5HG7A

Egfr (l858r, t790m, v948r) in complex with 1-{(3r,4r)-3-[5-chloro-2-(1-methyl-1h-pyrazol-4-ylamino)-7h-pyrrolo[2,3-d]pyrimidin-4-yloxymethyl]-4-methoxy-pyrrolidin-1-yl}propenone (pf-06459988)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
280
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of 1-{(3R,4R)-3-[({5-Chloro-2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-methoxypyrrolidin-1-yl}prop-2-en-1-one (PF-06459988), a Potent, WT Sparing, Irreversible Inhibitor of T790M-Containing EGFR Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 280
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hg7A01
4DEDA 2YEXA 3PA4A 4O7RA 4NW6A 2C3KA 2XYNA 2W5BA 1OECA 2JITA 2X2KA 2YM3A 3BX5A 3JY9A 4EKKA 5BVNA 4F63A 4JG8A 4R77A 4EK3A 3D94A 2HK5A 3KA0A 5CZHA 1V0PA 3AGMA 1T46A 4LV8A 4TYHA 4FTLA 4AAAA 3NR9A 2X4FA 1S9IA 1UA2A 2RG5A 4XV3A 2XIZA 3UNKA 5HCXA 4DA5A 4FNZA 4I3ZA 2GS7A 3KQ7A 4AUAA 3B2TA 3ZO3A 3O50A 4J99A 3MJ1A 3KY2A 3K3IA 4JG7A 5ANIA 3F3ZA 4R1VA 2VTMA 4NM5A 3IW7A 3ZDIA 4CZUA 2C6IA 3VC4A 4EOOA 2R0IA 3QD0A 2X8EA 3ZSHA 4AW0A 3KK8A 3OVVA 5GJFA 5AJQA 3HDNA 4V05A 4D4YA 4QP4A 3U9NA 4FVRA 2ESMA 5EYMA 4YJVA 4DF3A 2PVNA 2QR8A 4I5HA 2UZOA 2XM9A 4X3FA 5C4LA 4D55A 1SVHA 2YIWA 3GOKA 4IE9A 3OEZA 1P2AA 4K33A 3RCDA 3LLTA 3KRLA 2J51A 4XG4A 2QHMA 1S9JA 2C6KA 3FPQA 3QTIA 4BGHA 4C8BA 4EBWA 3RAKA 4EH9A 4M8TA 3GQIA 4GU6A 3VS6A 5IZFA 3WZDA 4DG2E 4QMQA 4NKSA 5AFVA 2GNGA 3FYKX 2DQ7X 3A61A 3BV2A 1MRVA 5EOBA 2WAJA 4DGNA 5K4IA 2YCSA 1U46A 2WU6A 2W1IA 4FV7A 2IJMA 5D11A 2YM4A 1U5QA 2B9IA 3F69A 4FSTA 4HYSA 3R9NA 3REPA 1OPJA 3R28A 4JQ7A 2YIXA 3COHA 5D7VA 3CY3A 2BRHA 5HO8A 4BKZA 4O7ZA 1PXMA 3DDQA 3MGYA 3NNWA 4FUYA 4YO6A 1PXJA 2VD5A 4CMOA 5E8WA 2A4LA 5C4KA 3OW3A 5HVJA 5IF1A 4BCKA 4IM3A 3F82A 4RFMA 4RQKA 3NUNA 5EW8A 3AMYA 4O21A 2BAKA 3BE2A 1JOWB 5DNRA 4UN0C 3MH3A 4TNDA 3HEGA 5BUEA 2QLUA 5LWNA 2I7QA 4EJNA 4DLIA 4JDHA 3DZQA 2JDVA 3G9NA 3QFVA 4GG5A 4ZAUA 4F08A 3Q2JA 4KBKA 3C9WA 1R1WA 3MA3A 2Y6MA 3TIYA 4C57A 2W96B 5IEVA 5KMMA 4D4SA 4FTNA 3HNGA 1LP4A 2KTYA 4OGRA 5HE1A 3SHEA 2YM6A 1MRUA 4QP3A 3LW0A 4LOPA 3QRTA 2JAVA 1FMKA 3P7CA 4PL3A 4QNAA 3IONA 4QMYA 4F7NA 3GCPA 1URWA 1LPUA 3UIBA 4KB8A 3TZ8A 2WOUA 4E8AA 3NVMB 2F2CB 2DWBA 2CKOA 4TXCA 5CSHA 5IG1A 5CU3A 5EI8A 3WZKA 3COIA 3UZPA 3ORMA 3V5LA 5HE3A 4E4MA 3C51A 4L45A 4O0WA 3VRZA 2EXMA 5I9ZA 3L9NA 4BGQA 3ZBXA 1G5SA 3Q9XA 3UJGA 2WMQA 4BDBA 4CSVA 3ZC5A 2X9FA 4FT3A 3UO6A 3UZRA 2VNWA 4WOVA 3EQPA 3OOGA 3L9MA 4M69B 1PXLA 4O27B 3UVQA 2ITQA 4BCJA 4FV6A 4QMTA 2W5HA 4CKJA 4GU9A 5IH6A 4BCHA 3SRVA 2W1CA 1ATPE 3AD4A 3C4ZA 4IFCA 5T68A 3UOLA 5CYIA 2VV9A 4FVQA 3OTVA 2VGOA 4IHPA 3DK3A 3KRXA 4GFOA 3ZO1A 5I3OA 4JG6A 5C01A 2C0OA 2YDJA 2UZEA 3QBNA 3D4QA 3EYGA 1GZKA 3ZUUA 3ZXTA 4EL9A 2B7AA 1PJKA 3AC2A 3GXLA 5EW9A 4QT1A 3RNIA 4WG4A 4CFWA 4UALA 1A9UA 3QWKA 1ZYCA 1Z5MA 4MH7A 4ACMA 5E9EA 4KIQA 3W1FA 1PRYA 3E7VA 1CKPA 4DTKA 3MFUA 2FB8A 3ZO2A 2UVYA 3W55A 2J5EA 2GNLA 4KBAA 3KXMA 3HV6A 4NTSA 4H39A 2W05A 1OPKA 3DBDA 4D2SA 2QQ7A 3AC8A 1A06A 2ZM4A 4UWYA 1H28A 2Z7LA 4M7IA 4RVTA 4ONAA 5AM7A 2OJGA 3QD4A 2B54A 1OL7A 4EYJA 4KINA 1IA9A 5GINE 2VO7A 2W1ZA 3Q9WA 5AV1A 5HU3A 2IZTA 3VF8A 4TYJA 2GNJA 3UG2A 4ALWA 2NRYA 3R8MA 4RJ3A 2ERZE 2R64A 3IQ7A 3P9JA 4RVLA 3AC5A 4WNPA 1JSUA 5DN3A 3VN9A 5DIAA 5FP5A 4OTWA 1H4LA 4F70A 2YIQA 3MY5A 3I5NA 1AD5A 1EH4A 5DR6A 2XH5A 4U3YA 5J95A 1M7NA 4C2VA 3Q4TA 4LFIA 1MUOA 5HX8A 2CHLA 4FK6A 3AXWA 5ANKA 3BEGA 5HG9A 4C38A 5HNBA 5C03A 4QMWA 3ZFMA 4E4LA 3FEGA 2YACA 3BHUA 5AP7A 4GRBA 3AC4A 5K4JA 3PVGA 3L8PA 3I6WA 3DQWA 5IA0A 3V5WA 5D9HA 4CD0A 3COMA 5H8BA 3MTFA 1IASA 4QP9A 3QTRA 1PXNA 2X8IA 4ANOA 5AAGA 3W18A 3IG7A 3MWUA 4ZLOA 3W10A 2DYLA 4XP2A 2QI8A 4AZWA 5KZ0A 1BI7A 2VN9A 4NT4A 1UU9A 4Y5QA 4AZSA 4TWOA 4O7TA 4EWHA 2F7ZE 4ZP5A 5CX9A 3QGWA 1PKGA 1Q8TA 2V5QA 3Q5ZA 1DI8A 5CSPA 1Q41A 4WNOA 4FSRA 3BBTB 4B7TA 3D0EA 3PA3A 4QTDA 4EUTA 1E1VA 3EFLA 1H0VA 4RFYA 4EH6A 4FIFA 5BUIA 2JDOA 2RF9A 4UMTA 4RLLA 5CSXA 3F5GA 5F94A 3U9CA 4CTCA 1JKLA 3ZONA 1CTPE 5CVGA 4UYNA 3LFQA 3PXZA 3EWHA 3TTIA 3F88A 2LGCA 3Q4UA 2VTLA 5B0XA 4QMPA 4P90A 2BILB 5DEYA 1Q8YA 3V5QA 4AFJA 3MPAA 2BUJA 3CPCA 3G33A 3KF7A 4I4FA 3DXPA 5AX9A 4GCJA 4NSTA 4F4PA 2BKZA 4EOKA 3VS4A 2XRUA 4JR3A 3C0IA 2O63A 3KRWA 4BDFA 4FKQA 5HD7A 5K5NA 4JBOA 3ZEWA 5CVFA 3MPMA 3BU5A 2OFUA 2ZOQA 3VS5A 3GT8A 4OBOA 4TPTA 1Z57A 3D14A 3R04A 3K54A 2V62A 4PL5A 1WVXA 5G6VA 4BTKA 5T3QA 3NSZA 2J5FA 2UW8A 1WZYA 4O6LA 3FPMA 1ZXEA 3CEKA 5TKDA 3RI1A 3ORLA 3UMXA 4C02A 5AR8A 3QAME 4RJ6A 5J5SA 3H3CA 5I0BA 3KGAA 3KVXA 2ZV7A 4HGLA 3OTUA 4K2RA 4QYYA 5HLPA 3UODA 2BRBA 5JKGA 3FZTA 1KV2A 4JAIA 4GIHA 4RIYA 3KXHA 4IMYA 3P1AA 3KRJA 3DOGA 4TKSA 4ZMEA 2HZNA 3A4OX 4N4SA 5AUUA 5JRQA 2ITOA 3FI3A 3TNQB 4DT9A 4UMPA 5CANA 4PDYA 2XIXA 4E4NA 5F9EA 2BRMA 1H8FA 3FXWA 4QMLA 4HCVA 4MNEB 3UOHA 2W4KA 1XHAA 4N70A 4KWPA 5AV4A 5AIRA 4BDEA 2W9FB 2QOQA 3D15A 3PSCA 3RCJA 3O8TA 4EOMA 4EUUA 4O86A 4HVGA 4LYNA 3TI1A 4V01A 2JDTA 2PWLA 3IECA 4WA9A 3FY2A 5FG8A 3HMNA 2XYUA 4GFGA 3E3PA 5LMKC 4WRSA 4XV1A 4UBAA 5KBRA 2IG7A 4HVSA 5CEQA 3U6JA 4JS8A 5AIKA 3D5VA 5E1SA 4CKIA 3LQ5A 2BZKB 3CTJA 4GT3A 2ZM1A 4FKUA 2J50A 3MDYA 4P4CA 2C6LA 2OZOA 1XWSA 4EC8A 2XK9A 3JY0A 5J1WA 1DM2A 2VTIA 4FTQA 2GS2A 3E64A 3EB0A 4UV0A 4BCGA 2CNQA 1CDKA 1ZZ2A 2CNVA 4KKEA 4RJ5A 3DBFA 4C4GA 2Y6OA 5DR9A 3LMIA 4WUNA 4QMVA 3QC9A 4GIIA 2OG8A 3G5DA 4ZZMA 4DFXE 3PXQA 3RM6A 4FF8A 4O6EA 3VBQA 3EQFA 2R3LA 4QP1A 4FSWA 3EQGA 5AX3A 2FH9A 3FZPA 2IPXA 4GK4A 1IAHA 4RX5A 4CFFA 2YIYA 4F9AA 5LCJA 4IX3A 2CJMA 3KK9A 3RPSA 4I94A 2WHBA 2O0UA 2YDIA 5AP4A 5GZAA 3SXFA 3TDVA 1H1RA 4EQMA 3NUAA 4AX8A 3HP5A 3LVPA 2C0IA 3FWQA 4M97A 3BU3A 4E5BA 4AW2A 4M0ZA 4DFZE 3RTPA 4CCUA 2WU7A 3GI3A 5HZNA 4BCMA 3LIJA 3I7CA 3OFMA 4I6HA 5TR6A 2ZB1A 4G31A 5L8KA 3BI6A 1ZYDA 2A1AB 4XG8A 3LFDA 2WMRA 3HRBA 3EQHA 5EM6A 2QVSE 5L2IA 5CNNA 4LL0A 2R0UA 3QCYA 4RIXB 5JSMA 3NYNA 3HRFA 4TZRA 1RQQA 3EOCA 2PE2A 2QC6A 3DLZA 2XK7A 3MSSA 3KEXA 2BAQA 5TE0A 4BCQA 4GS6A 4IJPA 4F99A 3ID6C 4DEEA 3DGKA 4E20A 4F9YA 3TEIA 1FPUA 1OB3A 3AMBA 3FL4A 3LPBA 4M68A 4ZTLA 4C4EA 3PPKA 3PLSA 2XCKA 5LMAA 1H08A 3Q2MA 5DG5A 5M55A 4KAOA 4G6NA 1IAJA 3AC3A 1HCKA 2R3OA 4W4WA 4XHKB 4XP0A 4PL4A 3BGPA 3WBLA 4X21A 2YABA 2W0JA 3IDBA 5LVNA 3A60A 3O7LD 2XZSA 3TV7A 5KZIA 4FIIA 3UIMA 2KULA 3KKVA 4R3CA 4FTTA 3V8TA 3EZVA 5F4NA 3SDJA 2BDJA 4OLIA 1KOBA 2HOGA 3EL7A 1Z9XA 4Z7HA 5IH5A 1SMHA 2E9VA 4FTMA 5CU4A 4C33A 4F64A 3ZO4A 4BTMA 5IQEA 2QKRA 3SW4A 1ZWSA 4ANQA 4G3CA 4H58A 5I4NA 1PY5A 4JLCA 2BVAA 3OF0A 4OAVB 2GNFA 4TWCA 2WOTA 4N57A 4EH7A 2ZV2A 4EQCA 4QD6A 5AP1A 2QOBA 3Q6UA 4ZS0A 5JFSA 4V0GB 4ANLA 2W5AA 3BQCA 4ZJVA 5L2SA 2YM5A 2X2MA 5DOSA 4CFNA 4UWBA 5DBXA 3FSKA 1ZMWA 4EZ7A 5AP5A 4ERKA 2GTNA 2X81A 2BKKA 3VAPA 3CBLA 3RBWA 5DT0A 4RA4A 3TNHA 5BPYA 3SW7A 2HZIA 4S2ZA 3FZ1A 3BEAA 3TACA 1B6CB 2IZUA 3R30A 3U6HA 3I7BA 3ZLYA 4O82A 4FKSA 4NWMA 5CWZA 5CLPA 4ASEA 4MD9E 5IDNA 3LKMA 2JBPA 3F2AA 2OIBA 1O6YA 1G8SA 2CMWA 4K1BA 2VRXA 4TYGA 4APCA 5DMZA 4YZMA 3ZU7A 5HBHA 5EI2A 5KO1A 4MVFA 5EI6A 4PTCA 4N0SA 2PULA 3N4UA 4GKHA 3OT3A 4ZTQA 3DXQA 1FOTA 4FE2A 5HO6A 2OFVA 2Y4PA 4HZRA 4KIKA 5CF6A 4WBOA 4WSQA 4QP2A 4BIDA 4TWNA 3EMGA 4FR4A 3QWJA 2RFEA 4LG4A 2R7BA 4I23A 1ZARA 3OZ6A 2YWPA 4QYGA 3E93A 2YAKA 3DFCB 3PVBA 1W83A 4D5HA 3IW8A 3SXRA 4C35A 1TQPA 4X6RA 4NCTA 3ROCA 4BBMA 3GU5A 1OKVA 4BWXA 4BY9E 3LXLA 1CKIA 1GIIA 5AUYA 4MAOA 1TQMA 4WKQA 1OITA 2QOLA 3MB7A 4IB0A 3CGFA 4CV8A 2WMTA 5AUZA 3VS2A 2Q0NA 3G0FA 2O65A 2OKRA 3UQFA 1V0BA 4P7EA 4OTFA 4I6BA 1XH5A 4WO5A 3MIAA 3GVUA 1Y8YA 1OM1A 4C62A 4IJ9A 5IUGA 2J9MA 5KMIA 1JSVA 3EYHA 3IGGA 3GCVA 3M1SA 2ZAZA 4PWNA 2C3LA 2NNWB 1PXKA 1LEWA 2BFYA 2VWXA 4FGRA 5HIDA 4F7JA 3ZYAA 3ZM9A 3IKAA 2WMXA 4FTOA 3P7AA 4ZJIA 2GNIA 2WO6A 4L3PA 1YOJA 3NIZA 3HDMA 3IOKA 3BLHA 4QMNA 3R8LA 1NVRA 4FSNA 3EQCA 4DCAA 2ZYBA 2ZB0A 4TY1A 5HOAA 3Q04A 2BRGA 3U4WA 4CCBA 5EYDA 4JJRA 2XK8A 1GIJA 3QQLA 1WBSA 3CPBA 4GVAA 1PF8A 3LMGA 3IW6A 4UWCA 5DPVA 4QMMA 1WCCA 5CU0A 1WBNA 2BALA 3GOPA 3O8PA 3H30A 3UNJA 4E73A 4YURA 3SG9A 3ZXZA 3KN5A 2XEYA 2AUHA 3MH0A 2OO8X 3KXGA 2X1NA 5EKNA 4I24A 2WQBA 2BDFA 3NUPA 3QF9A 3MW1A 3OUKA 4ZZNA 1OL5A 4BRXA 4XLIA 3OS3A 1V1KA 4IW0A 1W7HA 2DUVA 5I5ZA 4FBXA 4M84A 1H27A 1Y6BA 5DA3A 5I9VA 1XO2B 1NT2A 4D28A 3L8VA 1H01A 5IQBA 4XG2A 1OZ1A 2XMYA 2Y4IC 4HW7A 5CF4A 3Q9ZA 1J1CA 3O7LB 3D2KA 4FKRA 2XNMA 5DWRA 2OH4A 3F2NA 4I5CA 4U9AA 3ANQA 4FTJA 5BMMA 3NW5A 2B9JA 2QOOA 4A06A 3DTCA 1XQZA 4KSQA 4HYUA 5CI6A 3V3VA 1M2QA 5DVRA 5LVLA 3RMFA 3CR0A 4W8EA 5HCZA 2VTRA 3HV5A 4W4VA 1FGKA 4EH3A 5FDPA 3MVMA 3SLSA 2FYSA 2NRUA 2OXXA 4FSYA 4S33A 4XNEA 5JH6A 3CS9A 4MF1A 5CEIA 3GU4A 3LFAA 1HOWA 4LM5A 4O0TA 4U45A 1KUTA 3C4WA 4DG3E 2YIRA 3AD5A 1RDQE 3FV8A 4CMUA 3KU2A 5HKMA 3OUNB 4GL9A 5JK3A 4BI2A 5IQGA 1U54B 2C69A 2VTOA 4PTEA 4YZNA 3R9RA 4EWQA 2HZ4A 4LV5A 2ZDTA 4CEGA 1OIRA 1REKA 3G0EA 2RL5A 4RX7A 5FLFA 3ULIA 3BIZA 4ZY4A 3WF6A 4YLKA 3QTXA 2XNEA 3NCGA 4W4XA 4I0RA 4RX8A 2YLFA 3D9VA 4IAKA 1UU8A 5M51A 2BMCA 4DTBA 2J7TA 5GJGA 2C3IB 5BYYA 3F5UA 3T9TA 1IEPA 4F1OA 3PVWA 1XH8A 4RBLA 4NUSA 2B0QA 5GJDA 5J9ZA 3M11A 3UVPA 3B8QA 3CCNA 2XIRA 2HWPA 2OWBA 4IAIA 5JMSA 3PUPA 5FTOA 2OJ9A 3KULA 4ZSLA 2O8YA 3V6SA 4DH8A 4ZS4A 4NFNA 3IW4A 3R73A 4MXCA 1JBPE 4JNWA 4YZCA 5L2WA 4DAWA 2ZVAA 3UOKA 3MTLA 3VUGA 3RPYA 1LUFA 4XUFA 1NVQA 4AA5A 2XCHA 4ACDA 5CTPA 2CKQA 2PYWA 2YM8A 4WNMA 5ETFA 3PG1A 4OUCA 1JPAA 5ANDA 4NJDA 4G34A 5I9WA 2RFDA 5AR5A 5KKRC 3BYSA 5EHOA 4XV2A 1YW2A 3QXPA 4YHJA 4ERWA 4TL0A 3P0MA 4IX6A 3P86A 4FEUA 3R1YA 3IDPA 4N6ZA 3CJGA 3FMDA 1OKZA 4AZFA 4L8MA 3F3WA 2OICA 4KRDA 2W1DA 1GZNA 4C36A 3QTSA 5BVEA 3FDNA 3FJQE 4QOXA 4EOJA 4L00A 2YLEA 2W06A 4WHZA 2OI4X 3UE4A 2XBAA 3GENA 4EQUA 3QALE 4F6WA 5BMSA 2BZJA 5EYCA 3RWQA 2VTTA 4NKAA 2OJFE 4NZWB 4AGCA 3H9RA 4BIEA 4EZ3A 5IUHA 1OBGA 4DBXA 4GEOA 2PUUA 2WFYA 4L7FA 4USDA 4AN2A 4BICA 5KE0A 1BL7A 1K9AA 4C59A 4O1OA 2B4SB 5HCYA 5AV3A 3AG9A 4XOZA 5IEXA 2CGVA 4QMZA 3L8SA 3U6IA 3ALOA 3QTQA 4KNBA 3HAMA 2ONLC 2IVVA 4UMUA 4MEDA 4S32A 2BCJA 1FVRA 4USEA 1SZMA 4I21A 1R78A 4RIOA 2CDZA 4E3CA 5M09A 4PRJA 4FK3A 4NEUA 4Q9ZA 4Q5EA 4FKPA 4BWKA 4FV1A 4R3PA 2EXEA 4GK2A 1VYWA 3VS0A 3ZS5A 4F1MA 1IRKA 2R3PA 3B2WA 3PP0A 4FIGA 5FGKA 4AE9A 4XOYA 4ANNA 3BWJA 2AC3A 3UQCA 4ZK5A 4IADA 5EFQA 3R8VA 2OZAB 5EW3A 3EN4A 3RPOA 4F65A 3F66A 5AP6A 4FV4A 1YVJA 3OWLA 3LJ0A 3CD3A 1VEBA 3LAUA 3M2WA 3BE9A 4IM2A 4GJ3A 2JLDA 2WMUA 3TTJA 1JAMA 4MXOA 3TIZA 4RC3A 4RWLA 1BLXA 5DRBA 4MBJA 4AA0A 4RIWB 1KOAA 4YBKA 5GIOE 4B6LA 3POZA 2HY0A 1NXKA 4HYHA 4JDKA 3ZLWA 3ZRLA 4BTFA 5GNKA 4DH7A 4M3QA 2OLCA 2QCSA 3DAKA 4GSBA 1GOLA 4CXAA 3EQRA 3ZCLA 4ALUA 2J0JA 3LFEA 5DI1A 3MS9A 5FEDA 5HESA 5ICPA 4ZMFA 2XKEA 5L6PA 3KXXA 3PSBA 5E7RA 1CM8A 1YKRA 1RE8A 5IA3A 4YJOA 3ATSA 3DB8A 2YZLA 3FMEA 3MFSA 5C8NA 2C5XA 3FHIA 2H34A 3C4FA 4LRMA 3WF9A 5LWMA 2XNOA 5IA1A 5FBOA 1OUKA 2UZNA 3PFQA 3BHTA 4FC0A 4KIPA 4W9WA 1JKKA 2OXYA 5E8ZA 4MD7E 5HTBA 4G9CA 3VBVA 4C61A 5IQDA 4DEIA 3DAEA 5BYZA 3KXZA 5D41A 2GS6A 1W98A 4HZSA 2WB8A 3R7OA 4MK0A 2G01A 3P23A 4RPVA 5FM2A 4L52A 4XX9A 4QNYA 4EYMA 1DI9A 2R3IA 4RVKA 4JBVA 4L67A 4FKTA 3TNPC 4MXXA 2ITUA 3VUIA 3UP2A 4YLLA 3FLZA 4QYHA 3H10A 1PMVA 4LL5A 4ZY5A 2PE0A 3OD6X 4DHFA 3PY0A 3ZRKA 3I79A 5EHYA 3QUDA 3UGCA 2PVKA 4NH1A 5CEPA 4UX9A 3RJCA 2E9OA 4BF2A 3PXRA 2WTWA 3R0TA 4B99A 2P3GX 2VX3A 5CAPA 5HLNA 4DEBA 2EB2A 4E1ZA 5HQ0A 2R3GA 4OR5A 2BTSA 3FC2A 5M44A 5L6WL 5J1VA 3FLNC 4YLJA 4WBBB 3QZFA 2GMXA 2R3NA 3VUDA 4ORKA 4DITA 1B39A 3KF4A 3PE1A 2V7AA 4AN3A 4AZTA 4E6AA 3PZEA 3MA6A 5FXQA 1HCLA 2CPKE 3GFEA 4Q5HA 3R83A 2F49A 2OJIA 1V0OA 3BRBA 5LARA 3S4QA 2IWIA 4F1TA 3FQEA 1VZOA 4BDHA 1Q62A 3ODYX 1XBAA 4KS7A 4KBCA 1H00A 4ZTRA 4R5SA 3NDMA 3T3VA 3G9LX 2OF2A 3C7QA 3F5XA 4KD1A 5FEEA 3R7EA 3SKCA 1WBOA 3FSFA 3P5KA 2E9PA 3ORNA 4H36A 3CSVA 4IDVA 5D10A 5FQDC 4IB3A 4GW8A 2F4JA 5IEYA 2ZDUA 3CP9A 4K8AA 5KMOA 4NU1A 5H8GA 3QZIA 1UNHA 1Q99A 1Q5KA 3MY0A 3MFRA 3VS7A 5K0XA 5M07A 4FKWA 4TNBA 5HBJA 4KUJA 3LLAA 3CQUA 4UEUA 4JQ8A 3RPVA 1XJDA 4L44A 2OU7A 5BVFA 3H0YA 2W4JA 4PDSA 4TYHB 4WNKA 4CZYB 4YJQA 5HTIA 4PDPA 2GQRA 5EDPA 4DEAA 3BQRA 1FVVA 3OXTA 4FSQA 5EHLA 4O7YA 4HGSA 4U43A 5AAFA 2YDKA 4F7SA 3QLFA 4QP7A 3BYVA 4X2JA 1APME 4O7SA 2OF4A 4OTDA 5AUVA 4FTKA 5BVWA 3C50A 3ZTXA 2Y9QA 4I41A 2X9EA 5A9UA 4D9TA 3C4XA 3DT1A 5CS6A 1URCA 3Q32A 3VIDA 1TKIA 4RA5A 2WELA 1WBTA 4YUQA 4FSZA 1FINA 4QPMA 4F6SA 2C1AA 3UBDA 2HELA 4X3FB 2JIUA 4U42A 4GYGA 4ACGA 4CYJA 4CG8A 4JT3A 3BZ3A 3QQUA 1H07A 4G2FA 4C4FA 3ANRA 4RMZA 3BHVA 2VWVA 2Z2WA 5H8EA 4AT5A 2PVFA 3OT8A 3IOPA 3LXKA 4HCTA 3LJ2A 3WE8A 4FSUA 2JFLA 2B1PA 3FLYA 2VTPA 3ZSGA 4TN6A 5E8YA 5EOLA 4FEWA 4K6ZA 3RK9A 4KS8A 4HVHA 1Q3WA 2JDRA 5FD2A 3DNEA 3DNDA 3EFJA 3VQHA 5IQAA 1PHKA 4J71A 2XRWA 3E5AA 1YHWA 3OY1A 2P33A 4AOIA 4FEQA 4XG9A 4BZNA 4D4RA 3UIXA 4DC2A 4ZSEA 4IWOA 2WTDA 2HAKA 3PJ2A 4YPDA 1ZYSA 3QHRA 3PDTA 1O6LA 2UZUE 2P2IA 1YXVA 4FX3A 4NFMA 1Y6AA 4JL9A 2PUPA 3I1AA 2EXCX 2R3MA 4J98A 4QMOA 3TUBA 5E8XA 5JGDA 4CRLA 1I09A 3UPZA 2JBOA 3DV3A 2JDSA 2OJJA 3OW4A 4YJTA 5I9YA 5M4CA 1ZAOA 2CGXA 2I0VA 4TRLA 3OCGA 4IACA 4D1XA 1PMEA 3EFWA 2WKMA 3FMMA 4APPA 1OUYA 3D2IA 2WIPA 3PIXA 4I5PA 5IH4A 2WQEA 4QO9A 2REIA 5ITAA 3TG1A 1WBWA 4NCTC 1GZOA 4ARKA 4CFMA 4D0WA 2ONLA 3CIKA 2GNHA 4G16A 4FG9A 3Q53A 4Q9SA 1NY3A 3NUYA 3TKHA 5AA8A 1SVEA 3BYMA 3HMPA 2NPQA 2YERA 4IX5A 4S31A 1XH7A 4C37A 4BVUA 4ZLZA 5HTCA 3GFWA 4PDOA 2GCDA 2R3QA 2YZAA 3BBWA 2QHNA 4JX3A 4U3ZA 3GBZA 4LOOA 2HW6A 3SAYA 3VW6A 5IDPA 2QO9A 1KSWA 2VTJA 2WTCA 2JKMA 4M14A 3VRYA 1JLUE 5HORA 1FVTA 2VTAA 2VO6A 4M66A 2VTHA 2GDOA 3DJ6A 5GHVA 4DINA 5KMKA 1YQJA 1WAKA 2GPHA 2GHGA 4B4LA 2P4IA 2Y7JA 3AGLA 4RWIA 3E88A 5J9YA 4FV0A 2G1TA 3N9XA 3IO7A 2WQNA 3C13A 3H0ZA 3HYHA 2VO0A 3IGOA 3DJ5A 4OT5A 4BDCA 4L3JA 4J97A 4ANBA 1E9HA 4ZSAA 3MVHA 2OXDA 2QG5A 1YXUA 2J0IA 1WBVA 3NZ0A 4PNIA 4X2GA 5DGZA 5L2QA 5IA4A 2FSOX 2UW3A 3ZBFA 2HCKA 4M12A 1W82A 2C5OA 3N51A 3ENHA 3QX4A 2WTJA 4K11A 4BI1A 3HA8A 3FKNA 3SRVB 4J53A 4F6UA 1NVSA 2FSTX 3EN9A 5A4TA 4L7SA 2EB3A 1GIHA 3PY1A 4K9YA 3EQIA 5C9CA 1O9UA 1ZOEA 4DFYA 2BROA 3W2SA 4BCPA 4BCIA 2VGPA 2FSMX 3OWPA 4MHAA 2IW8A 1UWHA 3VULA 4IVBA 1GZ8A 2WMWA 3UNZA 4J96A 2B9FA 3FMNA 2X6EA 3FQHA 4S34A 3D5XA 4EH2A 3DQXA 2I0EA 1Q97A 3VUHA 3R1SA 4L3LA 5JFWA 5IQCA 1QCFA 3O17A 5K5XA 3FL5A 4PMTA 4ZIMA 3DXNA 2OSCA 3SXSA 2WNTA 4MKCA 5CAUA 4YJPA 1Q8ZA 5CF5A 2BPMA 4ENYA 3PJ3A 4ZSJA 4Y95A 3LFBA 3ELJA 3MBLA 3OROA 3QD3A 3TKIA 3V04A 5CEMA 2CCHA 3A7IA 3DA6A 2IZSA 2WZJA 4E6CA 3S00A 5KMNA 5H2UA 3NIEA 5JEBA 3QA8A 4A7CA 4CGAA 2JKQA 3BWFA 1OPLA 4IQ6A 1MQBA 5IPJA 4C2WA 1IR3A 5CAVA 4OAUC 4AZEA 1WVYA 3FI4A 3ETAA 5ETCA 4USFA 4YJRA 3PLAE 5AR7A 2XIKA 3FUPA 2CN8A 3SQQA 2Z8CA 2XA4A 2X0GA 4EHVA 4XMOA 4BWPA 4MXAA 4BHNA 3UVRA 4R7BA 4R7HA 5J7BA 3U51A 3O2MA 4AFEA 4NJ3A 4ID7A 3V8SA 4ZLYA 4G9RA 4HCUA 2C6OA 5CNOA 3VWAA 5CY3A 2I6LA 3QCQA 4U40A 5AR3A 3OOMA 3V01A 2FA2A 4U0IA 3ZLSA 5L6OA 2UW6A 3TJCA 3V5TA 5M56A 3SGCA 4FA2A 4I0TA 5HEZA 5L4QA 2G2FA 2JEDA 5IUIA 5HIEA 3CGOA 3RAIA 5L8LA 4G1WA 1J7UA 2XKDA 5JQ8A 4GT5A 2Q83A 2HXLA 1PXOA 2DS1A 4IDTA 1OL2A 5CXZA 5BYLA 4GH2A 1RW8A 4CFXA 5BUJA 4BGGA 3BKBA 1WVWA 3NX8A 2OBJA 3LM5A 4HVIA 2OK1A 3G6GA 4DLJA 3WILA 3DKOA 3HVCA 2Y8OA 5E4HA 3FXXA 3UTOA 3QX2A 4O2PA 5IA2A 3OCSA 2XKFA 3CQWA 1IG1A 3A7JA 4HOKA 2WMVA 5K0KA 1ZMVA 4YZDA 2PMIA 4O83A 4R3RA 2ITYA 4PF4A 2HYYA 4MWHA 4RZWA 3S2PA 5GZ8A 1M17A 3OMVA 4O1PA 4QP8A 4BC6A 3P08A 3PXYA 5CT7A 5DLSA 3Q4CA 5KHXA 4IC7A 4KIOA 5AUXA 4AOTA 4IWDA 4WG5A 4BZOA 3ALNA 2VWWA 5ETAA 4ZEGA 3U55A 2OGVA 2P0CA 2PZIA 4FZ7A 4YZ9A 5LJJA 2PU8A 4QQTA 3MFTA 3F61A 3PPZA 4E26A 1UWJA 4EKLA 1XKKA 4RIYB 1IA8A 3EZRA 3FXZA 5EH0A 5JZJA 3CE3A 2BR1A 4QRCA 4GKIA 1QPEA 4AT3A 3E8DA 4U81A 2XP2A 5EQYA 2XJ2A 3VJNA 2UZDA 3PWYA 5C8KA 4MQ1A 4P2KA 4KKGA 3E8CA 4FNYA 4YTHA 4YU2A 3HECA 4ZTHA 4RG0A 4RFZA 3JUHA 3EIDA 4JRVA 5FTQA 4MX9A 4JAJA 2R3KA 2F7EE 3A4PA 5K3YA 3R2YA 4D58A 4G6OA 5AA9A 5CAQA 2JFMA 4EK5A 4ZY6A 4ACCA 3GC9A 2QNJA 2ITXA 3NYOA 4IX4A 3E87A 3R01A 5FUTA 4RQVA 3SA0A 3MYGA 3RAWA 3BHHA 2PVRA 4NIFB 4DG0E 5BX0A 2C68A 4PPBA 1JNKA 1STCE 3PP1A 3QZHA 4H05A 3QRUA 3F3TA 5LMBA 3ZM4A 3SX9A 2UW7A 3CTQA 4A4OA 5EQPA 3N4VA 3PTGA 3HMIA 2C4GA 3HZTA 1XH4A 2PK9A 4QMSA 3FC1X 3R21A 5BVKA 4C4IA 3RKBA 4QTCA 1W84A 2PMLX 4XJ0A 3HP2A 3FI8A 3LJ1A 5F95A 1U59A 4H3QA 4FKJA 4LMUA 4QYEA 4RVMA 4Y5HA 1YDTE 4CNHA 1G3NA 3W2CA 4OTGA 4EC9A 3QKMA 4R1YA 5DFPA 5FBNC 4EHEA 5CF8A 3TZ9A 3R9DA 1YOMA 2BRNA 2QONA 4X0MA 5TF9A 4PQNA 2P2HA 4EEVA 5ANGA 3FE3A 4DTAA 2B9HA 3FLQA 3CY2A 4JI9A 4MNFA 2V7OA 3KMMA 4O0SA 5CEOA 3PZHA 3DZOA 2QD9A 3ITZA 4YJUA 2GQGA 4S30A 1A48A 3R7YA 1Y8GA 2R9SA 1DAYA 4X6QC 3P79A 3L9LA 3KN6A 4CVAA 1SNUA 4FT9A 5ANJA 2PZRA 4GFMA 5GIPE 3ORPA 4WRGA 3R7VA 4BFMA 2PZ5A 5B7VA 3CKXA 3MH2A 3P4KA 5BNJA 3EN7A 4YHFA 1XH6A 5CAOA 3W8LA 2EWAA 2WGJA 3GCQA 3M42A 3LFNA 3CJFA 4MWIA 3OEFX 2WMSA 1GNGA 1XBBA 3QYWA 4YNOA 2WD1A 4EH5A 3RK7A 2YJSA 3PRFA 3QRJA 5B2LA 1M52A 4IANA 3BYOA 4CLIA 3UG1A 2RKUA 3DJ7A 3E7OA 4O7VA 3B8RA 2UZWE 4U8ZA 3PXKA 2OH0E 1Q8WA 4U6RA 4FVPA 3CXWA 4RZVA 1OBDA 4Z3VA 4OTIA 4FKOA 3UPXA 4BB4A 4BN1A 3R1NA 3GU7A 2PVYA 4FZ6A 4ANSA 3FBVA 1YWNA 2UZVA 3A8WA 3GU8A 4EK8A 4IFGA 3S0OA 2O2UA 4R7IA 4RC4A 4XS2A 4C3PA 2JKKA 4QYFA 2W1FA 4ALVA 2XEZA 1SM2A 5CT0A 4D5KA 2A2AA 2JIVA 1YDRE 4YC3A 3Q60A 2FUMA 2XKCA 5DH3A 3FLSA 3CQEA 4E6DA 4D2PA 5J9LA 3EFKA 2CGUA 3FHRA 4Y73A 2H8HA 4O0UA 3WIKA 2V55A 4CFVA 4WSYA 5E91A 3PG3A 4FOCA 4RIWA 4EJ7A 4XH6A 2G2HA 3NPCA 4FYNA 4B8MA 1QPJA 3FMHA 4FTUA 3ZZWA 1XR1A 3DKGA 4YJNA 3UC4A 3LFCA 4MTAA 4Z16A 1FBNA 4JXFA 3F6XA 3VS3A 4IAYA 3VJOA 4YC6A 3QUEA 3Q6WA 3LCOA 5GZ9A 2W7XA 2G2IA 2B52A 3LXNA 5IA5A 2J0MB 3ZH8A 3QKKA 3TZMA 2ITTA 1DAWA 1JKSA 5HE2A 3WF7A 3ZFXA 4FL1A 3DBQA 3U87A 5IISA 4FSMA 4ZZOA 2R2PA 3EQBA 4AGUA 5ANOA 2CKEA 5A4QA 5EDRA 4FZDB 5D12A 4F09A 3BLQA 1M2RA 2CNUA 1YXTA 1KE6A 3O23A 3KRRA 2GHLA 3QKLA 5DE2A 3GUBA 4CG9A 2C5YA 2RGPA 3NLBA 2ITNA 4AXAA 4FOBA 2C5VA 3QTUA 4AS0A 5FM3A 2YCQA 3VHEA 5E8UA 3QCSA 4CQEA 4ITHA 5FDXA 3NS9A 2PVLA 2E9NA 2WTKC 1TVOA 2YWVA 4CT2A 4FEVA 4YP8A 2R3RA 4AG8A 2PE1A 5EYKA 3OWKA 5AADA 2PUNA 4FTIA 5CU2A 1U4DA 2CSNA 2OIQA 4TTHB 3QQGA 2YFXA 4F0GA 2QOKA 4CLJA 2H96A 2X8DA 2VX0A 5CASA 2QURA 5A4EA 5DHJA 4W4YA 4M69A 4WUAA 5CSVA 3FKLA 3MY1A 5KUPA 2WIHA 2YITA 4YHTA 2YHVA 3L9PA 3KL8A 4O7NA 1P5EA 3TKUA 3COKA 3T9IA 3C1XA 2HIWA 3D7TB 4MQ2A 3WZUA 2C6EA 2W9ZB 4IWQA 5LQFA 4FV3A 4HJOA 3LCKA 3NUXA 4IIRA 4YTCA 5DRDA 4MYGA 2XVDA 4WD5A 4WIHA 4PTGA 2ITPA 3MJ2A 2VTSA 4MXZA 4U5JA 2YAAA 4YC8A 4R78A 5LVMA 1WMKA 3NCZA 4AOJA 1H25A 1UU3A 3H9FA 5A46A 3R02A 5EM5A 3RM7A 1QPCA 4XG3A 3OCTA 4L01A 2B53A 3ORXA 3UZTA 2ITVA 1BKXA 3QHWA 1W0XC 4LOQA 1Y91A 4G5PA 3HUBA 3VUTA 2ETRA 4FTRA 1W8CA 1H1PA 2VWIA 4FT0A 3TDWA 1P4FA 3MVJA 2FSLX 2VX1A 1J91A 2QLQA 2I0YA 4PV0A 2W99B 3UMWA 1RJBA 3EH9A 4J8MA 4BDKA 3BGQA 4U97A 4EOIA 4NK9A 4JDIA 5KCVA 1O6KA 3U4UA 3H9OA 3BU6A 3W2QA 3GC0A 3LHJA 1OMWA 4DFBA 2PUIA 1TQIA 5E90A 3AC1A 3E8EA 3IS5A 3NNVA 3W16A 5JFVA 1H24A 2QR7A 4JBQA 3R7UA 3DK7A 4JIKA 1UU7A 1ZY4A 3O71A 4UZDA 1K2PA 4TYIA 2E2BA 4O91A 3R7IA 2QO2A 4LUDA 2UW4A 2YJRA 5AR4A 3ZUTA 3DS6A 3FLWA 4BYIA 4O38A 4IBMA 4CYIA 4HVDA 3TZ7A 3OXIA 1OIUA 2YCRA 2J0LA 2Q0BA 3E92A 2JAMA 4CKRA 3I0QA 3POOA 4AW1A 1ZYJA 2PVHA 3E63A 4J7BA 2QG7A 4BDGA 5JFXA 3H4JA 5HG5A 4CFUA 4MBLA 3I4BA 3S95A 5FXSA 3PY3A 1JWHA 3TNIA 3NYXA 5CQWA 4UYAA 4FTAA 2A0CX 4DGOA 5A3XA 2J6MA 4DBNA 3HV4A 3FMKA 2R3HA 3Q5IA 4FMQA 3ZUVA 5J87A 2ERKA 2UZLA 1ND4A 4QPSA 1F5QA 1OKWA 3QTWA 3AT4A 3GC7A 4BI0A 4A9SA 4F0IA 2ZMCA 4O22A 3TT0A 4QTEA 1PW2A 1J1BA 2XNPA 4I1ZA 5JZNA 3TJDA 3F3VA 4XBUA 1KE5A 4G3EA 3HGKA 3NRMA 4TWPA 2V0DA 3I5ZA 4U80A 3O8UA 2G15A 5H9BA 2GSFA 3LM0A 2GFCA 1F0QA 2RG6A 4H3PA 3ZFYA 3V6RA 1UNLA 5AP2A 1L8TA 4Z7GA 1L3RE 4IVAA 3W32A 4W8DA 5A14A 5C27A 2VUWA 1OGUA 1PKDA 1PYEA 4FNWA 3UYSA 4D4VA 1ZOHA 3JVSA 4KSPA 5D7AA 3NNXA 4ASDA 3KC3A 4D2TA 1PYXA 3PA5A 3EQDA 4I4EA 4YR8A 4ZTNA 3HRCA 4FTCA 4B0GA 3QU0A 2FGIA 2ZJWA 5M57A 3HAVA 4FIHA 4FV2A 4WT6A 3VUKA 4FGBA 1BUHA 1KV1A 4XLVA 4O7LA 2UW0A 3Q52A 4OTRA 3PRIA 1XH9A 2YN8A 4Y46A 2HZ0A 4O84A 3I6UA 5HVYA 4O7WA 2Y0AA 3TCPA 1LR4A 3QQJA 2QU6A 2HXQA 2YISA 3FZOA 3KB7A 5J7HA 5CVHA 2QOIA 4FG8A 4MNEA 4RWKA 2EVAA 3R6XA 4C4JA 4UY9A 4OBQA 2F57A 3W8QA 5EQEA 4D9UA 5KBQA 2R3FA 4NTTA 3OWJA 3N4TA 3TL8A 3KMUA 3QRIA 4PPAA 4Y8DA 1J3HA 3ATTA 3DDPA 3KULB 3OXZA 2GHMA 5EM8A 4L6QA 3QQHA 3DBCA 5HE0A 3BHYA 5A6OA 5FXRA 4LRJA 4G6LA 4NM3A 3FI2A 3TWJA 5HI2A 2PVJA 5M08A 4OW8A 4FIEA 4YPSA 3A8XA 3IDCA 5IKWA 4AE6A 3KREA 3PJCA 3TM0A 1WBPA 2R5TA 3GGFA 3ORTA 3SD0A 2VNYA 4AGDA 4ITJA 1QL6A 4FV8A 3ENMA 3LFFA 3RHKA 1M14A 4IAZA 3C4EA 1DS5A 3HL7A 4MCVA 4A07A 2ETMA 4U44A 3BPRA 3VVHA 5I3RA 4BCOA 4FICA 3RZFA 4DH3A 2XJ0A 4DT8A 2Z7RA 1BI8A 4U7ZA 3BELA 4P5QA 2RIOA 4ZOGA 2C5NA 2IVTA 4RJ7A 5IQIA 4Q2AA 4IVDA 2QOFA 2VZ6A 3QTZA 3RNYA 3DLSA 3FZSA 2VWBA 3II5A 4JIAA 3RPRA 4BZDA 4KRCA 1I44A 5HVKA 1OIYA 3LQ8A 2EU9A 3MV5A 4O0XA 2IW6A 2VU3A 4C7TA 5CALA 3U54A 4UB7A 4BDJA 1H0WA 2BIYA 3Q9YA 4RWJA 3TN8A 4C58A 2JIIA 2RFSA 5T6KA 2XNGA 5TT7A 4Z55A 5B2MA 3UO4A 2F9GA 5AWMA 4DGLC 3QYZA 4YSJA 2C3JA 3K3JA 3P78A 3TV6A 4D2WA 3FQSA 2CLQA 4X2KA 2WQMA 3R22A 1OL6A 5CENA 3O51A 4DH1A 3W2OA 4FUXA 4EBVA 3JYAA 3MH1A 4V04A 5H3QA 1YWVA 4AACA 4QQCA 4RC2A 2QO7A 1Y57A 3Q4ZA 4FG7A 4RIXA 4A9RA 3R1QA 4PMSA 4RT7A 4GG7A 5HIBA 3U8WA 4BKYA 5C8MA 2UUEA 3FY0A 4D2VA 4GK3A 4IEBA 4FKGA 4GVJA 4I22A 4RRVA 4BDIA 2YA9A 3IPHA 4H1JA 5J8IA 5FTGA 3O96A 4MXYA 4QQ5A 2UZBA 5A4LA 4Z9LA 2BZHB 1Q24A 2E9UA 4KA3A 3A7FA 4LRKA 3SV0A 4F9CA 2BTRA 3ACKA 3NAXA 2BDWA 2XS0A 5M4FA 2VWYA 3DCVA 2V22A 4ZTSA 3R8PA 3DKFA 3UP7A 3QCXA 3VO3A 5JN2A 3ZLXA 4PP7A 4NL0A 1FQ1B 3I81A 3WF8A 5CZIA 2WPAA 2J90A 2I1MA 1R0EA 3EN5A 3F3UA 3JR1A 3G51A 2O5KA 4U41A 4E5WA 4L53A 2X39A 2WMAA 4DYMA 3KCKA 4L9IA 3V51A 4QTAA 1WFCA 5HU9A 4DN5A 4DFUA 3ACJA 2HWOA 2BHHA 5J5TA 4HPUE 2X7FA 3C4CA 5HHWA 4FL3A 3C5IA 4FV9A 3DAJA 1MQ4A 3CTHA 1BMKA 2I40A 4LGDA 1ZLTA 4JBPA 4YTFA 4EK6A 4I20A 5ACBC 2JGZA 3UC3A 1PMNA 4EHZA 4EZ5A 1YI4A 5LXMA 4ACHA 3DPKA 1R0PA 4ZSGA 3F7ZA 4EH4A 5HO7A 2J2IB 3VF9A 3A7HA 3GEQA 2C6MA 2PPQA 5BVDA 4AZVA 5BVOA 2WEVA 3NNUA 4BDDA 5A54A 2HENA 1P4OA 2PZYA 2QOHA 3NW6A 1FGIA 4JR7A 4LQMA 3C0GA 4V0GA 3SC1A 3VQUA 3MPTA 4LGHA 3ODZX 3F9NA 1NA7A 5JGAA 1OKYA 1UVRA 4GJ2A 5IMXA 3D7ZA 3UOJA 3F5PA 2ZV9A 4UZHA 5HNIX 5KHWA 1XBCA 2W1GA 3JS2A 4AN9A 4C0TA 4DH5A 5HG8A 4JQEA 1CMKE 4G3GA 4FL2A 4P5ZA 3UDBA 3JXWA 2XNNA 1E1XA 4FT5A 4WG3A 4X2FA 3C5UA 3WIGA 4IAFA 4B8LA 4UMQA 2WXVA 3TUCA 1BL6A 1T45A 3ORKA 5E8TA 2PMOX 2QU5A 1M7QA 5L2TA 1B38A 5HBEA 2Y4IB 5AP3A 4BIBA 4C4HA 3LZBA 1FMOE 4G3FA 5EG3A 4ITIA 4II5A 4JRNA 5ANEA 5EK7A 5HGIA 3NYVA 5E92A 4E93A 2QODA 5CXHA 3DK6A 3QD2B 4IWPA 4YGAA 3VW8A 3NW7A 4AGWA 3IK3A 3LOKA 4FKLA 4D0XA 2F2UA 4D2RA 2BAJA 4J95A 3UIUA 4NIFA 1AQ1A 2WEIA 4IAAA 3VBTA 4XRLA 5FRIA 4IVCA 2JC6A 4G3DA 3V8WA 3PVUA 4FYOA 4H3BA 2ITZA 4IC8A 1KWPA 5LVPA 2BFXA 1KE8A 2O64A 2W1EA 2XJ1A 3OY3A 2ETKA 3UQGA 4EOQA 4ZTMA 1ZZLA 3PE2A 2CGWA 1YWRA 4F9WA 5AV0A 2ZM3A 1PXPA 5KNJA 3QGYA 4JVGA 4EONA 1U5RA 4BDAA 1K3AA 2WMBA 4DFLA 2C1BA 4I6FA 4IM0A 1QPDA 2SRCA 3RALA 3I0OA 4OTPA 4BYJA 4QP6A 2Z60A 4LI5A 4NM7A 2IZRA 4CRSA 3K5VA 1BX6A 2W17A 4Y85A 5IU2A 3Q96A 1H1QA 2W4OA 4HNIA 4O0VA 4PX6A 5CQUA 5LVOA 4ZXTA 1LEZA 1CKJA 3TUDA 3OP5A 4K18A 2IN6A 4DCEA 1J7IA 2PSQA 4FI1A 4YJSA 5F20A 3AD6A 2PY3A 3L8XA 3V5JA 2WTKB 3WI6A 3GNIB 3GCSA 4XYFA 2PHKA 4BCFA 3UYTA 3NAYA 3TXOA 4GT4A 4A4XA 3LCTA 4UXQA 5TOZA 4K0YA 5IMEA 1OIQA 1PMUA 2AYPA 2OIDA 3C0HA 4FT7A 3ZC6A 4YBJA 2UW9A 5KX8A 3NWWA 5AUTA 4AA4A 3FAAA 1H1WA 3NUUA 3EN6A 3G6HA 5J79A 1VYZA 3LFSA 3ZMMA 5LCKA 3TNWA 2CLXA 3S1HA 5M06A 5AR2A 3QQKA 4EI4A 5AAEA 3AT3A 5HICA 4EOPA 3VBYA 1JKTA 5KKRB 3QXOA 3EHAA 5E8VA 5M4IA 1SNXA 5A6NA 3MIYA 4PMPA 3DY7A 4E6QA 5AM6A 3ULZA 4FKVA 2B55A 3ZRMA 2X6DA 3QA0A 5ETIA 2LAVA 5KMLA 2UV2A 1Q61A 3ZDUA 4D1ZA 4PPCA 4BL1A 1JSTA 2UVXA 2IO6A 4YMJA 1NW1A 4XG6A 3R71A 3HV3A 4KABA 3BGZA 4HPTE 2H9VA 3QRKA 2VTQA 3RAHA 3MI9A 4RX9A 3THBA 3VUMA 3ZEPA 4CZTA 4A9TA 1R3CA 3KCFA 5A4CA 4FEXA 4O0YA 3TV4A 1X8BA 4L42A 3GB2A 4OTQA 4QTBA 3ZSIA 4YSMA 5E1EA 4DGMA 5FP6A 3KFAA 4E5AX 3F7WA 3SOCA 3EJ1A 4CMTA 2CCIA 2XK6A 3FMJA 1QMZA 2XK4A 5DEWA 3LCSA 4EOLA 3WF5A 4DFNA 3HKOA 3D5UA 5JT2A 4K77A 4LGGA 4AT4A 3CLYA 2XB7A 4PUZA 4QQJA 4AW5A 2IVSA 3JVRA 2WTVA 2PZPA 4GV1A 4RJ4A 2C30A 5I9UA 5K9IA 1YOLA 3NMUF 4TT7A 1OI9A 2C47A 3HA6A 3LXPA 4M0YA 2H6DA 3GP0A 3WE4A 3FKOA 2X2LA 3NEWA 5CU6A 4L46A 5IQHA 2OW3A 3G15A 3NGAA 3ET7A 1UKIA 3G90X 4TW9A 4UMRA 1U54A 3A99A 4KKHA 4LMNA 4DEGA 2P55A 1H1SA 3D83A 3E8NA 3GCUA 3R7GA 2UZTA 4G17A 4L68A 5DT3A 1MRYA 2ZMDA 1YI6A 2BHEA 4QMXA 2ZV8A 3E3BX 3W2RA 4HNFA 4MF0A 2O3PA 1J7LA 1Q3DA 3R8ZA 2R7IA 4ASZA 4FODA 3ROYA 4A9UA 3KXNA 3HX4A 5CI7A 3VHKA 4I92A 1ZY5A 4B9DA 2XNBA 3CD8A 4C3RA 4EH8A 4IZYA 4ENXA 4X2NA 5BQ0A 2NP8A 2XUUA 4OBPA 2UVZA 1UKHA 3BCEA 4I6QA 3PXFA 2JKOA 4OT6A 4PMMA 5KMJA 4XP3A 4M67A 4X3FC 4DE4A 3PPJA 4GUBA 3WARA 3EL8A 3WZJA 4HYIA 4X7QA 4O2ZA 5AMNA 5B2KA 2GTMA 4QPAA 4D1SA 4DGGA 4C3FA 3AMAA 3VBWA 4N6YA 3KMWA 3VBXA 2XF0A 2WQOA 4XG7A 5HD4A 3RP9A 5HX6A 2PVMA 1Q8UA 2NO3A 4QMUA 3QC4A 5EKOA 3R9HA 2Z7SA 3ZOSA 3D7TA 5HLWA 2BIKB 3K5UA 4X3JA 5M4UA 2XM8A 3WYYA 4XEYA 2Z02A 1ERKA 3R2BA 2VAGA 3R63A 4IZ7A 2HW7A 1JQHA 4XRJA 5DR2A 4J52A 5D1JA 3WOWA 3WYXA 2J4ZA 3OC1A 2IW9A 2QKWB 3PWDA 4MD8E 3SG8A 3LQ3A 4I5MA 4OTHA 3WZEA 2GU8A 3G2FA 4JOAA 4YO4A 2A19B 3R00A 4U79A 4RGJA 3OBJA 4BKJA 1G8AA 3RZBA 1AGWA 3F2RA 1KE9A 3L1SA 4HGTA 3VS1A 4L43A 4RLKA 4ZJJA 3UO5A 4PP9A 3HLLA 4C34A 3QZGA 1KE7A 2ACXA 3BLRA 1VR2A 2X7OA 4O0RA 5DT4A 5HG7A 3KVWA 2C6DA 3OG7A 3HUCA 4I0SA 4GMYA 2PL0A 3DFAA 4EORA 3LMHA 4NYEA 2AC5A 3NUSA 3P7BA 2GFSA 3ERKA 3ZHPC 1UV5A 4R6VA 5E8SA 3PIZA 2ITWA 5EM7A 2HY81 3AT2A 3CKWA 1YHSA 3T8OA 5LMKA 2C6TA 4M13A 2BZIB 3RHXA 3R9OA 3AQVA 4LUEA 4GYIA 2VWUA 4FZAB 4I93A 2RSVA 1SVGA 4F9BA 2VO3A 3QQFA 4F0FA 3DU8A 4YTIA 4ASXA 4DEHA 1CSNA 2X7GA 2OZAA 2UW5A 5AV2A 4FNXA 1ZYLA 4IB1A 5F1ZA 3D5WA 3VNTA 5TO8A 2VTNA 4AU8A 1ZMUA 4F7LA 3QUPA 4YZBA 4R5YA 2XK3A 5EDQA 4PNKA 3GU6A 2FVDA 3DBEA 1ZRZA 3FYJX 1GY3A 3V5PA 2XBJA 1YHVA 3DTWA 3HMMA 3LCDA 5CSWA 1YXXA 4XCUA 3RGFA 4MBIA 3RK5A 4A9YA 3IW5A 3BYUA 4JX7A 4EK4A 1OVEA 2I0HA 1YDSE 4FZFB 4BR3A 4NW5A 4XBRA 1GAGA 3GC8A 3A7GA 4HGEA 4IXPA 3EKNA 3EKKA 3ORZA 3PYYA 4AP7A 2A27A 4FV5A 2XIYA 4M15A 3PJ1A 2QOCA 4A4LA 4IZAA 5I9XA 1BYGA 1Q4LA 4FIJA 3HV7A 4TYEA 3ZZEA 3MB6A 3CC6A 4BBEA 3RVGA 4BHZA 3RINA 3MVLA 5AP0A 3DB6A 2EUFB 4EHGA 3QL8A 3T3UA 4BBFA 3GQLA 3OBGA 2FO0A 5LOHA 1ZOGA 1REJA 2JD5A 4PY1A 5JQ5A 4R8QA 2J0KA 4GUEA 5L3AA 1JVPP 4Y72A 2F7XE 5AEPA 4H1MA 3O0GA 2VWZA 3LE6A 4RJ8A 2IVUA 2R4BA 4E7WA 4IB5A 4E4XA 3BV3A 4YNEA 3JPVA 3SOAA 4BCNA 5FEQA 1F3MC 3RWPA 4IZ5A 2C0TA 1M2PA 1VJYA 5DYJA 5HNGA 4W9XA 2Z7QA 5IQFA 1YRPA 3QLGA 3OCBA 2GQSA 2G9XA 3HMOA 4G5JA 1GJOA 2W1HA 1YI3A 5JRSA 3Q3BA 4J1RA 5FWKK 4EOSA 4AWIA 1UNGA 3FZRA 3PIYA 3PSDA 5ACKA 3W33A 4CQGA 1PXIA 2R3JA 1R39A 5AUWA 4ANMA 5CEKA 4KIKB 4IH8A 3DKCA 3MESA 4CT1A 5L8JA 2CN5A 4FKIA 4XV9A 5JGBA 2YCFA 1MP8A 3E62A 3FMLA 3A62A 3MN3A 3S3IA 5C1QB 2YM7A 2PTKA 3I60A 4NM0A 4RSSA 3W2PA 3OHTA 5M53A 4CV9A 4BTJA 4CTBA 2X4ZA 4O96A 1OL1A 1H26A 4JDJA 3AOXA 2WTIA 4J8NA 3A2CA 4AQCA 3NVKI 2PMNX 1P14A 3R8UA 4AF3A 1YXSA 4UXLA 2RFNA 4O81A 4Y83A 5G1XA 3ORIA 1SYKA 3SVVA 2CKPA 3PJ8A 5C26A 3K2LA
chains in the Genus database with same CATH superfamily
4DEDA 2YEXA 3PA4A 4O7RA 4NW6A 2C3KA 2XYNA 2W5BA 1OECA 2JITA 2X2KA 2YM3A 3BX5A 3JY9A 4EKKA 5BVNA 4F63A 4JG8A 4R77A 4EK3A 3D94A 2HK5A 3KA0A 5CZHA 1V0PA 3AGMA 1T46A 4LV8A 4TYHA 4FTLA 4AAAA 3NR9A 2X4FA 1S9IA 1UA2A 2RG5A 4XV3A 2XIZA 3UNKA 5HCXA 4DA5A 4FNZA 4I3ZA 2GS7A 3KQ7A 4AUAA 3B2TA 3ZO3A 3O50A 4J99A 3MJ1A 3KY2A 3K3IA 4JG7A 5ANIA 3F3ZA 4R1VA 2VTMA 4NM5A 3IW7A 3ZDIA 4CZUA 2C6IA 3VC4A 4EOOA 2R0IA 3QD0A 2X8EA 3ZSHA 4AW0A 3KK8A 3OVVA 5GJFA 5AJQA 3HDNA 4V05A 4D4YA 4QP4A 3U9NA 4FVRA 2ESMA 5EYMA 4YJVA 4DF3A 2PVNA 2QR8A 4I5HA 2UZOA 2XM9A 4X3FA 5C4LA 4D55A 1SVHA 2YIWA 3GOKA 4IE9A 3OEZA 1P2AA 4K33A 3RCDA 3LLTA 3KRLA 2J51A 4XG4A 2QHMA 1S9JA 2C6KA 3FPQA 3QTIA 4BGHA 4C8BA 4EBWA 3RAKA 4EH9A 4M8TA 3GQIA 4GU6A 3VS6A 5IZFA 3WZDA 4DG2E 4QMQA 4NKSA 5AFVA 2GNGA 3FYKX 2DQ7X 3A61A 3BV2A 1MRVA 5EOBA 2WAJA 4DGNA 5K4IA 2YCSA 1U46A 2WU6A 2W1IA 4FV7A 2IJMA 5D11A 4QDVA 2YM4A 1U5QA 2B9IA 3F69A 4FSTA 4HYSA 3R9NA 3REPA 1OPJA 3R28A 4JQ7A 2YIXA 3COHA 5D7VA 3CY3A 2BRHA 5HO8A 4BKZA 4O7ZA 1PXMA 3DDQA 3MGYA 3NNWA 4FUYA 4QDEA 4YO6A 1PXJA 2VD5A 4CMOA 5E8WA 2XANA 2A4LA 5C4KA 3OW3A 5HVJA 5IF1A 4BCKA 4IM3A 3F82A 4RFMA 4RQKA 3NUNA 5EW8A 3AMYA 4O21A 2BAKA 3BE2A 1JOWB 5DNRA 4UN0C 3MH3A 4TNDA 3HEGA 5BUEA 2QLUA 5LWNA 2I7QA 4EJNA 4DLIA 4JDHA 3DZQA 2JDVA 3G9NA 3QFVA 4GG5A 4ZAUA 4F08A 3Q2JA 4KBKA 3C9WA 1R1WA 3MA3A 2Y6MA 3TIYA 2XALA 4C57A 2W96B 5IEVA 5KMMA 1W2DA 4D4SA 4FTNA 3HNGA 1LP4A 2KTYA 4OGRA 5HE1A 3SHEA 2YM6A 1MRUA 4QP3A 3LW0A 4LOPA 3QRTA 2JAVA 1FMKA 3P7CA 4PL3A 4QNAA 3IONA 4QMYA 4F7NA 3GCPA 4AXDA 4BJJB 1URWA 1LPUA 3UIBA 4KB8A 3TZ8A 2WOUA 4E8AA 3NVMB 2F2CB 2DWBA 2CKOA 4TXCA 5CSHA 5IG1A 5CU3A 5EI8A 3WZKA 4FJVA 3COIA 3UZPA 3ORMA 3V5LA 5HE3A 4E4MA 3C51A 4L45A 4O0WA 3VRZA 2EXMA 5I9ZA 3L9NA 4BGQA 3ZBXA 1G5SA 3Q9XA 3UJGA 2WMQA 4BDBA 4CSVA 3ZC5A 2X9FA 4FT3A 3UO6A 3UZRA 2VNWA 4WOVA 3EQPA 3OOGA 3L9MA 4M69B 1PXLA 4O27B 3UVQA 2ITQA 4BCJA 4FV6A 4QMTA 2W5HA 4CKJA 4GU9A 5IH6A 4BCHA 3SRVA 2W1CA 1ATPE 3AD4A 3C4ZA 4IFCA 5T68A 3UOLA 5CYIA 2VV9A 4FVQA 3OTVA 2VGOA 4IHPA 3DK3A 3TMOA 1TZDA 3KRXA 4GFOA 3ZO1A 5I3OA 4JG6A 5C01A 2C0OA 2YDJA 2UZEA 3QBNA 3D4QA 3EYGA 1GZKA 3ZUUA 3ZXTA 4EL9A 2B7AA 1PJKA 3AC2A 3GXLA 5EW9A 4QT1A 3RNIA 4WG4A 4CFWA 4UALA 1A9UA 3QWKA 1ZYCA 1Z5MA 4MH7A 4ACMA 5E9EA 4KIQA 3W1FA 1PRYA 3E7VA 1CKPA 4DTKA 3MFUA 2FB8A 3ZO2A 2UVYA 4MUQA 3W55A 2J5EA 2GNLA 4KBAA 3KXMA 3HV6A 4NTSA 4H39A 2W05A 1OPKA 3DBDA 4D2SA 2QQ7A 3AC8A 1A06A 2ZM4A 4UWYA 1H28A 2Z7LA 4M7IA 4RVTA 4ONAA 5AM7A 2OJGA 3QD4A 2B54A 1OL7A 4EYJA 4KINA 1IA9A 5GINE 2VO7A 2W1ZA 3Q9WA 5AV1A 5HU3A 2IZTA 3VF8A 4TYJA 2GNJA 3UG2A 4ALWA 2NRYA 3R8MA 4RJ3A 2ERZE 2R64A 3IQ7A 3P9JA 4RVLA 3AC5A 4WNPA 1JSUA 5DN3A 3VN9A 5DIAA 5FP5A 4OTWA 1H4LA 4F70A 2YIQA 3MY5A 3I5NA 1AD5A 1EH4A 5DR6A 2XH5A 4U3YA 5J95A 1M7NA 4C2VA 3Q4TA 4LFIA 1MUOA 5HX8A 2CHLA 4FK6A 3AXWA 5ANKA 3BEGA 5HG9A 4C38A 5HNBA 5C03A 4QMWA 3ZFMA 4E4LA 3FEGA 2YACA 3BHUA 5AP7A 4GRBA 3AC4A 5K4JA 3PVGA 3L8PA 3BL9A 3I6WA 3DQWA 5IA0A 3V5WA 5D9HA 4CD0A 3COMA 5H8BA 3MTFA 1IASA 4QP9A 3QTRA 1PXNA 2X8IA 4ANOA 5AAGA 3W18A 3IG7A 3MWUA 4ZLOA 3W10A 2DYLA 4XP2A 2QI8A 4AZWA 5KZ0A 1BI7A 2VN9A 4NT4A 1UU9A 4Y5QA 4AZSA 4TWOA 4O7TA 4EWHA 2F7ZE 4ZP5A 5CX9A 3QGWA 1PKGA 1Q8TA 2V5QA 3Q5ZA 1DI8A 5CSPA 1Q41A 4WNOA 4FSRA 3BBTB 4B7TA 3D0EA 3PA3A 4QTDA 4EUTA 1E1VA 3EFLA 1H0VA 4RFYA 4EH6A 4FIFA 5BUIA 2JDOA 2RF9A 4UMTA 4RLLA 5CSXA 3F5GA 5F94A 3U9CA 4CTCA 1JKLA 3ZONA 1CTPE 5CVGA 4UYNA 3LFQA 3PXZA 3EWHA 3TTIA 4AQKA 3F88A 2LGCA 3Q4UA 2VTLA 5B0XA 4QMPA 4P90A 2BILB 5DEYA 1Q8YA 3V5QA 4AFJA 3MPAA 2BUJA 3CPCA 3G33A 3KF7A 4I4FA 4O4FA 3DXPA 5AX9A 4GCJA 4NSTA 4F4PA 2BKZA 4EOKA 3VS4A 2XRUA 4JR3A 3C0IA 2O63A 3KRWA 4BDFA 4FKQA 5HD7A 5K5NA 4JBOA 3ZEWA 3W0MA 5CVFA 3MPMA 3BU5A 2OFUA 2ZOQA 3VS5A 3GT8A 4OBOA 4TPTA 1Z57A 3D14A 3R04A 3K54A 2V62A 4PL5A 1WVXA 5G6VA 4BTKA 5T3QA 3NSZA 2J5FA 2UW8A 1WZYA 4O6LA 3FPMA 1ZXEA 3CEKA 5TKDA 3RI1A 3ORLA 3UMXA 4C02A 5AR8A 3QAME 4RJ6A 5J5SA 3H3CA 5I0BA 3KGAA 3KVXA 2ZV7A 4HGLA 3OTUA 4K2RA 4QYYA 5HLPA 3UODA 2BRBA 5JKGA 3FZTA 1KV2A 4JAIA 4GIHA 4RIYA 3KXHA 4IMYA 3P1AA 3KRJA 3DOGA 4TKSA 4ZMEA 2HZNA 3A4OX 4N4SA 5AUUA 5JRQA 2ITOA 3FI3A 3TNQB 4DT9A 4UMPA 5CANA 4PDYA 2XIXA 4E4NA 5F9EA 2BRMA 1H8FA 3FXWA 4QMLA 4HCVA 4MNEB 3UOHA 2W4KA 1XHAA 4N70A 4KWPA 5AV4A 5AIRA 4BDEA 2W9FB 2QOQA 3D15A 3PSCA 3RCJA 3O8TA 4EOMA 4EUUA 4O86A 4HVGA 4LYNA 3TI1A 4V01A 2JDTA 2PWLA 3IECA 4WA9A 3FY2A 5FG8A 1TFFA 3HMNA 2XYUA 4GFGA 3E3PA 5LMKC 4WRSA 4XV1A 4UBAA 5KBRA 2IG7A 4HVSA 5CEQA 3U6JA 4JS8A 5AIKA 3D5VA 5E1SA 4CKIA 3LQ5A 2BZKB 3CTJA 4GT3A 2ZM1A 4FKUA 2J50A 3MDYA 4P4CA 2C6LA 2OZOA 1XWSA 4EC8A 2XK9A 3JY0A 5J1WA 1DM2A 2VTIA 4FTQA 2GS2A 3E64A 3EB0A 4UV0A 4BCGA 2CNQA 1CDKA 1ZZ2A 2CNVA 4KKEA 4RJ5A 3DBFA 4C4GA 2Y6OA 5DR9A 3LMIA 4WUNA 4QMVA 3QC9A 4GIIA 2OG8A 3G5DA 4ZZMA 4DFXE 3PXQA 3RM6A 4FF8A 4O6EA 3VBQA 3EQFA 2R3LA 4QP1A 4FSWA 3EQGA 5AX3A 2FH9A 3FZPA 2IPXA 4GK4A 1IAHA 4RX5A 4CFFA 2YIYA 4F9AA 5LCJA 4IX3A 2CJMA 3KK9A 3RPSA 4I94A 2WHBA 2O0UA 2YDIA 5AP4A 5GZAA 3SXFA 3TDVA 1H1RA 4EQMA 3NUAA 4AX8A 3HP5A 3LVPA 2C0IA 3FWQA 4M97A 3BU3A 4E5BA 4AW2A 4M0ZA 4DFZE 3RTPA 4CCUA 2WU7A 3GI3A 5HZNA 4BCMA 3LIJA 3I7CA 3OFMA 4I6HA 5TR6A 2ZB1A 4G31A 5L8KA 3BI6A 1ZYDA 2A1AB 4XG8A 3LFDA 2WMRA 3HRBA 3EQHA 5EM6A 2QVSE 5L2IA 5CNNA 4LL0A 2R0UA 3QCYA 4RIXB 5JSMA 3NYNA 3HRFA 4TZRA 1RQQA 3EOCA 2PE2A 2QC6A 3DLZA 2XK7A 3MSSA 3KEXA 2BAQA 5TE0A 4BCQA 4GS6A 4IJPA 4F99A 3ID6C 4DEEA 3DGKA 4E20A 4FRFA 4F9YA 3TEIA 1FPUA 1OB3A 3AMBA 3FL4A 3LPBA 4M68A 4ZTLA 4C4EA 3PPKA 3W0OA 3PLSA 2XCKA 5LMAA 1H08A 3Q2MA 5DG5A 5M55A 4KAOA 4G6NA 1IAJA 3AC3A 1HCKA 2R3OA 4W4WA 4XHKB 4XP0A 4PL4A 3BGPA 3WBLA 4X21A 2YABA 2W0JA 3IDBA 5LVNA 3A60A 3O7LD 2XZSA 3PUFC 3TV7A 5KZIA 4FIIA 3UIMA 2KULA 3KKVA 4R3CA 4FTTA 3V8TA 3EZVA 5F4NA 3SDJA 2BDJA 4OLIA 1KOBA 2HOGA 3EL7A 1Z9XA 4Z7HA 5IH5A 1W2FA 1SMHA 2E9VA 4FTMA 5CU4A 4C33A 4F64A 3ZO4A 4BTMA 5IQEA 2QKRA 3SW4A 1ZWSA 4ANQA 4G3CA 4H58A 5I4NA 1PY5A 4JLCA 4F78A 2BVAA 3OF0A 4OAVB 2GNFA 4TWCA 2WOTA 4N57A 4EH7A 2ZV2A 4EQCA 4QD6A 5AP1A 2QOBA 3Q6UA 4ZS0A 5JFSA 3PFYA 4V0GB 4ANLA 2W5AA 3BQCA 4ZJVA 5L2SA 2YM5A 2X2MA 5DOSA 4CFNA 4UWBA 5DBXA 3FSKA 1ZMWA 4EZ7A 5AP5A 4ERKA 2GTNA 2X81A 2BKKA 3VAPA 3CBLA 3RBWA 5DT0A 4RA4A 3TNHA 5BPYA 3SW7A 2HZIA 4S2ZA 3FZ1A 3BEAA 3TACA 1B6CB 2IZUA 3R30A 3U6HA 3I7BA 3ZLYA 4O82A 4FKSA 4NWMA 5CWZA 1OGYA 5CLPA 4ASEA 4MD9E 5IDNA 3LKMA 2JBPA 3F2AA 2OIBA 1O6YA 1G8SA 2CMWA 4K1BA 2VRXA 4TYGA 4APCA 5DMZA 4YZMA 3ZU7A 5HBHA 5EI2A 5KO1A 4MVFA 5EI6A 4PTCA 4N0SA 2PULA 3N4UA 4GKHA 3OT3A 4ZTQA 3DXQA 1FOTA 4FE2A 5HO6A 2OFVA 2Y4PA 4HZRA 4KIKA 5CF6A 4I6LA 4WBOA 4WSQA 4QP2A 4BIDA 4TWNA 3EMGA 4FR4A 3QWJA 2RFEA 4LG4A 2R7BA 4I23A 1ZARA 3OZ6A 2YWPA 4QYGA 3E93A 2YAKA 3DFCB 3PVBA 1W83A 4D5HA 3IW8A 3SXRA 4BHZA 4C35A 1TQPA 4X6RA 4NCTA 3ROCA 4BBMA 3GU5A 1OKVA 4BWXA 4BY9E 3LXLA 1CKIA 1GIIA 5AUYA 4MAOA 1TQMA 4WKQA 1OITA 2QOLA 3MB7A 4IB0A 3CGFA 4CV8A 2WMTA 3BLAA 5AUZA 3VS2A 2Q0NA 3G0FA 2O65A 2OKRA 3UQFA 1V0BA 4P7EA 4OTFA 5BV3A 4I6BA 1XH5A 4WO5A 3MIAA 3GVUA 1Y8YA 1OM1A 4C62A 4IJ9A 5IUGA 2J9MA 5KMIA 4DDIA 1JSVA 3EYHA 3IGGA 3GCVA 3M1SA 2ZAZA 4PWNA 2C3LA 2NNWB 1PXKA 1LEWA 2BFYA 2VWXA 4FGRA 5HIDA 4F7JA 3ZYAA 3ZM9A 3IKAA 2WMXA 4FTOA 3P7AA 4ZJIA 2GNIA 2WO6A 4L3PA 1YOJA 3NIZA 3HDMA 3IOKA 3BLHA 4QMNA 3R8LA 1NVRA 4FSNA 3EQCA 4DCAA 2ZYBA 2ZB0A 4TY1A 5HOAA 3Q04A 2BRGA 3U4WA 4CCBA 5EYDA 4JJRA 2XK8A 1GIJA 3QQLA 1WBSA 3CPBA 4GVAA 1PF8A 3LMGA 3IW6A 4UWCA 5DPVA 4QMMA 1WCCA 5CU0A 1WBNA 2BALA 3GOPA 3O8PA 3H30A 3UNJA 4E73A 4YURA 3SG9A 3ZXZA 3KN5A 2XEYA 2AUHA 3MH0A 2OO8X 3KXGA 2X1NA 5EKNA 4I24A 2WQBA 2BDFA 3NUPA 3QF9A 3MW1A 3OUKA 4ZZNA 1OL5A 4BRXA 4XLIA 3OS3A 1V1KA 4IW0A 1W7HA 2DUVA 5I5ZA 4FBXA 4M84A 1H27A 1Y6BA 5DA3A 5I9VA 1XO2B 1NT2A 4AXCA 4D28A 3L8VA 1H01A 5IQBA 4XG2A 1OZ1A 2XMYA 2Y4IC 4HW7A 5CF4A 3Q9ZA 1J1CA 3O7LB 3D2KA 4FKRA 2XNMA 5DWRA 2OH4A 3F2NA 4I5CA 4U9AA 3ANQA 4FTJA 5BMMA 3NW5A 2B9JA 2QOOA 4A06A 3DTCA 1XQZA 4KSQA 4HYUA 5CI6A 3V3VA 1M2QA 5DVRA 5LVLA 3RMFA 3CR0A 4W8EA 5HCZA 2VTRA 3HV5A 4W4VA 1FGKA 4EH3A 5FDPA 3MVMA 3SLSA 2FYSA 2NRUA 2OXXA 4FSYA 4S33A 4XNEA 5JH6A 3CS9A 4MF1A 5CEIA 3GU4A 3LFAA 1HOWA 4LM5A 4O0TA 4U45A 1KUTA 3C4WA 4DG3E 2YIRA 3AD5A 1RDQE 3FV8A 4CMUA 3KU2A 5HKMA 3OUNB 4GL9A 5JK3A 4BI2A 5IQGA 1U54B 2C69A 2VTOA 4PTEA 4YZNA 3R9RA 4EWQA 2HZ4A 4LV5A 2ZDTA 4CEGA 1OIRA 1REKA 3G0EA 2RL5A 4RX7A 5FLFA 3ULIA 3BIZA 4ZY4A 3WF6A 4YLKA 3QTXA 2XNEA 3NCGA 4W4XA 4I0RA 2A98A 4RX8A 2YLFA 3D9VA 4IAKA 1UU8A 5M51A 2BMCA 4DTBA 2J7TA 5GJGA 2C3IB 5BYYA 3F5UA 3T9TA 1IEPA 4F1OA 3PVWA 1XH8A 4RBLA 4NUSA 2B0QA 3AKJA 5GJDA 5J9ZA 3M11A 3UVPA 3B8QA 3CCNA 1XMLA 2XIRA 2HWPA 2OWBA 4IAIA 5JMSA 3PUPA 5FTOA 2OJ9A 3KULA 4ZSLA 2O8YA 3V6SA 4DH8A 4ZS4A 4NFNA 3IW4A 3R73A 4MXCA 1JBPE 4JNWA 4YZCA 5L2WA 4DAWA 2ZVAA 3UOKA 3MTLA 3VUGA 3RPYA 1LUFA 4XUFA 1NVQA 4AA5A 2XCHA 4ACDA 5CTPA 2CKQA 2PYWA 2YM8A 4WNMA 5ETFA 3PG1A 4OUCA 1JPAA 5ANDA 4NJDA 4G34A 5I9WA 2RFDA 5AR5A 5KKRC 3BYSA 3AKKA 5EHOA 4XV2A 1YW2A 3QXPA 4YHJA 4ERWA 4TL0A 3P0MA 4DHJA 4IX6A 3P86A 4FEUA 3R1YA 3IDPA 4N6ZA 3CJGA 3FMDA 1OKZA 4AZFA 4L8MA 3F3WA 2OICA 4KRDA 2W1DA 1GZNA 4C36A 3QTSA 5BVEA 3FDNA 3FJQE 4QOXA 4EOJA 4L00A 2YLEA 2W06A 4AAYA 4WHZA 2OI4X 3UE4A 2XBAA 3GENA 4EQUA 3QALE 4F6WA 5BMSA 2BZJA 5EYCA 3RWQA 2VTTA 4NKAA 2OJFE 4NZWB 4AGCA 3H9RA 4BIEA 4EZ3A 5IUHA 1OBGA 4DBXA 4GEOA 2PUUA 2WFYA 4L7FA 4USDA 4AN2A 4BICA 2X0PA 5KE0A 1BL7A 1K9AA 4C59A 4O1OA 2B4SB 5HCYA 5AV3A 3AG9A 4XOZA 5IEXA 2CGVA 4QMZA 3L8SA 3U6IA 3ALOA 3QTQA 4KNBA 3HAMA 2ONLC 2IVVA 4UMUA 4MEDA 4S32A 2BCJA 1FVRA 4USEA 1SZMA 4I21A 1R78A 4RIOA 2CDZA 4E3CA 5M09A 4PRJA 4FK3A 4NEUA 4Q9ZA 4Q5EA 4FKPA 4BWKA 4FV1A 4R3PA 2EXEA 4GK2A 1VYWA 3VS0A 3ZS5A 4F1MA 1IRKA 2R3PA 3B2WA 3PP0A 4FIGA 5FGKA 4AE9A 4XOYA 4ANNA 3BWJA 2AC3A 3UQCA 4ZK5A 4IADA 5EFQA 3R8VA 2OZAB 5EW3A 3EN4A 3RPOA 4F65A 3F66A 5AP6A 4FV4A 1YVJA 3OWLA 3LJ0A 3CD3A 1VEBA 3LAUA 3M2WA 3BE9A 4IM2A 4GJ3A 2JLDA 2WMUA 3TTJA 1JAMA 4MXOA 3TIZA 4RC3A 4RWLA 1BLXA 5DRBA 4MBJA 4AA0A 4RIWB 1KOAA 4YBKA 5GIOE 4B6LA 3POZA 2HY0A 1NXKA 4HYHA 4JDKA 3ZLWA 3ZRLA 4BTFA 5GNKA 4DH7A 3UDZA 4M3QA 2OLCA 2QCSA 3DAKA 4GSBA 1GOLA 4CXAA 3EQRA 3ZCLA 4ALUA 2J0JA 3LFEA 5DI1A 3MS9A 5FEDA 5HESA 5ICPA 4ZMFA 2XKEA 5L6PA 3KXXA 3PSBA 5E7RA 1CM8A 1YKRA 1RE8A 5IA3A 4YJOA 3ATSA 3DB8A 2YZLA 3FMEA 3MFSA 5C8NA 2C5XA 3FHIA 2H34A 3C4FA 4LRMA 3UDTA 3WF9A 5LWMA 4AXFA 2XNOA 5IA1A 5FBOA 1OUKA 2UZNA 3PFQA 3BHTA 4FC0A 4KIPA 4W9WA 2X0QA 1JKKA 2OXYA 5E8ZA 4MD7E 5HTBA 4G9CA 3VBVA 4C61A 5IQDA 4DEIA 3DAEA 5BYZA 3KXZA 5D41A 2GS6A 1W98A 4HZSA 2WB8A 3R7OA 4MK0A 2G01A 3P23A 4RPVA 5FM2A 4L52A 4XX9A 4QNYA 4EYMA 1DI9A 2R3IA 4RVKA 4JBVA 4L67A 4FKTA 3TNPC 4MXXA 2ITUA 3VUIA 3UP2A 4YLLA 3FLZA 4QYHA 3H10A 1PMVA 4LL5A 4ZY5A 2PE0A 3OD6X 4DHFA 3PY0A 3ZRKA 3I79A 5EHYA 3QUDA 3UGCA 2PVKA 3UDSA 4NH1A 5CEPA 4UX9A 3RJCA 2E9OA 4BF2A 3PXRA 2WTWA 3R0TA 4B99A 2P3GX 2VX3A 5CAPA 5HLNA 4DEBA 2EB2A 4E1ZA 5HQ0A 2R3GA 4OR5A 2BTSA 3FC2A 5M44A 5L6WL 5J1VA 3FLNC 4YLJA 4WBBB 3QZFA 2GMXA 2R3NA 3VUDA 4ORKA 4DITA 1B39A 3KF4A 3PE1A 2V7AA 4AN3A 4AZTA 4E6AA 3PZEA 3MA6A 5FXQA 1HCLA 2CPKE 3GFEA 4Q5HA 3R83A 2F49A 2OJIA 1V0OA 3BRBA 5LARA 3S4QA 2IWIA 4F1TA 3FQEA 1VZOA 4BDHA 1Q62A 3ODYX 1XBAA 4KS7A 4KBCA 1H00A 4ZTRA 4R5SA 3NDMA 3T3VA 3G9LX 2OF2A 3C7QA 3F5XA 4KD1A 5FEEA 3R7EA 3SKCA 1WBOA 3FSFA 3P5KA 2E9PA 3ORNA 4H36A 3CSVA 4IDVA 5D10A 5FQDC 4IB3A 4GW8A 2F4JA 5IEYA 2ZDUA 3CP9A 4K8AA 5KMOA 4NU1A 5H8GA 3QZIA 1UNHA 1Q99A 1Q5KA 3MY0A 3MFRA 3VS7A 5K0XA 5M07A 4FKWA 4TNBA 5HBJA 4KUJA 3LLAA 3CQUA 4UEUA 4JQ8A 3RPVA 1XJDA 4L44A 2OU7A 5BVFA 3H0YA 2W4JA 4PDSA 4TYHB 4WNKA 4CZYB 4YJQA 5HTIA 4PDPA 2GQRA 5EDPA 4DEAA 3BQRA 1FVVA 3OXTA 4FSQA 5EHLA 4O7YA 4HGSA 4U43A 5AAFA 3W0QA 2YDKA 4F7SA 3QLFA 4QP7A 3BYVA 4X2JA 1APME 4O7SA 2OF4A 4OTDA 5AUVA 4FTKA 5BVWA 3C50A 2IF8A 3ZTXA 2Y9QA 4AXEA 4I41A 2X9EA 5A9UA 4D9TA 3C4XA 3DT1A 5CS6A 1URCA 3Q32A 3VIDA 1TKIA 4RA5A 2WELA 1WBTA 4YUQA 4FSZA 1FINA 4QPMA 4F6SA 2C1AA 3UBDA 2HELA 4X3FB 2JIUA 4U42A 4GYGA 4ACGA 4CYJA 4CG8A 4JT3A 3BZ3A 3QQUA 1H07A 4G2FA 4C4FA 3ANRA 4RMZA 3BHVA 2VWVA 2Z2WA 5H8EA 4AT5A 2PVFA 3OT8A 3IOPA 3LXKA 4HCTA 3LJ2A 3WE8A 4FSUA 2JFLA 2B1PA 3FLYA 2VTPA 3ZSGA 4TN6A 5E8YA 5EOLA 4FEWA 4K6ZA 3RK9A 4KS8A 4HVHA 1Q3WA 2JDRA 5FD2A 3DNEA 3DNDA 3EFJA 3VQHA 5IQAA 1PHKA 4J71A 2XRWA 3E5AA 1YHWA 3OY1A 2P33A 4AOIA 4FEQA 4XG9A 4BZNA 4D4RA 3UIXA 4DC2A 4ZSEA 4IWOA 2WTDA 2HAKA 3PJ2A 4YPDA 1ZYSA 3QHRA 3PDTA 1O6LA 2UZUE 2P2IA 1YXVA 4FX3A 4NFMA 1Y6AA 4JL9A 2PUPA 3I1AA 2EXCX 2R3MA 4J98A 4QMOA 3TUBA 5E8XA 5JGDA 4CRLA 1I09A 3UPZA 3O5AA 2JBOA 3DV3A 2JDSA 2OJJA 3OW4A 4YJTA 5I9YA 5M4CA 1ZAOA 2CGXA 2I0VA 4TRLA 3OCGA 4IACA 4D1XA 1PMEA 3EFWA 2WKMA 3FMMA 4APPA 1OUYA 3D2IA 2WIPA 3PIXA 4I5PA 5IH4A 2WQEA 4QO9A 2REIA 5ITAA 3TG1A 1WBWA 4NCTC 1GZOA 4ARKA 4CFMA 4D0WA 2ONLA 3CIKA 2GNHA 4G16A 4FG9A 3Q53A 4Q9SA 1NY3A 3NUYA 3TKHA 5AA8A 1SVEA 3BYMA 3HMPA 2NPQA 2YERA 4IX5A 4S31A 1XH7A 4C37A 4BVUA 4ZLZA 5HTCA 3GFWA 4PDOA 2GCDA 2R3QA 2YZAA 3BBWA 2QHNA 4JX3A 4U3ZA 3GBZA 4LOOA 2HW6A 3SAYA 3VW6A 5IDPA 2QO9A 1KSWA 2VTJA 2WTCA 2JKMA 4M14A 3VRYA 1JLUE 5HORA 1FVTA 2VTAA 2VO6A 4M66A 2VTHA 2GDOA 3DJ6A 5GHVA 4DINA 5KMKA 1YQJA 1WAKA 2GPHA 2GHGA 4B4LA 2P4IA 2Y7JA 3AGLA 4RWIA 3E88A 5J9YA 4FV0A 2G1TA 3N9XA 3IO7A 2WQNA 3C13A 3H0ZA 3HYHA 2VO0A 3IGOA 3DJ5A 4OT5A 4BDCA 4L3JA 4J97A 1G8JA 4ANBA 1E9HA 4ZSAA 3MVHA 2OXDA 2QG5A 1YXUA 2J0IA 1WBVA 3NZ0A 4PNIA 4X2GA 5DGZA 5L2QA 5IA4A 2FSOX 2UW3A 3ZBFA 2HCKA 4M12A 1W82A 2C5OA 3N51A 3ENHA 3QX4A 2WTJA 4K11A 4BI1A 3HA8A 3FKNA 3SRVB 4J53A 4F6UA 1NVSA 2FSTX 3EN9A 5A4TA 4L7SA 4O4EA 2EB3A 1GIHA 3PY1A 4K9YA 3EQIA 5C9CA 1O9UA 1ZOEA 4DFYA 2BROA 3W2SA 4BCPA 4BCIA 2VGPA 2FSMX 3OWPA 4MHAA 2IW8A 1UWHA 3VULA 4IVBA 1GZ8A 2WMWA 3UNZA 4J96A 2B9FA 3FMNA 2X6EA 3FQHA 4S34A 3D5XA 4EH2A 3DQXA 2I0EA 1Q97A 3VUHA 3R1SA 4L3LA 5JFWA 5IQCA 3NFFB