5JK3A

Crystal structure of tl11-128 bound to tak1-tab1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
306
structure length
269
Chain Sequence
SLHMIIEVEEVVGRVCKAIKQISESERKAFIVELRQLSRVNHPNIVKLYNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7,TGF-beta-ac
publication title Structure-guided development of covalent TAK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 269
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jk3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jk3A01
2I0EA 2WTIA 1A9UA 1VZOA 2QKRA 3JVRA 5HE1A 3HMNA 2R3IA 4R5YA 3A7GA 3LFBA 4GIIA 4EC8A 3HV3A 4QYYA 3G0FA 4U3YA 2CKPA 4BKJA 3QTRA 4GU9A 5HIDA 1FGKA 4HGSA 4FTKA 2DWBA 4RWLA 4O7RA 4RPVA 3ZOSA 4CQGA 1Z57A 2R3PA 5FDXA 3WF9A 3QRTA 3OUNB 4YHFA 1TVOA 2P0CA 3OCBA 4HZRA 3DJ7A 5AP1A 5C01A 1OKWA 2C6IA 3EB0A 2V0DA 1YQJA 2ZYBA 4LG4A 5IH6A 2RFNA 4QMPA 2OBJA 4ACGA 3PDTA 4WKQA 3DBEA 5CZHA 1OGUA 4UXQA 3C5UA 4DEDA 2Y0AA 4O0UA 4YP8A 1UV5A 4W4WA 3N4VA 4FG8A 2JDVA 3UNJA 5CNOA 1P2AA 4ERKA 3D5WA 3DDPA 1OUYA 3LXPA 4XV2A 3HRFA 4FYOA 3EKKA 5EYCA 5CQUA 1BYGA 2UZWE 1PXPA 4PDOA 3WI6A 3MIAA 5AV3A 2P4IA 3AD4A 2XEZA 3P7AA 5HOAA 4J8MA 3N51A 3D2IA 3JYAA 4QMLA 4A07A 4RIOA 5ETIA 3R7YA 1UU9A 2WTKB 3O71A 3CIKA 4C3FA 3VJNA 3QTUA 4RC3A 4IQ6A 3UZTA 4FODA 2RGPA 4FIEA 4FSZA 3E87A 4F63A 3FV8A 3KL8A 3V6SA 3AGMA 4YURA 1S9JA 3BYMA 1OI9A 3CJGA 5IG1A 3DXQA 4UALA 1K9AA 3FHIA 3QCQA 2X8IA 4PL5A 4Y8DA 3T3UA 1OMWA 3GCQA 3RI1A 3FXWA 1XHAA 4DLJA 4FV5A 5J87A 5HX8A 3TZ7A 1VYWA 2UW6A 4D2WA 2Z02A 3ITZA 3VBTA 1U54B 1ZMWA 2QOOA 3AC5A 2CNUA 5KKRB 4W4VA 4I4EA 1XH8A 5LVNA 3NRMA 4Z3VA 3GU7A 3D2KA 3FLZA 5M4FA 5M09A 3CD8A 3HV4A 4IANA 3REPA 3QTSA 4X2GA 3L9LA 3QRUA 4YBKA 5GNKA 3VC4A 3VS6A 2VTSA 1DM2A 2ZV7A 3SXRA 3TJDA 4CTBA 3UIXA 3DFAA 1H0WA 3RP9A 3MH1A 4YJSA 4U80A 4ASDA 5L2TA 5FD2A 4NT4A 3DQWA 5AX9A 4DG2E 4J7BA 2PVKA 2ETRA 3L1SA 1M17A 4ANNA 1MRYA 3RHKA 3TACA 2I0VA 5HG5A 3ZTXA 3L8XA 3V3VA 2GQRA 4BDDA 4HYUA 3VS5A 4X3FC 1H1PA 3FLQA 3BCEA 3FAAA 4BKZA 3OXZA 5LQFA 5ANKA 3OBJA 4TPTA 5CALA 2YDIA 3BHUA 4JI9A 2XK6A 4IJPA 3P7BA 4OTHA 1Q8YA 4HVDA 2OZAB 3TDVA 3QD4A 5IEXA 2ZOQA 3K3IA 4H58A 3EOCA 5IQGA 3ORKA 3GP0A 5H9BA 3LJ1A 2VGOA 4K11A 5F95A 5L2SA 4CG9A 3BBWA 4L8MA 1W84A 4FR4A 4D2VA 2V55A 4E3CA 5CYIA 3IW8A 2V7OA 4ANQA 3GNIB 3E3PA 4JG8A 2XIYA 4FKIA 2QCSA 3UBDA 3ZEPA 1PXJA 2CKEA 4FV6A 1ZYCA 4YNOA 3QC4A 3P0MA 5M51A 5IF1A 2J0LA 3AC8A 4QPSA 2OFVA 2CJMA 1CTPE 4I20A 3ZRLA 4EZ5A 1ZLTA 1XWSA 4LM5A 5ANEA 3DB6A 4USFA 4G17A 3D83A 5EM6A 4DT8A 5L6WL 3OW4A 3LCSA 4KABA 1YHVA 3HV6A 3O8UA 1RW8A 2J50A 2VTMA 3CXWA 3O17A 3FI3A 3TM0A 4UN0C 2IZTA 4R5SA 2YIQA 4E1ZA 3A62A 4E5AX 3A4OX 2JBPA 4LV8A 5E1EA 3OP5A 3UZRA 3MYGA 4ZK5A 4MQ2A 4IAYA 5KUPA 2QU6A 3ZH8A 1YOMA 2PWLA 1ZYSA 1XQZA 3F7WA 5H3QA 4R6VA 4R3RA 4PPBA 4S33A 2BFXA 5IA0A 3N4TA 3G9NA 3OOMA 5DR2A 2HXQA 2VD5A 3CGOA 4DGNA 2C1BA 3IOKA 3PXRA 5C8KA 5IA1A 2QO7A 4Y73A 5FRIA 2OIBA 1KE7A 4L46A 1VJYA 4B8MA 2W9ZB 3FE3A 3F69A 3EMGA 4G5PA 4IZ5A 3KVWA 3R7OA 3CBLA 3UYTA 3ZEWA 4H05A 1UNLA 1PXKA 2UW8A 4LRMA 4I6FA 5F1ZA 4D9UA 1A48A 4IX6A 4QMVA 4FYNA 4CFXA 5DT0A 5BPYA 2BCJA 5E8XA 3IDPA 2DYLA 3LFEA 3LHJA 5CVGA 1SNUA 1XJDA 1LUFA 5B2MA 2HWPA 4BICA 4EL9A 3ROCA 3DOGA 3DT1A 2ESMA 3NLBA 4KS7A 3UQFA 2BKKA 4P5ZA 4BBFA 3IKAA 4L6QA 5CNNA 4C3PA 3TV4A 2UV2A 3FWQA 3F82A 4X21A 2B4SB 5AADA 4YZBA 2BFYA 3A8XA 5FGKA 1OZ1A 3BV3A 2QC6A 5EHLA 4WG5A 4CD0A 3RKBA 4ZP5A 1G8AA 3UOLA 4WG4A 2BUJA 4DITA 3MFUA 2GNLA 1V0BA 2R4BA 3E7OA 4YLKA 4J71A 5HE2A 4FZ7A 2BAJA 3LQ5A 1IA8A 2XJ1A 4FOCA 3FKLA 4FL2A 1OB3A 3C4FA 3NIEA 4FNWA 2OJGA 3CTHA 4MH7A 3R8VA 2O0UA 2C6TA 4H36A 4ENYA 4ALUA 5FEQA 5E8SA 5AFVA 1E9HA 3OHTA 3EN4A 3LQ8A 3CKWA 3QA8A 5EHOA 4AWIA 2W7XA 3I60A 4EH7A 4TNBA 4YPDA 1J7UA 2OXXA 2XCKA 5IDNA 1F0QA 1U59A 3E8DA 3W16A 4EBWA 4DFBA 3G51A 5FM3A 2ZDUA 4GRBA 5D41A 2X2KA 3NEWA 4KAOA 1PRYA 1RJBA 5AP7A 2EU9A 3FY2A 3NPCA 3ANRA 3QWKA 3R1NA 4FKQA 4ZEGA 4QP4A 4DN5A 4F6UA 3KN6A 2B55A 3GCUA 4E8AA 4ALVA 2X2LA 1ZY4A 3W2SA 2P55A 4YTCA 5HVKA 4TWOA 4IAAA 4QP1A 5IQEA 3FZPA 4GG5A 4O7NA 2SRCA 1OIQA 3H10A 2O3PA 3PXZA 5CQWA 3SW7A 3FQEA 4MD7E 4FIHA 4G3EA 4LMNA 2F7EE 4XNEA 3KF7A 2XRUA 3K3JA 3H9OA 5KZ0A 4YLJA 5KBQA 2UZOA 2ZVAA 4E4NA 4FKVA 4AOTA 2BZKB 5BYLA 5ETCA 3RK7A 2XH5A 1JAMA 2V7AA 3Q9ZA 2ZV8A 4LGGA 4MYGA 3IQ7A 4WOVA 2QQ7A 5CU3A 4KKGA 2OLCA 2P2HA 2WGJA 2WTKC 4U7ZA 5LWNA 4TYHA 2YDJA 4HYHA 3BYSA 4G1WA 3GEQA 3CR0A 4JAIA 5AP4A 4F9WA 3IW7A 4A4OA 5AWMA 5HE3A 2R0UA 5EOBA 1WBWA 4G3CA 3LCOA 4JQEA 3R02A 3POOA 2IJMA 4JDIA 4OTIA 4WNOA 4BCQA 4DLIA 2R3MA 4KKHA 3R7IA 3S4QA 5GZAA 2Z8CA 4IFGA 3IDCA 4WA9A 4KBCA 2OIQA 2C6MA 5CEMA 1YDTE 5C4LA 1P5EA 4L01A 4MXYA 3MH3A 5A4QA 1OBGA 1LEWA 3THBA 5FLFA 3PTGA 4BCOA 4FA2A 2ACXA 3MPTA 4F1TA 3SDJA 2EUFB 4X3JA 5GJFA 3QBNA 4O22A 1FQ1B 1UNHA 3ACKA 3MY0A 4XV1A 3OVVA 2BZIB 4AZEA 3MVHA 2WEIA 4HGTA 4FT3A 4IMYA 4KA3A 3ZM4A 5A54A 5GZ8A 3SA0A 3DQXA 5DFPA 4A4XA 5HHWA 2GNGA 4R3CA 5K4IA 4EYJA 5EM8A 1PMEA 3Q96A 4GIHA 3TZ9A 3M11A 4H3PA 4HJOA 2J0KA 3FYKX 3NDMA 3NUSA 4KIKB 2AC3A 4IZAA 2NPQA 2OXDA 1U46A 2WEVA 3BU3A 3PJCA 4ANBA 2CNQA 3LMHA 4KUJA 2XIXA 3VBYA 2B7AA 3SRVB 2PVLA 2W96B 3GOPA 3FXXA 3VUDA 4IWDA 2C5OA 2UZUE 2YCSA 3FC1X 4RJ3A 4X2KA 5I3RA 2NNWB 2DS1A 4QP7A 5CT0A 4GUBA 3V5LA 4RRVA 4MXCA 5CSWA 1QPDA 2ITZA 2XNEA 3GFEA 3SD0A 4DEEA 1GZOA 5AR8A 1A06A 4DG3E 4I92A 4U41A 1V0OA 4ZLOA 4GG7A 5ANOA 5EQEA 5CEQA 3BV2A 4Y85A 4Q5EA 3QCYA 1WAKA 3VW6A 5DYJA 5EW9A 2NRYA 1KSWA 3U9CA 4BDEA 3MB7A 3MBLA 3OT3A 3DJ5A 4J98A 5JMSA 2XRWA 3KRRA 3HDNA 3QD3A 2BAQA 3EN7A 1H08A 1OL7A 1W82A 3Q53A 4FVQA 3Q60A 3QCXA 4QTAA 1PXOA 5LCJA 1Q99A 3QUEA 2OJFE 3PA3A 5LVPA 3MY1A 5BNJA 3QQGA 2HIWA 4JX3A 4TXCA 3ZLSA 1GAGA 4KWPA 3LXNA 2H34A 3GGFA 5GJGA 2HZNA 1NVQA 2JLDA 3GOKA 3U6HA 4FTJA 2QOIA 3ULZA 3VUKA 4CYJA 4L42A 5HU9A 2W4JA 4G31A 4AG8A 1TQMA 3NSZA 3IK3A 5A14A 4BYJA 2WMQA 5AUVA 2H8HA 3DK6A 4BZNA 3FDNA 4AW0A 4YLLA 3LCKA 3CTQA 5IZFA 4KRDA 3F7ZA 2RFSA 5IQCA 1REKA 4BIBA 4NM0A 4YTFA 3NW7A 4V05A 4JG6A 4L7SA 4AZSA 4PPCA 3A8WA 5BUEA 1ZOGA 3POZA 3FZ1A 5HTIA 4FC0A 3RTPA 1OPKA 3S2PA 4D9TA 3D4QA 5HBJA 4GEOA 2PY3A 4ACCA 3LFNA 4CMUA 3G90X 1ZOEA 3OD6X 4XV3A 1H1WA 3EFKA 3MFRA 4IVCA 5CSXA 4E6QA 4ACHA 5EQPA 3N9XA 1UKIA 4CKIA 2I0HA 4MD9E 4Y83A 2CGXA 4E4MA 2BAKA 1GIJA 4IVAA 4NKSA 2YZLA 4AUAA 3L8SA 3VO3A 4C59A 3QHRA 3TNIA 4XYFA 5E7RA 2ITWA 4R3PA 3GVUA 3KRJA 4GL9A 4I0SA 4BDBA 4FOBA 4DT9A 2B9HA 3UDBA 4XBRA 4Z7GA 1OL1A 3PP0A 4IWPA 4P7EA 3U51A 2OSCA 2I40A 2YM3A 2YWVA 4YHTA 1Q4LA 3ORNA 3DAKA 4RG0A 3WF7A 2FSOX 3R8PA 2X39A 3TL8A 1JLUE 4I6QA 5L8KA 5FEDA 4UV0A 3OZ6A 3WZJA 2ITTA 1Y57A 2I0YA 1SMHA 5KMIA 2CCHA 4BCNA 3W18A 4QNYA 3IGOA 3FI8A 2RKUA 3QUPA 3HECA 5HCXA 5CY3A 4BDKA 4NL0A 2JAMA 4H3QA 3H0YA 4FK3A 4IXPA 4WBOA 5CVFA 3ZUTA 3Q4TA 2XZSA 4HNIA 3VUMA 4FEXA 1E1VA 4JOAA 1P4OA 4TT7A 2RG5A 3D15A 2WU6A 2CGVA 4NFNA 2PUIA 2IZSA 3MVJA 4XV9A 4O0YA 3RPOA 1APME 3BU5A 4IAFA 4AW1A 3R9OA 2W1ZA 4AF3A 4HCTA 4O0XA 4XCUA 3NWWA 5HEZA 4DYMA 2BKZA 2Z7SA 5ITAA 5J9ZA 3TIYA 2BVAA 3KXHA 4IZYA 4J8NA 3BHTA 4F7LA 3V01A 2PE0A 5CASA 2F7ZE 3GU4A 5F9EA 5FXRA 4LI5A 3T8OA 3NNVA 4M12A 3NUUA 1Q8TA 4F99A 2YERA 3NNXA 5EK7A 1BKXA 2C4GA 4FV3A 5M4UA 1TKIA 3F5GA 3NCZA 3ZXZA 2AC5A 4EKKA 5EW8A 4FG9A 4KB8A 4F7SA 4FKJA 2ZJWA 1J7LA 3RINA 2JEDA 2AYPA 1JSUA 4FTOA 3UJGA 4CEGA 4ID7A 3R01A 3CD3A 4NM5A 2X81A 2R3HA 5T6KA 3BI6A 2DUVA 4D2RA 3PWYA 3LMGA 2VRXA 4R7BA 4XG3A 3PE2A 4FICA 4O96A 2P3GX 4I6HA 4MAOA 2C5VA 4GFGA 2VWBA 4DA5A 1ZY5A 2ZB1A 5F20A 3E63A 2OJIA 3HRCA 3RAHA 4OAVB 4O82A 4PTEA 1U5RA 3BHHA 3O0GA 3VS2A 5JFVA 2PU8A 4RJ6A 1Q97A 1WBNA 2XIKA 4AFJA 5K9IA 2BRNA 1W8CA 3FKOA 4L3PA 3V8WA 4F9CA 1UU3A 3FYJX 5E1SA 4BCMA 3E8NA 2HK5A 1OECA 2BHEA 3KN5A 1YWRA 3QRJA 3EQIA 4ZJVA 2WU7A 5DT3A 5L3AA 3BLHA 3LIJA 4O7WA 2Y7JA 4KKEA 2W1FA 3DXNA 2ITNA 3CE3A 1STCE 4MVFA 2J6MA 2UZVA 2XKFA 4R7IA 2GQGA 2WMWA 3OFMA 3U55A 5AUYA 3O96A 4YJTA 2VO6A 1XH5A 2YCRA 3RMFA 4A9RA 3DAEA 2ERZE 4DFLA 3UC4A 3DPKA 4U0IA 3SXFA 4G3GA 4LGHA 3A4PA 3HNGA 4PDPA 3CSVA 3TV7A 3ZU7A 2UW4A 3G2FA 2OZOA 4IX5A 5C03A 1UA2A 3C4ZA 3KXZA 4YJQA 2YHVA 4M67A 3WZKA 4EBVA 2J7TA 2H96A 4GVAA 2WD1A 3I5NA 4BWPA 4PPAA 3R0TA 4AOIA 1ZRZA 4C62A 4I23A 1WBVA 2XKDA 5HBHA 2WMVA 5J5SA 4RIWA 4RWIA 4FSNA 4O7LA 5DR6A 2A4LA 2R3GA 2UVZA 4CFUA 2IG7A 5E9EA 2XVDA 1NXKA 4YTIA 3S95A 3PZHA 5M57A 3E93A 2ITUA 3KGAA 2CKQA 4FE2A 4RJ7A 3FPQA 3LM0A 4YC6A 4PP7A 1BI7A 3E88A 4S30A 4F0IA 4S2ZA 4QYGA 5CEKA 5KHXA 1BL6A 4FKSA 2Z60A 4FT9A 2P2IA 4B9DA 1XBAA 3RK5A 3NNWA 2C5YA 4ZSEA 4FEUA 4D4YA 1YXTA 3AMBA 2HOGA 3KULB 3DNEA 4RFMA 4OTRA 4C37A 3UE4A 3FMDA 4BGQA 3C5IA 4F70A 3E8CA 3EL7A 4PDSA 4QP3A 4PF4A 3P86A 4FL3A 1Q3DA 2X1NA 2P33A 2WOUA 5HG8A 2XNBA 3TN8A 1OIYA 3VS3A 3F3ZA 3LXLA 4BBEA 2A0CX 5CSVA 3VNTA 2FUMA 4LL5A 2HZ4A 5AIKA 4BDGA 2PMIA 4IB3A 3TDWA 4F08A 2WMXA 4RJ8A 2B52A 3GFWA 4OLIA 5T3QA 5AMNA 2VUWA 2QLUA 3OBGA 3WZDA 4DFZE 4ZTSA 3BWJA 3GC7A 3UC3A 3V5PA 4E73A 5IQAA 3AC3A 3TNQB 4I94A 4ZTRA 2PVHA 4H1JA 1WBPA 2JITA 3I79A 4WNMA 3HMIA 3TEIA 4IBMA 2XM8A 4V04A 4C02A 4HW7A 4C4FA 4H1MA 3VVHA 3KRXA 4MK0A 3UNKA 2JKKA 3GENA 3EQHA 3LW0A 4JBVA 4Y5HA 1Q8WA 4A7CA 2CCIA 4IAKA 3MVMA 5D12A 5AAFA 4HVHA 3C4EA 4RWJA 3B8RA 3R7UA 4FGBA 3NZ0A 4JQ8A 1YRPA 3HGKA 3BGZA 4JVGA 4YGAA 5DOSA 5DT4A 1QPJA 3ULIA 4E6DA 3Q2MA 1MQ4A 5JZNA 3VBVA 2GNHA 4ANMA 2EXEA 2VX1A 2RF9A 1BLXA 1OITA 3D7TA 5CXZA 4G6NA 5AA9A 5JFWA 2R7IA 2X0GA 2EWAA 1GZNA 2W05A 2DQ7X 4TY1A 2JIUA 2UZBA 4LRJA 4TYHB 1NVRA 2RG6A 2VTNA 4BGGA 5CZIA 1W83A 5A4LA 3NAXA 2UZEA 3HYHA 2KTYA 3BEAA 5HNIX 3K5VA 3ZC6A 2GSFA 4L45A 3RM7A 4BDCA 3F9NA 1OPJA 2WMRA 2RIOA 3A7IA 3C1XA 5AP0A 2BRGA 3AT3A 3AT2A 5E8YA 4QYHA 4YR8A 5EHYA 2GS2A 5KMLA 2QHMA 2PUUA 3BYUA 3W2CA 3DKFA 3LFAA 4OUCA 4W8EA 3CS9A 3W2PA 4GFOA 5JFXA 2PSQA 4B6LA 4O21A 1LP4A 3PIZA 1SVGA 3GBZA 3P79A 4IE9A 2R64A 5HO7A 5LWMA 2QG7A 2XNMA 5E8TA 4KSPA 2X6DA 2YIYA 4FK6A 3RPYA 3SAYA 4R8QA 4D2PA 3QRKA 3SKCA 3Q9WA 1DI9A 1H07A 4LL0A 3NUXA 4QYFA 3NUNA 3ET7A 4BCFA 5IISA 3RAIA 4EHZA 1WVWA 4QMTA 4DBXA 5FM2A 2X7FA 4M69A 5BYYA 2F49A 2YM5A 4QMNA 1ZMVA 4USEA 3UIBA 2YCFA 4WNKA 5DEYA 3RM6A 4FKUA 2F7XE 4ACDA 1ZYJA 1OKZA 1YHSA 5AR2A 4IM2A 3KY2A 4AP7A 2OIDA 3OY3A 4DINA 1VYZA 4J1RA 4U40A 4EH2A 4X0MA 4CLIA 3QLFA 3QALE 3B8QA 3KXGA 4QQCA 1UU7A 3MH2A 1AQ1A 3KKVA 2JDOA 3DCVA 2CLXA 2IVUA 4MX9A 4NSTA 2ZM4A 5I3OA 3ROYA 2XNOA 3E5AA 3HP5A 4MXZA 4QPMA 3T9IA 4BCJA 4U45A 2IWIA 4BKYA 1ZMUA 4NK9A 2QU5A 1O9UA 1ZYDA 3A61A 4FNXA 3TKHA 4M0YA 1IA9A 4CQEA 1XH9A 2AUHA 2B53A 1KE9A 3EQBA 3DV3A 3WYXA 3NAYA 1YHWA 4JG7A 5EKOA 3GC0A 2WNTA 4PQNA 4OTPA 5I9VA 2C3JA 5KCVA 3K2LA 2BPMA 3EN9A 4FT7A 4MWIA 4N6YA 4U43A 2BIYA 5IUHA 3EN6A 4L68A 4BC6A 2BRMA 3UIUA 4Y72A 1LPUA 4FTLA 4IEBA 4TZRA 4YZ9A 5B7VA 2CKOA 2YCQA 4RVTA 2GS6A 4L43A 5AUZA 2WMUA 4BZDA 3LOKA 2VWXA 2QOLA 4FKPA 4ORKA 5BUIA 2JDTA 5CEPA 5FBOA 4EJ7A 4KNBA 2WQEA 2Z7LA 3QAME 3RAWA 4QMYA 3MFTA 4CFVA 1YXSA 2OW3A 4GK4A 4OTDA 5CU2A 5HLPA 3RBWA 3DKOA 4DH5A 3LZBA 4QD6A 2X7GA 3I0OA 3MWUA 5AAEA 3SVVA 4ASXA 3DFCB 1YWNA 4C35A 5E4HA 4RT7A 2BTRA 3EFWA 5FTGA 2XK4A 1X8BA 4XG6A 1O6KA 3I4BA 2VWZA 4CCUA 2YAKA 1GNGA 3PSBA 4LQMA 2JAVA 4C33A 4PL3A 3RCJA 2GTMA 4HPUE 2C6LA 2X9FA 3OUKA 4IVBA 4G6OA 3ZXTA 4B8LA 4HYIA 2UZTA 1B6CB 1G8SA 4DEGA 1RE8A 4E6AA 3TIZA 2ZB0A 2HENA 1JNKA 3EQDA 4PL4A 4XLIA 3S3IA 1G5SA 4M7IA 5DGZA 4C2VA 5B2LA 4RJ4A 1DAWA 2Z2WA 1IEPA 1GZKA 5CSHA 2XBJA 5EYDA 1Q8UA 2BMCA 2VTHA 2VTLA 3EJ1A 3KB7A 3W10A 2PE1A 2GQSA 3TTIA 3DXPA 3ZSGA 1Q61A 5AR5A 4YZMA 2QG5A 3D5VA 5CWZA 3QTQA 4A9SA 2G1TA 2BRHA 4O38A 4QMXA 1YI6A 3HUCA 4FZ6A 3R7EA 1JOWB 3UP2A 3F3WA 4Z16A 3UMWA 3EQGA 4FSUA 3DLZA 4GYGA 4XX9A 4ALWA 4FKGA 4D1XA 4GW8A 5HIBA 2JKQA 3QKMA 4GJ2A 4OW8A 5HTCA 5A6NA 3ORTA 1M2PA 1WBTA 3OEZA 3LAUA 3TXOA 2G2FA 4FTCA 4BDIA 3A7FA 1Q8ZA 5IQBA 3R00A 4FV2A 5D1JA 4ZLZA 4H39A 3ZM9A 3ALOA 4W9XA 4EHVA 3ZUUA 1JWHA 3OT8A 4CFFA 4C0TA 4EH4A 4I0RA 4PRJA 3F3VA 1TQPA 2B54A 3NVKI 1VR2A 5J7HA 2OJJA 5EOLA 4BZOA 3AC2A 3OMVA 5LARA 1CKPA 3PSDA 3PPZA 1OUKA 3LPBA 2F2UA 3P08A 2C3IB 2ITVA 2YIWA 1KUTA 3RWPA 5TF9A 1CDKA 2Y4IB 4L44A 3RVGA 4JR7A 4Y5QA 5T68A 3U8WA 2J2IB 2G01A 3PG1A 4RFZA 5CAUA 5EI2A 3C7QA 3DZQA 3F2AA 3QU0A 2HAKA 4K33A 4K1BA 4XUFA 5IH4A 2VGPA 4BCPA 3BX5A 3NUAA 4DTBA 1IASA 4FIIA 1I44A 2CPKE 5GHVA 1HOWA 5HLWA 3OTVA 4UZDA 1FMKA 2RSVA 3AD6A 1SM2A 3QKKA 4EOLA 2WQNA 3Q9YA 3UNZA 2C68A 3IG7A 3NGAA 5EQYA 3W8QA 3IOPA 2X8EA 4AGWA 3EYGA 2ZAZA 5DE2A 4AA0A 1W98A 4IDVA 4BB4A 4JBQA 4WG3A 5IDPA 3P5KA 4UXLA 4E6CA 4LGDA 1Z9XA 3AT4A 3EH9A 3HKOA 3R7VA 1LEZA 4F9BA 5I9XA 2F57A 2HW7A 4I22A 3ZLWA 4ZS4A 4LV5A 2YEXA 4JL9A 2W4OA 3EIDA 3FQHA 3GUBA 2VWWA 4O91A 3E92A 4G9CA 2IW8A 4XP0A 3N4UA 2EVAA 2YA9A 4ZSJA 3IECA 2FSLX 3OW3A 3I0QA 3EQRA 1BI8A 2ITOA 3W2QA 5H8GA 5DEWA 3V8TA 4J95A 5AV2A 3C4XA 3H0ZA 4LOPA 5HCZA 2IZUA 3G0EA 5EM7A 4O84A 5AR3A 3Q4ZA 3Q32A 3LQ3A 2UW3A 4M97A 3QXOA 4IHPA 4JBPA 4UMPA 5IEVA 5GIOE 2YJSA 4DH7A 3LFSA 3ZO1A 3EZVA 4IJ9A 4YHJA 5TR6A 1WBOA 3RALA 4EH9A 1Q3WA 4N57A 4OTFA 3QHWA 4H3BA 4IB5A 4HGLA 4FSTA 4UEUA 5CF5A 4PWNA 3A60A 4YNEA 4Y95A 2Y6MA 5HG7A 4ZIMA 4ANSA 3OWJA 1WZYA 4O0TA 4TL0A 4FSWA 4Z7HA 2PVJA 2Y4PA 3CY2A 3EFLA 3KK9A 3II5A 3MPAA 1CMKE 2IVVA 5HIEA 4U79A 3CLYA 4Q5HA 4RIWB 5G1XA 3VHEA 2R3KA 4EQMA 4PMSA 2UW5A 2W1DA 5ETFA 3CEKA 3QKLA 3COMA 4QTEA 1OL2A 2HWOA 1FMOE 3UIMA 2PZIA 4AX8A 5KHWA 1XBCA 3TNWA 4XOYA 3O8PA 2WTVA 5KKRC 4UYNA 3BRBA 2XB7A 4GT4A 5EYKA 4M14A 1M52A 2YLEA 3GI3A 3L8VA 5AJQA 5AR7A 1DS5A 3C0HA 3KCFA 5AP2A 4RQKA 2VTJA 3FXZA 2C0IA 3EQCA 2V62A 3WE4A 3KEXA 4BHNA 1KWPA 3PJ2A 2WTWA 4MNFA 4FV1A 4IADA 2VTRA 2R9SA 3B2WA 3FZRA 2EXCX 3HV7A 4FTMA 3F66A 3PVBA 4KIOA 5M53A 3JPVA 1ERKA 1B38A 4FUYA 3CPBA 4GVJA 5F4NA 5TKDA 4D5KA 4EOPA 4ZSAA 4PNKA 2WQBA 3DBFA 5A4EA 3ZFXA 3CJFA 2NRUA 3PIYA 3ID6C 4YC8A 1SNXA 4C7TA 3WBLA 2XIZA 3TNHA 1PW2A 1M2RA 5CF4A 2WMAA 5K5XA 2GNIA 4RZVA 3T3VA 4DGOA 3FZSA 2VO3A 3OY1A 3R71A 4U3ZA 4FTNA 4TYEA 5BVEA 3NVMB 2R3LA 5JT2A 4BI0A 3OOGA 4PMPA 1YXXA 3QTZA 3NYVA 1O6YA 4FTRA 1XO2B 1GY3A 3FY0A 5M08A 3FMEA 3R04A 1PY5A 4FTIA 3CCNA 3R2YA 4QP9A 2VNYA 3KXMA 5DHJA 4FMQA 4QOXA 4EOMA 2WMBA 1NT2A 3Q6UA 2CSNA 4YMJA 3Q4UA 2JIVA 1H4LA 2J0JA 5D10A 3F6XA 3H9FA 3GCPA 3ZYAA 4G3FA 4IWOA 2G2HA 3R28A 3ORPA 5I9YA 4MF0A 4FZFB 4CVAA 3QTIA 4EONA 4O7VA 3G33A 4YC3A 5HBEA 2OKRA 4I5MA 3UVQA 5AV0A 3PVUA 2QKWB 4YSJA 3UPZA 5A4TA 2BILB 2QONA 2YN8A 5J9YA 5H8BA 3BHYA 3D7TB 3PA5A 5D7AA 5CS6A 1H01A 2VAGA 3MB6A 3H9RA 3NX8A 2BTSA 5AP3A 2B0QA 3NMUF 1H0VA 3QQKA 2HZ0A 4N4SA 2EB3A 2IW6A 5CTPA 4AGUA 1O6LA 3QQHA 3QC9A 3ERKA 5KZIA 3E62A 2W5HA 4BHZA 3WYYA 4ASZA 3SGCA 2XA4A 2J5EA 2WO6A 3ZMMA 1MRUA 3UZPA 3UP7A 3F2RA 5IA4A 4ZXTA 4A9UA 4G16A 4UBAA 1YDSE 5ANDA 5JZJA 4QQ5A 5F94A 2OF4A 3A2CA 5TO8A 3H3CA 4OT5A 1CM8A 1OM1A 4EOIA 2G9XA 2C69A 2CMWA 4TN6A 3WZUA 5EKNA 4CKRA 3KU2A 3DTCA 3MTFA 4RC4A 2YFXA 2XCHA 4L3LA 1JSTA 2VWUA 2YIRA 4TWPA 5FQDC 2CGUA 3RPVA 4QQJA 3PVGA 3ALNA 4CFNA 5HZNA 3TUCA 5BQ0A 2X4FA 4C4EA 2HZIA 3DAJA 4EH8A 4O27B 3BZ3A 4GV1A 3ZS5A 1YXVA 5AV4A 3GXLA 3KRWA 2CHLA 5BVNA 4XRJA 4FV0A 3ZFYA 3LM5A 3KA0A 3BLQA 3QTXA 4IFCA 3EQPA 4BCKA 1K3AA 4ZTNA 2J51A 2RFDA 2ZDTA 4NIFA 2FYSA 4RIXA 3DY7A 4GMYA 4DEBA 4EOOA 2UUEA 4FKWA 4M69B 3BYVA 4QMUA 3RHXA 2C0TA 3QXPA 2Y4IC 4ZY6A 4ZY4A 5L8LA 2XBAA 3OG7A 4WSQA 4CSVA 2X2MA 4G3DA 4CG8A 2X6EA 3NW6A 5DMZA 5I9WA 1IR3A 5EDQA 5AUWA 1SZMA 3TZ8A 1ZARA 2ZM3A 2WB8A 3Q6WA 5ACBC 4P4CA 2QHNA 5AUTA 3KK8A 3VS7A 4AN3A 2OFUA 4K2RA 1JQHA 2R3QA 3ZCLA 4FGRA 3G9LX 2ONLC 2ZMDA 3FLSA 1Y6BA 3VIDA 4QMWA 4DGGA 1PXMA 4I5CA 3ANQA 2R0IA 4PMMA 1G3NA 1JKSA 2B9JA 4RIYA 3ZONA 4C57A 2XJ2A 1OIUA 4YZNA 4B4LA 4I1ZA 1H00A 2JKOA 4M68A 1OKVA 4EC9A 5GIPE 4J53A 1H24A 4NU1A 2WIHA 3CTJA 1ZZLA 4WRSA 4P5QA 3QD0A 4TRLA 3AOXA 4G2FA 3U87A 3IPHA 4R77A 4E7WA 1AGWA 3PXYA 2LGCA 1K2PA 5KE0A 1NVSA 3OWKA 2R7BA 2C47A 4YTHA 4CYIA 3MTLA 5DIAA 3ODYX 5LMBA 5DH3A 1KV2A 3FSFA 4WIHA 4Q9SA 4AW5A 3ZBXA 1FVRA 3SV0A 5K0XA 2OJ9A 3PP1A 1UWHA 5FXSA 3VBQA 2WPAA 1XH4A 4R7HA 3A7JA 5A46A 4UZHA 2XM9A 4O1OA 1URCA 2PZPA 2JDRA 4FF8A 3F2NA 4FKLA 4O0VA 4ZTHA 3UODA 5M44A 1KE8A 4BDFA 2R3OA 4RJ5A 4FVRA 3O7LB 3R22A 4CGAA 4OT6A 5FDPA 3NS9A 2EB2A 4EK6A 3FBVA 3S1HA 3MN3A 4B7TA 5E92A 3PY0A 1XKKA 3P1AA 5L2QA 3R63A 4WT6A 4FKTA 4LYNA 3R8MA 4GT3A 4I41A 4WD5A 4YJVA 3ATTA 4NJ3A 3BLRA 3HAMA 4M13A 4IB0A 1F3MC 4DAWA 3IW4A 4D1SA 3GCVA 3ODZX 3ZRMA 2WIPA 3F88A 4TTHB 3MESA 2QR7A 4J97A 2JKMA 4QMZA 4YSMA 5I4NA 3V5JA 4FIJA 5BMMA 3KFAA 3QX4A 3OC1A 3ETAA 5IEYA 4ZLYA 5CEIA 1V1KA 4RQVA 4L7FA 4XLVA 2B9IA 3EL8A 4F9YA 1OL5A 2FGIA 3FLNC 3DDQA 3KMMA 5BYZA 2C1AA 5HQ0A 2PUNA 4DFUA 3C9WA 4BY9E 3RNIA 3PRFA 3NUYA 4ZMFA 2VTTA 5JGBA 4NCTC 5H8EA 3FLYA 2ZMCA 1KE5A 2W5AA 4ZS0A 3QZFA 1BX6A 2O63A 5A9UA 2WQMA 4GH2A 1JBPE 3F5UA 5K4JA 4BWXA 3SXSA 3OCTA 1PXLA 1H1QA 2QOKA 2WOTA 4HYSA 4AU8A 3UG2A 5DRBA 2GFCA 3WIGA 2X8DA 2CLQA 2F9GA 3HA6A 5M07A 2PHKA 3ZDIA 1PMVA 2FVDA 2XK7A 3ORMA 2LAVA 3V5WA 3VQUA 4PMTA 5CU0A 4RBLA 2XJ0A 3NYOA 2PVNA 4D58A 4C4HA 4ZZNA 3RPSA 3LVPA 1GIIA 2VWYA 4M84A 4EH6A 3FMNA 4XS2A 4IX3A 1YXUA 3QQJA 4ZJJA 2YAAA 4JJRA 1YDRE 1YWVA 1JPAA 2G15A 5AAGA 4B99A 3HAVA 2ITXA 4YJOA 4YJPA 5FXQA 2GNFA 3U4UA 3CY3A 3KQ7A 5HESA 5IQHA 1KE6A 4JDKA 4ONAA 5L2IA 1YW2A 1U4DA 4UWYA 1GJOA 4W9WA 4O86A 2QI8A 4RX8A 3BE9A 5CU4A 5D9HA 1H25A 1KOBA 4EOSA 4NEUA 5AUXA 3F5PA 5GINE 3GC9A 3DK3A 2OO8X 5I5ZA 5DPVA 3B2TA 1WCCA 2QD9A 3HX4A 2VTQA 5D7VA 5AM7A 5CI6A 3AGLA 4S32A 4ZSGA 5C26A 3BQCA 5IH5A 2C30A 1JKLA 3EQFA 4IM0A 2OH0E 3ZSIA 4ZY5A 2ITYA 3L8PA 2WAJA 3CC6A 3U6JA 4V01A 4F64A 4TWCA 3EWHA 2NO3A 1J3HA 1V0PA 5FBNC 2OK1A 3UQCA 1OBDA 3R9NA 3UGCA 1P14A 3UVPA 4BRXA 3BU6A 1UWJA 3R9RA 4JIKA 5JRSA 1ZOHA 4FTAA 4JAJA 3PPKA 5M56A 5M55A 5IMXA 4OTWA 4BCGA 4PNIA 4E5BA 4IACA 4KS8A 4OR5A 3SLSA 5HI2A 1URWA 5GJDA 4CZUA 2UVYA 2W0JA 4A4LA 3TKIA 3FC2A 5HTBA 4R1YA 5JH6A 3VBXA 1PYEA 3JY0A 3R8UA 5J79A 4CT1A 4ZOGA 2XKEA 3TTJA 4OTGA 3UO4A 1REJA 3ZO4A 1QPEA 1R0EA 2BRBA 3UG1A 4D1ZA 2YISA 4FV9A 2GTNA 3JY9A 1T45A 3FL5A 4QP8A 2OI4X 4EWHA 3L9PA 5L6OA 2VX0A 3MIYA 1JKTA 3JVSA 3BGPA 4BWKA 5CENA 4KIKA 2XF0A 3OXIA 3VWAA 4FG7A 4F7JA 4C4GA 4DH1A 4K0YA 1H1SA 2JDSA 2NP8A 2W5BA 3KMUA 5AX3A 3VBWA 4GUEA 4MWHA 3UTOA 5LXMA 3ZFMA 4XG7A 5KMMA 5LVMA 1UNGA 3F3TA 3PG3A 4DBNA 5CANA 3OCGA 1W0XC 5AUUA 3UOJA 3WE8A 3D94A 1EH4A 2YITA 4TNDA 3VUGA 4HZSA 3CQEA 4X6RA 2XNGA 3VHKA 4TYIA 1MUOA 4PX6A 4BDJA 2PULA 4ARKA 3BWFA 3TNPC 3EFJA 3R1SA 3IO7A 4AACA 1SYKA 2CGWA 2I1MA 3L9MA 4NM7A 4EORA 2PUPA 3NUPA 2VN9A 4RVLA 5DVRA 3D5UA 2GNJA 4AXAA 2PMOX 3BKBA 3C4CA 3MGYA 5C27A 2W4KA 2G2IA 3I7BA 4HOKA 2XK8A 4I24A 4MKCA 4QP2A 2XIRA 2PVYA 3TT0A 4B0GA 3ZO3A 2UZDA 3MI9A 3LMIA 3Q2JA 4AZWA 4GT5A 4BVUA 4DH3A 5DBXA 4QT1A 5CEOA 2JFMA 3KXXA 3R8ZA 4GU6A 3H30A 4EI4A 4NTTA 2VTOA 4E5WA 4CTCA 3KCKA 5CAQA 4YO6A 3BHVA 3FUPA 3A7HA 2GFSA 3IONA 4RVMA 1YOJA 3CQUA 3FQSA 3ZBFA 4EQUA 4O0WA 4PTCA 3E3BX 1YI3A 1WFCA 2FSTX 4IDTA 5HORA 5GZ9A 5K5NA 1SVHA 4X2JA 1H1RA 3ZUVA 1T46A 3VAPA 4I4FA 5LMAA 4C4IA 3QQFA 3DA6A 5JGAA 1S9IA 4NYEA 2BHHA 2YIXA 4QNAA 4F7NA 5CVHA 2HW6A 2UW9A 5JQ5A 4BTKA 2JGZA 3MFSA 3QLGA 4QMMA 3PJ1A 4FEWA 2Q83A 2YM4A 3D14A 4X2NA 4C8BA 4PY1A 4G34A 5LMKA 1U5QA 5CXHA 4PUZA 2HY81 5ACKA 3UOHA 2KULA 2VTAA 2FH9A 5E91A 3EYHA 3LFFA 2GDOA 4GS6A 3RZFA 4DE4A 5J1VA 3TCPA 4R78A 4FL1A 5IQDA 2GPHA 4NW6A 3NCGA 5EYMA 4I3ZA 5EDPA 5J7BA 2YM6A 3JR1A 1IRKA 3O8TA 2IVSA 3RWQA 4G5JA 5BVOA 1NY3A 3IW6A 1RQQA 2W1HA 5JN2A 5JSMA 4XRLA 1PKDA 2W06A 3JUHA 3ORZA 5JEBA 3W32A 1CKIA 2GS7A 2H9VA 4XP2A 2VU3A 4F6WA 4C34A 3EHAA 1UKHA 1IG1A 1HCLA 4V0GA 3M42A 3I81A 3GQIA 4K8AA 3MS9A 4BIDA 4CKJA 4M15A 3NR9A 3FSKA 5ANJA 1Q5KA 5E90A 3RJCA 4JX7A 1OVEA 4AW2A 4O7ZA 4NWMA 4JRVA 3WZEA 4O6LA 2BDJA 3QGYA 1L3RE 4JXFA 3P23A 4E26A 2JBOA 4KD1A 4KBKA 5AA8A 1E1XA 4E4LA 1R39A 3LXKA 3NIZA 2IN6A 4X7QA 1FOTA 3DZOA 2Q0BA 4BI2A 5EG3A 3T9TA 2J4ZA 4C61A 2A19B 4WO5A 2C6OA 1YI4A 3DBDA 4U97A 4WHZA 4YJRA 4F9AA 2WTDA 4JDHA 3WF6A 4OTQA 4ANOA 5JKGA 4D55A 1PKGA 1R78A 5BVWA 4AOJA 4CV9A 2OXYA 4JRNA 5KX8A 3GU5A 4CXAA 4RIXB 4NIFB 2YDKA 2PTKA 3QYWA 1B39A 4GFMA 1QPCA 2GHGA 3HMMA 5A4CA 4AE6A 5IUIA 1PYXA 5DG5A 2UZLA 2GHLA 3ZHPC 2QOQA 1YKRA 3AXWA 2Y6OA 3Q04A 5HO6A 4CRLA 3BELA 2W99B 1Y8GA 2VO0A 4XMOA 3ZO2A 5LVLA 2PVRA 3P78A 4WSYA 4RSSA 5KO1A 1IAJA 2OG8A 5LJJA 4IZ7A 3P4KA 2IPXA 1GOLA 2VWVA 3VRYA 2BDWA 3NNUA 3PLSA 3FEGA 2O5KA 3RGFA 4EOKA 3QZHA 3HRBA 5HKMA 3OEFX 3D7ZA 3ELJA 3KC3A 3PYYA 3QCSA 5B0XA 1BL7A 4A9YA 4DG0E 1QMZA 3GB2A 5L8JA 4YPSA 3UYSA 3DGKA 4L67A 2WTJA 3QZIA 3CPCA 4RIYB 2QOCA 2PMNX 3AMAA 3BGQA 5BX0A 3DK7A 5LCKA 3ZC5A 5IU2A 2VZ6A 1DAYA 3O23A 3R7GA 2A1AB 3PJ8A 3GCSA 2XNPA 5KNJA 5H2UA 4F6SA 2XEYA 3C50A 4EOJA 2XYUA 5C8NA 1H28A 3QF9A 2HCKA 4M0ZA 4TWNA 4U44A 4D5HA 2CNVA 1H27A 2CDZA 5IUGA 1XH7A 3C0IA 3UQGA 4X3FA 3PLAE 3QGWA 5HG9A 2VO7A 4O7SA 2YLFA 2XYNA 2RL5A 5FWKK 4C2WA 5FP5A 4RWKA 1PXIA 4JLCA 3LFQA 3TZMA 2WXVA 5C4KA 3WIKA 4APCA 5EDRA 4ERWA 3KREA 3VS4A 3PFQA 4MHAA 2QVSE 4RZWA 3RPRA 5M4CA 2OF2A 3EZRA 4F65A 4CMOA 3H4JA 4HPTE 4UWCA 4D0WA 5I9ZA 1FVTA 4QTBA 3RK9A 3QYZA 3V04A 4FSQA 3CKXA 4OBQA 4NH1A 3KVXA 2GHMA 2RFEA 3GQLA 4AAAA 5DNRA 1UVRA 3IS5A 2WMSA 1WBSA 1ZXEA 2PK9A 4FEQA 4U81A 4C4JA 4F4PA 5EH0A 3M1SA 3QRIA 1UU8A 1PHKA 4IM3A 3FL4A 2VTPA 1DI8A 3KMWA 3LJ0A 3QWJA 4JR3A 3R8LA 2CN5A 3COIA 4RGJA 4LFIA 3PUPA 1PMNA 2ERKA 2PZ5A 4IB1A 2ZV9A 3MVLA 4CFMA 1FBNA 4AS0A 1YVJA 2C0OA 3K5UA 3MY5A 4AT3A 4UX9A 5K0KA 2XK3A 3QQLA 4IVDA 4E20A 3OXTA 5CLPA 1J91A 3GC8A 3S0OA 5G6VA 2VTIA 1W7HA 1H8FA 2O2UA 3R2BA 4DH8A 4UY9A 4FKRA 4O2ZA 4K77A 3UPXA 5CF8A 3VS0A 4Y46A 4QRCA 3KULA 1PF8A 3ORLA 3MA6A 1OPLA 2QNJA 4IX4A 3VULA 3GU6A 4EWQA 5CU6A 2YWPA 3MSSA 5B2KA 5DLSA 2VWIA 4KINA 4GK3A 1Y91A 3FMJA 3W2RA 3DTWA 4EUTA 5CAVA 3Q4CA 3DLSA 4I5HA 3BEGA 2E9UA 2HELA 3C13A 5HNGA 5I9UA 4LOQA 4FT0A 5HD7A 3QL8A 4J99A 4JIAA 4EK5A 3LKMA 5FUTA 4KBAA 4M3QA 4XG9A 3IDBA 1VEBA 4L53A 5C1QB 4I5PA 4FNZA 1Q24A 4YJNA 5KMNA 4ENXA 1ND4A 2WFYA 3V8SA 4IH8A 3ZRKA 4FT5A 4QP6A 4S34A 4FZAB 4FBXA 3FZOA 3I1AA 4G9RA 4CFWA 2C6DA 4ZTQA 4MNEA 3MDYA 4DFNA 2XP2A 1R3CA 4MCVA 4O2PA 3Q3BA 4K18A 1PMUA 1CKJA 3QA0A 2I6LA 5HE0A 4DCEA 5HCYA 1M7QA 4AA4A 4DFYA 4RLKA 4AE9A 5AIRA 3FLWA 4L00A 3RCDA 4MBIA 4AFEA 1FPUA 4CNHA 3QX2A 4GKIA 3HZTA 5DN3A 3DBCA 2EXMA 3SW4A 1YOLA 3QTWA 3KRLA 4NFMA 2PZRA 1Q41A 3E64A 4XHKB 3ZSHA 3AQVA 4FX3A 2PVMA 4W4YA 4AQCA 4D0XA 3NYXA 3RAKA 3WOWA 3TKUA 4PTGA 4BCHA 2BROA 4AGDA 4ZZOA 3HA8A 3QQUA 5D11A 4GKHA 3DNDA 4ANLA 4AZTA 5DWRA 2J0MB 1M14A 3R1QA 4Q2AA 3DU8A 4XJ0A 3UMXA 3D0EA 2PVFA 4ZSLA 3DJ6A 4QQTA 3SG8A 3PPJA 2Y9QA 2JD5A 2HY0A 4ITIA 4BFMA 4NW5A 3FPMA 4CZTA 3I5ZA 3HL7A 4O81A 4EK4A 3VF9A 2CN8A 1JSVA 4L3JA 2J5FA 2BR1A 4MBLA 4AZVA 5ICPA 5E8UA 4RC2A 5C9CA 3OROA 2Z7QA 3W2OA 4YU2A 1FINA 3HLLA 3PA4A 4UB7A 1NA7A 3PIXA 4MBJA 4O1PA 4CMTA 4D28A 4D2SA 3ORXA 5TE0A 4F1MA 1SVEA 3A99A 5LVOA 2IZRA 2JIIA 2W1IA 4O83A 3BIZA 5EI8A 3O7LD 5JGDA 1J7IA 3HP2A 4LUEA 4ZZMA 4FTUA 3DKCA 4QMOA 1FGIA 3ATSA 2OGVA 4ZTMA 5I0BA 4KSQA 2BZHB 1GZ8A 4XG4A 2BZJA 3V51A 4XH6A 3W33A 1JKKA 4L9IA 1F5QA 4XG2A 2Q0NA 1TQIA 2BALA 2C3KA 3HMPA 4HGEA 3R9DA 4EZ3A 3LJ2A 4I6BA 3R21A 3SX9A 4RFYA 5LOHA 3U6IA 4A9TA 2QOHA 3TV6A 4BYIA 4LUDA 2ITQA 4BTJA 2PZYA 4U9AA 4CCBA 4IC8A 1QCFA 1XH6A 5IQFA 1PXNA 3I6WA 4RX9A 2R3FA 1U54A 3F3UA 4PV0A 4DFXE 3EN5A 3OTUA 3UVRA 2GCDA 4LMUA 4BI1A 3VQHA 4FUXA 5DR9A 4N6ZA 4EEVA 3HEGA 4DEIA 4NKAA 4D4VA 4DCAA 3GT8A 4AT5A 4BTFA 3PY1A 3PXKA 4UMTA 3FMKA 2C6KA 4HCUA 2O64A 4MXXA 3G15A 4J52A 5AP6A 4FIGA 4FKOA 4QMQA 4EKLA 3M2WA 3HUBA 3P9JA 2UVXA 3QZGA 4QTCA 5L4QA 4RMZA 2W17A 5DRDA 3C4WA 5FG8A 1L8TA 5TOZA 1PJKA 1Z5MA 1ZYLA 3BYOA 2WQOA 2XNNA 4ZMEA 2FA2A 4JBOA 4DGMA 1QL6A 4EQCA 3V5TA 5CF6A 2R2PA 4IIRA 4EH5A 3U54A 1ZZ2A 4FV4A 4O0SA 3TG1A 1HCKA 5FP6A 3AMYA 3LFCA 4M66A 3WF5A 5J5TA 4Z55A 2XKCA 3OWPA 2BIKB 4TYJA 3HV5A 3KXNA 5TT7A 2X7OA 3ZLYA 2OZAA 4U42A 2F4JA 2J0IA 4W4XA 5DA3A 4R1VA 2HXLA 4FTQA 3VW8A 2ETMA 4ASEA 4QPAA 4FV7A 2OU7A 2QLQA 4BDAA 4EHEA 5IMEA 1R1WA 3FMHA 4YJUA 4E4XA 5IA5A 2YZAA 4HVIA 3O2MA 2X9EA 3L9NA 3UO5A 5CX9A 2E9VA 3AC1A 1MQBA 1NW1A 3I6UA 3OF0A 4O7TA 4UWBA 1KOAA 2V5QA 4FSYA 3DBQA 4DTKA 4CRSA 5EW3A 2R5TA 4GK2A 3FI2A 2WELA 3FHRA 3W55A 4MEDA 3BPRA 4YZCA 4A06A 5C8MA 4OBOA 3TUBA 4GCJA 5ETAA 5HNBA 3COHA 3VRZA 4F1OA 4FNYA 3R30A 1WVYA 2IO6A 4BL1A 3I7CA 5KMJA 2ETKA 2F2CB 3ACJA 4S31A 4C38A 5EFQA 2REIA 3ENMA 3AC4A 3P7CA 4F0FA 5IA2A 2WHBA 5JQ8A 3HVCA 4BGHA 4HNFA 4UYAA 4IC7A 4AA5A 4MD8E 2XS0A 4KRCA 4BTMA 1M7NA 3W8LA 2A2AA 2O8YA 3CGFA 3LFDA 3RNYA 3SOCA 4WUAA 1MP8A 4NJDA 5J1WA 5JRQA 2JC6A 3W1FA 2R3NA 4N70A 3KF4A 4BCIA 5AP5A 4V0GB 4KIQA 2QODA 2R3RA 3DB8A 4QMSA 3V6RA 3Q9XA 5JFSA 4FVPA 3Q5ZA 5KBRA 3O50A 4WRGA 1IAHA 4C3RA 4JQ7A 3BQRA 4XBUA 5HVYA 4EYMA 2YM8A 4Q9ZA 2QOFA 3WILA 1Q62A 3MV5A 3TWJA 5BVDA 5HX6A 2A27A 4NZWB 3HMOA 2W1GA 4F0GA 4QYEA 5HD4A 5M4IA 1LR4A 3PZEA 4BIEA 4EUUA 4DC2A 3E7VA 1OIRA 2GU8A 4RX7A 4EH3A 3S00A 2FB8A 4JNWA 4C36A 2C3LA 4EOQA 2E9PA 4K6ZA 4GYIA 4QO9A 2PPQA 4FV8A 4DF3A 2IVTA 4UMQA 4F09A 1P4FA 3FI4A 3C51A 2I7QA 4IAIA 4MF1A 3Q5IA 5HGIA 4U8ZA 2V22A 3R6XA 2WMTA 2UW7A 4EJNA 3NYNA 2YACA 4P90A 3FZTA 3LE6A 3R1YA 4TYGA 5FEEA 3VF8A 1XR1A 4I0TA 3OWLA 3MA3A 5CAOA 2VX3A 1Y8YA 4OAUC 2J90A 5E8WA 3VJOA 4HCVA 3LCTA 2XK9A 1KV1A 3ZLXA 3D9VA 3PY3A 5FTQA 4N0SA 4PDYA 3PE1A 3PWDA 3ORIA 3VS1A 1BUHA 3NW5A 4K9YA 5BVKA 2PMLX 2WTCA 4TW9A 4PP9A 3SOAA 4DHFA 3QFVA 3UOKA 4USDA 1XBBA 2WKMA 2O65A 3CQWA 3FKNA 2ONLA 2QURA 2VNWA 3R9HA 3Q52A 3U4WA 2UZNA 1JVPP 2OICA 2X4ZA 4IW0A 4AN2A 3WF8A 5JK3A 1H26A 4AGCA 2FSMX 3JS2A 4CT2A 2UW0A 3GU8A 4GJ3A 2W1EA 5E8ZA 4JS8A 3DKGA 4NUSA 4ZTLA 3IGGA 3FMLA 4FSRA 4KIPA 4RA5A 5KMOA 4RA4A 1R0PA 1WMKA 1J1CA 3OCSA 4FTTA 3ZZEA 5BVFA 4YO4A 3HDMA 4W8DA 3R83A 5HLNA 5DI1A 4O7YA 2E9NA 5AR4A 4RX5A 4D2TA 1OKYA 2Z7RA 1CSNA 3MJ2A 4MXAA 4O6EA 5HVJA 4EHGA 1GIHA 1OL6A 2QO2A 3K54A 4I21A 4RVKA 2R3JA 4X3FB 2B9FA 4YBJA 4AN9A 5BMSA 4NM3A 3SG9A 4UMRA 3QD2B 4MXOA 4P2KA 4CV8A 4FEVA 1Y6AA 1ZWSA 2ZV2A 5K3YA 4XOZA 2OWBA 5L6PA 3LLAA 5ANGA 2GMXA 4XEYA 4FZDB 1MRVA 3G6HA 2WZJA 2ZM1A 3IW5A 4WNPA 5FTOA 2QR8A 4FSMA 4AT4A 3WARA 2Y8OA 5J95A 4WUNA 2W9FB 1I09A 3VUIA 5BUJA 4BF2A 3TI1A 2C5NA 2E2BA 4ITHA 1ZAOA 3V5QA 3PXFA 4NTSA 5IKWA 3FJQE 2W1CA 5EM5A 4EZ7A 4D4SA 3SC1A 3SHEA 4XG8A 4O0RA 3RZBA 4QTDA 4ZAUA 2B1PA 4II5A 5HICA 3VUTA 2C6EA 3PXQA 4XP3A 3F5XA 3TJCA 2QOBA 2QO9A 2XMYA 3PJ3A 4MTAA 4U5JA 1WVXA 3VUHA 4BBMA 4M8TA 5A6OA 5IA3A 3ZDUA 4AZFA 4FI1A 2E9OA 3ENHA 4U6RA 4RLLA 4APPA 5A3XA 4HVSA 3F61A 4BN1A 4G6LA 3OS3A 4X2FA 4OGRA 4JT3A 4YZDA 5CSPA 4JDJA 3PSCA 3MH0A 1BMKA 3O51A 4TKSA 3COKA 4LRKA 3SQQA 4IAZA 3G5DA 3G6GA 5M06A 4DTAA 3BBTB 4UMUA 4FIFA 3FMMA 3AG9A 4ITJA 3PVWA 2C5XA 5J8IA 4MQ1A 4NCTA 3CP9A 2JFLA 3BE2A 5AV1A 4CLJA 3PRIA 5HO8A 3TUDA 5CT7A 3DS6A 3JXWA 4EK8A 5AEPA 4ACMA 2YM7A 3C0GA 3E8EA 3MJ1A 4LOOA 5ANIA 2IW9A 2PYWA 1FVVA 4L52A 2XUUA 3LCDA 3UO6A 3D5XA 5J9LA 4DEHA 4ZJIA 3ZZWA 4DGLC 4I93A 1RDQE 5HU3A 5IQIA 1AD5A 3EKNA 5E8VA 2PE2A 3LLTA 2YJRA 3MW1A 2ITPA 4Z9LA 4D4RA 4BDHA 4BR3A 2FO0A 5AM6A 4WBBB 4E93A 4YUQA 4HVGA 2PL0A 2OH4A 3AD5A 3SRVA 4C58A 4GSBA 5CI7A 2J9MA 5IPJA 3U9NA 4IWQA 2H6DA 5EI6A 4EK3A 4MNEB 3MPMA 1ATPE 1J1BA 2YABA 3QUDA 2HYYA 5L2WA 3VN9A 2VV9A 4DEAA 5KMKA 3R73A 4CZYB 4X6QC 5LMKC 5CAPA 2BDFA 4OBPA 4J96A 1M2QA
chains in the Genus database with same CATH superfamily
2I0EA 2WTIA 1A9UA 1VZOA 2QKRA 3JVRA 5HE1A 3HMNA 2R3IA 4R5YA 3A7GA 3LFBA 4GIIA 4EC8A 4I6LA 3HV3A 4QYYA 3G0FA 4U3YA 2CKPA 4BKJA 3QTRA 4GU9A 1ST0A 5HIDA 1FGKA 4HGSA 4FTKA 2DWBA 4RWLA 4O7RA 4RPVA 3ZOSA 4CQGA 1Z57A 2R3PA 5FDXA 3WF9A 3QRTA 3OUNB 4YHFA 1TVOA 2P0CA 3OCBA 3BL7A 4HZRA 3DJ7A 5AP1A 5C01A 1OKWA 1OGYA 2C6IA 3EB0A 2V0DA 2XANA 1YQJA 2ZYBA 4LG4A 5IH6A 2RFNA 4QMPA 2OBJA 4ACGA 3PDTA 4WKQA 3DBEA 5CZHA 1OGUA 4UXQA 3C5UA 4DEDA 2Y0AA 4O0UA 4YP8A 1UV5A 4W4WA 3N4VA 4FG8A 2JDVA 3UNJA 5CNOA 1P2AA 4ERKA 3D5WA 3DDPA 1OUYA 3LXPA 4XV2A 3HRFA 4FYOA 3EKKA 5EYCA 5CQUA 1BYGA 2UZWE 1PXPA 4PDOA 3WI6A 3MIAA 5AV3A 2P4IA 3AD4A 2XEZA 3P7AA 5HOAA 4J8MA 3N51A 3D2IA 3JYAA 4QMLA 4A07A 4RIOA 5ETIA 3R7YA 1UU9A 2WTKB 3O71A 3CIKA 4C3FA 3VJNA 3QTUA 4RC3A 4IQ6A 3UZTA 4FODA 2RGPA 4FIEA 4FSZA 3E87A 4F63A 3FV8A 3KL8A 3V6SA 3AGMA 4YURA 1S9JA 3BYMA 1OI9A 3CJGA 5IG1A 3DXQA 4UALA 1K9AA 3FHIA 3QCQA 2X8IA 4PL5A 4Y8DA 3T3UA 1OMWA 3GCQA 3RI1A 3NFFB 3FXWA 1XHAA 4DLJA 4FV5A 5J87A 5HX8A 3TZ7A 1VYWA 2UW6A 3W0MA 4D2WA 2Z02A 3ITZA 3VBTA 1U54B 1ZMWA 2QOOA 3AC5A 2CNUA 5KKRB 4W4VA 4I4EA 1XH8A 5LVNA 3NRMA 4Z3VA 3GU7A 3D2KA 3FLZA 5M4FA 4FJVA 5M09A 3CD8A 3HV4A 4IANA 3REPA 3QTSA 4X2GA 3L9LA 3QRUA 4YBKA 5GNKA 3VC4A 3VS6A 2VTSA 1DM2A 2ZV7A 3SXRA 3TJDA 4CTBA 3UIXA 3DFAA 1H0WA 3RP9A 3MH1A 4YJSA 4U80A 4ASDA 5L2TA 5FD2A 4NT4A 3DQWA 5AX9A 4DG2E 4J7BA 2PVKA 2ETRA 3L1SA 1M17A 4ANNA 1MRYA 3RHKA 3TACA 2I0VA 5HG5A 3ZTXA 3L8XA 3V3VA 2GQRA 4BDDA 4HYUA 3VS5A 4X3FC 1H1PA 3FLQA 3BCEA 3FAAA 4BKZA 3OXZA 5LQFA 5ANKA 3OBJA 4TPTA 5CALA 2YDIA 3BHUA 4JI9A 2XK6A 4IJPA 3P7BA 4OTHA 1Q8YA 4HVDA 2OZAB 3TDVA 3QD4A 5IEXA 2ZOQA 3K3IA 4H58A 3EOCA 5IQGA 3ORKA 3GP0A 5H9BA 3LJ1A 2VGOA 4K11A 5F95A 5L2SA 4CG9A 3BBWA 4L8MA 1W84A 4FR4A 4D2VA 2V55A 4E3CA 5CYIA 3IW8A 2V7OA 4ANQA 3TMOA 3GNIB 3E3PA 4JG8A 2XIYA 4FKIA 2QCSA 3UBDA 3ZEPA 1PXJA 2CKEA 4FV6A 1ZYCA 4YNOA 3QC4A 3P0MA 5M51A 5IF1A 2J0LA 3AC8A 4QPSA 2OFVA 2CJMA 1CTPE 4I20A 3ZRLA 4EZ5A 1ZLTA 1XWSA 4LM5A 5ANEA 3DB6A 4USFA 4G17A 3D83A 5EM6A 4DT8A 5L6WL 3OW4A 3LCSA 4KABA 1YHVA 3HV6A 3O8UA 1RW8A 2J50A 2VTMA 3CXWA 3O17A 3FI3A 3TM0A 4UN0C 2IZTA 4R5SA 2YIQA 4E1ZA 3A62A 4E5AX 3A4OX 2JBPA 4LV8A 5E1EA 3OP5A 3UZRA 3MYGA 4ZK5A 4MQ2A 4IAYA 5KUPA 2QU6A 3ZH8A 1YOMA 2PWLA 1ZYSA 1XQZA 3F7WA 5H3QA 4R6VA 4R3RA 4PPBA 4S33A 2BFXA 5IA0A 3N4TA 3G9NA 3OOMA 5DR2A 2HXQA 2VD5A 3CGOA 4DGNA 2C1BA 3IOKA 3PXRA 5C8KA 5IA1A 2QO7A 4Y73A 5FRIA 2OIBA 1KE7A 4L46A 1VJYA 4B8MA 2W9ZB 3FE3A 3F69A 3EMGA 4G5PA 4IZ5A 3KVWA 3R7OA 3CBLA 3UYTA 3ZEWA 4H05A 1UNLA 1PXKA 2UW8A 4LRMA 4I6FA 5F1ZA 4D9UA 1A48A 4IX6A 4QMVA 4FYNA 4CFXA 5DT0A 5BPYA 2BCJA 5E8XA 3IDPA 2DYLA 3LFEA 3LHJA 5CVGA 1SNUA 1XJDA 1LUFA 5B2MA 2HWPA 4BICA 4EL9A 3ROCA 3DOGA 3DT1A 2ESMA 3NLBA 4KS7A 3UQFA 2BKKA 4P5ZA 4BBFA 3IKAA 4L6QA 5CNNA 4C3PA 3TV4A 2UV2A 3FWQA 3F82A 4X21A 2B4SB 5AADA 4YZBA 2BFYA 3A8XA 5FGKA 1OZ1A 3BV3A 2QC6A 5EHLA 4WG5A 4CD0A 3RKBA 4ZP5A 1G8AA 3UOLA 4WG4A 2BUJA 4DITA 3MFUA 2GNLA 1V0BA 2R4BA 3E7OA 4YLKA 4J71A 5HE2A 3UDZA 4FZ7A 2BAJA 3LQ5A 1IA8A 2XJ1A 4FOCA 1TFFA 3FKLA 4FL2A 1OB3A 3C4FA 3NIEA 4FNWA 2OJGA 3CTHA 4MH7A 3R8VA 2O0UA 2C6TA 4H36A 4ENYA 4ALUA 5FEQA 5E8SA 5AFVA 1E9HA 3OHTA 3EN4A 3LQ8A 3CKWA 3QA8A 5EHOA 4AWIA 2W7XA 3I60A 4EH7A 4TNBA 4YPDA 1J7UA 2OXXA 2XCKA 5IDNA 1F0QA 4AQKA 1U59A 3E8DA 3W16A 4EBWA 4DFBA 3G51A 5FM3A 2ZDUA 4GRBA 5D41A 2X2KA 3NEWA 3BL9A 4KAOA 1PRYA 1RJBA 5AP7A 2EU9A 3FY2A 3NPCA 3ANRA 3QWKA 3R1NA 4FKQA 4ZEGA 4QP4A 4DN5A 4F6UA 3KN6A 2B55A 3GCUA 4E8AA 4ALVA 2X2LA 1ZY4A 3W2SA 2P55A 4YTCA 5HVKA 4TWOA 4IAAA 4QP1A 5IQEA 3FZPA 4GG5A 4O7NA 2SRCA 1OIQA 3H10A 2O3PA 3PXZA 5CQWA 3SW7A 3FQEA 4MD7E 4FIHA 4G3EA 4LMNA 2F7EE 4XNEA 3KF7A 2XRUA 3K3JA 3H9OA 5KZ0A 4YLJA 5KBQA 2UZOA 2ZVAA 4E4NA 4FKVA 4AOTA 2BZKB 5BYLA 5ETCA 3RK7A 2XH5A 1JAMA 2V7AA 3Q9ZA 2ZV8A 4LGGA 4MYGA 3IQ7A 4WOVA 2QQ7A 5CU3A 4KKGA 2OLCA 3UDSA 4DDIA 2P2HA 2WGJA 2WTKC 4U7ZA 5LWNA 4TYHA 2YDJA 4HYHA 3BYSA 4G1WA 3GEQA 3CR0A 4JAIA 5AP4A 4F9WA 3IW7A 4A4OA 5AWMA 5HE3A 2R0UA 5EOBA 1WBWA 4G3CA 3LCOA 4JQEA 3R02A 3POOA 2IJMA 4JDIA 4OTIA 4WNOA 4BCQA 4DLIA 2R3MA 4KKHA 3R7IA 3S4QA 5GZAA 2Z8CA 4IFGA 3IDCA 4WA9A 4KBCA 2OIQA 2C6MA 5CEMA 1YDTE 5C4LA 1P5EA 4L01A 4MXYA 3MH3A 5A4QA 1OBGA 1LEWA 3THBA 3W0PA 5FLFA 3PTGA 4BCOA 3TYKA 4FA2A 2ACXA 3MPTA 4F1TA 3SDJA 2EUFB 4X3JA 5GJFA 3QBNA 4O22A 1FQ1B 1UNHA 3ACKA 3MY0A 4XV1A 4LDTA 3OVVA 2BZIB 4AZEA 3MVHA 2WEIA 4HGTA 4FT3A 4IMYA 4KA3A 3ZM4A 5A54A 5GZ8A 3SA0A 3DQXA 5DFPA 4A4XA 5HHWA 2GNGA 4R3CA 5K4IA 4EYJA 5EM8A 1PMEA 3Q96A 4GIHA 3TZ9A 3M11A 4H3PA 4HJOA 2J0KA 3FYKX 3NDMA 3NUSA 4KIKB 2AC3A 4IZAA 2NPQA 2OXDA 1U46A 2WEVA 3BU3A 3PJCA 4ANBA 2CNQA 3LMHA 4KUJA 2XIXA 3VBYA 2B7AA 3SRVB 2PVLA 2W96B 3GOPA 3FXXA 3VUDA 4IWDA 2C5OA 2UZUE 2YCSA 3FC1X 4RJ3A 4X2KA 5I3RA 2NNWB 2DS1A 4QP7A 5CT0A 3VONA 4GUBA 3V5LA 4RRVA 4MXCA 5CSWA 1QPDA 2ITZA 2XNEA 3GFEA 3SD0A 4DEEA 1GZOA 5AR8A 1A06A 4DG3E 4I92A 4U41A 1V0OA 4ZLOA 4GG7A 5ANOA 5EQEA 5CEQA 3BV2A 4Y85A 4Q5EA 3QCYA 1WAKA 2ZFYA 3VW6A 5DYJA 5EW9A 2NRYA 1KSWA 3U9CA 4BDEA 3MB7A 3MBLA 3OT3A 3DJ5A 4J98A 5JMSA 2XRWA 3KRRA 3HDNA 3QD3A 2BAQA 3EN7A 1H08A 1OL7A 1W82A 3Q53A 4FVQA 3Q60A 3QCXA 4QTAA 1PXOA 5LCJA 1Q99A 3QUEA 2OJFE 3PA3A 5LVPA 3MY1A 5BNJA 3QQGA 2HIWA 4JX3A 4TXCA 3ZLSA 1GAGA 4KWPA 3LXNA 2H34A 3GGFA 5GJGA 2HZNA 1NVQA 2JLDA 3GOKA 3U6HA 1G8KA 4FTJA 2QOIA 3ULZA 3VUKA 4CYJA 4L42A 5HU9A 2W4JA 4G31A 4AG8A 1TQMA 3NSZA 3IK3A 5A14A 4BYJA 2WMQA 5AUVA 2H8HA 3DK6A 4BZNA 3FDNA 4AW0A 4YLLA 3LCKA 3CTQA 5IZFA 4KRDA 3F7ZA 2RFSA 5IQCA 1REKA 4BIBA 4NM0A 3UDTA 4YTFA 3NW7A 4V05A 4JG6A 4L7SA 4AZSA 4PPCA 3A8WA 5BUEA 1ZOGA 3POZA 3FZ1A 5HTIA 4FC0A 3RTPA 4DHZA 1OPKA 3S2PA 4D9TA 3D4QA 5HBJA 4GEOA 2PY3A 4ACCA 3LFNA 4CMUA 3G90X 1ZOEA 3OD6X 4XV3A 1H1WA 3EFKA 3MFRA 4IVCA 5CSXA 4E6QA 4ACHA 5EQPA 3N9XA 1UKIA 4CKIA 2I0HA 4MD9E 4Y83A 2CGXA 4E4MA 2BAKA 1GIJA 4IVAA 4NKSA 2YZLA 4AUAA 3L8SA 3VO3A 4C59A 3QHRA 3TNIA 4XYFA 5E7RA 2ITWA 4R3PA 3GVUA 3KRJA 4GL9A 4I0SA 4BDBA 4FOBA 4DT9A 2B9HA 3UDBA 4XBRA 4Z7GA 1OL1A 3PP0A 4IWPA 4P7EA 3U51A 2OSCA 2I40A 2YM3A 2YWVA 4YHTA 1Q4LA 3ORNA 3DAKA 4RG0A 3WF7A 2FSOX 3R8PA 2X39A 3TL8A 1JLUE 4I6QA 5L8KA 5FEDA 4UV0A 3OZ6A 3WZJA 2ITTA 1Y57A 2I0YA 1SMHA 5KMIA 2CCHA 4BCNA 3W18A 4QNYA 3IGOA 3FI8A 2RKUA 3QUPA 3HECA 5HCXA 5CY3A 4BDKA 4NL0A 2JAMA 4H3QA 3H0YA 4FK3A 4IXPA 4WBOA 5CVFA 3ZUTA 3Q4TA 2XZSA 4HNIA 3VUMA 4FEXA 1E1VA 4JOAA 1P4OA 4TT7A 2RG5A 3D15A 2WU6A 2CGVA 4NFNA 2PUIA 2IZSA 3MVJA 4XV9A 4O0YA 3RPOA 1APME 3BU5A 4IAFA 4AW1A 3R9OA 2W1ZA 4AF3A 4HCTA 4O0XA 4XCUA 3NWWA 5HEZA 4DYMA 2BKZA 2Z7SA 5ITAA 5J9ZA 3TIYA 1W2FA 2BVAA 3KXHA 4IZYA 4J8NA 3BHTA 4F7LA 3V01A 2PE0A 5CASA 2F7ZE 3GU4A 5F9EA 5FXRA 4LI5A 3T8OA 3NNVA 4M12A 3NUUA 1Q8TA 4F99A 2YERA 3NNXA 5EK7A 1BKXA 2C4GA 4FV3A 5M4UA 1TKIA 3F5GA 3NCZA 3ZXZA 2AC5A 4EKKA 5EW8A 4FG9A 4KB8A 4F7SA 4FKJA 2ZJWA 1J7LA 3RINA 2JEDA 2AYPA 1JSUA 4FTOA 3UJGA 4CEGA 4ID7A 3R01A 3CD3A 4NM5A 2X81A 2R3HA 5T6KA 3BI6A 2DUVA 4D2RA 3PWYA 3LMGA 2VRXA 4R7BA 4XG3A 3PE2A 4FICA 4O96A 2P3GX 4I6HA 4MAOA 2C5VA 4GFGA 2VWBA 4DA5A 1ZY5A 2ZB1A 5F20A 3E63A 2OJIA 3HRCA 3RAHA 4OAVB 4O82A 4PTEA 1U5RA 3BHHA 3O0GA 3VS2A 5JFVA 2PU8A 4RJ6A 1Q97A 1WBNA 2XIKA 4AFJA 5K9IA 2BRNA 1W8CA 3FKOA 4L3PA 3V8WA 4F9CA 1UU3A 3FYJX 5E1SA 4BCMA 3E8NA 2HK5A 1OECA 2BHEA 3KN5A 1YWRA 3QRJA 3EQIA 4ZJVA 2WU7A 5DT3A 5L3AA 3BLHA 3LIJA 4O7WA 2Y7JA 4KKEA 2W1FA 3DXNA 2ITNA 3CE3A 1STCE 4MVFA 2J6MA 2UZVA 2XKFA 4R7IA 2GQGA 2WMWA 3OFMA 3U55A 5AUYA 3O96A 4YJTA 2VO6A 1XH5A 2YCRA 3RMFA 4A9RA 3DAEA 2ERZE 4DFLA 3UC4A 3DPKA 4U0IA 3SXFA 4G3GA 4LGHA 3A4PA 3HNGA 4PDPA 3CSVA 3TV7A 3ZU7A 2UW4A 3G2FA 2OZOA 4IX5A 5C03A 1UA2A 3C4ZA 3KXZA 4YJQA 2YHVA 4M67A 3WZKA 4EBVA 2J7TA 2H96A 4GVAA 2WD1A 3I5NA 4BWPA 4PPAA 3R0TA 4AOIA 1ZRZA 4C62A 3W0NA 4I23A 1WBVA 2XKDA 5HBHA 2WMVA 5J5SA 4RIWA 4RWIA 4FSNA 4O7LA 5DR6A 2A4LA 2R3GA 2UVZA 4CFUA 2IG7A 5E9EA 2XVDA 1NXKA 4YTIA 3S95A 3PZHA 5M57A 3E93A 2ITUA 3KGAA 2CKQA 4FE2A 4RJ7A 3FPQA 3LM0A 4YC6A 4PP7A 1BI7A 3E88A 4S30A 4DHIB 4F0IA 4S2ZA 4QYGA 5CEKA 5KHXA 1BL6A 4FKSA 2Z60A 4FT9A 2P2IA 4B9DA 1XBAA 3RK5A 3NNWA 2C5YA 4ZSEA 4FEUA 4D4YA 1YXTA 3AMBA 2HOGA 3KULB 3DNEA 4RFMA 4OTRA 4C37A 3UE4A 3FMDA 4BGQA 3C5IA 4F70A 3E8CA 3EL7A 4PDSA 4QP3A 4PF4A 3P86A 4FL3A 1Q3DA 2X1NA 2P33A 2WOUA 5HG8A 2XNBA 3TN8A 1OIYA 3VS3A 3F3ZA 3LXLA 4BBEA 2A0CX 5CSVA 3VNTA 2FUMA 4LL5A 2HZ4A 5AIKA 4BDGA 2PMIA 4IB3A 3TDWA 4F08A 2WMXA 4RJ8A 2B52A 3GFWA 4OLIA 5T3QA 5AMNA 2XAOA 2VUWA 2QLUA 3OBGA 3WZDA 4DFZE 4ZTSA 3BWJA 3GC7A 3UC3A 3V5PA 4E73A 5IQAA 3AC3A 3TNQB 4I94A 4ZTRA 2PVHA 4H1JA 1WBPA 2JITA 3I79A 4WNMA 3HMIA 3TEIA 4IBMA 2XM8A 4V04A 4C02A 4HW7A 4C4FA 4H1MA 3VVHA 3KRXA 4MK0A 3UNKA 2JKKA 3GENA 3EQHA 3LW0A 4JBVA 4Y5HA 1Q8WA 4A7CA 2CCIA 4IAKA 3MVMA 5D12A 5AAFA 4HVHA 3C4EA 4RWJA 3B8RA 3R7UA 4FGBA 3NZ0A 4JQ8A 1YRPA 3HGKA 3BGZA 4JVGA 4YGAA 5DOSA 5DT4A 1QPJA 3ULIA 4E6DA 3Q2MA 1MQ4A 5JZNA 3VBVA 2GNHA 4ANMA 2EXEA 2VX1A 2RF9A 1BLXA 1OITA 3D7TA 5CXZA 4G6NA 5AA9A 5JFWA 2R7IA 2X0GA 2EWAA 1GZNA 2W05A 2DQ7X 4TY1A 2JIUA 2UZBA 4LRJA 4TYHB 1NVRA 2RG6A 2VTNA 4BGGA 5CZIA 1W83A 5A4LA 3NAXA 2UZEA 3HYHA 2KTYA 3BEAA 5HNIX 3K5VA 3ZC6A 2GSFA 4L45A 3RM7A 4BDCA 3F9NA 1OPJA 2WMRA 2RIOA 3A7IA 3C1XA 5AP0A 2BRGA 3AT3A 3AT2A 5E8YA 4QYHA 4YR8A 5EHYA 2GS2A 2AEGA 5KMLA 2QHMA 2PUUA 3BYUA 3W2CA 3DKFA 3LFAA 4OUCA 4W8EA 3CS9A 3W2PA 4GFOA 5JFXA 2PSQA 4B6LA 4O21A 1LP4A 3PIZA 1SVGA 3GBZA 3P79A 4IE9A 2R64A 5HO7A 5LWMA 2QG7A 2XNMA 5E8TA 4KSPA 2X6DA 2YIYA 4FK6A 3RPYA 3SAYA 4R8QA 4D2PA 3QRKA 3P5JC 3SKCA 3Q9WA 1DI9A 1H07A 4LL0A 3NUXA 4QYFA 3NUNA 3ET7A 4BCFA 5IISA 3RAIA 4EHZA 1WVWA 4QDEA 4QMTA 4DBXA 5FM2A 2X7FA 4M69A 5BYYA 2F49A 2YM5A 4QMNA 1ZMVA 4USEA 3UIBA 2YCFA 4WNKA 5DEYA 3RM6A 4FKUA 2F7XE 4ACDA 1ZYJA 1OKZA 1YHSA 5AR2A 4IM2A 3KY2A 4AP7A 2OIDA 3OY3A 4DINA 1VYZA 4J1RA 4U40A 4EH2A 4X0MA 4CLIA 3QLFA 3QALE 3B8QA 3KXGA 4QQCA 1UU7A 3MH2A 1AQ1A 3KKVA 2JDOA 3DCVA 2CLXA 2IVUA 4MX9A 4NSTA 2ZM4A 5I3OA 3ROYA 2XNOA 3E5AA 3HP5A 4MXZA 4QPMA 3T9IA 4BCJA 4U45A 2IWIA 4BKYA 1ZMUA 4NK9A 2QU5A 1O9UA 1ZYDA 3A61A 4FNXA 3TKHA 4M0YA 1IA9A 4CQEA 3W0OA 1XH9A 2AUHA 2B53A 1KE9A 3EQBA 3DV3A 3WYXA 3NAYA 1YHWA 4JG7A 5EKOA 3GC0A 2WNTA 4PQNA 4OTPA 5I9VA 2C3JA 5KCVA 3K2LA 2BPMA 3EN9A 4FT7A 4MWIA 4N6YA 4U43A 2BIYA 5IUHA 3EN6A 4L68A 4BC6A 2BRMA 3UIUA 4Y72A 1LPUA 4FTLA 4IEBA 4TZRA 4YZ9A 5B7VA 2CKOA 2YCQA 4RVTA 2GS6A 4L43A 5AUZA 2WMUA 4BZDA 3LOKA 2VWXA 2QOLA 4FKPA 4ORKA 5BUIA 2JDTA 5CEPA 5FBOA 4EJ7A 4KNBA 2WQEA 2Z7LA 3QAME 3RAWA 4QMYA 3MFTA 4CFVA 1YXSA 2OW3A 4GK4A 4OTDA 2XAMA 5CU2A 5HLPA 3RBWA 3DKOA 4DH5A 3LZBA 4QD6A 2X7GA 3I0OA 3MWUA 5AAEA 3SVVA 4ASXA 3DFCB 1YWNA 4C35A 5E4HA 4RT7A 2BTRA 3EFWA 5FTGA 3W0SA 2XK4A 1X8BA 4XG6A 1O6KA 3I4BA 2VWZA 4CCUA 2YAKA 1GNGA 3PSBA 4LQMA 2JAVA 4C33A 4PL3A 3RCJA 2GTMA 4HPUE 2C6LA 2X9FA 3OUKA 4IVBA 4G6OA 3ZXTA 4B8LA 4HYIA 4FRFA 2UZTA 1B6CB 1G8SA 4DEGA 1RE8A 4E6AA 3TIZA 2ZB0A 2HENA 2A98A 1JNKA 3EQDA 4PL4A 4XLIA 3S3IA 1G5SA 4M7IA 5DGZA 4C2VA 5B2LA 4RJ4A 4QDVA 1DAWA 2Z2WA 1IEPA 1GZKA 5CSHA 2XBJA 5EYDA 1Q8UA 2BMCA 2VTHA 2VTLA 3EJ1A 3KB7A 3W10A 2PE1A 2GQSA 3TTIA 3DXPA 3ZSGA 4DHJA 1Q61A 5AR5A 4YZMA 2QG5A 3D5VA 5CWZA 3QTQA 4A9SA 2G1TA 2BRHA 4O38A 4QMXA 1YI6A 3HUCA 4FZ6A 3R7EA 1JOWB 3UP2A 3F3WA 4Z16A 3UMWA 3EQGA 4FSUA 3DLZA 4GYGA 4XX9A 4ALWA 4FKGA 4D1XA 4GW8A 5HIBA 2JKQA 3QKMA 4GJ2A 4OW8A 5HTCA 5A6NA 3ORTA 1M2PA 1WBTA 3OEZA 3LAUA 3TXOA 2G2FA 4FTCA 4BDIA 3A7FA 1Q8ZA 5IQBA 3R00A 4FV2A 5D1JA 4ZLZA 4H39A 3ZM9A 3ALOA 4W9XA 4EHVA 3ZUUA 1JWHA 3OT8A 4CFFA 4C0TA 4EH4A 4I0RA 4PRJA 3F3VA 1TQPA 2B54A 3AKJA 3NVKI 1VR2A 5J7HA 2OJJA 5EOLA 4BZOA 3AC2A 3OMVA 5LARA 1CKPA 3PSDA 3PPZA 3PFYA 1OUKA 3LPBA 2F2UA 3P08A 2C3IB 2ITVA 2YIWA 1KUTA 3RWPA 5TF9A 1CDKA 2Y4IB 4L44A 3RVGA 4JR7A 4Y5QA 5T68A 3U8WA 2J2IB 1ST4A 2G01A 3PG1A 4RFZA 5CAUA 5EI2A 3C7QA 3DZQA 3F2AA 3QU0A 2HAKA 4K33A 4K1BA 4XUFA 5IH4A 2VGPA 4BCPA 3BX5A 3NUAA 4DTBA 1IASA 4FIIA 1I44A 2CPKE 5GHVA 1HOWA 5HLWA 3OTVA 4UZDA 1FMKA 2RSVA 3AD6A 1SM2A 3QKKA 4EOLA 2WQNA 3Q9YA 3UNZA 4F78A 2C68A 3IG7A 3NGAA 5EQYA 3W8QA 3IOPA 2X8EA 4AGWA 3EYGA 2ZAZA 5DE2A 4AA0A 1W98A 4IDVA 4BB4A 4JBQA 4WG3A 5IDPA 3P5KA 4UXLA 4E6CA 4LGDA 1Z9XA 3AT4A 3EH9A 3HKOA 3R7VA 1LEZA 4F9BA 5I9XA 2F57A 2HW7A 4I22A 3ZLWA 4ZS4A 4LV5A 2YEXA 4JL9A 2W4OA 3EIDA 3FQHA 3GUBA 2VWWA 4O91A 3E92A 4G9CA 2IW8A 4XP0A 3N4UA 5BV3A 4BJJB 2EVAA 2YA9A 4ZSJA 3IECA 2FSLX 3OW3A 3I0QA 3EQRA 1BI8A 2ITOA 3W2QA 5H8GA 5DEWA 3V8TA 4J95A 5AV2A 3C4XA 3H0ZA 4LOPA 5HCZA 2IZUA 3G0EA 5EM7A 4O84A 5AR3A 3Q4ZA 3Q32A 3LQ3A 2UW3A 4M97A 3QXOA 4IHPA 2AQXA 4JBPA 4UMPA 5IEVA 5GIOE 2YJSA 4DH7A 3LFSA 3ZO1A 3EZVA 4IJ9A 4YHJA 5TR6A 1WBOA 3RALA 4EH9A 1Q3WA 4N57A 4OTFA 3QHWA 4H3BA 4IB5A 4HGLA 4FSTA 4UEUA 5CF5A 4PWNA 3A60A 4YNEA 4Y95A 2Y6MA 5HG7A 1G8JA 4ZIMA 4ANSA 3OWJA 1WZYA 4O0TA 4TL0A 4FSWA 4Z7HA 2PVJA 2Y4PA 3CY2A 3EFLA 3KK9A 3II5A 3MPAA 1CMKE 2IVVA 5HIEA 4U79A 3CLYA 4Q5HA 4RIWB 5G1XA 3VHEA 2R3KA 4EQMA 4PMSA 2UW5A 2W1DA 5ETFA 3CEKA 3QKLA 3COMA 4QTEA 1OL2A 2HWOA 1FMOE 3UIMA 2PZIA 4AX8A 5KHWA 1XBCA 3TNWA 4XOYA 3O8PA 2WTVA 5KKRC 4UYNA 3BRBA 2XB7A 4GT4A 5EYKA 4M14A 1M52A 2YLEA 3GI3A 3L8VA 5AJQA 5AR7A 1DS5A 3C0HA 3KCFA 5AP2A 4RQKA 2VTJA 3FXZA 2C0IA 3EQCA 2V62A 3WE4A 3KEXA 4BHNA 1KWPA 3PJ2A 2WTWA 4MNFA 4FV1A 4IADA 2VTRA 2R9SA 3B2WA 3FZRA 2EXCX 3HV7A 4FTMA 2NYAA 3F66A 3PVBA 4KIOA 5M53A 3JPVA 1ERKA 1B38A 3PUFC 4FUYA 3CPBA 4GVJA 5F4NA 5TKDA 4D5KA 4EOPA 4ZSAA 4PNKA 2WQBA 3DBFA 5A4EA 3ZFXA 3CJFA 2NRUA 3PIYA 3ID6C 4YC8A 1SNXA 4C7TA 3WBLA 4AXFA 2XIZA 3TNHA 1PW2A 1M2RA 5CF4A 2WMAA 5K5XA 2GNIA 4RZVA 3T3VA 4DGOA 3FZSA 2VO3A 3OY1A 3R71A 4U3ZA 4FTNA 4TYEA 5BVEA 3NVMB 2R3LA 5JT2A 4BI0A 3OOGA 4PMPA 1YXXA 3QTZA 3NYVA 1O6YA 4FTRA 1XO2B 1GY3A 3FY0A 5M08A 3FMEA 3R04A 1PY5A 4FTIA 3CCNA 3R2YA 4QP9A 2VNYA 3KXMA 5DHJA 4FMQA 4QOXA<