5HG7A

Egfr (l858r, t790m, v948r) in complex with 1-{(3r,4r)-3-[5-chloro-2-(1-methyl-1h-pyrazol-4-ylamino)-7h-pyrrolo[2,3-d]pyrimidin-4-yloxymethyl]-4-methoxy-pyrrolidin-1-yl}propenone (pf-06459988)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
280
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Discovery of 1-{(3R,4R)-3-[({5-Chloro-2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-methoxypyrrolidin-1-yl}prop-2-en-1-one (PF-06459988), a Potent, WT Sparing, Irreversible Inhibitor of T790M-Containing EGFR Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 280
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hg7A01
1Q4LA 3JY0A 3NX8A 5JFVA 3DK3A 1LEZA 1HCKA 2R4BA 4ZSAA 5AR5A 2REIA 2JBPA 2UZBA 5HG5A 2Q83A 4HW7A 4TT7A 4XX9A 1UU8A 3CCNA 5F94A 4IVAA 3R8LA 4G31A 4EH7A 2GS7A 2C5YA 4R3PA 3LZBA 3OP5A 3R9NA 3F3TA 1OMWA 2EB2A 3HNGA 5DT0A 1CTPE 5GJGA 1YXTA 3FKOA 3BLRA 4GS6A 3UODA 1OM1A 5H8BA 3RCDA 2GQRA 5L2QA 4YLLA 4CZUA 2KULA 5GINE 2JC6A 4ACHA 4FGBA 4FZAB 2BIYA 3W2SA 4FTTA 1XH5A 1H0VA 3AOXA 4DTAA 4CFNA 4ITIA 3BEGA 2WHBA 3EQFA 5CVHA 4F7LA 3CJGA 2J5FA 5CALA 1OIYA 2C6MA 2CPKE 1YKRA 2PE1A 2WGJA 3QZIA 4XOZA 3FI8A 5FM2A 5CAVA 3C4CA 2ITVA 3BU5A 3ORMA 3P5KA 4BCFA 5CEQA 5EKNA 5K9IA 3P1AA 3ZRLA 4FTNA 4F7JA 2G01A 3LCTA 4O1OA 4C36A 4IFGA 4RPVA 5E9EA 3NUSA 4BRXA 4RC4A 3OBGA 4ZJVA 4H3QA 5BVWA 5HO7A 2W1GA 4L52A 3OUKA 5KMOA 2C5OA 4CCBA 4EKLA 1XBCA 3S00A 3R8VA 4E26A 4DLJA 1YWNA 4PWNA 4QMVA 4UB7A 2FH9A 2OIBA 1PMNA 3QYZA 4JDJA 4F0IA 2W99B 4L00A 4ORKA 3FLZA 3DZOA 4CKJA 2WMUA 3FKNA 3P79A 4FC0A 3CLYA 3AMAA 2YWPA 5D12A 2XKCA 5HBEA 2W1ZA 1G5SA 4K18A 1MRYA 4FT3A 4JIAA 5CZIA 5L2IA 3BHTA 2DWBA 4FI1A 4OUCA 3BLQA 5H3QA 3R7VA 5TT7A 1OBDA 3HA6A 4E5WA 2HK5A 2OO8X 3PE1A 5FG8A 2ZB0A 3VC4A 5HD4A 3L9NA 2HW6A 5LMAA 3ZTXA 3W33A 1VJYA 4IVCA 4G1WA 2J5EA 5AV2A 2AC3A 2QC6A 3AGMA 4L8MA 3G6GA 4X2GA 5DIAA 4ZIMA 1JKLA 1QPCA 5CEMA 3NAYA 3VUTA 1GIHA 2W4OA 4FEQA 4PDPA 3IECA 2BDFA 3F66A 3G2FA 5IF1A 4O83A 4X3FC 3KY2A 2ZAZA 4XNEA 5J95A 2VWBA 4ZTQA 4KINA 3NLBA 4OAUC 3LFSA 5FDXA 3DK6A 2VU3A 3WZKA 4J97A 4NH1A 3BU3A 4AGWA 4JVGA 1H25A 4FK3A 3O2MA 3HYHA 1XH7A 3FL4A 3CTQA 3ORNA 3EQRA 5DG5A 3UQGA 1XH9A 3CEKA 1Z57A 3GU5A 3OCSA 1BL6A 3KREA 4M67A 3EN5A 4JJRA 5CNOA 3PXZA 1IASA 2QD9A 4DE4A 1GJOA 3ZSHA 1KE7A 4XG8A 5DN3A 5A46A 2QU6A 3EZRA 3PIZA 5LWNA 4MBLA 3WZUA 2YISA 4MYGA 5HKMA 3LPBA 3R8ZA 3BI6A 4XH6A 4CFVA 4FTIA 4IAZA 1YDRE 1QCFA 2G2FA 3EOCA 3MFTA 4RWKA 3Q5ZA 3MESA 3P9JA 4FNXA 1Y8YA 3RM7A 5AAGA 4FIIA 2YM3A 1YWRA 3DAEA 4GFMA 4OBPA 1XQZA 2BRBA 4F1MA 4EQMA 4YTIA 5LWMA 2XUUA 3MH3A 3PXYA 4KSQA 1BMKA 3DGKA 3VN9A 3ENHA 1M2RA 1H24A 2JEDA 2C47A 4UWBA 3RM6A 3TXOA 3CQEA 4ANLA 4GV1A 1MUOA 2C6OA 4C4JA 3EQPA 4QTDA 3AXWA 1UWHA 4G2FA 4QMYA 3KFAA 4JQEA 3V5WA 4OAVB 4OTFA 2J2IB 2WFYA 2QOHA 2V5QA 5AAFA 1ERKA 4QMZA 5BQ0A 3W2QA 3NYXA 4E6CA 5L2WA 3CBLA 3SGCA 5BVDA 4IM0A 5KMLA 3H30A 5L6WL 3PPKA 1SM2A 2UW9A 4IWDA 4IHPA 2X6DA 4RFZA 3BEAA 3QTZA 1E1XA 2WMVA 1WZYA 1URWA 2VTHA 4IX3A 2BZJA 4F9CA 3FJQE 4EYMA 3ORIA 4UZDA 4AXAA 4EK5A 4F6UA 4GUEA 4JIKA 2XK4A 3RAIA 4CTCA 5FDPA 5FXRA 2A0CX 3LCDA 4C59A 1QMZA 2AC5A 4QQCA 3R7GA 3DJ5A 5D7VA 1NXKA 3F5GA 1ZYSA 2E9OA 4E7WA 4Z7HA 2VD5A 4ZJIA 5AMNA 1H1WA 1GZ8A 1WBWA 4GK4A 1B6CB 5AR4A 1TQMA 2Z7SA 2RIOA 1YQJA 1Z5MA 2ZM3A 3PWDA 4FTKA 4EOPA 3DNDA 4UEUA 3LMHA 5ETFA 2W1IA 5CSVA 3QHWA 4FICA 4BI0A 4CFUA 4LOPA 3NS9A 5EOLA 4EOOA 3IQ7A 4Q2AA 5CVGA 3R1SA 4U45A 3NW6A 3R9HA 4DC2A 3OEFX 5HCXA 4RC3A 4FEUA 3MS9A 3U9CA 4E5AX 3SLSA 3OTUA 5L6PA 4FSQA 4BBFA 4DINA 3O51A 3GCQA 4XV1A 4MQ2A 2WTKC 4CCUA 1Q24A 4BBEA 2XNGA 2PWLA 4YPDA 1APME 2G2IA 5FUTA 3U4WA 3L9PA 3PP1A 1H1SA 3I81A 4XUFA 5I9VA 3UO6A 4MD8E 3KU2A 2VO6A 4O6LA 3F2RA 3LJ2A 4KKGA 4YLKA 5JN2A 4QYEA 2YWVA 3RPYA 2ACXA 2G2HA 3QA0A 1W8CA 4GCJA 4PTGA 5JZNA 4QMLA 3WBLA 4BZNA 3BKBA 4CFMA 5IA3A 3BWFA 4F9YA 2VTRA 4U3YA 3QGWA 4BGGA 3R22A 3BYSA 4FKRA 4TW9A 4CQGA 4QMQA 5CANA 5M4CA 3M42A 1V1KA 4PL3A 5AP1A 3AGLA 4FIHA 4J7BA 5M44A 4WNPA 3SD0A 4I5HA 5E92A 4ID7A 4CD0A 2IW9A 2WEVA 2XJ0A 1FINA 2UVXA 2XCKA 2XKEA 4FVPA 4FV8A 4FV6A 5EYDA 5LVPA 3U6IA 2I1MA 4JRVA 3PSCA 4CFFA 3MV5A 3EZVA 2BDWA 3WIGA 4YZCA 3ZO2A 3HMMA 5LVNA 1S9JA 2C4GA 2YEXA 4ZTMA 3PA3A 3R2BA 4L01A 5C03A 3T8OA 2B9IA 4S32A 3I60A 4FV1A 4DEGA 5TOZA 4U5JA 4I0RA 4IE9A 2HWPA 4MAOA 3UO4A 3HL7A 4FL2A 2ZM4A 4PMTA 4QP8A 2YDKA 3DLZA 4MD7E 4FKJA 4RJ4A 3RAKA 3UPZA 2ONLA 1GOLA 4UX9A 4C4IA 5CEPA 4MTAA 3C9WA 3DNEA 3I79A 4CT2A 4ALVA 5A4QA 5BMSA 2QG5A 2ZMDA 3OS3A 4N4SA 3MY0A 3VS3A 4K8AA 2PYWA 2OXYA 2BFYA 5E8TA 2ZOQA 3U8WA 4DH3A 2B9JA 3IGGA 4L7SA 2IVUA 1B38A 1JBPE 2JDSA 3R00A 3VF9A 2VTSA 4E4NA 3EYHA 2YHVA 5HU3A 4AZTA 2RFEA 2CDZA 4LV8A 5GZ8A 3DA6A 3R21A 4DBXA 4WIHA 2XK7A 4ZEGA 5J9LA 1J7LA 1SVHA 2ETKA 2W7XA 1KE9A 2O65A 3CS9A 1FQ1B 1WBOA 4YHFA 5JGDA 1YHSA 4MH7A 3JXWA 5CVFA 4BDFA 4I5CA 4BFMA 4FR4A 1HOWA 2HELA 1M7QA 3T3UA 4FEVA 4LFIA 2BRGA 3RCJA 1LEWA 4CSVA 2DYLA 3LW0A 4FEXA 4DEAA 4FKPA 2VWIA 3I5ZA 1ZOGA 3OBJA 3VWAA 4ERWA 4U97A 1CSNA 1CKPA 4ZMFA 1SNUA 5F95A 3D2KA 5IQAA 5TO8A 2HY81 2NPQA 2VX3A 4FKTA 4IBMA 3ZZEA 4B99A 5LJJA 4XLVA 3C4WA 3UG2A 2QOKA 3MVHA 3QZHA 5EDRA 5EQEA 5FXSA 2BRNA 3LCKA 4J8MA 3A7HA 4PP9A 3RMFA 4D5HA 5L8KA 4K0YA 5J9YA 1R0EA 5D7AA 4V04A 3LFNA 3W8QA 5HTBA 3GFWA 4BGQA 1JWHA 5K3YA 1G8AA 4FYOA 4D4RA 3FZTA 4D2SA 2W1HA 4IWOA 4AP7A 3TI1A 4DH5A 1Q3WA 4CZTA 4D4VA 4IWQA 2YM5A 3AC2A 4DFZE 3ORTA 4GG5A 1YVJA 1H0WA 4C8BA 5B7VA 3MSSA 3UG1A 2WB8A 5EYCA 2CNQA 5E8XA 2WMSA 3V8SA 2BTSA 4YBKA 4DGGA 5BVOA 1MRVA 4J1RA 4U80A 1QPEA 2UW3A 2YABA 4C0TA 4GT5A 1H4LA 2Y4IC 2EU9A 4GYIA 4C3FA 2VTTA 3NNWA 2IW8A 4MKCA 3DBCA 5DRDA 5IUHA 5CS6A 3KXXA 4BICA 3ZONA 3FXZA 2WMAA 2A1AB 1WVXA 4IJPA 4TKSA 4AS0A 4DAWA 3OWLA 4CV8A 1KV1A 1GIIA 4QRCA 5EM8A 2PZIA 2XNBA 3RHKA 1TQIA 5ANIA 3EFLA 3LFQA 5EDQA 4BL1A 4YP8A 3ZXZA 1K3AA 1Q5KA 3ORZA 5AJQA 3BGZA 2O8YA 3QQFA 3Q4TA 4FV7A 4IAYA 4BCJA 3C50A 3JUHA 5LMBA 1YXXA 2C3IB 2Q0NA 3PJ1A 5IA5A 4O38A 5LOHA 4O7TA 4KKHA 4A06A 1YHWA 4RJ6A 3VS1A 1XBAA 4FKOA 3W10A 3BWJA 3A7JA 2FUMA 2X7GA 2J9MA 3PWYA 2BIKB 2YIRA 4Q5EA 4RJ7A 1IRKA 1Q8ZA 3P7BA 4HYUA 4XV9A 4ZOGA 5HVJA 4QMNA 3IS5A 4KSPA 3V8TA 3K2LA 3HX4A 4PL4A 3E8NA 3PJCA 1DI9A 4L3PA 3TZ8A 2NNWB 4IM2A 4B8MA 2UZVA 3WI6A 4YPSA 2GSFA 3AC4A 5IQCA 2LAVA 2R3LA 4IB1A 4KB8A 3VUMA 3W8LA 5A6OA 4G5PA 2R3NA 1OITA 2XEYA 3CY3A 1ZYJA 3I6WA 3VAPA 3KVWA 3KRLA 4BDHA 1ZWSA 2C3LA 3CGOA 2CNVA 4OBOA 2ZV8A 4X2KA 3VULA 1MQ4A 3RNYA 3RALA 2Z02A 4OGRA 2WEIA 4FIJA 5HE0A 4D2WA 5I0BA 4IFCA 2XBJA 2OH0E 2GNGA 3R63A 4BKJA 3QA8A 5FEEA 2UUEA 1ZARA 4GMYA 4OTGA 3RZFA 1B39A 1OL7A 4WD5A 2OJFE 5AP6A 3SX9A 2QOLA 3MH1A 3ORKA 4G6LA 4WHZA 4K11A 1ZYLA 4Z55A 3QUPA 3SXSA 2J0MB 4U8ZA 1AGWA 4FSYA 2XBAA 4DFBA 3RTPA 3EL7A 3R1NA 2ZV2A 3OW4A 4X2JA 5M4FA 5JEBA 3DKFA 3ZUUA 3NW5A 4UY9A 3L8XA 4FOCA 4DLIA 3QGYA 4I6BA 3I7BA 4MXAA 4O0TA 4RC2A 5HGIA 5L8JA 4EHEA 5IZFA 3HEGA 2BR1A 2XIRA 4D58A 4UMRA 4YSMA 1S9IA 4QOXA 1FVTA 2QONA 2X39A 3CQWA 4FKIA 4KWPA 4NTSA 2E2BA 3JS2A 4WG3A 4ACCA 1OL1A 3C0HA 3OXZA 1X8BA 3DJ6A 5AA8A 3MYGA 4JOAA 4O96A 3QRTA 2WQOA 4V0GA 2WQNA 4V0GB 2R0UA 5DMZA 5IA4A 2BHHA 2C6DA 5K5NA 5IEVA 3DV3A 4UMQA 1H08A 2WOTA 4XP0A 2HXQA 1H00A 2C5XA 2E9VA 2YAKA 5CU4A 3QZFA 3KXMA 3QX4A 4FSNA 1TQPA 2CKOA 4UMTA 3EQGA 2J0JA 2R3JA 3EIDA 2G1TA 3CGFA 3Q4ZA 3ZDUA 5IQBA 4F99A 1M2PA 1YI6A 2I0HA 3MPMA 2C3JA 3OROA 2W96B 4XJ0A 2OFUA 4S2ZA 4ZS4A 3FXXA 4UXLA 3QF9A 3Q4CA 3QQGA 1NW1A 3EYGA 3N4VA 3UOJA 4BGHA 3CD8A 2F7XE 2GNIA 2YJSA 3QU0A 5LMKC 4RA4A 3E64A 2ITZA 3Q3BA 1YXVA 3MJ1A 3IG7A 2VWVA 2QURA 4RJ8A 3UZTA 4L42A 4CFXA 3L1SA 4I6QA 4FKQA 2PULA 4P2KA 4AF3A 2BMCA 4FTJA 4F9WA 3BV3A 2IJMA 3BE9A 4HYIA 3U4UA 4QP9A 3KMMA 2GTNA 3R8MA 2F4JA 2XKFA 4QMXA 3PPJA 4EQUA 4YURA 3Q9XA 4HVHA 4QMWA 4C2VA 5C4KA 3Q2JA 5KZIA 3A4OX 3V6RA 1Y6AA 4AFJA 5L3AA 3D7TA 2PVHA 2HXLA 4NSTA 3D7TB 4AOIA 4CKIA 2YIQA 3ZS5A 1Q3DA 3SW7A 3C5IA 3KCFA 3PY1A 3QQJA 4DFNA 1YOLA 3V5JA 2QO9A 4FG7A 2YIYA 3TKIA 3GC8A 2R3FA 2V7OA 2VWYA 2YAAA 3HMPA 3ZUTA 3QKLA 2RFNA 4JRNA 2YLFA 4RQKA 5M55A 3OCTA 4PRJA 1REKA 3F3ZA 2RG5A 2UZLA 4HCVA 1YDTE 4FIFA 1PXKA 3HDMA 5M09A 3MPAA 4I1ZA 5AX3A 1OPKA 4BCOA 2XK6A 2A4LA 5B0XA 4YR8A 3P4KA 1KV2A 4QNAA 4D2TA 4DYMA 4YZNA 1G8SA 3DLSA 4DEIA 3R8UA 2BPMA 1PXMA 2YJRA 5EQPA 3LFEA 3TM0A 1KUTA 5C9CA 4R3CA 4YUQA 2ZYBA 4DEHA 1P2AA 5IDNA 3T9TA 4CV9A 5JFXA 3A60A 4IZYA 5LQFA 4M8TA 1BI7A 2OI4X 4D2RA 4PPAA 1J3HA 4B9DA 3BYVA 4AA4A 2R3MA 5KZ0A 3OVVA 5DEWA 4KIKA 1P4FA 4W8EA 5T6KA 4ANQA 4KIKB 3KXGA 4D9TA 3AMYA 4EHZA 5M07A 4CLIA 2QO7A 4GRBA 4S34A 2R2PA 4K1BA 4TNBA 5B2KA 3VUIA 4YTFA 2FB8A 1REJA 1ZYDA 3KGAA 5EM6A 5K0XA 3EN6A 2PL0A 4YLJA 4O7LA 4TYGA 3AT3A 5DR6A 5FTQA 2HZIA 2NP8A 3FE3A 1BL7A 2VTMA 2BROA 2XRUA 5LARA 3U51A 2W4JA 3LFAA 4QMTA 4BWPA 4LM5A 4RGJA 4F0FA 3PXQA 3G0FA 4DCAA 3UYSA 2B54A 3PDTA 3ALNA 3F61A 4L44A 4RBLA 2ITPA 3DXNA 2QOBA 4IQ6A 5E8UA 5C8KA 3QLFA 3VW6A 4ZTRA 3HGKA 2PVLA 2OJJA 2RKUA 2WTVA 4DGLC 4XRLA 5AP0A 5KNJA 3MA3A 3E63A 4NJ3A 2ZDUA 3I4BA 3OY3A 4XBUA 4QQTA 4JAJA 4TPTA 1RW8A 3I7CA 3IW7A 4L46A 3PLAE 4C61A 5J9ZA 4MVFA 3NCGA 3IDCA 4PPBA 4NIFB 1CKIA 3WYXA 3NWWA 4CGAA 4AG8A 3DB8A 5M56A 5FQDC 5CXHA 4RZVA 5K4JA 1QPJA 3B8QA 2GS6A 3D5VA 2EUFB 4RWLA 2WU6A 3PFQA 3UZRA 2HY0A 4AT3A 5ANKA 5IKWA 1IA9A 2JAVA 1PXJA 3CPBA 3LXLA 4JL9A 5L2SA 4D28A 1R1WA 4FKLA 4FMQA 3ZUVA 4BCNA 5IU2A 3C0IA 5CTPA 3C4EA 3WZJA 3BU6A 3FQEA 3FLQA 4J95A 4M15A 4LG4A 1LR4A 4ZSJA 5D11A 3LFDA 3O23A 3UC3A 4NEUA 4UMUA 1NVSA 3RK9A 1BKXA 4L53A 5CSPA 3PJ2A 4R5SA 4K77A 4AZFA 2CJMA 4DCEA 2IZUA 1JSTA 4F63A 4CRLA 3OWJA 4EK6A 3GC9A 3TTJA 1WBSA 3BYUA 4LL0A 1WAKA 4W4WA 5TKDA 3VJOA 4H3PA 4D0XA 4Q9SA 3RBWA 2O3PA 2VTOA 5HLPA 5A14A 3Q32A 5I9ZA 5JGAA 2OFVA 3HKOA 4ZZMA 4KAOA 1ZYCA 4TTHB 3RPVA 4ZTSA 3HV7A 4JXFA 4RFMA 3DU8A 3E8DA 3VS7A 2H9VA 4B8LA 4IZ7A 4LMNA 4ZP5A 5DA3A 3FSKA 4KNBA 5C4LA 3AG9A 4R6VA 3LVPA 4TZRA 2B4SB 4ENXA 3UDBA 1ND4A 3FI3A 4O91A 1I44A 3LAUA 5AUTA 5KMJA 5JH6A 3SG8A 2WNTA 3D94A 3LJ0A 3LOKA 3UVRA 4D1XA 4EORA 2C0TA 2W5BA 3FHIA 3QAME 5JT2A 4RSSA 5DH3A 3OXIA 5LVLA 3K3JA 4WNMA 4FG8A 2ZJWA 5EI6A 3TNIA 3PRIA 1UNLA 3LFBA 3U9NA 2VAGA 4BR3A 3NZ0A 2PUUA 3QCSA 2WKMA 2PUNA 5KKRC 3G6HA 4DBNA 5GZ9A 4I94A 3FZ1A 3IW6A 5DI1A 1WFCA 3DQXA 3NUYA 4J71A 3ZO1A 2OIDA 3RK5A 4EH2A 5J5SA 4O0UA 5J7BA 1Y8GA 4G3CA 3AQVA 4BTMA 5KMKA 4BYIA 2ZB1A 2HZ0A 2VTIA 3UOKA 3RP9A 4MF0A 4RWJA 5IQDA 1W84A 2UZEA 3EB0A 1JNKA 3IPHA 3W55A 4QYFA 2VRXA 2HW7A 2QHNA 3Q9WA 5HNIX 1H27A 4HCTA 4S33A 2XB7A 3V5TA 5BUJA 3NIZA 4RX5A 3PUPA 3BBWA 3OD6X 2ITXA 3HVCA 3QHRA 2QHMA 4N0SA 3BGQA 4RVMA 1OKZA 5M51A 1FVVA 4JBVA 4KKEA 1GZKA 4QT1A 4CVAA 2IPXA 1OECA 1Y6BA 4PMMA 4NM0A 2UZUE 4QMUA 5HICA 4BCMA 3OEZA 3MI9A 4BIBA 1ZMUA 4FL3A 2GPHA 3BHUA 3QQLA 3RGFA 3KN6A 5DGZA 3SRVA 3R2YA 1G3NA 3F3WA 2GNHA 5HD7A 3SRVB 2JGZA 1XHAA 2JFLA 3VBYA 4E1ZA 5LXMA 5GJDA 4QP7A 4OTQA 4TY1A 3LQ5A 3ZC6A 4BF2A 4EQCA 5HQ0A 2ERZE 2WO6A 5DFPA 2CLQA 2WQMA 5H8GA 3RPRA 1R3CA 1KOAA 1XH6A 3NPCA 3FMNA 5EDPA 3PZHA 2R3IA 5HHWA 4MXCA 2VTPA 1IAJA 3ZU7A 3TZMA 5EW9A 5BVEA 2X81A 3FI2A 4FV5A 3LXKA 4E6DA 3K54A 2YACA 3VUGA 4BZDA 1OL2A 2VTNA 4ZLOA 3TL8A 3WILA 1H8FA 4I6HA 4UZHA 2XIZA 4NK9A 4M0YA 4X3FA 5CX9A 3UNZA 4FTUA 4X3FB 3LCSA 5BYZA 3G9NA 4BKYA 1WBVA 2PUPA 2PVFA 4GJ2A 5HU9A 2VNWA 3TKUA 3FEGA 4I5MA 2OZAA 4EZ7A 1U5RA 2JIVA 2OZAB 4D4SA 3PJ8A 2QOIA 3HP5A 2JKKA 2PZYA 4AGCA 5JMSA 3FC1X 5A4TA 5JRSA 4QMMA 3ZZWA 4OW8A 5C1QB 3POZA 4ZY6A 3UIXA 3KULA 2J4ZA 4EK4A 2ITTA 2PSQA 2BAKA 2ZV9A 3KULB 4LRKA 2F7ZE 3D4QA 5ACBC 4QQJA 1XH4A 4QPSA 1FGIA 3MB6A 2P33A 5GIOE 3AC3A 4RVKA 2BTRA 3FL5A 1F0QA 4I22A 3RPSA 4R78A 2PZ5A 3D5UA 3GCSA 4M13A 5IH6A 5BMMA 4Y5HA 5K5XA 5IQFA 4ZSGA 4KD1A 4IH8A 2JD5A 3QTUA 4WT6A 3RKBA 3W2CA 3HMOA 3HUCA 3GQIA 2CKPA 3NDMA 5CF8A 3IONA 3E8EA 3LLTA 2CNUA 3FXWA 5HBHA 3S95A 3F7WA 4MBJA 3Q52A 2HOGA 3L9MA 3UNJA 3VBWA 4FTMA 2W06A 3AD4A 3VJNA 4EI4A 5I4NA 1R39A 1PXLA 1GZNA 3R02A 5AWMA 4PNIA 4YU2A 1LPUA 2QOQA 2JAMA 4C58A 3PIYA 4K2RA 3RWPA 3EKKA 4FL1A 1ZXEA 4YC6A 4LGHA 3IDPA 2Y4PA 3TEIA 4GT4A 2X6EA 3IW5A 2C68A 3V5PA 4DG2E 1FGKA 1U59A 3ET7A 3QD3A 4XV2A 2C6EA 4O2PA 4IXPA 4C62A 5KHXA 2EXCX 4ARKA 4UALA 4O6EA 4W8DA 4BDJA 3TG1A 4U6RA 4S30A 5HCZA 3W2OA 4BHZA 4HPUE 4R7HA 4PF4A 4DG0E 1ZY4A 4RJ5A 2OH4A 4R7IA 3ZC5A 4YSJA 4PX6A 3F69A 4ZTNA 3QCQA 4NKSA 4L67A 2YIWA 5ETCA 4YO4A 1OPLA 2IVTA 2P2IA 3NNUA 1SVGA 5GIPE 2V0DA 3E8CA 4UYAA 2I6LA 3R7EA 4YHJA 3MDYA 5DVRA 3MFSA 3EJ1A 5I9YA 2XZSA 1U4DA 2QNJA 3LFCA 3FLNC 3Q5IA 5E4HA 3MB7A 3O8UA 4OBQA 4FKVA 5ANGA 1OKVA 2WTKB 1YI3A 4EOMA 1CKJA 4JDIA 3QALE 1GNGA 4I0SA 4JQ7A 2CGWA 1PXOA 1Q8WA 2RG6A 3KRXA 3E3PA 4I41A 4DGOA 1OUKA 4MNEA 2F9GA 4TRLA 4U79A 5FGKA 3DQWA 4MNEB 3TJCA 4WG5A 3COHA 3MFRA 2OG8A 4C33A 3HMIA 3U54A 4QP1A 5KBQA 4EUTA 1K9AA 4MEDA 4G6OA 3EL8A 1UA2A 3CKWA 3D5XA 3VS5A 4C4EA 4FTCA 2VWZA 5KX8A 2GTMA 5EI8A 4EOSA 5KO1A 5L6OA 3ORLA 5IQEA 4MQ1A 4W9WA 1XWSA 4Y83A 2R7BA 2BZIB 3GU8A 4PMSA 5H8EA 4LV5A 5FP6A 3CE3A 3WF7A 1O6YA 3CKXA 4QPAA 2BAJA 4LGGA 3VQUA 3D2IA 4AQCA 2YERA 3UYTA 5J87A 4DTKA 5CF6A 3EHAA 4NUSA 3REPA 1AD5A 1NA7A 3FZSA 3F5UA 4XLIA 3RAHA 4QMOA 2CGXA 4GFOA 5I9XA 2R9SA 4F09A 2WIPA 3QXPA 2WMWA 4QPMA 2CCIA 1NVRA 2V55A 4KA3A 4CTBA 4Z7GA 5AIKA 3FDNA 4I5PA 2YZLA 3VBVA 5HTIA 3BPRA 3TV4A 3R7OA 3NMUF 3KRRA 3GU6A 5DWRA 3AT2A 2YDJA 2VO0A 4MK0A 3KRJA 2PY3A 2J51A 4A7CA 3PXRA 4FODA 3GU4A 3HDNA 1YDSE 3F6XA 3IOKA 4USEA 1PRYA 1A9UA 2C6IA 3M1SA 3OMVA 4JNWA 1OI9A 4YHTA 5JRQA 3BLHA 4FK6A 4A07A 1RDQE 3VS2A 4KBAA 3TIZA 3EFJA 4FTRA 2ITUA 1Q99A 4M7IA 3FHRA 3ODYX 4HGLA 2W9FB 4H3BA 3H0YA 3A8WA 5JGBA 4GKHA 4UYNA 5AR3A 4EOJA 3UE4A 5HLWA 1WVWA 2PVYA 1U46A 1PMVA 2C3KA 4JT3A 5A4CA 5BYYA 2OJ9A 1UVRA 2XNNA 3FYJX 3QCYA 2XM8A 3W2RA 1UNGA 2YM7A 4UN0C 4L45A 5FD2A 4O84A 1PY5A 3KC3A 4JDHA 3CSVA 3VO3A 2H96A 4IVDA 5T3QA 4O86A 4X6QC 4KRDA 4YMJA 5DT4A 3S1HA 3SA0A 3IDBA 2JFMA 4J8NA 4EC8A 4GG7A 2W1EA 3VBQA 2OJIA 1IEPA 2WOUA 3KB7A 2IZTA 2G15A 2YZAA 3M2WA 5AV1A 2ETMA 4AA0A 4AACA 4CMTA 5IG1A 3R1QA 1L8TA 3VBXA 1H1PA 2W1DA 2WTCA 1ZMVA 3NVMB 1PF8A 2WTIA 1RJBA 4W4XA 4OT6A 2Y8OA 3HRFA 4AGUA 4AZVA 4J99A 3KRWA 4C7TA 4DN5A 5CSXA 3BGPA 2FGIA 1XBBA 5JQ5A 4GVJA 5BVKA 1ZZ2A 5CNNA 2W0JA 4KBKA 4BTFA 2XCHA 5BVFA 3OXTA 4N6YA 5CAUA 2VTQA 4XHKB 3Q04A 2QODA 1M52A 4EONA 2JKMA 3ENMA 5CU2A 4F7NA 4UWCA 1JSVA 1DI8A 1DM2A 4JS8A 3EQIA 3KEXA 3A8XA 2R64A 3BCEA 3CQUA 3NR9A 3GCPA 4JR7A 2FA2A 4FX3A 1U5QA 1ZLTA 3AC8A 3LJ1A 3ZMMA 3DCVA 4II5A 4FT9A 5DPVA 4BTJA 5CSHA 2R3HA 1Z9XA 3GXLA 2O2UA 2PE0A 2BILB 2Y4IB 2IW6A 3R04A 3BQCA 4ZY5A 5HIBA 2XK9A 3TIYA 5FXQA 3OHTA 3OT8A 4ZJJA 1DAYA 2FSTX 4M3QA 5FEDA 3E3BX 3R83A 2XIXA 3QBNA 1FBNA 4YZBA 3F5XA 4ASXA 1OL5A 2QO2A 5H9BA 3MPTA 5EHOA 3G9LX 2OGVA 4FV3A 5DRBA 3O8TA 3MTLA 2BHEA 3BBTB 3HV3A 3F3VA 4DEBA 3KK8A 5M08A 3V51A 4XG4A 5JFSA 5HI2A 3VF8A 5E8ZA 2VN9A 4IAIA 2IO6A 4HVDA 3O71A 2HAKA 3DK7A 4G9RA 4E6QA 4ZLYA 4FNZA 1FMOE 1OB3A 2Y6OA 2UW0A 5GJFA 3R9OA 3I5NA 4APCA 2QLQA 3LFFA 1GZOA 4OTHA 4BWXA 5H2UA 4B4LA 5B2LA 3DAKA 3D9VA 4JR3A 2WAJA 3VRYA 2PU8A 5IMEA 2I40A 5AR7A 5DE2A 2YLEA 2GFCA 3THBA 2ZM1A 2XNOA 3E92A 3ULIA 2BAQA 3DPKA 4HNIA 3AC5A 1PXNA 3UVQA 3UP2A 3UIUA 4I4FA 4CYJA 2FO0A 2J7TA 5E8YA 1WBTA 3A7IA 2PE2A 4BKZA 4C34A 4BDDA 4JQ8A 3QQHA 5EI2A 4R77A 2WQEA 4M97A 4PQNA 5M53A 4CMUA 1PMUA 4H39A 4ACDA 4A4XA 1M7NA 4O27B 4TYIA 2IN6A 5HE3A 2V22A 4V01A 3DKGA 4I4EA 3VUHA 3WOWA 2DS1A 3Q53A 3UTOA 5AP4A 4EH5A 3VQHA 1SVEA 3NUNA 2V7AA 4FV4A 4A4LA 3TUCA 4ZMEA 2PVJA 2X8EA 3ZM4A 5D41A 2JKQA 4F6WA 3ZFYA 4UMPA 3QCXA 1XJDA 3NNXA 3FSFA 4O0XA 4BIEA 4EOKA 2C0IA 3R1YA 4AW5A 4U43A 4DEDA 4IANA 2PMLX 1H01A 4MWIA 4F70A 5JFWA 2PVNA 3ODZX 4P7EA 5E1SA 4ASZA 3PLSA 4O21A 3KL8A 2GNLA 3C0GA 3GENA 5C01A 5AUUA 2JITA 1J1CA 2C1AA 4QYGA 2C6KA 4LI5A 4W4YA 3Q2MA 4ZTLA 2AYPA 3FYKX 4QTCA 3JVSA 3S4QA 3VHKA 5F4NA 3ZFXA 3CP9A 5CWZA 5A4LA 2OBJA 1NVQA 3EQDA 4FBXA 5LVOA 4BDKA 3HAVA 3GEQA 2FVDA 4IACA 3UMXA 5FEQA 1Y57A 2VNYA 4I24A 3ROYA 2OLCA 1VEBA 4ZXTA 3DB6A 3EH9A 3A62A 3T9IA 3P7CA 3ULZA 4B0GA 1Q62A 4EOIA 3OWPA 2R3KA 3MIAA 4ZS0A 4QTBA 3ZO3A 1URCA 4FEWA 5M06A 4YGAA 2HYYA 4TWOA 3BYMA 3P0MA 2VTAA 5M4UA 4G3DA 5AV0A 5CF5A 2OWBA 3NW7A 4FYNA 5LMKA 4U3ZA 3PVBA 4QMSA 3WF9A 3ITZA 4XP3A 4GL9A 1JKSA 4O7SA 3KXHA 1OIRA 4DGMA 2NRYA 5A9UA 4ANMA 3KXNA 4NM5A 3UGCA 1M17A 4JLCA 5IUIA 4FZFB 4O2ZA 4AGDA 3HUBA 4CEGA 5BUIA 4AU8A 5I3OA 2Z2WA 1H28A 4QO9A 4HZRA 4G6NA 2XIKA 3R8PA 5E90A 5CAOA 1JPAA 4YJRA 2CCHA 3PSBA 4YC3A 5EW8A 4F0GA 3OWKA 4E73A 4EHVA 2CLXA 5L8LA 4FT5A 5ETIA 1I09A 3C4XA 5C8MA 4D2VA 3FMMA 5IISA 4HPTE 4HGEA 5I9WA 5TF9A 4GK3A 1XR1A 4CKRA 5KBRA 4TWNA 4C2WA 2BUJA 5IA2A 5FTOA 1ZOHA 3ATSA 4NCTC 4AN9A 4EYJA 2B1PA 5IPJA 2VX1A 4O7ZA 5M57A 2C1BA 4K9YA 5CEOA 4FV2A 3TUDA 5DEYA 4WBBB 4APPA 3QQKA 3FPMA 1UKIA 4RLKA 4Y5QA 3V01A 4BB4A 4DA5A 4U0IA 4FSUA 3DTCA 1DAWA 1JAMA 3BZ3A 2XKDA 5HZNA 3KMWA 3QL8A 2X9FA 4TYEA 3IGOA 4X0MA 3GNIB 2O63A 5D10A 4AAAA 2ITYA 1JOWB 3A7FA 3TNPC 3FMJA 4MNFA 2R3RA 2UZDA 1F3MC 4G34A 5AR8A 2E9NA 4RIYA 4YTHA 5LVMA 4KS7A 1PXIA 5L2TA 3WE8A 2WTWA 3LMIA 4FZ7A 3JR1A 3MFUA 4FVQA 3BE2A 3BELA 3FY2A 4OLIA 3SOCA 3TN8A 3W32A 3OCBA 4GIHA 4L7FA 3MJ2A 4AZEA 4L43A 1J7IA 3R7IA 3N9XA 3QRJA 4N6ZA 1TKIA 1PKGA 2X4FA 3F3UA 2VGPA 5HO8A 4AE9A 4FUXA 4PDSA 3ZEPA 3PYYA 2QOOA 3DXPA 3ZXTA 4YBJA 2I7QA 1FMKA 4YJTA 4RIWA 3UC4A 3KQ7A 3UQCA 3EN7A 3OW3A 4RIWB 3V8WA 3UP7A 5HVKA 5HIEA 4O7NA 4NM7A 3R9RA 5IQHA 3TDVA 4WNOA 4U41A 3DKOA 5ANDA 4PDOA 4MXYA 4CZYB 2WTJA 4TYHA 2HZ4A 3DBEA 3OTVA 4AN3A 4TYHB 2UZWE 4EOQA 2B9FA 5FRIA 2OF4A 4M66A 3TTIA 5KCVA 4TWPA 2JBOA 4IM3A 5E7RA 3C4FA 5G6VA 3COKA 4PDYA 4QMPA 1NT2A 1BLXA 3FQHA 3BRBA 2B55A 4CNHA 3DDQA 3FMDA 5CEKA 1OVEA 5EQYA 3LLAA 4TNDA 5CT7A 5HEZA 4Z16A 4H36A 4Y8DA 2X1NA 2UW7A 2X8DA 1AQ1A 1IAHA 3QD0A 3SXFA 5HESA 2PMOX 4F7SA 1KE6A 3QRUA 4E5BA 2BZHB 4XOYA 2XYUA 3TV7A 3WIKA 3WYYA 2XK3A 2R0IA 4U40A 5FP5A 3V3VA 4P5QA 5AV4A 1O6KA 4AW1A 3QRKA 3IW4A 4UBAA 1V0PA 3QFVA 4WUNA 3MH0A 5K0KA 2IWIA 1WMKA 2KTYA 4FT7A 3RPOA 2YCQA 4FSRA 4GKIA 4OTPA 4NFNA 4YZ9A 4DITA 4M12A 4V05A 3QD2B 4RMZA 4FOBA 3GBZA 1P5EA 3SC1A 2BKKA 3ZO4A 4EJNA 3TNWA 4BHNA 4C57A 4KIQA 4IAAA 3LHJA 3MY5A 4JG8A 4HCUA 2WMBA 4S31A 3ZCLA 4ANSA 4FA2A 3PA4A 3TUBA 1YHVA 2OIQA 1XO2B 4RX9A 4LOQA 3GP0A 3R6XA 4QYYA 2XA4A 3O8PA 3ZRMA 2YM4A 4ANBA 1M2QA 4MF1A 3TWJA 2OW3A 3DAJA 1R78A 5HORA 4BCGA 3F82A 3VS4A 2W9ZB 3G33A 4GFGA 2C6LA 3PA5A 3KA0A 1UNHA 3VNTA 1M14A 5EK7A 5BX0A 1OZ1A 3RINA 3T3VA 4RIXA 2OF2A 3CR0A 2P3GX 4RIXB 4YJQA 3O7LB 5FWKK 4Y95A 3TT0A 5ICPA 3V6SA 1XH8A 3U55A 4EBWA 3C7QA 3SG9A 2UVYA 1NY3A 1R0PA 2B52A 5DT3A 3GUBA 1RQQA 5ETAA 3U87A 5CXZA 4Q9ZA 3Q6UA 1F5QA 4NYEA 1UKHA 3LXPA 1GAGA 3GQLA 4K6ZA 2WTDA 2R3QA 2VWUA 1H26A 2OXXA 4UWYA 2C69A 3O7LD 4XG3A 4BCIA 2VX0A 5JQ8A 3SW4A 3D14A 1MQBA 2X7OA 3MH2A 4GH2A 5CY3A 4E4LA 4O82A 4BCHA 4Y72A 2YN8A 3SQQA 5KUPA 3K5VA 4KBCA 3OY1A 5HO6A 1PJKA 1V0OA 1STCE 4GSBA 4ALWA 4E4XA 4ZK5A 5KKRB 1HCLA 2W1FA 3H9OA 5IDPA 1XKKA 3O50A 4UXQA 1BUHA 4KS8A 3QQUA 1CM8A 1OIUA 4IZAA 1YXSA 4KABA 1UU3A 1PMEA 3V5LA 5ANOA 3BQRA 1ZY5A 3NEWA 2IVVA 1E9HA 4IDTA 3TNHA 4C3PA 2W5HA 3E88A 1A48A 2Y0AA 4J52A 4E6AA 4TN6A 5HTCA 2WQBA 5CF4A 3P7AA 1UWJA 1OPJA 3HP2A 4IAKA 4CMOA 4ENYA 2FSOX 3N4UA 1FPUA 3MWUA 4FTOA 4L3LA 5AV3A 4BIDA 4WO5A 3CD3A 2YA9A 4FGRA 4ZSEA 4X7QA 5EHLA 4BWKA 3C51A 3ATTA 3ZRKA 4EH6A 4NT4A 3CC6A 4NW5A 1IR3A 3FKLA 4OTWA 2CHLA 1MP8A 2R5TA 3HV4A 4DTBA 4R5YA 2P55A 4HYSA 3GB2A 4IJ9A 3TKHA 4CFWA 4F08A 4IX5A 5A3XA 2H8HA 4PUZA 3UZPA 3BHVA 4TL0A 3BX5A 4J98A 5EHYA 4MBIA 3PZEA 2HIWA 4EBVA 3QWKA 4K33A 3DY7A 5IH5A 3PSDA 5IA0A 2XS0A 1W98A 3KCKA 2PUIA 4CQEA 3K5UA 3A7GA 4AX8A 4LQMA 4IDVA 4O0VA 3E62A 4A9RA 2XK8A 3QWJA 4D2PA 3FUPA 2CGUA 3NCZA 4WUAA 4XV3A 2O0UA 3MTFA 4BN1A 1JSUA 4I6FA 2OXDA 3VBTA 2P4IA 4DH8A 4MHAA 4IMYA 4IIRA 1ZOEA 2VTLA 2VO7A 4XG7A 4IB5A 3OZ6A 4HJOA 5K4IA 4KIOA 4AZSA 2ZV7A 2Z7RA 5LCKA 2ESMA 2BALA 2QR8A 4XMOA 2VWXA 2XJ2A 5J1VA 4PTEA 4D1ZA 2ZVAA 4N70A 2VGOA 2ITQA 2R3OA 3ZDIA 4O0WA 5AAEA 3HRCA 2QG7A 2BCJA 2BRHA 5BYLA 2VWWA 3QUEA 4FF8A 3OFMA 4G16A 3R28A 3SKCA 3P23A 2LGCA 2QVSE 3EQCA 3EFKA 3I0OA 1H1QA 5HG8A 4FNYA 3UO5A 4W9XA 4C35A 1EH4A 3COMA 3IO7A 2Y6MA 5AX9A 3MVMA 4I20A 4G3FA 5IEYA 2CKEA 5J79A 3A61A 2GNFA 3E87A 2Z7QA 4XBRA 4BCKA 3AC1A 3BHHA 4RZWA 3CTJA 1Q61A 3HRBA 3ZOSA 4HZSA 4EHGA 2FYSA 4EK3A 4HGTA 3FZOA 3EKNA 3JVRA 2FSLX 1J1BA 2XNMA 2RFDA 4R3RA 3ZSGA 3LCOA 4DFLA 2BVAA 3F9NA 3RI1A 2GHGA 5DR9A 4NW6A 1ATPE 3QTQA 4R1YA 4JG6A 5J5TA 4QQ5A 5AFVA 4XG9A 3NYNA 4C37A 3QX2A 3H3CA 3FBVA 4M68A 2A2AA 1CMKE 3WF8A 3H9RA 3DFAA 3IW8A 4YJNA 1Q8UA 3PE2A 4YJUA 4JBOA 2CGVA 4JAIA 2IVSA 4GU9A 2QR7A 3SAYA 2YM8A 3UMWA 3BV2A 4DH7A 2XEZA 4AN2A 4H05A 3CJFA 3GOPA 3MW1A 3NSZA 4G3GA 4EWQA 5IMXA 4XEYA 3VS0A 4O81A 5AEPA 3FLYA 3RK7A 3A2CA 4ZZNA 2C5NA 2GMXA 4E20A 5IQGA 5E8SA 1U54A 2Y7JA 3KK9A 3PIXA 4ACGA 1U54B 3V5QA 3RWQA 3TNQB 5KMNA 3ZM9A 4FNWA 3QLGA 1PYXA 2XRWA 3LE6A 4FZ6A 4M14A 3QTSA 1YW2A 1YOMA 4YNEA 4O22A 5EKOA 4MXOA 5HG7A 4EZ3A 2ZMCA 3PVWA 2QKWB 3W18A 3TCPA 5AADA 3QRIA 2GCDA 4NL0A 3DXQA 2UW8A 4IB3A 3S3IA 4F9AA 1VZOA 1LUFA 2DUVA 4EL9A 1W82A 3SVVA 3DS6A 3F5PA 3ZHPC 4E8AA 2PZRA 3HMNA 4GK2A 3U6HA 2WZJA 3UIBA 3PY3A 2QI8A 3DZQA 3ACKA 3MVLA 3PP0A 4G5JA 4AA5A 1BX6A 1GY3A 1W0XC 4DG3E 4HVSA 1PW2A 2XIYA 3D5WA 5DHJA 3KF4A 4RWIA 3RJCA 2F49A 1J91A 4P90A 4FTLA 3LKMA 3TZ9A 4GT3A 2J50A 4BVUA 3LM0A 4RQVA 4H58A 5EH0A 2B53A 4WOVA 3L8VA 3QC9A 4EKKA 5F9EA 3P86A 1KWPA 2RF9A 4I3ZA 3ANRA 4BZOA 4RFYA 5AIRA 3I0QA 4WA9A 5TE0A 3ZH8A 1A06A 4WRGA 4HOKA 3DDPA 2J6MA 5CASA 3E93A 3D7ZA 4USDA 2C5VA 4CT1A 2P2HA 3QKMA 3F2NA 2X9EA 3AMBA 4RRVA 3SDJA 1YXUA 4BDEA 5CAPA 4WRSA 4YZDA 4EH3A 5M4IA 4GVAA 2XYNA 4LL5A 4NWMA 4YNOA 2SRCA 1J7UA 4WSQA 5HG9A 1KE8A 4DH1A 3ZLYA 3AD5A 3G15A 3HV5A 3PJ3A 4ZSLA 5L4QA 2PVRA 2PHKA 2W1CA 4E3CA 4ZTHA 3R71A 5DBXA 2ONLC 3R7YA 4YO6A 1PHKA 2A19B 1Q41A 1Q8TA 2O5KA 4JBPA 4DEEA 3W1FA 4IC8A 4J53A 3GGFA 4B7TA 2W4KA 3LM5A 3PRFA 1JVPP 4RVTA 3VHEA 2OK1A 3S0OA 4XS2A 1JKKA 2R7IA 3GI3A 3Q9ZA 2H34A 3LXNA 4GUBA 4H1MA 5AA9A 4FT0A 3Q4UA 4YJPA 3IOPA 3GOKA 3TACA 2C0OA 2QCSA 4B6LA 3PVGA 3PXKA 4BI1A 5AUXA 2NO3A 2JDVA 3KN5A 4MD9E 4YJSA 3FZRA 1OIQA 4GW8A 3NIEA 5AUVA 3ZSIA 1E1VA 4RX8A 2ETRA 3QTIA 5FM3A 4FKSA 4BI2A 5C26A 5JZJA 4F64A 5KMMA 1T46A 3DTWA 3FMHA 3R73A 2ITOA 5I5ZA 1UV5A 3GCVA 1LP4A 2UZNA 1OKYA 2XNEA 4QP2A 4RX7A 2X2LA 5FBOA 3ZBFA 3L8PA 5AUWA 1PKDA 4O1PA 3NRMA 4XG2A 3NYVA 3TZ7A 3E7OA 5DLSA 3L8SA 5EYKA 5HVYA 5I9UA 5CT0A 1YI4A 4ASDA 5J7HA 1OBGA 2XJ1A 1VYWA 3QTWA 1PXPA 2C6TA 4OTIA 3LQ3A 4W4VA 3OF0A 3VIDA 2B7AA 3R9DA 1OL6A 3DOGA 2QLUA 2XH5A 3C4ZA 1JKTA 3OOMA 3QKKA 4IEBA 5CU3A 5HX6A 4F9BA 3MN3A 4F4PA 3ZLXA 3JYAA 4C02A 4MXZA 2OICA 1QPDA 2X2MA 4N57A 2IG7A 4AWIA 2UW5A 2Q0BA 3ELJA 3UIMA 2RSVA 4F1TA 2QKRA 4R8QA 2F7EE 1UU9A 4ITHA 3PY0A 2WMTA 4RG0A 3PPZA 5G1XA 5AP3A 2WMQA 4XP2A 3H0ZA 3KF7A 1WCCA 3GC0A 4BC6A 2P0CA 3P78A 1H07A 4BTKA 5EW3A 4KRCA 4A9UA 1VYZA 3C5UA 5EOBA 3OC1A 4PL5A 3MIYA 4FUYA 4IZ5A 2XMYA 5CI6A 4QTAA 2EWAA 4L6QA 4A4OA 2EXEA 1FOTA 1SMHA 1P4OA 2OZOA 3FLWA 3UJGA 4CYIA 2JDTA 3CY2A 1IG1A 3UBDA 3EWHA 3DKCA 4WG4A 3W2PA 3POOA 4ZZOA 3DFCB 2GFSA 5FTGA 3HV6A 2HZNA 4AT4A 3CTHA 5AP7A 4WKQA 3ERKA 1Q97A 3GVUA 3VW8A 3QXOA 4BDBA 5GNKA 5E8WA 3VRZA 3EN4A 3W16A 5D9HA 2DQ7X 4X2FA 4EEVA 4ZY4A 5B2MA 3SXRA 3LMGA 4O7YA 4EK8A 4MWHA 4I92A 1YWVA 3TDWA 3B2TA 4LGDA 4YC8A 4EH8A 3O0GA 3TJDA 2X4ZA 4NFMA 1H1RA 3D0EA 4FKGA 4D1SA 2OKRA 1QL6A 4QP6A 4PP7A 2H6DA 5HX8A 3DBDA 3FMLA 2HCKA 3ORXA 4RT7A 3PTGA 3Q9YA 4Y85A 1KSWA 4EC9A 2JKOA 4HVGA 5BPYA 4FIGA 4DT8A 3U6JA 4AW2A 4GYGA 5ANEA 4RVLA 4M69A 2WXVA 1SNXA 3CPCA 4IADA 4XG6A 2UZOA 4M69B 5AP5A 5F1ZA 1WBPA 2YITA 5I3RA 4F65A 3SV0A 4NM3A 4NU1A 3R7UA 4IB0A 3IK3A 5CSWA 5CU0A 2WPAA 4C3RA 3OG7A 5CI7A 1P14A 3ACJA 3NUUA 2PZPA 4KIPA 5JK3A 4EJ7A 2A27A 2EB3A 3EQBA 4QP4A 4CRSA 3C1XA 4O0RA 3UOHA 3ZLSA 4EUUA 3GCUA 1GIJA 3R30A 1K2PA 4E93A 3FLSA 5CLPA 4U81A 4NKAA 3VUKA 4AW0A 2BZKB 3L9LA 2QQ7A 2VO3A 3S2PA 2EXMA 3G5DA 2FSMX 5GZAA 1RE8A 5JSMA 3OCGA 2NRUA 4BCQA 3A4PA 2ERKA 4O7VA 3FY0A 2YIXA 2V62A 1SYKA 4IWPA 5DOSA 4DGNA 5IUGA 3IKAA 4AFEA 2CKQA 3SOAA 2GNJA 3C13A 4H1JA 2BKZA 4FSMA 2CSNA 2CMWA 4TWCA 2WU7A 4LRJA 3AT4A 4AT5A 1JQHA 5C8NA 4OT5A 5CYIA 5E8VA 5IH4A 2JIUA 2UZTA 3RHXA 3PG3A 3QD4A 3F88A 4HYHA 4MXXA 2XP2A 4MX9A 1ZMWA 3EMGA 1ZZLA 4DFYA 4OTDA 3HZTA 3UNKA 3HECA 2C30A 4MCVA 5C27A 4D4YA 3BHYA 4FIEA 4IAFA 5KE0A 4R1VA 4EZ5A 3ALOA 4NJDA 2BDJA 5AM6A 2GHMA 5A6NA 3GU7A 5T68A 2RGPA 3BYOA 3WF6A 4FVRA 4FTQA 3EFWA 4DT9A 4CXAA 4JG7A 3VVHA 4PNKA 4G9CA 3G90X 4U42A 2XNPA 3ANQA 2PMNX 4HNFA 4E4MA 3ORPA 4Z9LA 2E9PA 4XRJA 3ZEWA 4ASEA 4I93A 3ZLWA 4FG9A 2OJGA 3NUAA 4C4GA 4BDCA 4ANNA 4FSTA 1JLUE 3FC2A 2J90A 2UV2A 3EQHA 2F2UA 5FLFA 3UQFA 2UVZA 4L68A 3F2AA 4OTRA 2PTKA 4FSZA 3TV6A 3RAWA 2GHLA 2I0VA 3I1AA 4QD6A 3SHEA 5HIDA 3E7VA 3QTRA 4XYFA 4Z3VA 3WZEA 3QUDA 3HA8A 4QYHA 3LQ8A 2XF0A 4M0ZA 4O7RA 2I0EA 2WELA 2R3GA 2YCFA 2QU5A 4FSWA 5A54A 4BY9E 2YDIA 4D9UA 1PYEA 5KMIA 4C38A 3VS6A 2WMXA 5BVNA 5DNRA 2B0QA 5ACKA 5DYJA 4PTCA 4FKUA 2QOFA 2XM9A 3NNVA 4X6RA 2ITWA 2HWOA 3KXZA 3PG1A 4DHFA 2JLDA 3Q60A 1OKWA 4JX7A 4CG8A 3AD6A 3F7ZA 4PY1A 4RA5A 1SZMA 4RLLA 3RNIA 2AUHA 5CAQA 4R7BA 2W17A 2PK9A 4FE2A 3NUPA 1L3RE 2F57A 3A99A 3H10A 3KMUA 2WIHA 3QC4A 4WBOA 4ANOA 4AE6A 4ITJA 4ERKA 2UW6A 5HE2A 4GJ3A 2BRMA 5HNBA 2OSCA 3MVJA 1O9UA 1WVYA 4LRMA 3FI4A 2IZRA 3WZDA 5HBJA 2WMRA 1OUYA 5AP2A 2GDOA 1KOBA 2PVMA 4Y73A 5HE1A 3UPXA 2GQSA 4FZDB 1TVOA 5J8IA 5HLNA 4ZLZA 1W83A 4G17A 3OT3A 5LCJA 3UOLA 4O7WA 5HCYA 4X3JA 5ANJA 4O0SA 4KUJA 3CIKA 2XVDA 3M11A 1WBNA 3MGYA 5E1EA 5E91A 5BNJA 4XCUA 3WF5A 4QTEA 4QP3A 1BI8A 2YCRA 3E5AA 1YRPA 3G51A 3I6UA 3K3IA 2VUWA 3NGAA 4EWHA 2Z60A 2YFXA 5CQUA 4ZAUA 3DBFA 1IA8A 3P08A 4NCTA 4D5KA 4EOLA 3ID6C 5IQIA 4JX3A 4DFUA 4QNYA 5CENA 4L3JA 2O64A 4L9IA 3WE4A 2G9XA 2YCSA 5KHWA 4GIIA 3V04A 3H4JA 4JBQA 5JKGA 5IA1A 2RL5A 5CU6A 3PXFA 2I0YA 3FMKA 3ZYAA 1UU7A 4LUDA 2WD1A 2IZSA 5F20A 5DR2A 5CEIA 2X0GA 3G0EA 4Y46A 4RIYB 4EH9A 3ETAA 4FKWA 3B2WA 2R3PA 3O96A 2JDRA 4RJ3A 4FV9A 3D15A 1V0BA 4JI9A 3ZFMA 3Q6WA 5J1WA 5TR6A 4ACMA 3COIA 3FZPA 4U9AA 2BFXA 4YJOA 2F2CB 2VTJA 2HENA 2VZ6A 5EYMA 4AOJA 4BDAA 4DFXE 1BYGA 1CDKA 2GS2A 4LUEA 3MBLA 3D83A 4DF3A 4NZWB 4A9TA 4O0YA 3OOGA 3HLLA 4A9SA 3KVXA 4BBMA 5FBNC 1FVRA 3N51A 1MRUA 2PPQA 3VUDA 4USFA 2OU7A 3R0TA 2B9HA 5AM7A 5EG3A 4C4HA 2J0LA 2PVKA 5EM5A 3O17A 4BDGA 5D1JA 2CN8A 3WARA 4A9YA 5BUEA 4GEOA 4F1OA 3QYWA 1Y91A 4JDKA 3JY9A 2YM6A 4YZMA 4YJVA 3FPQA 4F6SA 3PVUA 4EH4A 2VV9A 4P5ZA 3RZBA 3H9FA 4BDIA 1T45A 1DS5A 3NUXA 4G3EA 2ITNA 3FAAA 5HOAA 1YOJA 5IEXA 4LMUA 3EN9A 4I21A 3QZGA 3FMEA 4OR5A 4RIOA 5EFQA 4HGSA 4J96A 4PPCA 2X2KA 4IW0A 4CG9A 5EM7A 2JIIA 3ROCA 5HNGA 1W7HA 3NYOA 3CXWA 4TYJA 4ONAA 4AZWA 3JPVA 5CZHA 2X8IA 3FWQA 2ZDTA 5A4EA 2EVAA 5AR2A 4BCPA 2PMIA 3GT8A 3DJ7A 4X2NA 2X7FA 1ZRZA 2W5AA 3OUNB 4M84A 4ALUA 4FTAA 1O6LA 4D0WA 4NIFA 3GFEA 3LIJA 3NAXA 3BIZA 3QTXA 2GU8A 3R01A 4IC7A 4TXCA 4PMPA 4CLJA 2QOCA 4GU6A 2RFSA 4LYNA 4HVIA 3ZBXA 2E9UA 4P4CA 4AOTA 3KKVA 2W05A 4C4FA 4WSYA 4LOOA 3MA6A 3N4TA 4NTTA 3GC7A 4PV0A 3RVGA 2JDOA 3FQSA 4IX4A 4UV0A 4I23A 5GHVA 1Q8YA 4IVBA 2Y9QA 2CN5A 4WNKA 2J0IA 3II5A 4IX6A 4D55A 3UVPA 4X21A 3Q96A 3NVKI 5ITAA 3DT1A 4Q5HA 1ZAOA 3FV8A 3HAMA 2UW4A 1KE5A 1VR2A 4U7ZA 5AUZA 4U44A 3B8RA 2GQGA 3MY1A 4AUAA 3DBQA 5AUYA 2J0KA 4I0TA 4FV0A 5CQWA 4YTCA 2Z8CA 4BYJA 1OGUA 2Z7LA
chains in the Genus database with same CATH superfamily
1Q4LA 3JY0A 3NX8A 5JFVA 3DK3A 1LEZA 1HCKA 2R4BA 4ZSAA 5AR5A 2REIA 2JBPA 2UZBA 5HG5A 2Q83A 4HW7A 4TT7A 4XX9A 1UU8A 3CCNA 5F94A 4IVAA 3R8LA 4G31A 4EH7A 2GS7A 2C5YA 4R3PA 3LZBA 3OP5A 3R9NA 3F3TA 1OMWA 2EB2A 3HNGA 5DT0A 1CTPE 5GJGA 1YXTA 3FKOA 3BLRA 4GS6A 3UODA 1OM1A 5H8BA 3RCDA 2GQRA 5L2QA 4YLLA 4CZUA 2KULA 5GINE 2JC6A 4ACHA 4FGBA 4FZAB 2BIYA 3W2SA 4FTTA 1XH5A 1H0VA 3AOXA 4DTAA 4CFNA 4ITIA 3BEGA 3W0OA 2WHBA 3EQFA 5CVHA 4F7LA 3CJGA 2J5FA 5CALA 1OIYA 2C6MA 2CPKE 1YKRA 2PE1A 2WGJA 3QZIA 4XOZA 3FI8A 5FM2A 5CAVA 3C4CA 2ITVA 3BU5A 3ORMA 3P5KA 4BCFA 5CEQA 5EKNA 5K9IA 3P1AA 3ZRLA 4FTNA 4F7JA 2G01A 3LCTA 4O1OA 4C36A 4IFGA 4RPVA 5E9EA 3NUSA 4BRXA 4RC4A 3OBGA 4ZJVA 4H3QA 5BVWA 5HO7A 2W1GA 4L52A 3OUKA 5KMOA 2C5OA 4CCBA 4EKLA 1XBCA 3S00A 3R8VA 4E26A 4DLJA 1YWNA 4PWNA 4QMVA 4O4BB 4UB7A 2FH9A 2OIBA 1PMNA 3QYZA 4JDJA 4F0IA 2W99B 4L00A 4ORKA 3FLZA 3DZOA 4CKJA 2WMUA 3FKNA 3P79A 4FC0A 3CLYA 3AMAA 2YWPA 5D12A 2XKCA 5HBEA 2W1ZA 1G5SA 4K18A 1MRYA 4FT3A 4JIAA 5CZIA 5L2IA 3BHTA 2DWBA 4FI1A 4OUCA 3BLQA 5H3QA 3R7VA 5TT7A 1OBDA 3HA6A 4E5WA 2HK5A 2OO8X 3PE1A 5FG8A 2ZB0A 3VC4A 5HD4A 3L9NA 2HW6A 5LMAA 3ZTXA 3W33A 2AQXA 1VJYA 4IVCA 4G1WA 2J5EA 5AV2A 2AC3A 2QC6A 3AGMA 4L8MA 3G6GA 4X2GA 5DIAA 4ZIMA 1JKLA 1QPCA 5CEMA 3NAYA 3VUTA 1GIHA 2W4OA 4FEQA 4PDPA 3IECA 2BDFA 3F66A 3G2FA 5IF1A 4O83A 4X3FC 3KY2A 2ZAZA 4XNEA 5J95A 2VWBA 4ZTQA 1TZDA 4KINA 3NLBA 4OAUC 3LFSA 5FDXA 3DK6A 2VU3A 3WZKA 4J97A 4NH1A 3BU3A 4AGWA 4JVGA 1H25A 4FK3A 3O2MA 3HYHA 1XH7A 3FL4A 3CTQA 3ORNA 3EQRA 5DG5A 3UQGA 1XH9A 3CEKA 1Z57A 3GU5A 3OCSA 1BL6A 3KREA 4M67A 3EN5A 4JJRA 5CNOA 3PXZA 1IASA 2QD9A 4DE4A 1GJOA 3ZSHA 1KE7A 4XG8A 5DN3A 5A46A 2QU6A 3EZRA 3PIZA 5LWNA 4MBLA 3WZUA 2YISA 4MYGA 5HKMA 3LPBA 3R8ZA 3BI6A 4XH6A 4CFVA 4FTIA 4IAZA 1YDRE 1QCFA 2G2FA 3EOCA 3MFTA 4RWKA 3Q5ZA 3MESA 3P9JA 4FNXA 1Y8YA 3RM7A 5AAGA 4FIIA 2YM3A 1YWRA 3DAEA 4GFMA 4OBPA 1XQZA 2BRBA 4F1MA 4EQMA 4YTIA 5LWMA 2XUUA 3MH3A 3PXYA 4KSQA 1BMKA 3DGKA 3VN9A 3ENHA 1M2RA 1H24A 2JEDA 2C47A 4UWBA 3RM6A 3TXOA 3CQEA 4ANLA 4GV1A 1MUOA 2C6OA 4C4JA 3EQPA 4QTDA 3AXWA 1UWHA 4G2FA 4QMYA 3KFAA 4JQEA 3V5WA 4OAVB 4OTFA 3PUFC 2J2IB 2WFYA 2QOHA 2V5QA 5AAFA 1ERKA 4QMZA 5BQ0A 2X0OA 3W2QA 3NYXA 4E6CA 5L2WA 3CBLA 3SGCA 5BVDA 4IM0A 5KMLA 3H30A 5L6WL 3PPKA 1SM2A 2UW9A 4IWDA 4IHPA 2X6DA 4RFZA 3BEAA 3QTZA 1E1XA 2WMVA 1WZYA 1URWA 2VTHA 4IX3A 2BZJA 4F9CA 3FJQE 4EYMA 3ORIA 4UZDA 4AXAA 4EK5A 4F6UA 4GUEA 4JIKA 2XK4A 3RAIA 4CTCA 5FDPA 5FXRA 2A0CX 3LCDA 4C59A 1QMZA 2AC5A 4QQCA 3R7GA 3DJ5A 5D7VA 1NXKA 3F5GA 1ZYSA 2E9OA 4E7WA 4Z7HA 2VD5A 4ZJIA 5AMNA 1H1WA 1GZ8A 5BV3A 1WBWA 4GK4A 1B6CB 5AR4A 1TQMA 2Z7SA 2RIOA 1YQJA 4QDEA 1Z5MA 2ZM3A 3PWDA 4FTKA 4EOPA 3DNDA 4UEUA 3LMHA 5ETFA 2W1IA 5CSVA 3QHWA 4FICA 4BI0A 4CFUA 4LOPA 3NS9A 3W0QA 5EOLA 4EOOA 3IQ7A 4Q2AA 5CVGA 3R1SA 4U45A 3NW6A 3R9HA 4DC2A 3OEFX 5HCXA 4RC3A 4FEUA 3MS9A 3U9CA 4E5AX 3SLSA 3OTUA 5L6PA 4FSQA 4BBFA 4DINA 3O51A 3GCQA 4XV1A 4MQ2A 2WTKC 4CCUA 1Q24A 4BBEA 2XNGA 2PWLA 4YPDA 1APME 2G2IA 5FUTA 3U4WA 3L9PA 3PP1A 1H1SA 3I81A 4XUFA 5I9VA 3UO6A 4MD8E 3KU2A 2VO6A 4O6LA 3F2RA 3LJ2A 4KKGA 4YLKA 5JN2A 4QYEA 2YWVA 3RPYA 2ACXA 2G2HA 3QA0A 1W8CA 4GCJA 4PTGA 5JZNA 4QMLA 3WBLA 4BZNA 3BKBA 4CFMA 5IA3A 3BWFA 4F9YA 2VTRA 2X0QA 4U3YA 3QGWA 4BGGA 3R22A 3BYSA 4FKRA 4TW9A 4CQGA 4QMQA 5CANA 5M4CA 3M42A 1V1KA 4PL3A 5AP1A 3AGLA 4FIHA 4J7BA 5M44A 4WNPA 3SD0A 4I5HA 5E92A 4ID7A 4CD0A 2IW9A 2WEVA 2XJ0A 1FINA 2UVXA 2XCKA 2XKEA 4FVPA 4FV8A 4FV6A 5EYDA 5LVPA 3U6IA 2I1MA 4JRVA 3PSCA 4CFFA 3MV5A 3EZVA 2BDWA 3WIGA 4YZCA 3ZO2A 3HMMA 5LVNA 1S9JA 2C4GA 2YEXA 4ZTMA 3PA3A 3R2BA 4L01A 5C03A 3T8OA 2B9IA 4S32A 3I60A 4FV1A 4DEGA 5TOZA 4U5JA 4I0RA 4IE9A 2HWPA 4MAOA 3UO4A 2XALA 3HL7A 4FL2A 2ZM4A 4PMTA 4QP8A 2YDKA 3DLZA 4MD7E 4FKJA 4RJ4A 3RAKA 3UPZA 2ONLA 1GOLA 4UX9A 4C4IA 5CEPA 4MTAA 3C9WA 3DNEA 3I79A 4CT2A 4ALVA 5A4QA 5BMSA 2QG5A 2ZMDA 3OS3A 4N4SA 3MY0A 3VS3A 4K8AA 2PYWA 2OXYA 2BFYA 5E8TA 2ZOQA 3U8WA 4DH3A 2B9JA 3IGGA 4L7SA 2IVUA 1B38A 1JBPE 2JDSA 3R00A 3VF9A 2VTSA 4E4NA 3EYHA 2YHVA 5HU3A 4AZTA 2RFEA 2CDZA 4LV8A 5GZ8A 3DA6A 3R21A 4DBXA 4WIHA 2XK7A 4ZEGA 5J9LA 1J7LA 1SVHA 2ETKA 2W7XA 1KE9A 2O65A 3CS9A 1FQ1B 1WBOA 4YHFA 5JGDA 1YHSA 4MH7A 3JXWA 5CVFA 4BDFA 4I5CA 4BFMA 4DDIA 4FR4A 1HOWA 2HELA 1M7QA 3T3UA 4FEVA 1W2FA 4LFIA 2BRGA 3RCJA 1LEWA 4CSVA 2DYLA 3LW0A 4FEXA 4DEAA 4FKPA 2A98A 2VWIA 3I5ZA 1ZOGA 3OBJA 3VWAA 4ERWA 4U97A 1CSNA 1CKPA 4ZMFA 1SNUA 5F95A 3D2KA 5IQAA 5TO8A 2HY81 2NPQA 2VX3A 4FKTA 4IBMA 3ZZEA 4B99A 5LJJA 4XLVA 3C4WA 3UG2A 2QOKA 3MVHA 3QZHA 5EDRA 5EQEA 5FXSA 2BRNA 3LCKA 4J8MA 3A7HA 4PP9A 3RMFA 4D5HA 5L8KA 4K0YA 5J9YA 1R0EA 5D7AA 4V04A 3LFNA 3W8QA 5HTBA 3GFWA 4BGQA 1JWHA 5K3YA 1G8AA 4FYOA 4D4RA 3FZTA 4D2SA 2W1HA 4IWOA 4AP7A 3TI1A 4DH5A 1Q3WA 4CZTA 4D4VA 4IWQA 2YM5A 3AC2A 4DFZE 3ORTA 4GG5A 1YVJA 1H0WA 4C8BA 5B7VA 3MSSA 3UG1A 2WB8A 5EYCA 2CNQA 5E8XA 2WMSA 3V8SA 2BTSA 4YBKA 4DGGA 5BVOA 1MRVA 4J1RA 4U80A 1QPEA 2UW3A 2YABA 4C0TA 4GT5A 1H4LA 2Y4IC 2EU9A 4GYIA 4C3FA 2VTTA 3NNWA 2IW8A 4MKCA 3DBCA 5DRDA 5IUHA 5CS6A 3KXXA 4BICA 3ZONA 3FXZA 2WMAA 2A1AB 1WVXA 4IJPA 4TKSA 4AS0A 4DAWA 3OWLA 4CV8A 1KV1A 1GIIA 4QRCA 5EM8A 2PZIA 2XNBA 3RHKA 1TQIA 5ANIA 3EFLA 3LFQA 5EDQA 4BL1A 4YP8A 3ZXZA 1K3AA 1Q5KA 3ORZA 5AJQA 3TYKA 3BGZA 2O8YA 3QQFA 3Q4TA 4FV7A 4IAYA 4BCJA 3C50A 3JUHA 5LMBA 1YXXA 2C3IB 2Q0NA 3PJ1A 5IA5A 4O38A 5LOHA 4LDTA 4O7TA 4KKHA 4A06A 1YHWA 4RJ6A 3VS1A 1XBAA 4FKOA 3W10A 3BWJA 3A7JA 2FUMA 2X7GA 2J9MA 3PWYA 2BIKB 2YIRA 4Q5EA 4RJ7A 1IRKA 1Q8ZA 3P7BA 4HYUA 4XV9A 4ZOGA 5HVJA 4QMNA 3IS5A 4KSPA 3V8TA 3K2LA 3HX4A 4PL4A 3E8NA 3PJCA 1DI9A 4L3PA 3TZ8A 2NNWB 4IM2A 4B8MA 2UZVA 3WI6A 4YPSA 2GSFA 3AC4A 5IQCA 2LAVA 2R3LA 4IB1A 4KB8A 3VUMA 3W8LA 5A6OA 4G5PA 2R3NA 1OITA 2XEYA 3CY3A 1ZYJA 3I6WA 3VAPA 3KVWA 3KRLA 4BDHA 1ZWSA 2C3LA 3CGOA 2CNVA 4OBOA 1W2DA 2ZV8A 4X2KA 3VULA 1MQ4A 3RNYA 3RALA 2Z02A 4OGRA 3W0MA 2WEIA 4FIJA 5HE0A 4D2WA 5I0BA 4IFCA 2XBJA 2OH0E 2GNGA 3R63A 4BKJA 3QA8A 5FEEA 2UUEA 1ZARA 3UDSA 4GMYA 4OTGA 3RZFA 1B39A 1OL7A 4WD5A 2OJFE 5AP6A 3SX9A 2QOLA 3MH1A 3ORKA 4G6LA 4WHZA 4K11A 1ZYLA 4Z55A 3QUPA 3SXSA 2J0MB 4U8ZA 4QDVA 1AGWA 4FSYA 2XBAA 4DFBA 3RTPA 3PFYA 3EL7A 3R1NA 2ZV2A 3OW4A 4X2JA 5M4FA 5JEBA 3DKFA 3ZUUA 3NW5A 4UY9A 3L8XA 4FOCA 4DLIA 3QGYA 4I6BA 3I7BA 4MXAA 4O0TA 4RC2A 5HGIA 5L8JA 4EHEA 5IZFA 3HEGA 2BR1A 2XIRA 4D58A 4UMRA 4YSMA 1S9IA 4QOXA 1FVTA 2QONA 2X39A 3CQWA 4FKIA 4KWPA 4NTSA 2E2BA 3JS2A 4WG3A 2ZFYA 4ACCA 1OL1A 3C0HA 3OXZA 1X8BA 3DJ6A 5AA8A 3MYGA 4JOAA 4O96A 3QRTA 2WQOA 4V0GA 2WQNA 4V0GB 2R0UA 5DMZA 5IA4A 2BHHA 2C6DA 5K5NA 5IEVA 3DV3A 4UMQA 1H08A 2WOTA 4XP0A 2HXQA 1H00A 2C5XA 2E9VA 2YAKA 5CU4A 1G8JA 3QZFA 3KXMA 3QX4A 4FSNA 1TQPA 2CKOA 4UMTA 3EQGA 2J0JA 2R3JA 3EIDA 2G1TA 3CGFA 3Q4ZA 3ZDUA 5IQBA 4F99A 1M2PA 1YI6A 2I0HA 3MPMA 2C3JA 3OROA 2W96B 4XJ0A 2OFUA 4S2ZA 4ZS4A 3FXXA 4UXLA 3QF9A 3Q4CA 3QQGA 1NW1A 3EYGA 3N4VA 3UOJA 4BGHA 3CD8A 2F7XE 2GNIA 2YJSA 3QU0A 5LMKC 4RA4A 3E64A 4I6LA 2ITZA 3Q3BA 1YXVA 3MJ1A 3IG7A 2VWVA 2QURA 4RJ8A 3UZTA 4L42A 4CFXA 3L1SA 4I6QA 4FKQA 2PULA 4P2KA 4AF3A 2BMCA 4FTJA 4F9WA 3BV3A 2IJMA 3BE9A 4HYIA 3U4UA 1ST0A 4QP9A 3KMMA 2GTNA 3R8MA 2F4JA 2XKFA 4QMXA 3PPJA 4EQUA 4YURA 3BL9A 3Q9XA 4HVHA 4QMWA 4C2VA 5C4KA 3Q2JA 5KZIA 3A4OX 3V6RA 1Y6AA 4QEBA 4AFJA 5L3AA 3D7TA 2PVHA 2HXLA 4NSTA 3D7TB 4AOIA 4CKIA 2YIQA 3ZS5A 1Q3DA 3SW7A 3C5IA 3KCFA 3PY1A 3QQJA 4DFNA 1YOLA 3V5JA 2QO9A 4FG7A 2YIYA 3TKIA 3GC8A 2R3FA 2V7OA 2VWYA 2YAAA 3HMPA 3ZUTA 3QKLA 2RFNA 4JRNA 2YLFA 4RQKA 5M55A 4JMQA 3OCTA 4PRJA 1REKA 3F3ZA 2RG5A 2UZLA 4HCVA 1YDTE 4FIFA 1PXKA 3HDMA 5M09A 3MPAA 4I1ZA 5AX3A 1OPKA 4BCOA 2XK6A 2A4LA 5B0XA 4YR8A 3P4KA 1KV2A 4QNAA 4D2TA 4DYMA 4YZNA 1G8SA 3DLSA 4DEIA 3R8UA 2BPMA 1PXMA 2YJRA 5EQPA 3LFEA 3TM0A 1KUTA 5C9CA 4R3CA 4YUQA 2ZYBA 4DEHA 1P2AA 5IDNA 3T9TA 4CV9A 5JFXA 3A60A 4IZYA 5LQFA 4M8TA 1BI7A 2OI4X 4D2RA 4PPAA 1J3HA 4B9DA 3BYVA 4AA4A 2R3MA 5KZ0A 3OVVA 5DEWA 4KIKA 1P4FA 4W8EA 5T6KA 4ANQA 4KIKB 3KXGA 4D9TA 3AMYA 4EHZA 5M07A 4CLIA 2QO7A 4GRBA 4S34A 2R2PA 4K1BA 4TNBA 5B2KA 3VUIA 4YTFA 2FB8A 1REJA 1ZYDA 3KGAA 5EM6A 5K0XA 3EN6A 2PL0A 4YLJA 4O7LA 4TYGA 3AT3A 5DR6A 5FTQA 2HZIA 2NP8A 3FE3A 1BL7A 2VTMA 2BROA 2XRUA 5LARA 3U51A 2W4JA 3LFAA 4QMTA 4BWPA 4LM5A 4RGJA 4F0FA 3PXQA 3G0FA 4DCAA 3UYSA 2B54A 3PDTA 3ALNA 3F61A 4L44A 4RBLA 2ITPA 3DXNA 2QOBA 4IQ6A 5E8UA 5C8KA 3QLFA 3VW6A 4ZTRA 3HGKA 2PVLA 2OJJA 2RKUA 2WTVA 4DGLC 4XRLA 5AP0A 5KNJA 3MA3A 3E63A 4NJ3A 2ZDUA 3I4BA 3OY3A 4XBUA 4QQTA 4JAJA 4TPTA 1RW8A 3I7CA 3IW7A 4L46A 3PLAE 4C61A 5J9ZA 4MVFA 3NCGA 3IDCA 4PPBA 4NIFB 1CKIA 3WYXA 3NWWA 4CGAA 4AG8A 3DB8A 5M56A 5FQDC 5CXHA 4RZVA 5K4JA 1QPJA 3B8QA 2GS6A 3D5VA 2EUFB 4RWLA 2WU6A 3PFQA 3UZRA 2HY0A 4AT3A 5ANKA 5IKWA 1IA9A 2JAVA 1PXJA 3CPBA 3LXLA 4JL9A 5L2SA 4D28A 1R1WA 4FKLA 4FMQA 3ZUVA 4BCNA 5IU2A 3C0IA 5CTPA 3C4EA 3WZJA 3BU6A 3FQEA 3FLQA 4J95A 4M15A 4LG4A 1LR4A 4ZSJA 5D11A 3LFDA 3O23A 3UC3A 4NEUA 4UMUA 1NVSA 3RK9A 1BKXA 4L53A 5CSPA 3PJ2A 4R5SA 4K77A 4AZFA 2CJMA 4DCEA 2IZUA 1JSTA 4F63A 4CRLA 3OWJA 4EK6A 3GC9A 3TTJA 1WBSA 3BYUA 4LL0A 1WAKA 4W4WA 5TKDA 3VJOA 4H3PA 4D0XA 4Q9SA 3RBWA 2O3PA 2VTOA 5HLPA 5A14A 3Q32A 5I9ZA 5JGAA 2OFVA 3HKOA 4ZZMA 4KAOA 1ZYCA 4TTHB 3RPVA 4ZTSA 3HV7A 4JXFA 4RFMA 3DU8A 3E8DA 3VS7A 2H9VA 4B8LA 4IZ7A 4LMNA 4ZP5A 5DA3A 3FSKA 4KNBA 5C4LA 3AG9A 4R6VA 3LVPA 4TZRA 2B4SB 4ENXA 3UDBA 1ND4A 3FI3A 4O91A 1I44A 3LAUA 5AUTA 5KMJA 5JH6A 3SG8A 2WNTA 3D94A 3LJ0A 3LOKA 3UVRA 4D1XA 4EORA 2C0TA 2W5BA 3FHIA 3QAME 5JT2A 4RSSA 5DH3A 3OXIA 5LVLA 3K3JA 4WNMA 4FG8A 2ZJWA 5EI6A 3TNIA 3PRIA 1UNLA 3LFBA 3U9NA 2VAGA 4BR3A 3NZ0A 2PUUA 3QCSA 2WKMA 2PUNA 5KKRC 3G6HA 4DBNA 5GZ9A 4I94A 3FZ1A 3IW6A 5DI1A 1WFCA 3DQXA 3NUYA 4J71A 3ZO1A 2OIDA 3RK5A 4EH2A 5J5SA 4O0UA 5J7BA 1Y8GA 4G3CA 3AQVA 4BTMA 5KMKA 4BYIA 2ZB1A 2HZ0A 2VTIA 3UOKA 3RP9A 4MF0A 4RWJA 5IQDA 1W84A 2UZEA 3EB0A 1JNKA 3IPHA 3W55A 4QYFA 2VRXA 2HW7A 2QHNA 3Q9WA 5HNIX 1H27A 4HCTA 4S33A 2XB7A 3V5TA 5BUJA 3NIZA 4RX5A 3PUPA 3BBWA 3OD6X 2ITXA 3HVCA 3QHRA 2QHMA 4N0SA 3BGQA 4RVMA 1OKZA 5M51A 1FVVA 4JBVA 4KKEA 1GZKA 4QT1A 4CVAA 2IPXA 1OECA 1Y6BA 4PMMA 4NM0A 2UZUE 4QMUA 5HICA 4BCMA 3OEZA 3MI9A 4BIBA 1ZMUA 4FL3A 2GPHA 3BHUA 3QQLA 3RGFA 3KN6A 5DGZA 3SRVA 3R2YA 1G3NA 3F3WA 2GNHA 5HD7A 3SRVB 2JGZA 1XHAA 2JFLA 3VBYA 4E1ZA 5LXMA 5GJDA 4QP7A 4OTQA 4TY1A 3LQ5A 3ZC6A 4BF2A 4EQCA 5HQ0A 2ERZE 2WO6A 5DFPA 2CLQA 2WQMA 5H8GA 3RPRA 1R3CA 1KOAA 1XH6A 3NPCA 3FMNA 5EDPA 3PZHA 2R3IA 5HHWA 4MXCA 2VTPA 1IAJA 3ZU7A 3TZMA 5EW9A 5BVEA 2X81A 3FI2A 4FV5A 3LXKA 4E6DA 3K54A 2YACA 3VUGA 4BZDA 1OL2A 2VTNA 4ZLOA 3TL8A 3WILA 1H8FA 4I6HA 4UZHA 2XIZA 4NK9A 4M0YA 4X3FA 5CX9A 3UNZA 4FTUA 4X3FB 3LCSA 5BYZA 3G9NA 4BKYA 1WBVA 2PUPA 2PVFA 4GJ2A 5HU9A 2VNWA 3TKUA 3FEGA 4I5MA 2OZAA 4EZ7A 1U5RA 2JIVA 2OZAB 4D4SA 3PJ8A 2QOIA 3HP5A 2JKKA 2PZYA 4AGCA 5JMSA 3FC1X 5A4TA 5JRSA 4QMMA 3ZZWA 4OW8A 5C1QB 3POZA 4ZY6A 3UIXA 3KULA 2J4ZA 4EK4A 2ITTA 2PSQA 2BAKA 2ZV9A 3KULB 4LRKA 2F7ZE 3D4QA 5ACBC 4QQJA 1XH4A 4QPSA 1FGIA 3MB6A 2P33A 5GIOE 3AC3A 4RVKA 2BTRA 3FL5A 1F0QA 4I22A 3RPSA 4R78A 2PZ5A 3D5UA 3GCSA 4M13A 5IH6A 5BMMA 4Y5HA 5K5XA 5IQFA 4ZSGA 4KD1A 4IH8A 2JD5A 3QTUA 4WT6A 3RKBA 3W2CA 3HMOA 3HUCA 3GQIA 2CKPA 3NDMA 5CF8A 3IONA 3E8EA 3LLTA 2CNUA 3FXWA 5HBHA 3S95A 3F7WA 4MBJA 3Q52A 2HOGA 3L9MA 3UNJA 3VBWA 4FTMA 2W06A 3AD4A 3VJNA 4EI4A 5I4NA 1R39A 1PXLA 1GZNA 3R02A 5AWMA 4MUQA 4PNIA 4YU2A 1LPUA 2QOQA 2JAMA 4C58A 3PIYA 4K2RA 3RWPA 3EKKA 4FL1A 1ZXEA 4YC6A 4LGHA 3IDPA 2Y4PA 3TEIA 4GT4A 2X6EA 3IW5A 2C68A 3V5PA 4DG2E 1FGKA 1U59A 3ET7A 3QD3A 4XV2A 2C6EA 4O2PA 4IXPA 4C62A 5KHXA 2EXCX 4ARKA 4UALA 4O6EA 4W8DA 4BDJA 3TG1A 4U6RA 4S30A 5HCZA 3W2OA 3W0RA 4BHZA 4HPUE 4R7HA 4PF4A 4DG0E 1ZY4A 4RJ5A 2OH4A 4R7IA 3ZC5A 4YSJA 4PX6A 3F69A 4ZTNA 3QCQA 4NKSA 4L67A 2YIWA 5ETCA 4YO4A 1OPLA 2IVTA 2P2IA 3NNUA 1SVGA 5GIPE 2V0DA 3E8CA 4UYAA 2I6LA 3R7EA 4YHJA 3MDYA 5DVRA 3MFSA 3EJ1A 5I9YA 2XZSA 1U4DA 2QNJA 3LFCA 3FLNC 3Q5IA 5E4HA 3MB7A 3O8UA 4OBQA 4FKVA 5ANGA 1OKVA 2WTKB 1YI3A 4EOMA 1CKJA 4JDIA 3QALE 1GNGA 4I0SA 4JQ7A 2CGWA 1PXOA 1Q8WA 2RG6A 3KRXA 3E3PA 4I41A 4DGOA 1OUKA 4MNEA 2F9GA 4TRLA 4U79A 5FGKA 3DQWA 4MNEB 3TJCA 4WG5A 3COHA 3MFRA 2OG8A 4C33A 3HMIA 3U54A 4AQKA 4QP1A 5KBQA 4EUTA 1K9AA 4MEDA 4G6OA 3EL8A 1UA2A 3CKWA 3D5XA 3VS5A 4C4EA 4DHZA 4FTCA 2VWZA 5KX8A 2GTMA 5EI8A 4EOSA 5KO1A 5L6OA 3ORLA 5IQEA 4MQ1A 4W9WA 1XWSA 4Y83A 2R7BA 2BZIB 3GU8A 4PMSA 5H8EA 4LV5A 5FP6A 3CE3A 3WF7A 1O6YA 3CKXA 4QPAA 2BAJA 4LGGA 3VQUA 3D2IA 4AQCA 2YERA 3UYTA 5J87A 4DTKA 5CF6A 3EHAA 4NUSA 3REPA 1AD5A 1NA7A 3FZSA 3F5UA 4XLIA 3RAHA 4QMOA 2CGXA 4GFOA 5I9XA 2R9SA 4F09A 2WIPA 3QXPA 2WMWA 4QPMA 2CCIA 1NVRA 2V55A 4KA3A 4CTBA 3W0SA 4Z7GA 5AIKA 3FDNA 4I5PA 2YZLA 3VBVA 5HTIA 3BPRA 3TV4A 3R7OA 3NMUF 3KRRA 3GU6A 5DWRA 3AT2A 2YDJA 2VO0A 4MK0A 3KRJA 2PY3A 2J51A 4A7CA 3PXRA 4FODA 3GU4A 3HDNA 1YDSE 3F6XA 3IOKA 4USEA 1PRYA 1A9UA 2C6IA 3M1SA 3OMVA 4JNWA 1OI9A 4YHTA 5JRQA 3BLHA 4FK6A 4A07A 1RDQE 3VS2A 4KBAA 3TIZA 3EFJA 4FTRA 2ITUA 1Q99A 4M7IA 3FHRA 3ODYX 4HGLA 2W9FB 4H3BA 3H0YA 3A8WA 5JGBA 4GKHA 4UYNA 5AR3A 4EOJA 3UE4A 5HLWA 1WVWA 2PVYA 1U46A 1PMVA 2C3KA 4JT3A 5A4CA 5BYYA 3NFGB 2OJ9A 1UVRA 2XNNA 3FYJX 3QCYA 2XM8A 3W2RA 1TFFA 1UNGA 2YM7A 4UN0C 4L45A 5FD2A 4O84A 1PY5A 3KC3A 4JDHA 3CSVA 3VO3A 2H96A 4IVDA 5T3QA 4O86A 4X6QC 4KRDA 4YMJA 5DT4A 3S1HA 3SA0A 3IDBA 2JFMA 4J8NA 4EC8A 4GG7A 2W1EA 3VBQA 2OJIA 1IEPA 2WOUA 3KB7A 2IZTA 2G15A 2YZAA 3M2WA 5AV1A 2ETMA 4AA0A 4AACA 4CMTA 5IG1A 3R1QA 1L8TA 3VBXA 1H1PA 2W1DA 2WTCA 1ZMVA 3NVMB 1PF8A 2WTIA 1RJBA 4W4XA 4OT6A 2Y8OA 3HRFA 4AGUA 4AZVA 4J99A 3KRWA 4C7TA 4DN5A 5CSXA 3BGPA 2FGIA 1XBBA 5JQ5A 4GVJA 5BVKA 1ZZ2A 5CNNA 2W0JA 4KBKA 4BTFA 2XCHA 5BVFA 3OXTA 4N6YA 5CAUA 2VTQA 4XHKB 3Q04A 2QODA 1M52A 4EONA 3UDTA 2JKMA 3ENMA 5CU2A 4F7NA 4UWCA 1JSVA 1DI8A 1DM2A 4JS8A 3EQIA 3KEXA 3A8XA 2R64A 3BCEA 3CQUA 3NR9A 3GCPA