1BMKA 4XP0A 4TYHA 3G9LX 4XHKB 1FQ1B 4ZLZA 4H3PA 4X3FB 3PVUA 4Q9SA 3TNHA 4HNFA 5DEYA 4D58A 3HYHA 3KVXA 3PVWA 3QL8A 2C6MA 1CDKA 4ZSLA 1SM2A 2VTQA 4MF1A 3KFAA 3ORTA 4YGAA 1P14A 3RMFA 2ZV7A 1UNLA 1GIIA 4OTQA 3CXWA 5FLFA 5LMKA 2QOCA 2UW7A 5EM5A 1KV2A 4KBAA 2XK4A 2RIOA 1PRYA 3KMUA 1YI4A 4NW5A 4A4LA 4YZNA 4MHAA 2C6OA 2C5YA 3QTWA 5AIRA 2W0JA 5HD7A 4R3CA 5K5XA 3MH0A 3KXNA 2QOBA 3D4QA 3K3JA 3V5TA 3CY3A 4ZZOA 2PYWA 2PMNX 2VO0A 4WD5A 2WD1A 3E87A 1STCE 3EN5A 3NUXA 4NFMA 4O22A 4YC6A 4BDFA 5EM6A 4FC0A 4YZ9A 4RC4A 3VBWA 3EQPA 4NU1A 4G9CA 4R1YA 4EQUA 4ITHA 3KRRA 4X0MA 4CLIA 2IN6A 1Q5KA 5FEQA 4I0RA 4CEGA 3P1AA 3F61A 3WZDA 4JRVA 5L2SA 4X6RA 5A9UA 3MWUA 3VS6A 4BWKA 1ZOHA 3EQRA 4BCPA 4KA3A 3NDMA 3ET7A 4FSRA 3A4OX 2GS7A 3QD2B 4RIXB 3QRUA 2OSCA 3DJ5A 2NRYA 3R9NA 3EN6A 4FV0A 5AX9A 3E3PA 3DT1A 4XNEA 5D10A 3GOPA 4FTLA 3A7GA 3VUIA 3ORIA 3ZDUA 3VHKA 3L8SA 1IEPA 3NNUA 3LQ5A 4XX9A 4MD8E 5CSVA 4XBUA 4RVTA 4EC9A 4BB4A 5AIKA 4LUDA 4UMQA 3ZBFA 1HOWA 4O7NA 3G51A 5IU2A 3UNZA 4RQVA 5D7VA 5KMLA 1GZNA 4WIHA 3UO6A 4ALWA 3EJ1A 4Y46A 4BCHA 4D1SA 3AT4A 4O7VA 1GOLA 1Q62A 4RWKA 3VWAA 4BBMA 4BHZA 4CMTA 4E6DA 3U4UA 1J1BA 4EH5A 5FDPA 5TO8A 2WQNA 3C1XA 5CSHA 4A07A 3FAAA 3IW4A 4ZAUA 3KRXA 1FMOE 3IG7A 3U51A 4EHGA 2JKQA 2P4IA 3I6WA 2DWBA 5HG8A 3K5UA 2JDRA 2W1EA 3W18A 4DLJA 3BPRA 4Z7GA 3WIGA 2WGJA 3E8NA 2VO6A 5IG1A 2W4KA 3LHJA 1GZKA 1OVEA 1PXLA 3DJ6A 3AD5A 5GNKA 4PP7A 3HZTA 1PKGA 5J1VA 5H9BA 1H25A 1OKVA 2V55A 5FDXA 3E8DA 3EN7A 3BV3A 5JMSA 3D2IA 2WQBA 3TIYA 3TI1A 5M07A 2VTIA 3EKNA 5DH3A 4OGRA 5BUIA 5EFQA 2RSVA 1CKPA 3FUPA 4IM2A 5FXSA 4ZSEA 3V5WA 3LJ1A 2JEDA 4IH8A 5EK7A 3WZUA 1MQBA 3WIKA 1OL1A 3QQLA 1YHVA 1RW8A 4ZOGA 2YM4A 2J6MA 4RIYB 3AC4A 5D41A 4BZOA 4CVAA 4RX5A 2CKQA 4QMLA 5JFXA 3PRFA 5HBJA 5IQFA 4BCFA 4NM3A 5E8UA 2FSOX 4F6UA 3BEAA 3RALA 1WVYA 1Y6AA 2P3GX 4IX6A 4APCA 1Q8YA 1Y6BA 2VAGA 1KE8A 2WPAA 3M42A 3FPQA 3CEKA 3UYSA 4M69A 5IF1A 3B2TA 4BTFA 3ZZEA 4OBOA 1NVSA 4IHPA 2QQ7A 5AM6A 4C4JA 4O7ZA 3AQVA 3NEWA 4L8MA 3OUNB 3LFCA 3EYGA 4U45A 3NW7A 2Q0NA 4XG4A 3UVPA 3D83A 5M57A 2OZAB 3EN4A 3OWJA 3WILA 1I44A 4A9YA 3UQGA 1M14A 2YABA 2JIVA 4QTCA 4XV9A 4BGGA 1G8AA 5BVNA 1RJBA 4QP1A 2QOIA 1BI7A 4IQ6A 4YTHA 3UIXA 4I6QA 3I81A 5BVEA 2YIXA 4O27B 4YP8A 4KUJA 4FT0A 4FTOA 3UVQA 2G1TA 1JSUA 4IC8A 3TKUA 2F2CB 3FQSA 4LGDA 2EXEA 3O50A 1JBPE 3VJOA 2QOLA 4TYGA 3IGGA 4QMVA 1O6LA 4U97A 4O96A 2VWYA 4G5PA 4BZDA 4GKIA 1LEWA 4RSSA 3MH3A 3N51A 4G6OA 3TV6A 3IQ7A 3D14A 2X9EA 3L8XA 4AZFA 4V04A 2JAVA 3C4EA 3CPBA 1LR4A 3Q6UA 3BQRA 2X8DA 3RWQA 5JH6A 3FMHA 4J1RA 3LCKA 3QC4A 1WBVA 4E93A 5CU4A 5HVKA 4Q5HA 3MY5A 4TPTA 4I6HA 2CHLA 2WXVA 3VVHA 4TYJA 4N6ZA 2OJFE 2PUIA 5LOHA 5CI6A 2XNPA 4RX7A 2OI4X 4FSMA 4OBPA 4FL2A 4BDEA 3U54A 5FGKA 5HESA 5JRQA 3PG1A 1H26A 2FVDA 4BKJA 3LMHA 3ZM9A 4IB0A 4GUBA 3EMGA 3UOLA 4EOPA 1Y8YA 4RIWA 3PTGA 4FVRA 2WMTA 4R8QA 4U81A 4YTCA 2HCKA 4G3EA 2XUUA 2R3QA 4JG6A 3U6JA 1DAYA 4J95A 3RPRA 2ONLC 3NUYA 4I92A 4UB7A 4QMNA 3FYKX 3II5A 4D1XA 4F9BA 4DE4A 4EK4A 4O38A 1PXNA 4XG7A 5K5NA 3QC9A 3GGFA 4YPDA 5E8VA 3FLQA 4BDJA 4HVHA 4H39A 3UBDA 4JJRA 4R5YA 3ALOA 3ZONA 1H08A 4AFEA 4FKGA 3WYXA 5LCJA 2QONA 1BX6A 4IIRA 3FQEA 4FUYA 1V0BA 3MBLA 1NT2A 4IZ7A 4PNKA 5EM7A 4Z55A 2HENA 3V5JA 3SW7A 3A62A 3R8UA 4XV3A 4HZSA 5CU0A 4CFUA 1FVTA 2E9OA 3JVSA 4RA5A 1IRKA 4JXFA 4I20A 4ANBA 4E6QA 4BCQA 4IM0A 4K2RA 4ZSGA 3LMIA 4O0SA 5M56A 5GINE 2WIHA 2Y9QA 3KEXA 3MPAA 4DBNA 5AEPA 4U8ZA 5EHOA 3QX4A 5CTPA 1Q8ZA 3I79A 2V7OA 2AC3A 4ZTRA 5BX0A 2ZV2A 2WFYA 2WQOA 4R3RA 2JDOA 5BYZA 4ZY4A 4EYMA 3RGFA 2UZEA 4GU9A 4WKQA 4U5JA 4XV2A 4WA9A 1FVVA 3UOJA 1XHAA 3VF8A 3I7BA 2OK1A 3PP1A 4FIFA 4OW8A 4F9YA 5ETAA 1L8TA 3R8MA 4DF3A 3NWWA 5A54A 4RWIA 4YMJA 2PWLA 5E92A 5HCXA 3THBA 1WCCA 3PIXA 5JSMA 2WMRA 1LUFA 3ACKA 1GZOA 1QPJA 2UW8A 2W1DA 4L7FA 2XA4A 5J9YA 5DYJA 2I0EA 5AR3A 2WNTA 3TNIA 4E7WA 1NVQA 2C3KA 3BI6A 3CTJA 2NNWB 3MPMA 5HTBA 2C5XA 3TUDA 2O5KA 2BAQA 1YOLA 1JQHA 3GC8A 4GH2A 3PA3A 2CJMA 4KBKA 2O3PA 2PZPA 4FTAA 4PP9A 5IQCA 5EOBA 5L8JA 2CKPA 4UEUA 4L52A 2VWWA 4DAWA 4O2PA 3SOCA 4XLVA 4FVPA 4FIEA 5DEWA 1U5RA 2W4OA 4BTKA 5IZFA 2XIXA 4BGHA 2XYNA 3NUNA 4FSYA 1YOMA 3IW6A 3VRZA 4KB8A 2CNVA 4O0WA 1OBDA 4FV7A 4YJOA 3BZ3A 1WAKA 2RFSA 4MYGA 2OH0E 4YJNA 3ORPA 4IW0A 3VUDA 4U40A 2QOKA 3LM5A 2REIA 4YJRA 4IDVA 3CBLA 4HVGA 4ZLOA 3NNXA 5AUZA 4IFCA 4X3FC 4C4EA 1UU3A 2IVUA 3LPBA 4CYJA 3DJ7A 3KKVA 3GU5A 4LMNA 3KXXA 4F08A 4M97A 2ZM4A 3Q2JA 1OM1A 5DR6A 3K3IA 5HOAA 5AUUA 3OC1A 4IAAA 1H1RA 4XP2A 3DKCA 3O23A 2PSQA 2B9JA 5DE2A 4FMQA 5D9HA 4CQEA 5D1JA 1S9IA 3I60A 4U80A 4KKEA 2BIYA 4XS2A 4IAKA 3R28A 1PXKA 4WNMA 3T8OA 1OKYA 3E64A 4DH7A 5HO7A 3HMPA 5BPYA 3IOKA 4NKAA 4HVIA 1MRUA 4L00A 3IW5A 3VBVA 5IA0A 3ZH8A 4UV0A 3NYNA 1YQJA 2CDZA 5KO1A 3T3VA 4TWCA 4KRDA 5DT3A 3C5IA 3D5UA 3MSSA 4JX7A 3R8VA 2C68A 4L3PA 4YZDA 1VEBA 4PPAA 3P86A 3PIZA 4PDOA 4AOTA 5AFVA 1BI8A 3QTXA 4C58A 5KMIA 3C4WA 5AR2A 5B0XA 4RBLA 1DI8A 3UC4A 3GCVA 3KCFA 3MVHA 4XV1A 2RG5A 3D2KA 4IANA 2IWIA 2CGXA 3NMUF 3QRKA 5IDNA 5EKNA 4MNEA 3SXSA 1DI9A 3BE9A 3PY3A 3DQXA 3HA6A 4FR4A 4OTRA 2ETRA 1YXXA 3KMWA 3R21A 2UW0A 4JBOA 4WNKA 1VYWA 3LXNA 5CEKA 3R0TA 3QRJA 4FTKA 4GJ3A 3HLLA 3BKBA 4EOKA 3OCGA 3OCSA 3FY2A 2XZSA 4QYFA 2ITTA 4E5WA 3SGCA 2VNYA 4XUFA 4C59A 3K5VA 2QOQA 3DGKA 2IVTA 5DHJA 4DBXA 4O84A 2QOOA 4ASXA 1Z5MA 5JGDA 4TYEA 2ZOQA 5DWRA 5DRDA 1OIUA 4JBQA 4XLIA 3VULA 3FLYA 2RFEA 4EONA 4W8EA 3OF0A 1GNGA 1Y8GA 1YVJA 3G90X 3OHTA 2B1PA 4QMUA 3SDJA 4CQGA 1Q97A 2WZJA 4Z3VA 3N9XA 3MI9A 3RNIA 4EORA 5LVMA 4H05A 3ZU7A 4QTAA 4FV9A 4E4MA 3FSFA 4XG6A 1QMZA 3R7EA 4BTJA 2PUNA 2VGOA 4GK4A 4BICA 3RWPA 3U9NA 1OL6A 2X6DA 4PDYA 5F95A 3DKOA 1KSWA 4MF0A 3ZSGA 5HLWA 1Y57A 2FUMA 3R2YA 3W10A 3DLZA 2BFXA 4FKUA 3NLBA 3BYMA 4NM0A 4BDIA 4NCTC 3UO5A 2GQGA 2CPKE 2PZIA 3U87A 2G15A 3R9DA 4BWPA 3MW1A 4O1OA 2V62A 3POOA 3SHEA 3SX9A 1W83A 1OUYA 2JDVA 5I9XA 5HHWA 2VU3A 2RF9A 5JGBA 4J7BA 4J71A 3TUCA 1XKKA 3ENHA 4I6FA 5HNGA 3MDYA 3NSZA 2X6EA 4NH1A 4I22A 4FT9A 5J1WA 3G5DA 4C3PA 4DEAA 3Q53A 4USFA 2EVAA 3FZPA 2UW9A 2YISA 5JEBA 5HTIA 5CEPA 3Q04A 3VNTA 5E9EA 4ZTHA 4EK8A 4N6YA 4KNBA 4ZTQA 2ZM3A 2Z7LA 4GCJA 4XOZA 5EDPA 4QO9A 1DS5A 2BZHB 3VBTA 4X2FA 4GMYA 4X21A 4GKHA 4D2PA 5E8WA 3CJFA 3GBZA 2CNUA 5IMEA 4AE9A 2JBOA 4X2NA 3R8ZA 4PTCA 4F9AA 5FTGA 3RK5A 4QT1A 4QPMA 3GU6A 3NS9A 3C0GA 3R1SA 5BUJA 2VO3A 3W2OA 4UZDA 3OOGA 5EM8A 4Z9LA 5EQPA 3GQIA 3DDQA 3ZRMA 2QVSE 3ZYAA 4OTFA 1T45A 4L67A 5EW8A 5C26A 5HBEA 2AC5A 3LXKA 4FZ7A 3LFEA 4G17A 2G2HA 4EUUA 5HVJA 4ZS0A 3KXMA 3LIJA 3R73A 4CFWA 4O7TA 2GTMA 4ONAA 3DBFA 5ANOA 3VUKA 4FG8A 3V3VA 3Q4TA 5CNNA 4O1PA 2OJGA 1IAJA 3MJ1A 4NKSA 1XR1A 4FTIA 1UVRA 5CENA 3TZ9A 1YDSE 4L68A 1XH7A 4ANSA 4C8BA 4PY1A 5KMOA 4FSNA 4FKPA 3IS5A 1FINA 3MIAA 2BPMA 4YU2A 3F3ZA 4GFGA 3AGMA 3CKXA 4YLLA 3VRYA 5FBNC 2QC6A 5DOSA 5CEOA 1ZOGA 4OLIA 3QX2A 3FMJA 3Q4CA 2EU9A 4BYIA 3COHA 4ERWA 5HIDA 4CV8A 3GCQA 4IWQA 3QZFA 4O0TA 5EHLA 3PVGA 3RCJA 3TIZA 5IH4A 4RWLA 4YSMA 1PXOA 3JY0A 4MXOA 4C33A 1A06A 2O0UA 3IW8A 5B7VA 2ERKA 1WBTA 5IQIA 1YOJA 1V0PA 3F3WA 3BWJA 4TYHB 4UBAA 5GJGA 4RVMA 4HGLA 3O71A 3QCQA 5K3YA 5BVKA 2DS1A 4FEXA 4D55A 4BYJA 4B8LA 1T46A 4FYNA 4H36A 1H4LA 3VUHA 2IZTA 4ASZA 5HIEA 3DB6A 1Q3DA 3RAWA 4F0FA 2CN5A 1YI3A 3ITZA 3DBCA 3PJ2A 4XRJA 3ODYX 3TV7A 5IQEA 3G6HA 2R3GA 1R39A 2A2AA 2YDJA 4RJ4A 2BCJA 5CI7A 5JRSA 5AR7A 2IW9A 4M15A 4QPSA 4FKLA 4NJ3A 3EL7A 3BX5A 3QCSA 1VJYA 2GS6A 4FEWA 3BBWA 1ZZLA 4CLJA 4I5MA 5LWNA 3QQGA 4DA5A 5C01A 2WU6A 4IACA 3W2PA 3UC3A 1XJDA 4JDIA 3UYTA 3PP0A 2YIRA 4WNPA 1GIHA 4NM7A 1GAGA 2PE1A 3ORXA 3Q32A 4L53A 4W9XA 4YNOA 4A9SA 5HZNA 3UP7A 4WOVA 2IVVA 2C30A 1QCFA 4N70A 3ATSA 4IWOA 3BEGA 4U41A 3FEGA 2X4FA 3MN3A 3Q6WA 3H9OA 3PFQA 4DFXE 3C9WA 2HELA 4M0ZA 5HKMA 2HZNA 3OOMA 2HY81 5GIOE 5EYMA 3D9VA 3BU6A 3HKOA 3KA0A 4NIFA 4I4FA 4IB1A 3GCSA 4RLLA 3VS2A 1H1QA 2XIZA 3DBDA 3H0ZA 4IWPA 4MXYA 3NYVA 5AUYA 1PJKA 2OF4A 3JUHA 5KBQA 4DINA 3PSCA 2WMWA 3QZHA 5EI6A 5IPJA 4L3LA 3EH9A 2X7GA 3FE3A 5IQHA 3LFSA 5CYIA 4C4IA 1BL6A 3RM6A 2YFXA 3UTOA 4AW2A 3ACJA 5IA3A 3GNIB 4I6BA 3VF9A 2PMLX 3UIUA 2FB8A 5DA3A 4YLKA 3A8WA 4W4XA 1FGKA 4FSZA 3MJ2A 3QAME 4FKIA 3IK3A 4IZYA 1CSNA 1ZAOA 4EUTA 4R3PA 4BDHA 4F9WA 5FUTA 3PSDA 3HUCA 3PLSA 1ZYJA 3EFJA 4B99A 5JFSA 3UVRA 4HGEA 3H30A 4FKQA 2R3NA 3JY9A 1HCLA 4FTQA 5E90A 2EUFB 4GYGA 4F70A 3QWJA 2ESMA 2GNGA 5CSXA 2BALA 3GCPA 3IGOA 3UO4A 4D4SA 2BROA 3GP0A 3KRWA 4GS6A 4WRSA 5F20A 4F6SA 2RL5A 3KULB 3MFUA 1OIYA 2W5BA 1YKRA 4E6AA 3CTHA 3PLAE 4O21A 4NTTA 3FHIA 4EWQA 3UGCA 4CV9A 3C4FA 3U8WA 1TQIA 2I0YA 4LG4A 3MVJA 1IAHA 3E8CA 1YWVA 3EQDA 5M4UA 3ERKA 3FXZA 4YHFA 1XBAA 4HYSA 4UY9A 5KHWA 4QP9A 2PVNA 4YHJA 5EYCA 4RWJA 2YM6A 3DTWA 3DQWA 1ZRZA 2YA9A 1NA7A 3MPTA 4GVAA 4TN6A 2XK6A 1V0OA 4Z16A 5I9YA 1ATPE 2J90A 4CYIA 1JWHA 4AGUA 1OI9A 2ACXA 4HGTA 4QMWA 3TXOA 1SYKA 2B9IA 3K54A 5J9ZA 4MAOA 2UZVA 4DITA 4OR5A 2YCSA 2BKZA 4IE9A 4MQ1A 2XK8A 4QP4A 4CFNA 5JFWA 1J7UA 3HAVA 3OUKA 3ZLSA 2P2IA 3VC4A 4FTJA 2WELA 3FI2A 3OY1A 4G6NA 3BELA 3BE2A 3VQHA 5EW9A 3GU7A 4GK3A 3UQFA 4IFGA 4DFBA 4D9TA 2IJMA 4S32A 3QU0A 5IQDA 3MESA 2I40A 3HECA 4KKGA 3FKOA 3JYAA 4B8MA 4CRSA 4AZEA 1SVGA 1WVXA 2FGIA 3HEGA 4FTNA 3TJDA 3WZKA 4W4VA 4MD9E 4BBEA 5A4CA 2B54A 2EXMA 2R3JA 2W5HA 4KIKA 3DKGA 4QYYA 4ZK5A 3CSVA 2E9NA 4M68A 3DZQA 2P33A 5CZHA 4EHVA 4H1MA 3PE2A 4PPBA 4MXXA 3SA0A 2VX0A 5AMNA 4CTCA 4YLJA 5HNBA 4F6WA 4QNYA 5CX9A 4E1ZA 1R0PA 4O91A 1YDTE 1JNKA 3I4BA 4FV2A 4S34A 2WHBA 4DC2A 5DBXA 3F6XA 4PNIA 1Q8WA 2Y4IB 5H3QA 2PK9A 3EHAA 4CRLA 3PYYA 5IEXA 5AADA 4U3ZA 3W8LA 3DU8A 3RM7A 4MX9A 2PVYA 4NYEA 1XO2B 2V0DA 3QQHA 4I0SA 1IG1A 1NY3A 4ENYA 3LW0A 4J99A 3F5XA 2VTLA 4B0GA 4AF3A 4JIAA 2OICA 2ONLA 2W1GA 1KV1A 4ID7A 4J8NA 4JOAA 4OTIA 3IONA 4MTAA 4FICA 3VS0A 4BI2A 2CNQA 1WMKA 4BDKA 3H0YA 4IB5A 4YUQA 5IQGA 2JKKA 3QALE 4TNBA 3U4WA 2RKUA 5EI8A 4AT4A 1MRVA 2CCIA 4EH7A 1UA2A 2ZVAA 3OBJA 4USDA 3DK3A 2J0IA 3PJ1A 3Q2MA 3KXZA 4JVGA 2VWUA 4XRLA 2HWOA 4W4WA 3I5NA 4FOCA 5AV4A 4FGBA 5C8KA 2B4SB 4EK3A 5CF8A 5FXQA 4UXLA 3PPJA 4OTDA 5E8XA 4GG5A 3QRTA 3TACA 4GL9A 2C6LA 3GU4A 4HCTA 4M66A 3ZFMA 5HU9A 3F66A 3BHTA 3HRCA 4K77A 3BU5A 3QGYA 3KRJA 5KMMA 4O82A 2C6EA 3QF9A 4TL0A 1GJOA 4JDHA 3BYVA 2R3MA 4ZTNA 2QO7A 4JQEA 3HMMA 4X2GA 2BDJA 2VV9A 3SRVA 4AP7A 3MGYA 4CZTA 4PDPA 5M4IA 4MXCA 5IQBA 1I09A 5IUHA 4L9IA 4F1OA 2VWVA 3ZC5A 5FD2A 3ULIA 3UOHA 4DTAA 2Y6MA 3TV4A 3F5PA 5KMKA 2UVYA 2H34A 1OMWA 1U54A 2XM8A 5M55A 3NNVA 5FRIA 3LM0A 3VUMA 3O8UA 4DH1A 1J3HA 1UNGA 1WBPA 2BFYA 4WT6A 2C47A 3P78A 1LPUA 3UOKA 2ITPA 3WI6A 3G0FA 4UN0C 5IKWA 4ZP5A 3U9CA 2GCDA 2UZUE 4D2RA 3G2FA 4BR3A 3ORNA 3PXZA 4DEHA 4V01A 4KBCA 4KS8A 4G1WA 3FI4A 2C6KA 4BHNA 3OEFX 5AWMA 2ZDTA 5EYDA 2DYLA 2BZJA 1QPEA 2ITNA 2XIKA 5AAFA 1KE5A 4YTIA 3AT3A 5CZIA 3P0MA 3DKFA 3RHKA 4YTFA 5HNIX 4HVDA 1JAMA 2C6DA 1ZMWA 4WO5A 3CGFA 4WUNA 4XCUA 4AFJA 2XKDA 1XH6A 4TXCA 2Y0AA 3F7WA 3FC2A 4CFFA 5A4LA 3DBEA 4I5CA 4GT3A 1M2PA 5HEZA 4FNYA 4K18A 4GIIA 1YWRA 2QODA 4DG0E 2YWVA 4F99A 1F0QA 1UWHA 3FMEA 3TM0A 5TE0A 1K3AA 3UP2A 1YXTA 4DEEA 4X3FA 2W9FB 4QQTA 3MA3A 2WTKC 4XOYA 2LAVA 2UW3A 3SG8A 5EKOA 3CP9A 4TW9A 4EH8A 3L1SA 3L9MA 3QD3A 2ITYA 4P5ZA 3DB8A 3O17A 3Q9ZA 4FTRA 1ZARA 4KSPA 2RFNA 3LJ2A 4JQ7A 3R7OA 4EZ7A 4PMPA 4JR3A 2XK3A 3DFAA 3GC0A 4GEOA 3UDBA 5KNJA 2G2FA 3UZTA 2ITUA 4JDKA 3SQQA 1YWNA 3ETAA 4F9CA 2VTJA 2WTVA 5HLPA 2YAAA 3Q5ZA 5HCYA 2PPQA 3GC7A 3REPA 4CFMA 4UMTA 3D5VA 4DH3A 2R9SA 3C5UA 2WO6A 3P5KA 3SV0A 1ZY4A 2W17A 4F1MA 5CXHA 4ZTSA 2X2MA 3W33A 4F64A 1O6KA 2J5FA 3VS3A 1ZY5A 3QD0A 2B53A 3LQ8A 3FMNA 3NIEA 4FK3A 3AC1A 1GY3A 4QRCA 3PY0A 4UMPA 1IA9A 3FXXA 2G01A 5EG3A 3S3IA 5LMAA 2XCHA 3S4QA 2Q83A 3QA8A 4Y95A 3TCPA 3BHUA 3Q52A 2ITVA 4E26A 2YEXA 3S00A 2YAKA 3MB6A 4FSWA 4CMUA 3AC3A 3QRIA 4B4LA 3E92A 5AUXA 1JOWB 4I93A 4FF8A 5HIBA 2XM9A 3SD0A 1Q8TA 3FLZA 4TY1A 5FP6A 4FKSA 1H00A 5LWMA 2BKKA 2X1NA 4JG8A 3U55A
chains in the Genus database with same CATH superfamily
3K2LA 4FEVA 4EYJA 3GCUA 3HVCA 3D0EA 2UZTA 3DY7A 4XBRA 3RK7A 1WZYA 4I94A 4YR8A 4MBLA 2UZOA 5JKGA 3EZRA 5EHYA 5E8SA 4A9RA 4RVKA 3CS9A 5IA4A 5HTCA 3OCBA 1SNXA 4IAZA 5F94A 2FA2A 3QUEA 4ACCA 2BRBA 3EKKA 5C27A 5G1XA 2F2UA 4L44A 1XBCA 5A4QA 2XJ1A 4BL1A 4KKHA 4O0VA 3BWFA 1M52A 2VX1A 4QQJA 2HZ0A 4YBKA 3KIOC 3PVBA 4JT3A 4YBJA 1ZWSA 2XEZA 5HG5A 2A19B 3VBQA 3DS6A 4GU6A 5GZAA 3R8LA 4XEYA 2XP2A 3QBNA 4KAOA 1OIRA 2PVLA 2YCQA 4FZ6A 4S30A 5AM7A 1NXKA 2F7XE 2Z2WA 2UZNA 3QGWA 4ZLYA 3PXYA 4MUQA 4R7IA 5JT2A 4FV1A 5H8GA 5LMBA 5E1EA 4FNZA 4O2ZA 2WU7A 5ANJA 3WF6A 4RFZA 4C34A 4PV0A 2R3PA 1R3CA 2PVKA 4WRGA 4YO6A 4AZWA 4NCTA 4D5HA 1JSVA 2CGWA 3UIMA 2VWXA 5CU6A 4GK2A 5I9WA 3IW7A 3KK9A 4H3BA 4KINA 4FSTA 2DUVA 2OWBA 4K33A 4V05A 2JITA 2ZV8A 3F3TA 4K8AA 2X9FA 4BIEA 2GTNA 3OVVA 3P7AA 4C35A 4RFYA 5J79A 5AP0A 3KXGA 4RIYA 5ANEA 2QOFA 2YM8A 3ZZWA 5CVGA 1CMKE 4IVBA 4CG8A 4AGCA 3WF8A 1KOAA 4HVSA 3W55A 2JIIA 1FGIA 4A9TA 3UDTA 2QI8A 3LCOA 2O8YA 4FIJA 4I0TA 2YDKA 3QQUA 5IH5A 5DRBA 3EN9A 3CPCA 3V8SA 2PZRA 5CQUA 2F7EE 4ITJA 2FSTX 4G2FA 5M4FA 5FQDC 3PIYA 3DV3A 2UW4A 3ODZX 3OMVA 4FRFA 4LV7A 5C9CA 4D2SA 1YW2A 2VTAA 3OWPA 1YI6A 3V5PA 4FIGA 4PRJA 5AAGA 1DM2A 2QD9A 4QMOA 2JFLA 4DFLA 4J96A 5AR8A 5JQ5A 5JQ8A 5M44A 4G5JA 5CQWA 2XNGA 5KZ0A 2NYAA 3RPOA 2BAJA 3EIDA 2A98A 4CKJA 3SOAA 2YM3A 4DFYA 4O0UA 3EFLA 5FP5A 5K4JA 3AC2A 4ZEGA 3PUPA 2XJ0A 3WARA 4DGOA 4DGGA 2W5AA 3HV5A 3Q9YA 4YNEA 4R5SA 3ID6C 3MB7A 5DLSA 1H07A 4M7IA 1IASA 2Z8CA 4EH3A 1R78A 4FTUA 4D28A 4GV1A 5GZ8A 3CTQA 1Q61A 3DK7A 3KU2A 2F57A 3DAEA 3UMWA 3O5AA 5H8EA 4BKYA 5A6NA 3QUDA 4IBMA 5LVNA 2RGPA 4L6QA 2VTPA 3P9JA 4FKRA 5C1QB 3V6SA 3R7VA 1OPKA 2OFUA 2OGVA 2YIYA 4XG8A 2J50A 4I5HA 3TJCA 1JVPP 1G8SA 3E63A 2IZRA 3TDWA 2QO9A 4EBVA 2WOTA 3HV7A 1PHKA 1P4FA 2JD5A 3PJ8A 4RVLA 3GENA 4CCUA 3C50A 4E5BA 4F0GA 4OAVB 2C0IA 4IVCA 4KS7A 2XALA 1MUOA 2ERZE 3R63A 5CT7A 3QFVA 2X7OA 4O4DA 2OW3A 5I9VA 2YACA 5HE0A 5L2TA 5L6OA 3EQGA 4FTCA 3H4JA 1JKLA 2BHEA 4OT6A 4O0RA 2YZLA 3FY0A 3LFFA 4UX9A 3UE4A 3R7UA 1A9UA 2BIKB 2J0JA 3A4PA 2XBJA 3QQJA 4GRBA 3ROCA 5CXZA 4FTMA 5AP5A 3OXIA 2ITWA 4EQMA 1E1XA 4QMSA 5DNRA 3MY1A 4AX8A 1A48A 3KMMA 3QKLA 4F63A 5AUTA 4PQNA 2WMXA 2ITOA 3RBWA 4DH8A 4FE2A 3A8XA 5TT7A 4FIHA 5K9IA 4MXAA 3BIZA 3SC1A 3VW8A 4AOJA 4S31A 3UJGA 2VNWA 1BYGA 1RDQE 2YITA 4MVFA 5IA1A 5KUPA 5ANIA 4YZCA 3RK9A 4GG7A 4QYHA 4BCJA 3A7FA 3A7JA 4Y83A 4D5KA 4UYAA 3BV2A 3Q3BA 2QR7A 3NAYA 2XBAA 5CEMA 2EB3A 2XB7A 3R1NA 5CEIA 4ZS4A 3HNGA 3EQBA 3GI3A 3HV6A 4JBPA 3V01A 4CXAA 1Q8UA 2W06A 5DN3A 2CGVA 2IZUA 5FEDA 3OBGA 4DFUA 2W1IA 4FV3A 4BIDA 2PUUA 1BUHA 3QTRA 4J8MA 3TZ7A 4QMTA 5CAUA 4JI9A 4BY9E 4G6LA 4U3YA 5L6WL 5GIPE 5AP1A 5A6OA 4MCVA 4E3CA 4F0IA 2OXDA 3OWLA 1J91A 3AXWA 1ZYDA 1CKIA 3PXKA 1OL7A 5ANKA 2WKMA 2CSNA 1OBGA 4TZRA 4NEUA 3TNWA 5IA5A 2HXLA 3QTQA 3OS3A 4C4HA 3UIBA 2J4ZA 2ITQA 3FL5A 3C4XA 1YXVA 4ANNA 3OW3A 4LOOA 4BCMA 3R30A 4EL9A 2W9ZB 5CALA 5H8BA 4C36A 1H1PA 1ZYLA 2ZAZA 2X39A 4EOJA 4DT9A 3LFBA 3TEIA 1PXMA 3DA6A 3DTCA 3NR9A 2FO0A 3C0HA 3D7TA 3ZUUA 2I7QA 5CT0A 4JQ8A 4FV4A 4QYGA 5HBHA 2X4ZA 5J5TA 4CZUA 3GFWA 5BVWA 5CY3A 4ZJJA 4ZSAA 5BVDA 1LEZA 4ALVA 2W7XA 2EWAA 2X0GA 5GJDA 4KRCA 2WTIA 4J52A 4IADA 1SVHA 4QMQA 2YCRA 3HRFA 4EH6A 2BRNA 4I3ZA 3BCEA 2R2PA 1YHSA 1F5QA 4NFNA 3CLYA 3KN5A 4QNAA 5EI2A 5AV3A 4Y5QA 3CQUA 4QPAA 2OBJA 4WBBB 3V6RA 4RX9A 3VIDA 4ZZNA 3I7CA 4V0GB 5CWZA 3S2PA 4IX5A 4QQCA 1PMEA 4DCAA 2W1CA 4OT5A 2QNJA 2UVXA 2OZOA 3GC9A 4ZJIA 2J51A 2YDIA 1SVEA 3MV5A 2V22A 2FSMX 4LOPA 2BRGA 3TG1A 4C7TA 3F7ZA 4GFOA 3ZHPC 3G9NA 3NIZA 3NW6A 4R77A 3PWDA 3A61A 4E73A 3KXHA 3BLHA 4EH9A 3UDSA 3ZO4A 1M2QA 2ETMA 3QTUA 4E4LA 3ZFYA 2UV2A 4U6RA 4NTSA 4UMUA 2R7IA 5AP6A 4FG7A 3OTUA 5HGIA 1L3RE 5TR6A 5T6KA 2XKEA 5AP7A 2JKOA 2VTSA 2CN8A 2R3FA 3CC6A 3FZSA 2R7BA 4YZMA 2R3KA 4FIIA 3ATTA 3KREA 2GS2A 2ZDUA 4GW8A 2HZIA 2BRMA 3HV3A 2GU8A 4GT4A 2BMCA 3EQIA 3TNPC 3ZO2A 4UWCA 2ITXA 4LL0A 4AZSA 2OJJA 4FZDB 2UZDA 4JBVA 1OECA 3O96A 4CCBA 4BBFA 3O0GA 4AN9A 1J1CA 3LAUA 4FSUA 4AN3A 5M09A 2BZKB 5G6VA 5M53A 5D7AA 3LFNA 4QTBA 5A14A 4HYHA 2XYUA 2UW6A 4D4RA 5HG9A 3FKNA 1JKSA 2R3LA 2X0QA 4YO4A 1PKDA 2R5TA 4K9YA 2QOHA 4BWXA 2C5OA 3E88A 1PW2A 3MFTA 5CAQA 3QTSA 4LV8A 5C03A 4UMRA 3A7IA 3HRBA 4P4CA 3RPVA 2XNOA 3LXLA 2BILB 4FKOA 1SNUA 3NCGA 3SVVA 4EWHA 5IEVA 4RIOA 2VN9A 4IZAA 3DCVA 4BFMA 3QD4A 4BTMA 3U6IA 3NUPA 4EI4A 3CGOA 4IZ5A 3DNDA 5M4CA 4M13A 3EOCA 3R22A 2WMQA 3EQCA 3R8PA 4AT3A 2PUPA 1UU9A 5A46A 4BDAA 1KE6A 3E5AA 3GB2A 4O6LA 4D9UA 2GNJA 3D5XA 1KE9A 5HLNA 3EL8A 5ETCA 2Z02A 1WFCA 1OKZA 4LGHA 4MD7E 4UALA 3JVRA 5EDRA 2X81A 4ZZMA 4BI0A 1Q3WA 3IDCA 3NUAA 2XF0A 1W7HA 2R0IA 3PG3A 3TWJA 1CTPE 2E9PA 4PWNA 5LQFA 2QG7A 4NUSA 4CMOA 3VN9A 2ZB1A 2IG7A 3DOGA 1IR3A 3OP5A 3TL8A 4N0SA 4LL5A 4MK0A 3N4VA 4EZ5A 3SXRA 5IISA 3OXTA 5DI1A 4O81A 4RLKA 4HYUA 3TT0A 3ZEWA 3COKA 5FTOA 4PUZA 4U0IA 5AV0A 4TRLA 2ZMDA 4QP7A 5HQ0A 5HCZA 3QTIA 4GUEA 1KWPA 3V04A 2QR8A 3FSKA 4AGWA 3CR0A 4BN1A 2XJ2A 2Y4PA 5LCKA 2YLFA 4QP8A 4TWNA 4CKRA 4I1ZA 3SLSA 3W2RA 4S2ZA 4DEGA 2HW6A 4DG3E 4P90A 1B39A 2Z60A 5M08A 3KVWA 4FV6A 4YZBA 5KCVA 3FHRA 1VR2A 2WMBA 4YURA 5B2LA 4LOQA 2IVSA 2J2IB 1O6YA 2YIQA 4FKWA 4ACMA 3TDVA 2XK7A 4EOOA 4TWPA 5BUEA 5CVHA 3WYYA 5K0KA 3TZMA 4Z7HA 4I6LA 4EKLA 4ZY6A 1XQZA 3DBQA 4CFXA 3UZPA 2C1BA 4RPVA 2OO8X 1H01A 2IO6A 3ZDIA 4J97A 4LRJA 3RAKA 3DXQA 2P0CA 4P2KA 4NL0A 3GU8A 5L6PA 2YWPA 3Q5IA 5ICPA 2HOGA 1E1VA 1H0VA 3FBVA 5DPVA 1TQMA 3CD8A 5D11A 1ZYSA 2XNNA 3RP9A 3W1FA 2PY3A 4EHEA 3AT2A 3AMBA 4IXPA 3T3UA 2XARA 5CSPA 2OIDA 3VS4A 4D0WA 5BYYA 5FTQA 4BVUA 3HDMA 1Q24A 2O64A 4W4YA 3VUTA 1QPCA 1WBSA 3D7ZA 1X8BA 5KMNA 3BLRA 4RJ8A 3EFWA 4CTBA 4FGRA 4R78A 2XRUA 2EXCX 2VO7A 3CKWA 2PZYA 4ACDA 4WHZA 5D12A 1G8JA 1PXIA 2VUWA 1J7LA 3PDTA 2W1FA 2FH9A 3ZFXA 4IAFA 3PXQA 4X7QA 3OW4A 3O7LB 4FKTA 5J8IA 4E8AA 3R01A 1U46A 2KTYA 3F3VA 3KF7A 3BYSA 3QYZA 4GYIA 3ZBXA 2B52A 3F3UA 4OBQA 4QMPA 1F3MC 4FG9A 3VS7A 4A4OA 1PMUA 2XNMA 5BYLA 2XIYA 4DGLC 3H10A 4KABA 4QDEA 1W8CA 2W1ZA 4OTPA 1KE7A 2VTRA 4X3JA 3HP5A 4IVDA 3VQUA 2BR1A 5E1SA 4IC7A 4MEDA 3WE8A 4TWOA 1E9HA 1HCKA 2VWBA 4LRMA 5FM2A 5HU3A 1JLUE 2WEIA 4MWHA 5CAVA 4DCEA 3NX8A 4FL3A 4FODA 4P7EA 1MQ4A 2GPHA 4PL4A 5AP4A 4BZNA 5K0XA 2VGPA 2WQMA 3BBTB 3PA4A 4JX3A 1ZMUA 4FTTA 3NGAA 3KCKA 1K9AA 3E7VA 4RX8A 3F5GA 4NJDA 3F5UA 4FV8A 4M69B 3QLFA 4PMSA 4EH4A 4C2WA 2AYPA 5L2QA 2R3OA 4CFVA 4DFNA 5FEEA 5E8YA 4APPA 1ZLTA 5L2IA 2JLDA 2X2KA 3C51A 2GSFA 2QCSA 3B8RA 2C6IA 4IJPA 4PDSA 2GMXA 3DLSA 5CNOA 4I41A 5KBRA 4S33A 3P7CA 1Q4LA 3BGQA 2YM5A 3FPMA 4A06A 4AW0A 4XYFA 3QHRA 1U4DA 1PXJA 2HW7A 3LXPA 2BRHA 2J5EA 2JBPA 4HYIA 1UNHA 4I24A 3OCTA 2HY0A 3SKCA 2OIBA 4RJ5A 2XNBA 3CIKA 1GIJA 3ROYA 3KN6A 3ZO1A 2CMWA 5EOLA 2R0UA 3ZS5A 3ZXZA 3A60A 4MQ2A 4Y5HA 1W0XC 4LMUA 4O7SA 1YXSA 2C0TA 4AXFA 3MTFA 5I0BA 4R7HA 3SW4A 4OAUC 1UU8A 5HI2A 1FVRA 3B2WA 4IJ9A 3TMOA 5KKRB 4C57A 3DK6A 4D2WA 3ZXTA 5FBOA 3FJQE 5DFPA 5DMZA 4YSJA 3BHHA 5BMMA 2HIWA 3ORKA 2VTTA 4JNWA 3HMIA 3C0IA 2X7FA 3G0EA 2BDFA 4L7SA 2CLQA 3WZJA 5JZJA 2NRUA 3MFRA 2VZ6A 2C6TA 5EQYA 2HAKA 2PVJA 3P08A 5DR9A 5IUGA 3LFDA 2Z7SA 5AR4A 2A1AB 4CT2A 4H1JA 4P5QA 5I5ZA 1MRYA 4RIWB 4BI1A 5DR2A 4WSYA 3OWKA 3KQ7A 2QLUA 4AA5A 4JLCA 3NZ0A 2GNFA 4C3RA 4EHZA 5HX6A 4EQCA 4DT8A 3KL8A 5AX3A 2WTWA 2AUHA 2E2BA 3PRIA 4ZXTA 1M7NA 4AA0A 4KIPA 2HWPA 5CANA 4KIQA 3RVGA 3L8PA 1H28A 2JIUA 4E20A 3UPZA 1Z9XA 3VS5A 4I5PA 1AQ1A 5ACKA 3COIA 2F9GA 4RMZA 5CS6A 2YN8A 1MP8A 4G9RA 2GNLA 3GFEA 3KB7A 2ZM1A 2C3LA 3NNWA 4FVQA 2F4JA 4G3DA 3ZLXA 4BF2A 4AZVA 4LGGA 3RI1A 4MH7A 1B6CB 4Q2AA 2BUJA 2OIQA 4RJ6A 4YPSA 5HG7A 3RPYA 5AUWA 3CCNA 4BDCA 4QP2A 4RFMA 5CAOA 3FWQA 4ZMFA 4G3GA 2BVAA 5KX8A 2XNEA 4K0YA 3VW6A 2J0LA 3M11A 4II5A 5E4HA 4HCVA 3P79A 3TN8A 3NFFB 1K2PA 1WBNA 4H58A 4A7CA 4O7LA 1YRPA 5HE3A 3KULA 3N4UA 1NVRA 4Y85A 5AP2A 3R71A 3T9TA 3ZO3A 2BAKA 2PVMA 3ZSHA 4CGAA 4CSVA 2FSLX 2XKCA 3E7OA 2WTDA 3LCDA 3QUPA 3DZOA 4Y8DA 1YHWA 4GIHA 3CQWA 3E93A 2WOUA 3IECA 5EQEA 4RZVA 3H9RA 1VZOA 4G3CA 5AUVA 4D4YA 4RZWA 4YJUA 2OH4A 5FWKK 5E91A 3M2WA 3L9LA 4GJ2A 3CE3A 3HMOA 3MVLA 4G31A 1PF8A 5TKDA 2RG6A 3C4ZA 4CD0A 3PXFA 4AT5A 5M51A 3WOWA 2XS0A 1O9UA 2Y7JA 4LI5A 3NYOA 2ZJWA 4OTWA 1XH4A 3E62A 3QTZA 4QP6A 3HMNA 2H9VA 1IA8A 3ORZA 1PMVA 5C8MA 4FEUA 2CKEA 3KC3A 1OGYA 2FYSA 4BCIA 5GZ9A 3QCYA 1G3NA 3UQCA 3IO7A 2W99B 2IW6A 2QURA 3OEZA 3ZM4A 4LFIA 4M3QA 5IA2A 4AA4A 4YC3A 3V5QA 5A4TA 4B6LA 4ZTLA 4EH2A 2GNIA 2HZ4A 2PE0A 3NAXA 1M2RA 2J7TA 2ZYBA 3W0OA 3C7QA 3FZTA 4O0XA 1OKWA 4Q5EA 4ENXA 5JN2A 4OUCA 2QU5A 4N57A 1OGUA 4ORKA 3UNJA 2I1MA 5AV2A 3RNYA 1XH5A 3L9NA 4RRVA 1BKXA 3LFQA 3R7IA 3W0PA 1Q99A 2UZWE 3IOPA 1TQPA 3RCDA 3V8TA 2OKRA 3NCZA 5CF4A 5HD4A 3U6HA 4O83A 1P5EA 3C13A 3HP2A 5I9UA 3HUBA 5C4KA 3W2SA 3QZGA 1XH9A 3MH2A 3HX4A 5LMKC 1U5QA 4U43A 2XVDA 2CGUA 2I0HA 4EKKA 4EJ7A 3W32A 4XJ0A 2XIRA 4BDDA 2HXQA 4C0TA 4RIXA 5FM3A 4ANQA 3RTPA 2F7ZE 2JAMA 5B2KA 2GQSA 3DXPA 2PHKA 2DQ7X 1TKIA 1JPAA 5CU2A 5AP3A 2R4BA 4FOBA 2WMAA 4F7SA 3PSBA 5M06A 1FPUA 4PMMA 3ORLA 4FX3A 4QMMA 3FI3A 5L2WA 4PTEA 3ZMMA 2HK5A 4HGSA 2UUEA 1JKTA 1H8FA 3R04A 3V5LA 2WAJA 3HGKA 2VWIA 2UZLA 2E9VA 4FNXA 4C2VA 5HE1A 1XH8A 4YJQA 3W0NA 2R3RA 4EBWA 4ZTMA 4HZRA 3C4CA 2PMOX 5CF6A 5A3XA 3V51A 3WF7A 5AJQA 4ACHA 3D5WA 4EK6A 5K4IA 1H1SA 4MNEB 5I3RA 1R1WA 4FBXA 3V8WA 2W1HA 4O0YA 3MIYA 1PMNA 3RAIA 4EOSA 4QD6A 5T3QA 4AU8A 3SXFA 4BCOA 4EZ3A 1SMHA 2WTJA 4WBOA 3ZC6A 3ELJA 5DGZA 3R9OA 2QKWB 2PULA 2WTCA 1J7IA 2A4LA 5ITAA 1W2FA 2X0OA 4QMXA 3LE6A 4CKIA 4AUAA 4DGMA 3ZTXA 1CKJA 2I6LA 3LLAA 3D15A 2VD5A 4BCGA 4XG2A 2NPQA 4ITIA 4DLIA 5KHXA 1FOTA 3W2QA 4OTGA 2WEVA 5E8ZA 5HO6A 2R3HA 3ULZA 4O7YA 5IMXA 4IB3A 3ANRA 3QZIA 2XK9A 1ZXEA 4FNWA 4CZYB 1DAWA 3CJGA 5J87A 4W9WA 3I6UA 5DG5A 4C02A 4ZSJA 1B38A 4TT7A 4FKVA 1YXUA 3LVPA 3R6XA 3OT3A 4TKSA 2B55A 4FEQA 3UODA 4O4BB 4I23A 3OZ6A 4FA2A 2O63A 5BMSA 3A99A 2QKRA 2OG8A 4AXDA 4Y73A 4XG3A 2WMUA 2OU7A 3ALNA 2IW8A 1ZMVA 4KSQA 3ZRLA 4C3FA 4WSQA 2Y6OA 5FXRA 1FMKA 3IDBA 3WF9A 5EYKA 4USEA 1OL2A 3POZA 4C37A 4MWIA 3TZ8A 3FLSA 5J9LA 3QKMA 2W96B 3P23A 1H24A 3LJ0A 5EH0A 4G34A 4MKCA 4IX4A 4EK5A 3QHWA 2E9UA 3D7TB 3UPXA 3P7BA 2OZAA 3BGPA 2YLEA 4AGDA 4R7BA 4L42A 3KGAA 3VS1A 3BHYA 2B9HA 4D4VA 3KK8A 2PMIA 2XRWA 5EW3A 3R7YA 3FZ1A 2I0VA 3DNEA 3PZEA 2VX3A 4HJOA 3W8QA 2KULA 3R7GA 4PF4A 1UWJA 1V1KA 3LKMA 5E8TA 4RGJA 4A9UA 2JKMA 1PYEA 2WQEA 4NZWB 4BKZA 3UNKA 4DEDA 1M17A 2YERA 5ACBC 4F1TA 3BLQA 3P4KA 3PPZA 2Y8OA 3UG1A 3LCTA 5CF5A 5C8NA 3AC5A 4DGNA 1H27A 1P4OA 3DAJA 2X0PA 3O51A 3MYGA 5AV1A 1KOBA 2W05A 3LZBA 4EOIA 4ERKA 2C0OA 2YJRA 4ARKA 5AA9A 3TKIA 2C69A 4A4XA 1OZ1A 2HYYA 1BLXA 4MXZA 3SAYA 3R2BA 4RA4A 3EFKA 4M8TA 5CVFA 2C5VA 3RHXA 4QMZA 4M12A 2X8IA 3FC1X 3FV8A 1UKHA 3FLWA 4HCUA 1XWSA 4RC2A 4ZIMA 1RE8A 3ZLYA 5BVFA 3KY2A 5L3AA 4JS8A 3JR1A 4JG7A 3VAPA 3S1HA 3LQ3A 5HVYA 4QOXA 2C1AA 3RZBA 4RC3A 4C61A 4J98A 5DIAA 2C3JA 3I1AA 2H6DA 3TTJA 5CASA 3R02A 3GXLA 2O2UA 2Y4IC 3UZRA 1OIQA 3QQKA 4NWMA 4O7RA 1JKKA 1H0WA 4R6VA 3IKAA 4JRNA 4LYNA 5IEYA 3MH1A 1Z57A 4OTHA 4IVAA 3JS2A 4E6CA 3F9NA 3DFCB 3FQHA 1W82A 2G9XA 4NM5A 5CEQA 3RJCA 5KKRC 4UZHA 4FL1A 1BL7A 3LOKA 4PMTA 3CQEA 3Q4ZA 3Q9XA 4YHTA 3AOXA 5J95A 4AACA 4DHFA 2V5QA 4AOIA 3S95A 1UKIA 1ND4A 3I0OA 2YCFA 4G16A 3O2MA 4O6EA 3WBLA 1JSTA 4G3FA 4ZY5A 3OT8A 4LUEA 2ZV9A 3GOKA 2C3IB 3VO3A 3I5ZA 2GHGA 3FMLA 3FLNC 5A4EA 1URWA 3G6GA 3PPKA 3BYUA 3UG2A 5LARA 3Q60A 2OFVA 3LFAA 4PPCA 4ANLA 4BDBA 3FZOA 3GT8A 4KD1A 4E5AX 4R1VA 2ZB0A 3W2CA 4K1BA 3ENMA 1OITA 1U59A 3FDNA 3GQLA 3PA5A 5LJJA 4DN5A 3L9PA 3OTVA 4U9AA 4LRKA 4FK6A 4DFZE 4FSQA 2OLCA 2CLXA 1NW1A 5ETFA 1VLRA 3KRLA 5C4LA 3PE1A 3IDPA 3F69A 4XP3A 4L46A 5AAEA 5KZIA 1W98A 3OY3A 3DPKA 4QP3A 3VJNA 5HICA 1ZZ2A 4FV5A 3BYOA 3FL4A 2YM7A 3ANQA 2WMSA 3GVUA 4HOKA 3UMXA 4ALUA 5J7HA 1PXPA 2BTRA 4K6ZA 4JDJA 2YHVA 4FKJA 2RFDA 4BCKA 4AN2A 4XG9A 1OPJA 4WNOA 5JGAA 4YC8A 2GHLA 3NYXA 4M14A 4L3JA 4FI1A 1WBWA 3TTIA 3VBYA 5L8LA 2XMYA 3D94A 4PL3A 3MTLA 3QYWA 3A7HA 3RZFA 2VTNA 3ZCLA 2VTHA 2O65A 3CY2A 3OFMA 4M0YA 3VHEA 4F09A 3Q96A 3HL7A 3A2CA 5JFVA 5ANGA 4NIFB 3PUFC 4WUAA 4U44A 4AQCA 1PY5A 3EB0A 5J7BA 3QLGA 4RJ7A 4RT7A 3ZEPA 4D2VA 3ZUTA 4HPTE 2YJSA 5L4QA 5DT4A 2XH5A 3H3CA 2J9MA 3ZLWA 3E8EA 5IUIA 3NUUA 2CCHA 5F9EA 3NVMB 3BL9A 3W0MA 3GUBA 4ANOA 3BHVA 2VTOA 3W16A 4B7TA 4HPUE 4KIOA 3JPVA 1UV5A 3T9IA 4AW1A 5B2MA 3PJ3A 2BZIB 1FBNA 3F82A 2PZ5A 1RQQA 1AGWA 1EH4A 1LP4A 1QPDA 1Y91A 4WG5A 4X2KA 4ANMA 5IQAA 4IMYA 1VYZA 3QA0A 4DTBA 5KE0A 3G33A 3TUBA 3PZHA 5BVOA 2WB8A 3LLTA 4WG4A 1TVOA 4C4GA 4GT5A 2PVFA 4BCNA 3HV4A 4YJVA 2W4JA 3O7LD 4ZMEA 4AXAA 5LXMA 4FYOA 1ERKA 4O4CA 5F4NA 4ZJVA 3O8PA 2Q0BA 2QO2A 4BC6A 5LVOA 3VBXA 4UWYA 5HX8A 3SG9A 4J53A 1M7QA 2GNHA 1H1WA 2YZAA 1APME 3MA6A 3PWYA 4ACGA 3HAMA 4PX6A 4EOLA 5F1ZA 2PTKA 4EEVA 2JC6A 4L43A 3AD4A 3MS9A 3RAHA 4AS0A 5HORA 3QWKA 3ZSIA 2JDSA 5HE2A 4QTEA 4D1ZA 2ITZA 4X2JA 4D0XA 1AD5A 4UWBA 4L45A 3MFSA 4U79A 1REJA 3RINA 4HW7A 5BNJA 4BIBA 4Y72A 4IAYA 3FZRA 5GJFA 2H96A 5ETIA 2QHMA 4LM5A 2G2IA 4L01A 4DEIA 4DYMA 2EB2A 4YJTA 4AG8A 5E7RA 3Q4UA 5CLPA 2B9FA 1Q41A 3QKKA 4FT7A 2A0CX 4KWPA 1OL5A 5CU3A 3R1YA 4IAIA 2P55A 4TYIA 4EOMA 2JFMA 1WVWA 2H8HA 3S0OA 3NPCA 3WE4A 4HNIA 2WTKB 2OF2A 4IDTA 5IDPA 3W0RA 3ZOSA 3B8QA 2JGZA 1SZMA 3COMA 3AGLA 2C5NA 2QG5A 3EWHA 4I4EA 3F2AA 4XH6A 1WBOA 4JAIA 4FT5A 4C4FA 3KF4A 4F4PA 1G5SA 4GSBA 1CM8A 4XMOA 3QXOA 3HDNA 3ZUVA 3PJCA 2QLQA 4ASDA 4AWIA 5GHVA 4TTHB 2PU8A 4KIKB 3ZRKA 3R9RA 2Z7RA 1QL6A 4LV5A 3NRMA 1UU7A 2NO3A 2J0KA 4M67A 4D2TA 5FG8A 4IWDA 4RQKA 1S9JA 3OROA 3M1SA 3BQCA 3Q9WA 4EC8A 5JK3A 2X2LA 4FT3A 3MY0A 3BU3A 2XEYA 3FMDA 3PFYA 2BDWA 3RKBA 2GHMA 3DDPA 3EZVA 4PL5A 2UZBA 4F7LA 5KMJA 2R64A 4GFMA 2X8EA 3FMMA 2YIWA 3NUSA 2OJIA 4O86A 5T68A 4I21A 4FZAB 2WIPA 2PL0A 1OB3A 2IZSA 5I9ZA 3EQHA 5LVLA 4UXQA 1OPLA 3LCSA 4JIKA 4RG0A 3R83A 3G15A 3EYHA 4FUXA 4RJ3A 4C62A