5HG7A

Egfr (l858r, t790m, v948r) in complex with 1-{(3r,4r)-3-[5-chloro-2-(1-methyl-1h-pyrazol-4-ylamino)-7h-pyrrolo[2,3-d]pyrimidin-4-yloxymethyl]-4-methoxy-pyrrolidin-1-yl}propenone (pf-06459988)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
280
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of 1-{(3R,4R)-3-[({5-Chloro-2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-methoxypyrrolidin-1-yl}prop-2-en-1-one (PF-06459988), a Potent, WT Sparing, Irreversible Inhibitor of T790M-Containing EGFR Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 88
structure length 280
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hg7A01
4OLIA 1DAYA 4I5MA 5JRSA 4ZY4A 5HNIX 4F65A 2QC6A 1ZMWA 5LJJA 3WBLA 3VS0A 4C61A 4ASEA 5B7VA 4GKHA 4YMJA 3QYWA 3GVUA 2XVDA 1RQQA 4FUYA 4DEAA 4IB0A 1MP8A 2PVFA 4MEDA 4FKUA 5CY3A 2GDOA 3PXKA 2XIZA 4PMMA 4TYHA 4BDHA 5I9UA 2XNMA 5KZ0A 2R3GA 4LOQA 4WSQA 4DFYA 2GTNA 4FZ6A 5KBQA 4JR7A 4M66A 2WMWA 2A0CX 1GY3A 4B8LA 1H1PA 5J79A 5LVPA 5DA3A 4U6RA 4AWIA 2X9FA 4RJ8A 2UZOA 3CLYA 4D4SA 1NT2A 4M69A 5CVHA 1Q8ZA 1V0BA 3TZ8A 3QXPA 5JK3A 2Y9QA 2XEZA 3L9NA 3QD0A 4P5QA 2QOBA 2BZJA 1OKZA 3TNIA 3WE4A 3U4WA 4DBNA 2GHGA 4FG9A 1YOLA 2C1AA 3V8WA 2RFSA 3GP0A 2C6TA 3OVVA 2BAJA 3PSCA 4ZZOA 3R01A 3VF9A 2YERA 4K18A 3W2CA 4DH1A 1Q3WA 5JEBA 4R3PA 4FSUA 4JRVA 5CWZA 2BRNA 2ZMDA 4QMMA 3V3VA 3OCGA 4BDDA 3PXQA 5DBXA 4V0GA 1ATPE 5EFQA 3QQUA 4JX3A 2YDJA 4M8TA 4D9UA 3PJCA 1PXLA 4DTAA 2Z7QA 2W17A 4LL0A 4P90A 4EWQA 4A9SA 5AV3A 2R3PA 4O0TA 3OW4A 3OXZA 4FKLA 3ROCA 1H0WA 4YTCA 3I5NA 4QMVA 1M2RA 3UZRA 3TT0A 4WUAA 2G01A 3BYVA 1SNUA 5L2IA 4C4GA 1YOJA 3A4PA 1JBPE 2OI4X 2VWVA 4MD9E 4EK4A 3G33A 3DCVA 1YWNA 3D7TA 3P79A 5E7RA 3KXZA 3LMIA 2XEYA 3E63A 1DI9A 2XUUA 4BIBA 3FLZA 3UG1A 3C13A 2QKRA 3SLSA 4K0YA 2PU8A 3LCOA 1PXKA 3IW4A 3FMNA 4I6QA 5K3YA 4DITA 3W1FA 4MQ1A 2JIIA 1UNGA 4W4WA 4CFWA 3ZDIA 5IQGA 4CCUA 1GNGA 1LUFA 3NAXA 4LQMA 3LXPA 5M08A 3NZ0A 2X8DA 3KXGA 3QD3A 5KHXA 4S33A 5D9HA 3QA8A 4CFUA 4EC8A 3LLAA 2B0QA 2CCHA 3LZBA 3ORPA 4R1VA 5HVYA 5AEPA 4FT5A 2GNFA 1BKXA 3O8UA 3PY1A 4XUFA 4N6ZA 4E4XA 1RW8A 1U54A 2PY3A 4FR4A 2XBAA 5AAFA 4F7SA 3HRFA 5E8UA 4U3YA 4WOVA 3RJCA 4RFZA 4D58A 4FX3A 4F0GA 4F7NA 4IHPA 4N0SA 2XM9A 2CKEA 2JLDA 4G34A 4BBEA 1PY5A 2FUMA 1KV2A 3LIJA 4F6SA 4ZJJA 1KWPA 4KIQA 2BKKA 3MESA 5GZAA 1OVEA 3S2PA 2A2AA 4UN0C 4ITHA 3Q4ZA 2AC5A 2Z7LA 3DKCA 4D4VA 2ETRA 2OZAA 3R04A 2VWXA 3MDYA 3CSVA 2VZ6A 2FYSA 3FZOA 4E93A 4KAOA 5ACBC 3H4JA 2R4BA 4RVLA 2F4JA 4A07A 4EK8A 3SG9A 5JKGA 5LVNA 4G3CA 1OL5A 3BWJA 3KRXA 4RC2A 3N4VA 4D5KA 4DLIA 4R7IA 4L7SA 2W99B 1PXMA 2VNWA 5A4TA 4PNIA 3LFEA 4IZ7A 3HKOA 1VYWA 3F6XA 1XJDA 3QTSA 4IH8A 1OM1A 3F2AA 2HK5A 3W2RA 3QLFA 3VN9A 2UVYA 4YHFA 3DY7A 5DVRA 3KEXA 2QR7A 3DNEA 2R7BA 4BCOA 5HTCA 2X8IA 3DJ7A 2EXEA 3LQ5A 5GJFA 4F7LA 1H24A 2SRCA 3LM0A 3UZPA 4FBXA 3VS6A 4ALUA 4KKGA 1GOLA 3JVSA 3RK5A 1H07A 4XV1A 4C3PA 3IS5A 3MA3A 3QRIA 4QTDA 3DA6A 4MNFA 4AGUA 2VTSA 4WBOA 3I5ZA 4DEHA 2YISA 3R02A 4OTDA 4XG8A 3BIZA 3U6HA 2GFSA 3D2IA 5E8YA 2YCFA 2CMWA 4TL0A 3PXFA 5AAGA 2XIRA 4HYIA 2B7AA 4CLIA 4KIKA 4D0WA 3K54A 5DPVA 1UU9A 3KXHA 4A9UA 2YDIA 3CPBA 5CU0A 4WO5A 3DS6A 4BN1A 2HZ0A 2VTMA 3AC2A 4X3FA 3CS9A 1H25A 4HGSA 4O83A 2Z8CA 4JG7A 2YM3A 4JNWA 4FSRA 5BMMA 3EQDA 3R28A 4CQEA 1KOAA 4BWPA 4D5HA 2PUNA 4IIRA 5FP5A 4IB3A 3ZCLA 3DK6A 1YKRA 5M4CA 3I79A 4XG6A 3UVRA 3EWHA 3Q4UA 4UMQA 4FSMA 4YC3A 2E9PA 3ZRLA 3WZEA 4IEBA 2BR1A 3BZ3A 1GZKA 2WXVA 3ZEPA 3O71A 3UYSA 3VUMA 3GCVA 4PP7A 3FL5A 4YUQA 5HLNA 2KULA 4W9XA 4CLJA 2NNWB 5L8JA 1G3NA 3DOGA 4IMYA 2ITVA 4XBRA 4U45A 5EDQA 1JVPP 3PUPA 3A7FA 2F9GA 2RSVA 4PMPA 2NO3A 1BLXA 4AFJA 4PDPA 1H4LA 3ZSGA 4AU8A 4BI1A 2IZTA 4F4PA 4F70A 1YDRE 4FGBA 4FTNA 4RG0A 2X9EA 3DK7A 5D41A 2ZMCA 5J7BA 3COKA 3OS3A 1Q8UA 4GYIA 2WHBA 5CAPA 3AC1A 3ACJA 4RLLA 4CRLA 1ZY4A 1XBCA 4I0TA 5LVOA 5JZJA 2WO6A 5HX6A 1YHWA 3PZEA 3ODYX 4ZXTA 5FXRA 4XV3A 2QOLA 2CKPA 2GU8A 3G2FA 2C3LA 3S3IA 1TVOA 3QTUA 4HGEA 3OZ6A 4L3PA 4BIDA 4U81A 4RZWA 1OITA 2WMTA 3GXLA 3OY1A 3HUBA 3MPMA 3A7GA 3A8XA 2HXLA 3BLQA 3Q9WA 4KNBA 3EMGA 1P2AA 3NNVA 4PL4A 4YZBA 2JKMA 4B7TA 3TIZA 4FKQA 2OLCA 3I6UA 4NH1A 2UV2A 3VJOA 3BGQA 4QP2A 1DS5A 2CLQA 3OEFX 4J96A 4IBMA 3EFWA 5FP6A 3KK9A 2DUVA 5HE3A 2W1EA 4MQ2A 4LRMA 5HLPA 3NYVA 3UQCA 3H9FA 3D7TB 3LXLA 4M15A 5AP0A 3H0YA 3A7IA 2CCIA 4EHVA 4OBOA 2B55A 5KMIA 3GC8A 2HOGA 3HLLA 1CKPA 4RC4A 3F3TA 4ZY6A 3LPBA 4XP0A 2F57A 1PMEA 4NIFB 3QQJA 5CSHA 1K9AA 4R6VA 3FQSA 4ZTHA 5E4HA 3BQCA 4BR3A 3F5GA 4RJ7A 3P1AA 4DH7A 3FLWA 1T45A 4FNYA 4RIWA 3UIMA 4DTBA 5FEQA 1GZ8A 1I44A 3F88A 5JGDA 2OXXA 1BI7A 3LFCA 2GNIA 2VTOA 3NSZA 4FV9A 4YSJA 3VUKA 1ZRZA 4LGDA 4O7ZA 2C6DA 3C4XA 1WBNA 5DT0A 4I4EA 2C6MA 3OMVA 3CGFA 3QX2A 2C47A 4QNAA 1A48A 4FSQA 3UNZA 1Y6BA 2BAQA 2HWPA 3LFDA 4EH3A 4CG8A 4I6HA 3P08A 1H1WA 5HG5A 4BDAA 2PL0A 1UU7A 4TNDA 4X6RA 1UKIA 2FA2A 4F64A 4J8NA 5AP1A 3D5WA 4RGJA 4BIEA 2BRHA 4IANA 1F5QA 4FTOA 4A4XA 4L00A 3PDTA 4O2PA 3ZS5A 5IDPA 5E8XA 4AW0A 2PZIA 5CF8A 3FEGA 3K5UA 2RIOA 5BYYA 3CCNA 3LCKA 1U5QA 5DFPA 1ZXEA 1REJA 3VWAA 4ZZNA 2C30A 5AIRA 2GTMA 4BKZA 2YITA 4F08A 3H9OA 1JSTA 4RWKA 5D1JA 3QZGA 2B9IA 3GGFA 2UW7A 3QUDA 5F95A 3IO7A 3MJ2A 5FWKK 4Q9ZA 5LVMA 1Z5MA 5IQIA 1B39A 4FUXA 5IA2A 2OG8A 4GYGA 3E7VA 5J9YA 4PV0A 3R1QA 4GV1A 2JDOA 4AS0A 5JGAA 2E9UA 2OFVA 3DPKA 3HV5A 3VS4A 2W4KA 4FTQA 1JKLA 2UZWE 3VUHA 3BBTB 4HW7A 3TV7A 4X2JA 3W8LA 4JBOA 5EW8A 4D2SA 2CKOA 3FQEA 4O21A 4ACMA 3NRMA 3KXXA 2X1NA 4O27B 3TM0A 3F3ZA 4NCTC 4BTMA 1LEWA 3MVMA 2J0IA 4DH3A 2ZDUA 5AP6A 4UZDA 3UIXA 3V5QA 5FRIA 3PLAE 3KMUA 2X4FA 4MX9A 3OCTA 4NFMA 4ONAA 5JT2A 2JBPA 3TV4A 4TN6A 4EK6A 1MQBA 4EWHA 5A6OA 4CRSA 5KKRB 2BHHA 2PUUA 2V7OA 5HD4A 5CEIA 4JBQA 4E8AA 4HYUA 4C38A 2ZAZA 4LYNA 5ACKA 3GFWA 3KRWA 2PE1A 2YZAA 4AT4A 2H96A 5I3RA 5GNKA 4AXAA 4NM3A 1U59A 2HYYA 3K2LA 4ITIA 4IZAA 4GG7A 5FEEA 3SXFA 3IQ7A 4UWBA 5HNBA 5FBNC 3ULZA 4XX9A 3ZLWA 4U8ZA 3HUCA 3PFQA 1IASA 1SNXA 4WSYA 5CXHA 4C2WA 5AADA 4DFXE 4YO4A 3LFSA 3ZBXA 3E62A 4QTAA 4FZAB 5DEYA 3WZJA 4DEBA 2WU6A 3FLYA 3IKAA 4JIAA 5HCZA 4U43A 1MRYA 1E1VA 4GSBA 3CBLA 5FGKA 3C9WA 3Q3BA 5GJDA 4YTIA 3KC3A 4UMTA 4C0TA 1XH7A 4RX8A 4FSTA 4BCPA 3ALOA 3QRKA 4H1JA 4OR5A 3NCGA 3D2KA 2UZVA 3H9RA 5ETIA 3UZTA 1O9UA 4DT8A 4F09A 4EYMA 1B6CB 3ZRMA 4BVUA 3UPZA 3NNWA 5FLFA 3HECA 4GG5A 4QT1A 3A99A 3LFFA 3QQHA 5BVDA 4DF3A 5HD7A 1ZYSA 3CJGA 3G6GA 4MWIA 4F9BA 4I3ZA 1NVRA 2PULA 5DRDA 3ZO3A 1ZZ2A 3NYXA 1UNLA 3UO4A 1XH8A 3KRJA 4O96A 3PSDA 2I0YA 3R1NA 3FI3A 5KKRC 4O7SA 2JFMA 4EKKA 4LGGA 4AE6A 2XJ1A 1CDKA 3I7BA 3R00A 4UALA 1Z57A 5J8IA 3UODA 4BCKA 3EN5A 2VO6A 3OWKA 1KV1A 4DINA 4F6UA 3FBVA 3HV4A 2PZYA 4L6QA 4S32A 2GHMA 3G6HA 4FV1A 3QCYA 3PLSA 4DLJA 2QOCA 2ZM1A 3CP9A 4IDVA 4P7EA 4CFVA 5JSMA 5LOHA 3NLBA 4CMOA 1CM8A 2OH0E 4NZWB 4USDA 4IAIA 2WMUA 3M42A 4WBBB 5M55A 2WQOA 1BL7A 4GT5A 2C3IB 1KE9A 5DYJA 5E8SA 4Y5HA 2IW6A 3DB8A 3KF7A 2G15A 2QOOA 4LI5A 3JY9A 3PP1A 5B2LA 5T68A 4UMRA 1DAWA 3EQIA 3NYNA 3OBGA 4G3DA 5E8ZA 3AC8A 3EN7A 3L1SA 3LHJA 3VBQA 4AW1A 4EK3A 4ERKA 4I23A 2QG7A 4RVMA 4IW0A 2OXDA 1ZOGA 4CTBA 4B6LA 5IH4A 4OUCA 2R3NA 3DTWA 4IM2A 5HIDA 4QMPA 1GIHA 2X4ZA 4I6BA 4JL9A 2C0IA 4DEDA 2X39A 3HGKA 4O91A 3R8PA 2JKQA 3KVXA 5IMXA 5EM6A 1OL2A 3BRBA 4RC3A 3FZPA 2C3KA 4FYNA 1BMKA 4EOSA 2WMQA 2G2FA 3QCQA 3TEIA 1SVGA 5HKMA 4ZJVA 2FH9A 4TNBA 3FI8A 4K6ZA 5FM3A 4JS8A 4WG5A 4BCFA 3BE9A 3ORZA 4Y85A 4BWKA 3OOMA 2WTCA 4XG9A 2FSMX 4FEQA 5JGBA 3LLTA 2J5EA 4ZMFA 2H34A 5TE0A 3BEGA 3SXSA 4YJSA 4PL5A 5AMNA 3JVRA 3RWQA 2WTKB 3W33A 5I9WA 3FL4A 4C36A 4FTJA 4J71A 4AX8A 4O7VA 3CY2A 5HX8A 5LQFA 5CSPA 4LFIA 4GFOA 4C62A 4AGDA 4O1OA 1XO2B 2OJFE 2VV9A 4TYHB 3ZOSA 3TZMA 4DC2A 2PE2A 3IONA 4M0YA 3I6WA 2X0GA 4FKSA 3EQHA 3OCSA 2EU9A 4X21A 5CTPA 2VGOA 3HMNA 5LWMA 2BHEA 1OL1A 2WQNA 3AMYA 2IW9A 3QLGA 3FMKA 2CGVA 4R7BA 2VWWA 4QMSA 1OKWA 3QTXA 5ITAA 4TY1A 1ZOEA 3HDNA 4YURA 1P5EA 3RINA 4ZLYA 2CJMA 3EH9A 4ZTQA 4ZEGA 2GQSA 3DFCB 3IOPA 3C0GA 4OTRA 5BVKA 4M12A 3MW1A 3SC1A 1TQPA 3VRZA 4EQMA 5D11A 5JFVA 3B2TA 2OIDA 5L2QA 3QQLA 5JQ8A 5BNJA 4W9WA 4BZOA 2JAMA 2W5HA 5C8NA 1KUTA 3PWDA 3PPJA 3SOAA 4G9RA 1FINA 3DTCA 2Q0NA 1KE7A 1WVWA 1BL6A 2H6DA 2XNPA 5AM6A 5A4LA 2X7OA 1QPCA 3PIYA 5TR6A 3NW6A 2A4LA 4XCUA 1JPAA 3FC1X 1H27A 4O0WA 1JKSA 2BRGA 2RL5A 2YWPA 3DLZA 4L3JA 5LVLA 2NRUA 4IZYA 4UYNA 4QMUA 5H8BA 4WIHA 3OWJA 4GT3A 2Y4PA 4U97A 4MF0A 4TYJA 2XIKA 5E90A 3V8TA 5DMZA 1FOTA 1RJBA 2BPMA 3FMLA 1PHKA 4X7QA 2WOUA 1WAKA 2DS1A 2ZJWA 2F7ZE 3AT3A 1V1KA 4H3QA 3R83A 3Q9YA 3SGCA 5CAUA 2UZDA 3V6RA 2PVJA 4D1SA 3FAAA 4LRJA 3QTIA 4NKSA 3JXWA 4XLIA 3ZONA 4BRXA 3FSFA 4V04A 3OROA 4OTWA 3UIBA 3FHIA 3HV7A 3R2BA 3RI1A 4FV4A 2YDKA 1TQIA 2UW0A 5D10A 3NVKI 4JIKA 3VBWA 4IWDA 5AP2A 4XOYA 4G31A 4BDCA 3VS7A 4BCNA 2WNTA 4M68A 4GL9A 5DR2A 4ANBA 2ACXA 3BE2A 3OWLA 1P4OA 2B9JA 3ZXTA 4ANQA 4CD0A 4CZTA 4KSQA 4ZS0A 5JH6A 4BC6A 3TN8A 1YI3A 2QOQA 3C4FA 3OUKA 4FV3A 5BYZA 5TF9A 4QQCA 2B53A 4J8MA 3RK7A 2PSQA 2XNBA 3OFMA 3T9TA 3AMAA 4QPAA 3U6JA 2IVTA 2ONLC 2XKDA 4DGGA 4FKGA 4HCTA 2CHLA 4EORA 3I60A 5IUGA 4A06A 2PK9A 4MBIA 3ELJA 3WF8A 3UNKA 4APCA 5CS6A 5HBJA 5B2MA 3SDJA 3IOKA 1P4FA 4NK9A 1YXTA 3VULA 1SZMA 4EZ7A 3AT2A 1B38A 2VTRA 2WAJA 3IDPA 3TCPA 3UP7A 3WZKA 5IA3A 4EEVA 4HVIA 4FG7A 3RAWA 5ETAA 3FY2A 5JFSA 2EXCX 2GNLA 3M11A 4C4EA 1U46A 2EB3A 3TNPC 3KN6A 5ETFA 4XLVA 4BBMA 4Z55A 3EQRA 4P4CA 4ZTSA 3UMXA 3LOKA 3ID6C 2OJIA 2XNGA 3RCDA 2OW3A 4G6OA 2YM5A 5HCYA 4MYGA 4BCIA 2UW8A 3FMEA 4LV5A 4BY9E 4JG6A 3NMUF 1XR1A 5EHYA 3VQHA 4ASDA 4FIIA 4NUSA 5HNGA 1Y8YA 1GZOA 5HICA 3DBCA 3MPTA 3LE6A 2XK7A 3CTQA 4OT5A 5AJQA 5DT3A 3AG9A 4XOZA 4RX9A 3MVHA 2YACA 2VWIA 3R0TA 4I5HA 5F20A 3SRVB 3D7ZA 3MIYA 3LVPA 1KE8A 4QP8A 3RPVA 4UMPA 3WF7A 3TTIA 2C5YA 5LCKA 2BZIB 2J5FA 5HQ0A 3H3CA 3SAYA 4EJ7A 3ULIA 3LJ1A 4DEIA 2BZHB 3EQGA 2XRUA 2B1PA 1OL6A 4YBJA 4P2KA 2ITOA 3GENA 1IA9A 3EKKA 3RCJA 2R3HA 4UV0A 2YAKA 3QKKA 4QP7A 3FPQA 2VTQA 1M2QA 2OGVA 4W8EA 2OBJA 3F5UA 4FOBA 2EVAA 3EQBA 3KA0A 4O0YA 4QMXA 2YM6A 2W1GA 3C0IA 3VBVA 4LV8A 1A06A 4G5PA 4HNIA 4QP3A 3V8SA 3HRBA 3QQFA 2VO0A 3GQIA 4G1WA 4JT3A 4XRLA 5IEVA 4IVBA 3OCBA 2CNVA 3P7CA 4RVKA 3BHTA 4BYIA 2C5VA 3O7LB 4GCJA 1WMKA 5HO6A 5TOZA 4ID7A 3N4TA 2XM8A 3NGAA 4C33A 2P2IA 2YM8A 2VX1A 3FPMA 4I21A 2C5XA 4GK4A 1R3CA 3FE3A 4KBAA 4NWMA 1QPEA 4Y95A 2YCQA 1R1WA 5ICPA 2A1AB 2NPQA 4USEA 1UV5A 5C4KA 4YTFA 2QO9A 4NJ3A 3F3UA 4FK6A 2V0DA 3S00A 1XBBA 3KVWA 5L6WL 1FQ1B 4GK3A 3QAME 3G90X 4BWXA 4EYJA 3NYOA 5EKNA 1E9HA 4N57A 2WKMA 4QYYA 3L9PA 3OOGA 1PRYA 3Q04A 5IQAA 3RHKA 4CG9A 3KXNA 4FKJA 4BHZA 4KINA 5L2TA 2YLFA 5CYIA 4EUUA 1A9UA 1OL7A 1GIJA 3D15A 3PA4A 4PMTA 1S9IA 3T9IA 2BILB 2LAVA 1J1BA 2XH5A 1LP4A 3FXWA 2JKKA 4ZP5A 3VS5A 4ZLOA 3F66A 5KMJA 1AGWA 4JXFA 4MBLA 5IQHA 2QONA 3ZLYA 3ZZWA 5JN2A 1IA8A 5CVFA 5H3QA 3ETAA 3E8EA 4Q5HA 4E26A 5EHOA 2QURA 4FT9A 4FTCA 2YJRA 4BL1A 1YWVA 4J95A 3CGOA 3PWYA 4Y72A 3QXOA 2C68A 3KL8A 2VTPA 5GIPE 1OMWA 1L8TA 4F9WA 4GJ3A 2OICA 1XH5A 2PVYA 3LW0A 3MA6A 4BGGA 4H05A 3NIZA 4YHJA 5LMBA 3U4UA 5IQFA 5L8LA 4U79A 4CQGA 2ZM4A 3QCSA 4QQ5A 3KRRA 2UW4A 5HIBA 3W2SA 5A14A 2ETMA 4W4YA 1OPJA 4M3QA 5EM7A 2OXYA 3NDMA 4HPUE 2Y6MA 4R3CA 4I0RA 4MH7A 4YZDA 3QRJA 3Q9ZA 4UWYA 4CXAA 4HVDA 4G5JA 4D4YA 4F7JA 3IDBA 4QNYA 3MB7A 5M07A 1OBDA 3ZLXA 1ZWSA 4YO6A 3BU3A 1Z9XA 4FSNA 2X2KA 3RWPA 3UOHA 2OF4A 3FUPA 4EHEA 4O38A 2UVZA 3DJ6A 5DLSA 4NTTA 2XIYA 3RALA 3UBDA 2CKQA 4FV0A 3E64A 2YZLA 2ITWA 3N51A 4ANLA 4YPSA 1AQ1A 3NWWA 1XBAA 2PZRA 2V62A 3MPAA 4KIOA 4QQJA 4TWOA 1UWJA 5M57A 1NVQA 2W1IA 2C6IA 4TWPA 3IG7A 2JIUA 2PHKA 5CEPA 2WD1A 1O6YA 2B52A 5CQUA 5KNJA 5IMEA 3WYXA 5HLWA 3L8SA 3ATSA 3QGYA 5E8WA 3C1XA 5EOLA 3C4EA 3ORNA 3ERKA 2W1HA 3UC4A 4CGAA 2OO8X 2JC6A 5IUIA 5IF1A 2XIXA 3UE4A 1Q61A 3GU8A 2QKWB 3MH1A 3R7YA 3ZTXA 4O82A 3PIXA 4L01A 5FXQA 3PXYA 3ZZEA 2OJJA 5G6VA 5HTIA 4YSMA 5KX8A 3THBA 5KZIA 5AV1A 5AA9A 5JFXA 1LR4A 4R3RA 3U54A 4QMQA 4MF1A 4WKQA 3AT4A 1REKA 1PMUA 3PA5A 4HGLA 5AWMA 1WBPA 2R3IA 1R0EA 4YJNA 1Q5KA 4EQCA 2ZV9A 4GT4A 4RFMA 3ZFMA 4GVAA 2JDVA 4GIHA 3TNWA 3ZC5A 4D0XA 2PMOX 3E7OA 4FSYA 4PDOA 4CNHA 4EC9A 1JKKA 4YLJA 3ORMA 3QTWA 3GB2A 3BU6A 4DEGA 4USFA 4NM7A 2YEXA 3LXKA 2JITA 3BPRA 4O7RA 2WQEA 1YI6A 4UB7A 5EYMA 5DH3A 4HNFA 4X2GA 4CKRA 3NW5A 4NM5A 4XMOA 3LXNA 3UJGA 3VUIA 2EWAA 4BB4A 2IG7A 1JLUE 3TNHA 3DV3A 4DH5A 3CD8A 2Z2WA 3PY0A 2ITTA 1QMZA 5LCJA 2Y8OA 5J1VA 2J7TA 2F49A 4MD8E 3VS2A 4BDKA 4U9AA 5DOSA 2UW3A 4QMNA 5AR4A 4CFNA 4AN3A 4DGNA 2BDWA 4H58A 4ZSEA 4ZS4A 4OAVB 2ESMA 3QTQA 3NW7A 2OSCA 4NIFA 4FVRA 4F9CA 4MTAA 3ZUTA 4RIXA 1H1SA 4DGOA 3IW8A 4CZYB 4FNXA 3R7UA 2QD9A 4XP2A 2CSNA 3KCFA 4JR3A 3UG2A 2BDFA 3FZ1A 4X2FA 3R7OA 3PJ8A 4HVSA 2IPXA 3P5KA 3BQRA 4DE4A 4N70A 4QYHA 4BZNA 1M7QA 2J50A 5CU6A 4LOPA 3V01A 4EHGA 3PJ3A 4U42A 2J2IB 4WRGA 1G5SA 4C4FA 4FSZA 5DEWA 5D7VA 2HELA 5AR3A 4I41A 3OW3A 3RPSA 5CF4A 5HZNA 4O1PA 3HYHA 1H28A 4F99A 4IC8A 3CEKA 2J0LA 4IAYA 4HOKA 3RTPA 3VBXA 3I0QA 3GCQA 4AA0A 4O81A 3DK3A 1OI9A 4XS2A 2EXMA 4FYOA 1IR3A 1UKHA 2QOFA 3DFAA 4PTCA 3ZFXA 1WZYA 4YBKA 3TZ7A 2GNGA 2GPHA 4GUEA 3PJ1A 3TL8A 4I24A 5LMKC 2PVRA 3QKMA 4EBWA 1H26A 5ANDA 5AX9A 4IJ9A 3MY0A 2ITUA 3FYJX 4MVFA 4IQ6A 3AQVA 5KMLA 2X8EA 4X0MA 4AQCA 2YIWA 2HAKA 3JYAA 4R7HA 3B2WA 2QOKA 2FVDA 3BYUA 3LFAA 3G5DA 2IO6A 1YXVA 4I92A 1YRPA 1DI8A 1STCE 2VX0A 3VNTA 3L8VA 2Q0BA 2WTVA 2C0OA 4Y46A 4PL3A 4EH7A 4F0IA 3E8NA 5IQBA 3GU7A 4UXLA 5JRQA 4PNKA 5I4NA 3Q4TA 5LMKA 4QPSA 1FPUA 3L9MA 3WF5A 4RZVA 4R78A 4GU9A 4G6LA 4FTIA 4OTIA 3EQCA 5AUUA 4W4VA 5AAEA 1T46A 2VTJA 2YJSA 3EIDA 4JI9A 4L8MA 4WG3A 4IWQA 2ZB0A 3NAYA 5DG5A 3WYYA 4CV9A 2Z02A 3P7AA 3GC0A 3MI9A 5TKDA 5CEKA 4RRVA 3RAHA 2Y6OA 2XK4A 3FMJA 4L46A 4DFZE 4Z16A 3U55A 2BFXA 2PVKA 3OP5A 4FG8A 3UP2A 3IW5A 3ZO4A 3MYGA 4FGRA 2YIQA 1R78A 1OUKA 4L7FA 4DFLA 1GAGA 4HCVA 4AZEA 5GINE 5AIKA 5B0XA 1ZARA 2ERKA 5M44A 2R3KA 4IX5A 5GJGA 2OIQA 3EQFA 4DG0E 2X81A 3O51A 2GQGA 3W18A 3W2OA 4S31A 2PPQA 2BAKA 3OUNB 2BROA 4E3CA 3FDNA 4GVJA 4MXXA 2C3JA 4O86A 4IX3A 2J0JA 1J7IA 3WIKA 3BCEA 2R0IA 2WMAA 2RKUA 5HE0A 1ND4A 2ZV8A 4O0XA 2GFCA 1CTPE 3MV5A 4FF8A 4U7ZA 4AT5A 4HZRA 3ET7A 2P55A 1XH9A 2UW9A 1PMVA 3FI2A 2XB7A 2EUFB 2OWBA 4FKTA 3OXTA 4IC7A 4DGMA 3ZO2A 5IPJA 2I7QA 3D94A 3EB0A 4ZSJA 4C2VA 2BFYA 2HY81 2HY0A 2J6MA 2I0VA 4J1RA 4ARKA 4AUAA 4WD5A 5HORA 2C6KA 3LFNA 4C02A 4E5AX 3OBJA 4MAOA 3P23A 3CTHA 4S30A 3MFRA 2XBJA 4D2VA 1FBNA 5E9EA 3EJ1A 3P9JA 5E8TA 4JDIA 3QZFA 5KMKA 5GZ9A 5CEQA 4S2ZA 5ANGA 4X6QC 1YXSA 4C58A 3HV3A 4C57A 4JAIA 3U51A 1QPJA 5C4LA 3COHA 4AN2A 4AW2A 5FBOA 2O64A 3VC4A 2WTWA 3NUSA 3W2QA 2XNOA 4D2TA 5IQDA 1Q41A 3R7IA 1PYEA 3DT1A 2RGPA 2XYUA 3RPYA 4BCMA 4G3FA 4BKJA 2QODA 3OF0A 2C6LA 3E93A 4HZSA 4CTCA 3LMHA 4CSVA 4MNEB 3RNIA 2IVSA 2OFUA 3HV6A 3QTZA 4G16A 4YZ9A 4E6DA 3WZDA 1PKGA 4Y5QA 5F1ZA 4AFEA 3BWFA 5L3AA 5HO8A 2E2BA 4D28A 3AC5A 3NUPA 4IAKA 1OIYA 3MN3A 1PJKA 3IW7A 4EI4A 2R9SA 2W06A 3PVGA 3R21A 3ACKA 5AR5A 2VO7A 1MRVA 1UA2A 1Q62A 2X2MA 2BVAA 4LOOA 4YC6A 1HCLA 2QI8A 3CKXA 3QFVA 3VAPA 4QPMA 4EOMA 3PRIA 5H8EA 4FODA 4GRBA 2PMLX 5BUJA 2IJMA 3Q52A 5HHWA 3DQXA 3EOCA 5KE0A 3BGZA 4QP9A 4D2PA 4IVDA 4JX7A 4O22A 3NNUA 3QHWA 3DB6A 3DGKA 4GS6A 4NT4A 3EL8A 3CTJA 4E5WA 3GCPA 3ORTA 1MRUA 4U40A 5EDRA 3ZFYA 3QUEA 5DGZA 3TZ9A 2CGUA 5KHWA 3VRYA 5FTQA 3VW6A 4AA4A 1URWA 2VX3A 2UZBA 3E3BX 1NA7A 4C35A 4DFUA 2BUJA 4K11A 5ANIA 4OT6A 3Q32A 4EBVA 4AOIA 1SVEA 3TJCA 3POOA 1JWHA 5HIEA 3UPXA 4X3FB 4XNEA 3GU6A 4IZ5A 4EH2A 3SA0A 4FIFA 3FKLA 3HMIA 2OZOA 3EZRA 3FSKA 5DI1A 3UO6A 2ONLA 4YJVA 4IWPA 4WNOA 5AX3A 3LCTA 3TKHA 5K5XA 3CPCA 3NUYA 1WVXA 2XKCA 3DU8A 3BI6A 2WIPA 3LJ0A 3QBNA 3CKWA 4F9AA 5J5SA 1XKKA 5KUPA 4ZSLA 4QOXA 5H8GA 3DDPA 3KMWA 4EQUA 1H8FA 4CEGA 2JD5A 2XKEA 1Q99A 2CN8A 4HGTA 4ACDA 4GJ2A 1BYGA 5ANOA 2CPKE 5EI2A 4BGQA 4IX4A 3F3VA 4AZFA 3UYTA 3MIAA 3FLQA 4I94A 3PYYA 2X2LA 2HW6A 3GCUA 4WUNA 4EONA 1SVHA 4K77A 4CT2A 4FEVA 4QMOA 4I4FA 5FUTA 4BDBA 2ZV7A 3F9NA 1JQHA 5J9ZA 2WMSA 3PZHA 4LL5A 2VWBA 4M69B 5IA5A 1IAJA 5E1SA 4O7TA 2HW7A 3VIDA 5CT7A 2W5BA 4RJ5A 3ZUVA 2PYWA 5ANJA 3R7VA 2XA4A 2R64A 3ZO1A 1OUYA 2X6DA 2R3LA 4MK0A 3GC7A 3ZRKA 1UU8A 3N4UA 3P0MA 2XK9A 4LRKA 1OIQA 2WGJA 5JMSA 3COIA 4FKIA 2XP2A 3EN6A 4Y73A 4YJRA 1FGKA 4OTFA 4C4HA 3HA6A 4BCQA 1F0QA 3CY3A 4QP4A 3MB6A 3V51A 2R3MA 2WMBA 3R9RA 5EQYA 3R1YA 5FQDC 5HE1A 3L8XA 4I93A 4YZMA 2UZUE 1V0PA 1XQZA 3UDBA 3BV2A 3NS9A 1X8BA 4QTCA 4U5JA 3Q6UA 4QYGA 3FLNC 4BDJA 5FXSA 3F82A 4YHTA 1ZLTA 4JOAA 2QU5A 2XRWA 2Y4IB 1PKDA 4FA2A 5DR9A 2WMVA 3KULA 4UYAA 3KN5A 2J0KA 2BDJA 5AUZA 2VWZA 2EB2A 2YM7A 3VUTA 2PTKA 5BPYA 2J51A 3S95A 3ODZX 4PY1A 4IB5A 4YJUA 4EH9A 4ZMEA 1GZNA 2AYPA 5DHJA 5T3QA 1URCA 3VJNA 3ZC6A 4F1MA 5I9VA 3OY3A 5CALA 5DR6A 5BX0A 1H01A 3G51A 3NEWA 1OZ1A 3R30A 4IB1A 4MKCA 3FV8A 2PVNA 1GJOA 3MH3A 3EFKA 3Q2MA 1RE8A 1BX6A 1W83A 2LGCA 3KGAA 2F2CB 4FKVA 4OGRA 4FIHA 3VUDA 1CKIA 4C8BA 4C4JA 5HCXA 3UVPA 4PUZA 5KMNA 3NR9A 2XS0A 1O6KA 4CKIA 4FL1A 4EH4A 4JJRA 4FTMA 5T6KA 1GIIA 2FSTX 4MXZA 4ANOA 4UZHA 3GOKA 3PG1A 3SKCA 4FT3A 4BI0A 5AR2A 5CEOA 2BRMA 3ZHPC 4C7TA 4N6YA 3LMGA 3WZUA 5EYCA 5CSWA 2I1MA 3Q53A 1YOMA 3CQUA 3PE2A 4ASXA 3PE1A 2VNYA 1KSWA 5GIOE 3QU0A 1U54B 4DT9A 5CF5A 3Q4CA 5AUXA 3JPVA 4X2KA 3CXWA 3ORIA 4KD1A 1Q8YA 1UWHA 4HPTE 4YC8A 5M4IA 5H2UA 3QRUA 2ETKA 4KRDA 3A62A 3FY0A 2Y7JA 3ANRA 4EL9A 4E73A 5CEMA 2V5QA 3RZBA 1H00A 4TW9A 4HCUA 5CF6A 3OTUA 1ZOHA 2JGZA 1Q97A 4X2NA 3ZXZA 2WTIA 3MVJA 3UMWA 4JQEA 3HP2A 2VTHA 3FMMA 3MTLA 5IH5A 4TRLA 4CYIA 3LAUA 2I0HA 1ZYJA 3BBWA 4UWCA 3LQ3A 4XG3A 5FDXA 3A4OX 4C37A 2DWBA 5IEXA 3AMBA 1WVYA 2IWIA 4EOKA 4KS8A 3UQGA 4ZSAA 3PG3A 5HBEA 3ZH8A 4LG4A 4BCJA 3TWJA 2WPAA 4RA5A 5CNOA 5EK7A 4EH6A 1YHVA 4RIOA 2XNNA 2R2PA 3NUXA 2IZUA 2VWUA 4TYGA 3RMFA 3CR0A 4E5BA 1I09A 3OD6X 3T3UA 2WEIA 5A4QA 4FTRA 3UOLA 5A4CA 3WF6A 3WOWA 5I9ZA 1Q3DA 3ORXA 4IWOA 4R5SA 5AM7A 5DIAA 5HG7A 4RT7A 3A7HA 4RA4A 3JS2A 4PRJA 3LJ2A 4NFNA 4O0VA 2PUPA 4UEUA 2ITZA 3PSBA 4H36A 4YR8A 5K4IA 4XG4A 4JQ7A 3AC3A 1AD5A 4JDJA 4XJ0A 5C9CA 1FGIA 5DRBA 3FZSA 4J53A 3ZUUA 4JBVA 3BYMA 2HZNA 3PJ2A 4M14A 4O0RA 4Y83A 3QD4A 4ZZMA 3QHRA 3ROYA 2J0MB 5CU3A 4MCVA 3L9LA 3UIUA 5K9IA 1OKYA 4JLCA 4E4LA 1JSVA 2IVVA 5BQ0A 4FTKA 3W10A 3MGYA 5IA1A 3R63A 2QLQA 1XH6A 4IE9A 5L6OA 3W8QA 4F1OA 4AAAA 4I5PA 4MXOA 1W0XC 4LM5A 4OBPA 5KMMA 4DCAA 3B8QA 3CQWA 3KU2A 3QGWA 3VF8A 4LMUA 4FZ7A 3DLSA 3DAKA 4QMTA 5FG8A 4FKRA 4FMQA 5H9BA 3TG1A 3NUNA 3VHEA 1H1RA 3DJ5A 2R3QA 4BDIA 3HEGA 3QF9A 5G1XA 2A19B 3MJ1A 4HVGA 2C5OA 2B54A 1MUOA 4QD6A 4FTAA 1PW2A 4JDKA 3DKOA 1UU3A 4IVAA 4QMWA 3BKBA 2G2HA 3A8WA 1S9JA 3OC1A 5M53A 2BZKB 4JDHA 4FT7A 2B9HA 4PX6A 1R39A 4RX7A 5CQWA 2Z7RA 4A9YA 2IN6A 4IVCA 4M0ZA 4W4XA 3TTJA 2CDZA 4J98A 1J7LA 3MFTA 3OWPA 4AGWA 3NVMB 3IGGA 4AZWA 2RFNA 5CAQA 1VYZA 3FKOA 3O50A 4C3RA 3DXNA 3V5JA 5CX9A 3FLSA 2QO2A 5L8KA 2X6EA 5CI7A 3R8VA 4FV2A 2YN8A 4L68A 4YGAA 2W1ZA 5HVJA 4E6AA 2O63A 3F3WA 5FDPA 5HESA 3V6SA 4B99A 3POZA 4O7YA 4E6QA 2YCSA 1G8AA 4WG4A 3EZVA 3I1AA 4WNKA 4XHKB 2QOIA 1FMOE 1ERKA 2G9XA 3ZMMA 3KREA 1IEPA 4Z7GA 2VAGA 3KY2A 3A60A 3ZEWA 3HAMA 1LPUA 4YJQA 1APME 5CZHA 2G1TA 1YXXA 3LCDA 1WBSA 1NXKA 4RIYB 1JSUA 4GH2A 5ANEA 5JZNA 3TUDA 5J1WA 3DKFA 3AD4A 3K5VA 3L8PA 1J7UA 2E9OA 5LARA 4U3ZA 1ZMUA 5M09A 1TQMA 2CN5A 5CENA 4PPCA 5ETCA 1R0PA 4UY9A 4QQTA 4E6CA 1JKTA 3F2NA 4CV8A 2V55A 3BEAA 3SX9A 1YDSE 2HENA 2PE0A 4M84A 4IACA 3PXZA 2OH4A 5AV2A 4RX5A 5A54A 4XYFA 3NUAA 4IADA 1OB3A 4I22A 5L2WA 3EN9A 4MWHA 4BTFA 2C6EA 3BX5A 5A46A 3QWJA 4FI1A 4KS7A 2UZTA 4K2RA 4DYMA 3ATTA 5HGIA 4FIJA 2HXQA 3DXPA 2ZVAA 3SG8A 4KWPA 5C03A 4RBLA 3IDCA 4GMYA 4IM0A 2GCDA 4NCTA 2OK1A 3VQUA 3F2RA 4L45A 3WI6A 1XWSA 5AP7A 5K0XA 5AP4A 3RK9A 3C5IA 2PVHA 3SOCA 4DFBA 2CNQA 4FVQA 2FSLX 4FK3A 2FO0A 3RAIA 1M17A 3MH0A 5BVWA 3PP0A 2I40A 2JAVA 1WBTA 4FV6A 5CXZA 3FC2A 2IZSA 2W4JA 3UOKA 4P5ZA 1H0VA 4G17A 4KIPA 3QWKA 3WE8A 5EQEA 4NM0A 2VWYA 3OT8A 2O2UA 3FI4A 3QC9A 1YWRA 4L44A 2V7AA 3Q6WA 3A2CA 5K4JA 4K8AA 5L6PA 4R8QA 2R5TA 3KXMA 4IAFA 4RMZA 4RQVA 4XRJA 4CKJA 5BYLA 1VEBA 3PVUA 1Y6AA 3WF9A 3H30A 1W84A 3GQLA 4G9CA 4G3GA 4UBAA 3GOPA 3O0GA 3IK3A 2JKOA 4KKHA 5AP3A 4Q5EA 5K0KA 3FXZA 4DCEA 2W1DA 5BVOA 1BI8A 4GFMA 4WRSA 3KMMA 5CSVA 4YPDA 3U8WA 2O5KA 4V05A 4XEYA 4APPA 2YIYA 3A61A 4RJ6A 5A6NA 3O96A 3W16A 2YCRA 4BICA 4Z3VA 3Q2JA 3GEQA 3TI1A 3I7CA 4V01A 3W2PA 3FWQA 3PRFA 4YP8A 3RP9A 1OIUA 1BUHA 3M2WA 1QL6A 1W82A 4D2RA 5L2SA 2NP8A 2ZOQA 4OAUC 3TACA 3QZIA 3LFQA 3O7LD 3R73A 4I0SA 4J7BA 4XH6A 3R8LA 4B0GA 5FD2A 3ORKA 3TNQB 2WU7A 4XBUA 2QLUA 2PVLA 4BDEA 4GKIA 4O7LA 2GHLA 2CNUA 3LQ8A 4DHFA 5IKWA 2YHVA 4YZCA 1WFCA 5CAOA 5FM2A 4ZOGA 1W7HA 3O8PA 3Q96A 2QHMA 4TTHB 3GI3A 3VVHA 3D5VA 2Z7SA 4TYIA 4FTLA 5M4FA 4FEWA 1PXJA 4H3PA 4V0GB 4DBXA 4E4NA 3AGMA 4KB8A 5BUEA 2XNEA 4UX9A 2GMXA 5IQEA 4G6NA 4ORKA 2QCSA 5AV4A 4ASZA 3NCZA 4KSPA 4ENYA 3ITZA 5IDNA 2BTSA 3RVGA 4IDTA 4L52A 2W0JA 4FV7A 1M7NA 3H10A 3D83A 4KKEA 4GEOA 5IEYA 4FV8A 4G3EA 3ZYAA 5AUTA 4B9DA 2R3FA 4EOPA 5I9XA 1NVSA 2FB8A 3CD3A 3FKNA 4DA5A 5I5ZA 3DQWA 4O84A 3QL8A 3EYGA 2GSFA 3G9LX 4S34A 4Q2AA 3AD5A 4D2WA 3I0OA 1O6LA 4QRCA 5M56A 2R3JA 4HYSA 3TDVA 4KA3A 4D1XA 2UUEA 3CQEA 3HZTA 3BV3A 4FE2A 5TT7A 2VTNA 1SYKA 2R0UA 3C50A 2XYNA 3C4WA 3HX4A 4BTKA 4DN5A 4ANNA 2OKRA 2JEDA 5C8MA 4BCGA 5I0BA 3G9NA 4HJOA 5M06A 4MBJA 2BMCA 4RVTA 2UZEA 2R3OA 5A4EA 3F61A 5TO8A 3KF4A 2C5NA 3NUUA 4GU6A 3TKIA 3DKGA 3PPKA 4EOJA 4R77A 3E88A 1WBVA 2XJ0A 3ZSIA 3KQ7A 5JFWA 4ALVA 2PWLA 3EQPA 2BIYA 4PDYA 4L3LA 3R2YA 4XG2A 4XV2A 4RSSA 5HVKA 2F7EE 4TZRA 5HE2A 3CJFA 3OTVA 4U41A 2RG6A 1DM2A 2B4SB 4WNMA 5AV0A 3TUCA 2E9NA 3DBDA 3LKMA 3SXRA 2P2HA 4O6LA 3RKBA 1PXIA 2UZLA 2GS6A 3PY3A 4YZNA 3OXIA 4CFMA 2YAAA 5B2KA 2X7FA 2IVUA 4ACHA 4DTKA 3U6IA 2XCHA 2XCKA 4MHAA 5F94A 4AGCA 1OBGA 4I5CA 2OF2A 4O6EA 2QU6A 1NY3A 5AUYA 3RPRA 3P4KA 4AZVA 1YDTE 5KMOA 3MVLA 1PXOA 3RGFA 4AF3A 4ZAUA 2X7GA 2P33A 1Q4LA 1W8CA 5HO7A 2BRBA 4FC0A 4M7IA 2WEVA 3P86A 4AZSA 2FGIA 4NW5A 2W05A 4OTHA 4TKSA 4L9IA 4AA5A 2GS2A 2QHNA 4QO9A 3QX4A 3SD0A 4M97A 4DFNA 3D9VA 3OT3A 3DZQA 4BDGA 2BKZA 2F7XE 2WTJA 3GT8A 2DQ7X 4OTPA 1CSNA 2IZRA 2A27A 2W9ZB 1G8SA 3EFJA 4TYEA 2WFYA 4H39A 2DYLA 1M14A 2NRYA 5F4NA 3K3JA 3SW4A 4WA9A 4AN9A 4F6WA 2WQMA 4RJ3A 2REIA 1SMHA 3NPCA 2P3GX 2QG5A 2VO3A 3AGLA 4BKYA 3TXOA 4PDSA 3RZFA 4A4LA 4ANMA 5BVFA 4YJTA 2ITPA 3ALNA 2BCJA 2C4GA 3F7ZA 4BBFA 3SHEA 4CT1A 3UQFA 4J52A 3NIEA 5EYDA 1ZYDA 4AT3A 3C4ZA 4FKOA 5HG8A 3W55A 3UVQA 1RDQE 3Q60A 1KE6A 4C59A 3SV0A 4ZJIA 2R7IA 3HDMA 1FMKA 5LMAA 4KIKB 4OTQA 1YXUA 1OECA 3E87A 4MNEA 3BYOA 5HOAA 2ZM3A 4FIGA 3AC4A 2E9VA 4KABA 3ZM4A 3TKUA 2WELA 4O7WA 5AR8A 3F5PA 3E5AA 2JDRA 5HBHA 3DZOA 4ERWA 4B8MA 4PPAA 4J99A 5IU2A 4UMUA 1ZYLA 1IG1A 3R22A 4ZLZA 4ZY5A 4LUDA 3D5XA 3EKNA 3WIGA 4AG8A 2P0CA 3HMOA 1PYXA 3MH2A 1Y57A 2ZV2A 3GCSA 2UW6A 3MTFA 4FNWA 3M1SA 4IXPA 2PZ5A 3MWUA 3EN4A 3U87A 3DDQA 2PVMA 2R3RA 1YVJA 3JUHA 5J95A 4AOTA 2Y4IC 3ENMA 4A4OA 3LCSA 1YHSA 3FJQE 4Q9SA 1Q8TA 3OG7A 3VS1A 2AC3A 4H3BA 2PUIA 2C0TA 3KB7A 3NNXA 4CYJA 3S1HA 1J1CA 5EOBA 2WTKC 1ZAOA 2O3PA 2OIBA 1WCCA 3HMPA 5EG3A 4II5A 3UNJA 3C51A 3RM6A 2QQ7A 3DXQA 2J90A 5IUHA 3DAEA 3N9XA 4BZDA 5CNNA 4IX6A 4JRNA 4EZ5A 1XHAA 3HVCA 5FTGA 5DWRA 4FSWA 2O0UA 2O8YA 3RHXA 2VTAA 3TV6A 2Z60A 4RWLA 3C0HA 3JY0A 1QPDA 3MFUA 4BF2A 4NYEA 4RLKA 4TXCA 5J87A 2QO7A 4B4LA 2XJ2A 3TJDA 4ALWA 5HU9A 4K33A 3QCXA 4MXAA 4RFYA 4BGHA 2XZSA 4ANSA 2YABA 4NTSA 3BHVA 3Q5IA 5LXMA 5CU4A 2BALA 3ZU7A 2GQRA 2WOTA 3R8ZA 3BLRA 3C5UA 4M13A 3PIZA 5CI6A 2I6LA 3R9OA 5A9UA 2WIHA 2YA9A 4WT6A 2ZB1A 5E92A 4E20A 4EOOA 2CLXA 5D7AA 1JNKA 2JDSA 3Q9XA 2W7XA 3BHYA 4BTJA 4EUTA 3MY5A 3K3IA 2FSOX 3GBZA 2H9VA 2KTYA 4BDFA 5HTBA 4L53A 2RG5A 2XKFA 1F3MC 2WTDA 5CVGA 1IAHA 3QUPA 4FKPA 4JVGA 3C4CA 4L43A 4F0FA 5EH0A 4NJDA 4FTUA 1Q24A 4FTTA 3UO5A 3UGCA 3DAJA 4RIWB 1EH4A 2RFDA 4MD7E 2W1CA 3D14A 4L42A 4X3JA 4YLLA 5DNRA 3MY1A 3R6XA 5AP5A 4W8DA 3RPOA 3RBWA 4IM3A 4DH8A 1XH4A 4CVAA 3EYHA 3G0EA 4X3FC 3WARA 2BIKB 3Q5ZA 4FICA 3I4BA 2W96B 1M52A 3QRTA 3O23A 1Y8GA 5EKOA 4BCHA 3CIKA 5BUIA 3IGOA 4YU2A 2I0EA 3BELA 4NU1A 5JQ5A 3HMMA 3F5XA 3KFAA 4QMZA 3GNIB 4JBPA 5CU2A 3ZM9A 4QYEA 4AW5A 2W9FB 4C3FA 4NW6A 3OHTA 4OTGA 4PPBA 1JAMA 4LMNA 3SVVA 3GU4A 3A7JA 4GFGA 4PF4A 4DEEA 2Q83A 4O7NA 2XMYA 4A9RA 2UZNA 4BFMA 5IZFA 5J5TA 1OPKA 3PPZA 2CGWA 2WB8A 3HL7A 1FVRA 3II5A 5EDPA 2VTLA 4PQNA 3BHUA 4FNZA 5K5NA 3JR1A 5L4QA 2Y0AA 3GC9A 3KULB 4TWCA 4GK2A 4TPTA 4RIXB 5CZIA 2UVXA 3E8DA 4PTEA 3HAVA 5C01A 3RNYA 2J9MA 2JBOA 4JAJA 3AXWA 3HP5A 4QMYA 5HEZA 3S0OA 3UOJA 3E3PA 1W98A 3BGPA 5BVNA 3KKVA 3MBLA 1Y91A 5DE2A 4ENXA 5C27A 3HA8A 2XK3A 4I6FA 3SRVA 3W32A 2HZIA 4RWIA 2WZJA 4ZSGA 4CFXA 3R9HA 1YW2A 5EW3A 2W5AA 2J4ZA 3U9CA 2UW5A 4FV5A 1TKIA 3I81A 3BU5A 4IFCA 3QYZA 3VO3A 3P78A 3VW8A 1SM2A 4KBCA 1M2PA 3R7GA 5BMSA 1UVRA 3ENHA 4KUJA 2C1BA 4EJNA 2PMNX 5AFVA 4DG2E 4C4IA 2W4OA 4J97A 5IG1A 3R1SA 3R8UA 5KCVA 4RPVA 5EI8A 5CAVA 5CSXA 5M4UA 4L67A 5EYKA 4CCBA 1OKVA 4ZIMA 3EHAA 3O2MA 3V5WA 2XK6A 1IRKA 2XF0A 4HYHA 5C1QB 4F1TA 3G0FA 3GFEA 4YNOA 3TIYA 1OGUA 1ZYCA 2YIXA 4GUBA 4O0UA 4PTGA 3MSSA 2WMRA 3U9NA 4QP6A 1OPLA 3KCKA 3QALE 4LUEA 3FQHA 2OU7A 5AUWA 4AACA 3KK8A 4F63A 2ITQA 4NKAA 1FVVA 4CZUA 5C26A 4EOLA 5GZ8A 4KBKA 5EI6A 4EK5A 1WBWA 3PTGA 4EZ3A 3COMA 4AP7A 2WMXA 2QNJA 3DBFA 5M51A 2H8HA 3LFBA 4I1ZA 1YI4A 3BLHA 1MQ4A 3E92A 3HNGA 1PXPA 4H1MA 1UNHA 4FT0A 2VTTA 4YLKA 2JFLA 3PA3A 1K3AA 4N4SA 3FMHA 2VU3A 4YNEA 3VUGA 2ZDTA 2WQBA 3S4QA 3PXRA 3EFLA 3IPHA 3C7QA 1CMKE 4IFGA 4DAWA 5CANA 3OEZA 2OJGA 3FXXA 3ZLSA 3IW6A 4E1ZA 2YLEA 1H1QA 1VR2A 3D4QA 3IECA 3F7WA 3NX8A 4O0SA 5I3OA 1V0OA 4JQ8A 4D55A 4M67A 1HOWA 4Z9LA 4U80A 4ZTNA 1KE5A 4EOIA 3FZTA 5HU3A 1YQJA 4CFFA 4JG8A 1KOBA 3UTOA 5EHLA 4K9YA 3QQKA 3VHKA 1VJYA 2AUHA 3QKLA 4XG7A 3CE3A 4RIYA 3GU5A 1ZY5A 4FL2A 3GUBA 4EH5A 4IAZA 3O17A 4YJOA 4FVPA 4RQKA 2VGPA 4OBQA 2VUWA 3O8TA 3RM7A 4IJPA 4FEUA 4A9TA 1VZOA 3MFSA 3SW7A 4RJ4A 2JIVA 4FEXA 2GNJA 5EW9A 3QQGA 2B9FA 3VS3A 4IAAA 3FMDA 4EHZA 4EOQA 4QMLA 4DG3E 5GHVA 3TDWA 3BYSA 2O65A 2QOHA 2HCKA 5AUVA 2HZ4A 4MXYA 3PVWA 5AA8A 3T8OA 2YIRA 2ERZE 3B8RA 4ZTLA 3QTRA 3ZSHA 4CMUA 2CGXA 3R7EA 3V5PA 5E1EA 2OJ9A 5C8KA 1E1XA 3AOXA 4NSTA 4FOCA 4NEUA 5FTOA 1LEZA 1Q8WA 5KBRA 4U44A 3D5UA 4QP1A 4O2ZA 2RF9A 3AD6A 3UC3A 3DNDA 3V5LA 3D0EA 2YM4A 3ORLA 4D9TA 2YWVA 2QR8A 5EQPA 2P4IA 4ZK5A 4BI2A 4F9YA 4AE9A 2VD5A 5D12A 5EM5A 5EM8A 2W1FA 3EL7A 2XK8A 1PF8A 5HI2A 5DN3A 4PMSA 4E4MA 5LWNA 4FKWA 1PMNA 2GS7A 4QYFA 4UXQA 3SQQA 1OIRA 2ITNA 3QA0A 3E8CA 4XP3A 4Z7HA 2VTIA 4XV9A 4AOJA 2OZAB 1HCKA 3QC4A 5IA0A 5HG9A 1U4DA 4TWNA 2G2IA 4U0IA 4ZTRA 1CKJA 5IH6A 2YFXA 4YJPA 4D1ZA 3RAKA 5IISA 2GNHA 4GW8A 2JDTA 3G15A 4CMTA 5DT4A 2BTRA 4R5YA 2VN9A 4Y8DA 4FIEA 4C34A 4WHZA 4NL0A 5J9LA 1WBOA 2QVSE 3CC6A 3DBQA 3WILA 4LGHA 4WNPA 3QD2B 2HIWA 3PVBA 3P7BA 3HRCA 4AZTA 1P14A 3V04A 1PXNA 2ITXA 1ZZLA 5ANKA 3R8MA 4EH8A 4G2FA 3FYKX 5CLPA 3VBTA 4BHNA 5FEDA 2ZYBA 4ITJA 4QTBA 4EKLA 1QCFA 4BYJA 4ZTMA 3TUBA 1H08A 3DBEA 2PMIA 4ACCA 5AR7A 4KRCA 4QTEA 4TT7A 5IQCA 2ITYA 2V22A 4FZFB 2F2UA 3REPA 3ZBFA 5KO1A 1ZMVA 4MXCA 4PP9A 3R71A 4RWJA 3KRLA 3QZHA 4I20A 3BHHA 4OW8A 3VBYA 5BVEA 5E8VA 4GIIA 1L3RE 1JOWB 3ZDUA 1FVTA 4HVHA 5I9YA 5CT0A 3V5TA 1J3HA 1J91A 2RFEA 1K2PA 4FL3A 3H0ZA 4YTHA 5A3XA 4FZDB 4R1YA 5E91A 2IW8A 4DGLC 5CASA 3FHRA 3T3VA 1U5RA 3R9DA 4E7WA 5F9EA 3MS9A 4D4RA 3LM5A 2PZPA 4ACGA 4K1BA 3ANQA 2C69A 2HWOA 4PWNA 3F69A 2C6OA 5J7HA 5IA4A 3R9NA 1NW1A 4A7CA 2VRXA 3FZRA
chains in the Genus database with same CATH superfamily
4OLIA 1DAYA 4I5MA 5JRSA 4ZY4A 5HNIX 4F65A 2QC6A 1ZMWA 5LJJA 3WBLA 3VS0A 4C61A 4ASEA 5B7VA 4GKHA 4YMJA 3QYWA 3GVUA 2XVDA 1RQQA 4FUYA 4DEAA 4IB0A 1MP8A 2PVFA 4MEDA 4FKUA 5CY3A 2GDOA 3PXKA 2XIZA 4PMMA 4TYHA 4BDHA 5I9UA 2XNMA 5KZ0A 2R3GA 4LOQA 4WSQA 4DFYA 2GTNA 4FZ6A 5KBQA 4JR7A 4M66A 2WMWA 2A0CX 1GY3A 4B8LA 1H1PA 5J79A 5LVPA 5DA3A 4U6RA 4AWIA 2X9FA 4RJ8A 2UZOA 3CLYA 4D4SA 1NT2A 4M69A 5CVHA 1Q8ZA 1V0BA 3TZ8A 3QXPA 5JK3A 2Y9QA 2XEZA 3L9NA 3QD0A 4P5QA 2QOBA 2BZJA 1OKZA 3TNIA 3WE4A 3U4WA 4DBNA 2GHGA 4FG9A 1YOLA 2C1AA 3V8WA 2RFSA 3GP0A 2C6TA 3OVVA 2BAJA 3PSCA 4ZZOA 3R01A 3VF9A 2YERA 4K18A 3W2CA 4DH1A 1Q3WA 5JEBA 4R3PA 4FSUA 4JRVA 5CWZA 2BRNA 2ZMDA 4QMMA 3V3VA 3OCGA 4BDDA 3PXQA 5DBXA 4V0GA 1ATPE 5EFQA 3QQUA 4JX3A 2YDJA 4M8TA 4D9UA 3PJCA 1PXLA 4DTAA 2Z7QA 2W17A 4LL0A 4P90A 4EWQA 4A9SA 5AV3A 2R3PA 4O0TA 3OW4A 3OXZA 4FKLA 3ROCA 1H0WA 4YTCA 3I5NA 4QMVA 1M2RA 3UZRA 3TT0A 4WUAA 2G01A 3BYVA 1SNUA 5L2IA 4C4GA 1YOJA 3A4PA 1JBPE 2OI4X 2VWVA 4MD9E 4EK4A 3G33A 1ST4A 3DCVA 1YWNA 3D7TA 3P79A 5E7RA 3KXZA 3LMIA 2XEYA 3E63A 1DI9A 2XUUA 4BIBA 3FLZA 3UG1A 3C13A 2QKRA 3SLSA 4K0YA 2PU8A 3LCOA 1PXKA 3IW4A 3FMNA 4I6QA 5K3YA 4DITA 3W1FA 4MQ1A 2JIIA 1UNGA 4W4WA 4CFWA 3ZDIA 5IQGA 4CCUA 1GNGA 1LUFA 3NAXA 4LQMA 3LXPA 5M08A 3NZ0A 2X8DA 3KXGA 3QD3A 5KHXA 4S33A 5D9HA 3QA8A 4CFUA 4EC8A 3LLAA 2B0QA 2CCHA 3LZBA 3ORPA 4R1VA 5HVYA 5AEPA 4FT5A 2GNFA 1BKXA 4LV7A 3O8UA 3PY1A 4XUFA 4N6ZA 4E4XA 1RW8A 1U54A 2PY3A 4FR4A 2XBAA 5AAFA 4F7SA 3HRFA 5E8UA 4U3YA 4WOVA 3RJCA 4RFZA 4D58A 4FX3A 4F0GA 4F7NA 4IHPA 4N0SA 2XM9A 2CKEA 2JLDA 4G34A 4BBEA 1PY5A 2IF8A 2FUMA 1KV2A 3LIJA 4F6SA 4ZJJA 1KWPA 4KIQA 2BKKA 3MESA 5GZAA 1OVEA 3S2PA 2A2AA 4UN0C 4ITHA 3W0QA 3Q4ZA 2AC5A 2Z7LA 3DKCA 4D4VA 2ETRA 2OZAA 3R04A 2VWXA 3MDYA 3CSVA 2VZ6A 2FYSA 3FZOA 4E93A 4KAOA 5ACBC 3H4JA 2R4BA 4RVLA 3TMOA 2F4JA 4A07A 4EK8A 3SG9A 5JKGA 5LVNA 4G3CA 1OL5A 3BWJA 3KRXA 4RC2A 3N4VA 4D5KA 4DLIA 4R7IA 4L7SA 2W99B 1PXMA 2VNWA 5A4TA 4PNIA 3LFEA 4IZ7A 3HKOA 1VYWA 3F6XA 1XJDA 3QTSA 4IH8A 1OM1A 3F2AA 2HK5A 3W2RA 3QLFA 3VN9A 2UVYA 4YHFA 3DY7A 5DVRA 3KEXA 2QR7A 3DNEA 2R7BA 4BCOA 5HTCA 2X8IA 3DJ7A 2EXEA 3LQ5A 5GJFA 4F7LA 1H24A 2SRCA 3LM0A 3UZPA 4FBXA 3VS6A 4ALUA 4KKGA 1GOLA 3JVSA 3RK5A 1H07A 4XV1A 4C3PA 3IS5A 3MA3A 3QRIA 4QTDA 3DA6A 4MNFA 4AGUA 2VTSA 4WBOA 3I5ZA 4DEHA 2YISA 3R02A 4OTDA 4XG8A 3BIZA 3U6HA 2GFSA 3D2IA 5E8YA 2YCFA 2CMWA 4TL0A 3PXFA 5AAGA 2XIRA 4HYIA 2B7AA 4CLIA 4KIKA 4D0WA 3K54A 5DPVA 1UU9A 3KXHA 4A9UA 2YDIA 3CPBA 5CU0A 4WO5A 3DS6A 4BN1A 2HZ0A 2VTMA 3AC2A 4X3FA 3CS9A 1H25A 4HGSA 4O83A 2Z8CA 4JG7A 2YM3A 4JNWA 4FSRA 5BMMA 3EQDA 3R28A 4CQEA 1KOAA 4BWPA 4D5HA 2PUNA 4IIRA 5FP5A 4IB3A 3ZCLA 3DK6A 1YKRA 5M4CA 3I79A 4XG6A 3UVRA 3EWHA 3Q4UA 4UMQA 4FSMA 4YC3A 2E9PA 3ZRLA 3WZEA 4IEBA 2BR1A 3BZ3A 1GZKA 2WXVA 3ZEPA 3O71A 2X0OA 3UYSA 3VUMA 3GCVA 4PP7A 3FL5A 4YUQA 5HLNA 2KULA 4W9XA 4CLJA 2NNWB 5L8JA 1G3NA 3DOGA 4IMYA 2ITVA 4XBRA 4U45A 5EDQA 1JVPP 3PUPA 3A7FA 2F9GA 2RSVA 4PMPA 2NO3A 1BLXA 4AFJA 4PDPA 1H4LA 3ZSGA 4AU8A 4BI1A 2IZTA 4F4PA 4F70A 1YDRE 4FGBA 4FTNA 4RG0A 2X9EA 3PFYA 3DK7A 5D41A 2ZMCA 5J7BA 3COKA 3OS3A 1Q8UA 4GYIA 2WHBA 5CAPA 3AC1A 3ACJA 4RLLA 4CRLA 1ZY4A 1XBCA 4I0TA 5LVOA 5JZJA 2WO6A 5HX6A 1YHWA 3PZEA 3ODYX 4ZXTA 5FXRA 4XV3A 2QOLA 2CKPA 2GU8A 3G2FA 2C3LA 3S3IA 1TVOA 3QTUA 4HGEA 3OZ6A 4L3PA 4BIDA 4U81A 4RZWA 1OITA 2WMTA 3GXLA 3OY1A 3HUBA 3MPMA 3A7GA 3A8XA 2HXLA 3BLQA 3Q9WA 4KNBA 3EMGA 1P2AA 3NNVA 4PL4A 4YZBA 3UDZA 2JKMA 4B7TA 3TIZA 4FKQA 2OLCA 3I6UA 4NH1A 2UV2A 3VJOA 3BGQA 4QP2A 1DS5A 2CLQA 3OEFX 4J96A 4IBMA 3EFWA 5FP6A 3KK9A 2DUVA 5HE3A 2W1EA 4MQ2A 4LRMA 5HLPA 2A98A 3NYVA 3UQCA 3H9FA 3D7TB 3LXLA 4M15A 5AP0A 3H0YA 3A7IA 2CCIA 4EHVA 4OBOA 2B55A 5KMIA 3GC8A 2HOGA 3HLLA 1CKPA 4RC4A 3F3TA 4ZY6A 3LPBA 4XP0A 2F57A 1PMEA 4NIFB 3QQJA 5CSHA 1K9AA 4R6VA 3FQSA 4ZTHA 5E4HA 3BQCA 4BR3A 3F5GA 4RJ7A 3P1AA 4DH7A 3FLWA 1T45A 4FNYA 4RIWA 3UIMA 4DTBA 5FEQA 1GZ8A 1I44A 3F88A 5JGDA 2OXXA 1BI7A 3LFCA 2GNIA 2VTOA 3NSZA 4FV9A 4YSJA 3VUKA 1ZRZA 4LGDA 4O7ZA 2C6DA 3C4XA 1WBNA 5DT0A 4I4EA 2C6MA 3OMVA 4BJJA 3CGFA 3QX2A 2C47A 4QNAA 1A48A 4FSQA 3UNZA 1Y6BA 2BAQA 2HWPA 3LFDA 4EH3A 4CG8A 4I6HA 3P08A 1H1WA 5HG5A 4BDAA 2PL0A 1UU7A 4TNDA 4X6RA 1UKIA 2FA2A 4F64A 4J8NA 5AP1A 3D5WA 4RGJA 4BIEA 2BRHA 4IANA 1F5QA 4FTOA 4A4XA 4L00A 3PDTA 4O2PA 3ZS5A 5IDPA 5E8XA 4AW0A 2PZIA 5CF8A 3FEGA 3K5UA 2RIOA 5BYYA 3CCNA 3LCKA 1U5QA 5DFPA 1ZXEA 1REJA 3VWAA 4ZZNA 2C30A 5AIRA 2GTMA 4BKZA 2YITA 4F08A 3H9OA 1JSTA 4RWKA 5D1JA 3QZGA 2B9IA 3GGFA 2UW7A 3QUDA 5F95A 3IO7A 3MJ2A 5FWKK 4Q9ZA 5LVMA 1Z5MA 5IQIA 1B39A 4FUXA 5IA2A 2OG8A 4GYGA 3E7VA 5J9YA 4PV0A 3R1QA 4GV1A 2JDOA 4AS0A 5JGAA 2E9UA 2OFVA 3DPKA 3HV5A 3VS4A 2W4KA 4FTQA 1JKLA 2UZWE 3VUHA 3BBTB 4HW7A 3TV7A 4X2JA 3W8LA 4JBOA 5EW8A 4D2SA 2CKOA 3FQEA 4O21A 4ACMA 3NRMA 3KXXA 2X1NA 4O27B 3TM0A 3F3ZA 4NCTC 4BTMA 1LEWA 3MVMA 2J0IA 4DH3A 2ZDUA 5AP6A 4UZDA 3UIXA 3V5QA 5FRIA 3PLAE 3KMUA 2X4FA 4MX9A 3OCTA 4NFMA 4ONAA 5JT2A 2JBPA 3TV4A 4TN6A 4EK6A 1MQBA 4O4EA 4EWHA 5A6OA 4CRSA 5KKRB 2BHHA 2PUUA 2V7OA 5HD4A 5CEIA 4JBQA 4E8AA 4HYUA 4C38A 2ZAZA 4LYNA 5ACKA 3GFWA 3KRWA 2PE1A 2YZAA 4AT4A 2H96A 5I3RA 5GNKA 4AXAA 4NM3A 1U59A 2HYYA 3K2LA 4ITIA 4IZAA 4GG7A 5FEEA 3SXFA 3IQ7A 4UWBA 5HNBA 5FBNC 3ULZA 4XX9A 3ZLWA 4U8ZA 3HUCA 3PFQA 1IASA 1SNXA 4WSYA 5CXHA 4C2WA 4JMQA 5AADA 4DFXE 4YO4A 3LFSA 3ZBXA 3E62A 4QTAA 4FZAB 5DEYA 3WZJA 4DEBA 2WU6A 3FLYA 3IKAA 4JIAA 5HCZA 4U43A 1MRYA 1E1VA 4GSBA 3CBLA 5FGKA 3C9WA 3Q3BA 5GJDA 4YTIA 3KC3A 4UMTA 4C0TA 1XH7A 4RX8A 4FSTA 4BCPA 3ALOA 3QRKA 4H1JA 4OR5A 3NCGA 3D2KA 2UZVA 3H9RA 5ETIA 3UZTA 1O9UA 4DT8A 4F09A 4EYMA 1B6CB 3ZRMA 4BVUA 3UPZA 3NNWA 5FLFA 3HECA 4GG5A 4QT1A 3A99A 3LFFA 3QQHA 5BVDA 4DF3A 5HD7A 1ZYSA 3CJGA 3G6GA 4MWIA 4F9BA 3NFGB 4I3ZA 1NVRA 2PULA 5DRDA 3ZO3A 1ZZ2A 3NYXA 1UNLA 3UO4A 1XH8A 3KRJA 4O96A 3PSDA 2I0YA 3R1NA 3FI3A 5KKRC 4O7SA 2JFMA 4EKKA 4LGGA 4AE6A 2XJ1A 1CDKA 3I7BA 3R00A 4UALA 1Z57A 5J8IA 3UODA 4BCKA 3EN5A 2VO6A 4O81A 3OWKA 1KV1A 4DINA 4F6UA 3FBVA 3HV4A 2PZYA 4L6QA 4S32A 2GHMA 3G6HA 4FV1A 3QCYA 3PLSA 4DLJA 2QOCA 2ZM1A 3CP9A 4IDVA 4P7EA 4CFVA 5JSMA 5LOHA 3NLBA 4CMOA 1CM8A 2OH0E 4NZWB 4USDA 4IAIA 2WMUA 3M42A 4WBBB 5M55A 2WQOA 1BL7A 4GT5A 2C3IB 1KE9A 5DYJA 5E8SA 4Y5HA 2IW6A 3DB8A 3KF7A 2G15A 2QOOA 4LI5A 3JY9A 3KIOC 3PP1A 5B2LA 5T68A 4UMRA 1DAWA 3EQIA 3NYNA 3OBGA 4G3DA 5E8ZA 3AC8A 3EN7A 3L1SA 3LHJA 3VBQA 4AW1A 4EK3A 4ERKA 4I23A 2QG7A 4RVMA 4IW0A 2OXDA 1ZOGA 4CTBA 4B6LA 5IH4A 4OUCA 2R3NA 3DTWA 4IM2A 5HIDA 4QMPA 1GIHA 2X4ZA 4I6BA 4JL9A 2C0IA 4DEDA 2X39A 3HGKA 4O91A 3R8PA 2JKQA 3KVXA 5IMXA 5EM6A 1OL2A 3BRBA 4RC3A 3FZPA 2C3KA 4FYNA 1BMKA 4EOSA 2WMQA 2G2FA 3QCQA 3TEIA 1SVGA 5HKMA 4ZJVA 2FH9A 4TNBA 3FI8A 3TYKA 4K6ZA 5FM3A 3W0PA 4JS8A 4WG5A 4BCFA 3BE9A 3ORZA 4Y85A 4BWKA 3OOMA 2WTCA 4XG9A 2FSMX 4FEQA 3BL9A 5JGBA 3LLTA 2J5EA 4ZMFA 2H34A 5TE0A 3BEGA 3SXSA 4YJSA 4PL5A 5AMNA 3JVRA 3RWQA 2WTKB 3W33A 5I9WA 3FL4A 4C36A 4FTJA 4J71A 4AX8A 2ZFYA 4O7VA 3CY2A 5HX8A 5LQFA 5CSPA 4LFIA 4GFOA 4C62A 4AGDA 4O1OA 1XO2B 2OJFE 2VV9A 4TYHB 3ZOSA 3TZMA 4DC2A 2PE2A 3IONA 4M0YA 3I6WA 2X0GA 4FKSA 3EQHA 3OCSA 2EU9A 4X21A 5CTPA 2VGOA 3HMNA 5LWMA 2BHEA 1OL1A 2WQNA 3AMYA 2IW9A 3QLGA 3FMKA 2CGVA 4R7BA 2VWWA 4QMSA 1OKWA 3QTXA 5ITAA 4TY1A 1ZOEA 3HDNA 4YURA 1P5EA 3RINA 4ZLYA 2CJMA 3EH9A 4ZTQA 4ZEGA 2GQSA 3DFCB 3IOPA 4AXCA 3C0GA 4OTRA 5BVKA 4M12A 3MW1A 3SC1A 1TQPA 3VRZA 4EQMA 5D11A 5JFVA 3B2TA 2OIDA 5L2QA 3QQLA 5JQ8A 5BNJA 4W9WA 4BZOA 2JAMA 2W5HA 5C8NA 1KUTA 3PWDA 3PPJA 3SOAA 4G9RA 1FINA 3DTCA 2Q0NA 1KE7A 1WVWA 1BL6A 2H6DA 2XNPA 5AM6A 5A4LA 2X7OA 1QPCA 3PIYA 5TR6A 3NW6A 2A4LA 4XCUA 1JPAA 3FC1X 1H27A 4O0WA 1JKSA 2BRGA 2RL5A 2YWPA 3DLZA 4L3JA 5LVLA 2NRUA 4IZYA 4UYNA 4QMUA 5H8BA 4WIHA 3OWJA 4GT3A 2Y4PA 4U97A 4MF0A 4TYJA 2XIKA 5E90A 3V8TA 5DMZA 1FOTA 1RJBA 2BPMA 3FMLA 1PHKA 4X7QA 2WOUA 1WAKA 2DS1A 2ZJWA 2F7ZE 3AT3A 1V1KA 4H3QA 3R83A 3Q9YA 3SGCA 5CAUA 2UZDA 3V6RA 2PVJA 4D1SA 3FAAA 4LRJA 3QTIA 4NKSA 3JXWA 4XLIA 3ZONA 4BRXA 3FSFA 4V04A 3OROA 4OTWA 3UIBA 3FHIA 3HV7A 3R2BA 3RI1A 4FV4A 2YDKA 1TQIA 2UW0A 5D10A 3NVKI 4JIKA 3VBWA 4IWDA 5AP2A 4XOYA 4G31A 4BDCA 2NYAA 3VS7A 4BCNA 2WNTA 4M68A 4GL9A 5DR2A 4ANBA 2ACXA 3BE2A 3OWLA 1P4OA 2B9JA 3ZXTA 4ANQA 4CD0A 4CZTA 4KSQA 4ZS0A 5JH6A 4BC6A 3TN8A 1YI3A 2QOQA 3C4FA 3OUKA 4FV3A 5BYZA 5TF9A 4QQCA 2B53A 4J8MA 3RK7A 2PSQA 2XNBA 3OFMA 3T9TA 3AMAA 4QPAA 3U6JA 2IVTA 2ONLC 2XKDA 4DGGA 4FKGA 4HCTA 2CHLA 4EORA 3I60A 5IUGA 4A06A 2PK9A 4MBIA 3ELJA 3WF8A 3UNKA 4APCA 5CS6A 5HBJA 5B2MA 3SDJA 3IOKA 1P4FA 4NK9A 1YXTA 3VULA 1SZMA 4EZ7A 3AT2A 1B38A 2VTRA 2WAJA 3IDPA 3TCPA 3UP7A 3WZKA 5IA3A 4EEVA 4HVIA 4FG7A 3RAWA 5ETAA 3FY2A 5JFSA 2EXCX 2GNLA 3M11A 4C4EA 1U46A 2EB3A 3TNPC 3KN6A 5ETFA 4XLVA 4I6LA 4BBMA 4Z55A 3EQRA 4P4CA 4ZTSA 1W2DA 3LOKA 3UMXA 3ID6C 2OJIA 2XNGA 3RCDA 2OW3A 4G6OA 2YM5A 5HCYA 4MYGA 4BCIA 2UW8A 3FMEA 4LV5A 4BY9E 4JG6A 3NMUF 1XR1A 5EHYA 3VQHA 4ASDA 4FIIA 4NUSA 5HNGA 1Y8YA 1GZOA 5HICA 3DBCA 3MPTA 3LE6A 2XK7A 3CTQA 4OT5A 5AJQA 5DT3A 3AG9A 4XOZA 4RX9A 3MVHA 2YACA 2VWIA 3R0TA 4I5HA 5F20A 3SRVB 3D7ZA 3MIYA 3LVPA 1KE8A 4QP8A 3RPVA 4UMPA 3WF7A 3TTIA 2C5YA 5LCKA 2BZIB 2J5FA 5HQ0A 3H3CA 3SAYA 4EJ7A 3ULIA 3LJ1A 4DEIA 2BZHB 3EQGA 2XRUA 2B1PA 1OL6A 4YBJA 4P2KA 2ITOA 3GENA 1IA9A 3EKKA 3RCJA 2R3HA 4UV0A 2YAKA 3QKKA 4QP7A 3FPQA 2VTQA 1M2QA 2OGVA 4W8EA 2OBJA 3F5UA 4FOBA 3AKKA 2EVAA 3EQBA 3KA0A 4O0YA 4QMXA 2YM6A 2W1GA 3C0IA 3VBVA 3BLAA 4LV8A 1A06A 4G5PA 4HNIA 4QP3A 3V8SA 3HRBA 3QQFA 2VO0A 3GQIA 4G1WA 4JT3A 4XRLA 5IEVA 4IVBA 3OCBA 2CNVA 3P7CA 4RVKA 3BHTA 4BYIA 2C5VA 3O7LB 4GCJA 1WMKA 5HO6A 5TOZA 4ID7A 3N4TA 2XM8A 3NGAA 4C33A 2P2IA 2YM8A 2VX1A 3FPMA 4I21A 2C5XA 4GK4A 1R3CA 3FE3A 4KBAA 4NWMA 1QPEA 4Y95A 2YCQA 1R1WA 5ICPA 2A1AB 2NPQA 4USEA 1UV5A 5C4KA 4YTFA 2QO9A 4NJ3A 3F3UA 4FK6A 2V0DA 3S00A 1XBBA 3KVWA 5L6WL 1FQ1B 4GK3A 3QAME 3G90X 4BWXA 4EYJA 3NYOA 5EKNA 1E9HA 4N57A 2WKMA 4QYYA 3L9PA 3OOGA 1PRYA 3Q04A 5IQAA 3RHKA 4CG9A 3KXNA 4FKJA 4BHZA 4KINA 5L2TA 2YLFA 5CYIA 4EUUA 1A9UA 1OL7A 1GIJA 3D15A 3PA4A 4PMTA 1S9IA 1TFFA 3T9IA 2BILB 2LAVA 1J1BA 2XH5A 1LP4A 3FXWA 2JKKA 4ZP5A 3VS5A 4ZLOA 3F66A 5KMJA 1AGWA 4JXFA 4MBLA 5IQHA 2QONA 3ZLYA 3ZZWA 5JN2A 1IA8A 5CVFA 5H3QA 3ETAA 3E8EA 4Q5HA 4E26A 5EHOA 2QURA 4FT9A 4FTCA 2YJRA 4BL1A 1YWVA 4J95A 3CGOA 3PWYA 4Y72A 3QXOA 2C68A 3KL8A 2VTPA 5GIPE 1OMWA 1L8TA 4F9WA 4GJ3A 4O4BB 2OICA 1XH5A 2PVYA 3LW0A 3MA6A 4BGGA 4H05A 3NIZA 4YHJA 5LMBA 3U4UA 5IQFA 5L8LA 4U79A 4CQGA 2ZM4A 3QCSA 4QQ5A 3KRRA 2UW4A 5HIBA 3W2SA 5A14A 2ETMA 4W4YA 1OPJA 4M3QA 5EM7A 1OGYA 2OXYA 3NDMA 4HPUE 2Y6MA 4R3CA 4I0RA 4MH7A 4YZDA 3QRJA 3Q9ZA 4UWYA 4CXAA 4HVDA 4G5JA 4D4YA 4F7JA 3IDBA 4QNYA 4LDTA 3MB7A 5M07A 1OBDA 3ZLXA 1ZWSA 4YO6A 3BU3A 1Z9XA 4FSNA 2X2KA 3RWPA 3UOHA 2OF4A 3FUPA 4EHEA 4O38A 2UVZA 3DJ6A 5DLSA 4NTTA 2XIYA 3RALA 3UBDA 2CKQA 4FV0A 3E64A 2YZLA 2ITWA 3N51A 4ANLA 4YPSA 1AQ1A 3NWWA 1XBAA 2PZRA 2V62A 3MPAA 4KIOA 4QQJA 4TWOA 1UWJA 5M57A 1NVQA 2W1IA 2C6IA 4TWPA 3IG7A 2JIUA 2PHKA 5CEPA 2WD1A 1O6YA 2B52A 5CQUA 5KNJA 5IMEA 3WYXA 5HLWA 3L8SA 3ATSA 3QGYA 5E8WA 3C1XA 5EOLA 3C4EA 3ORNA 3ERKA 2W1HA 3UC4A 4CGAA 2OO8X 2JC6A 5IUIA 5IF1A 2XIXA 3UE4A 1Q61A 3GU8A 3W0MA 2QKWB 3MH1A 3R7YA 3ZTXA 4O82A 3PIXA 4L01A 5FXQA 3PXYA 3ZZEA 2OJJA 5G6VA 5HTIA 4YSMA 5KX8A 3THBA 5KZIA 5AV1A 5AA9A 5JFXA 1LR4A 4R3RA 3U54A 4QMQA 4MF1A 4WKQA 3AT4A 1REKA 1PMUA 3PA5A 4HGLA 5AWMA 1WBPA 2R3IA 1R0EA 4YJNA 1Q5KA 4EQCA 2ZV9A 4GT4A 4RFMA 3ZFMA 4GVAA 2JDVA 4GIHA 3TNWA 3ZC5A 4D0XA 2PMOX 3E7OA 4FSYA 4PDOA 4CNHA 4EC9A 1JKKA 4YLJA 3ORMA 3QTWA 3GB2A 3BU6A 4DEGA 4USFA 4NM7A 2YEXA 3LXKA 2JITA 3BPRA 4O7RA 2WQEA 1YI6A 4UB7A 5EYMA 5DH3A 4HNFA 4X2GA 4CKRA 3NW5A 4NM5A 4XMOA 3LXNA 3UJGA 3VUIA 2EWAA 4BB4A 2IG7A 1JLUE 3TNHA 3DV3A 4DH5A 3CD8A 2Z2WA 3PY0A 2ITTA 1QMZA 5LCJA 2Y8OA 5J1VA 2J7TA 2F49A 4MD8E 3VS2A 4BDKA 4U9AA 5DOSA 2UW3A 4QMNA 2XANA 5AR4A 4CFNA 4AN3A 4DGNA 2BDWA 4H58A 4ZSEA 4ZS4A 4OAVB 2ESMA 3QTQA 3NW7A 2OSCA 4NIFA 4FVRA 4F9CA 4MTAA 3ZUTA 4RIXA 1H1SA 4DGOA 3IW8A 4CZYB 4FNXA 3R7UA 2QD9A 4XP2A 2CSNA 3KCFA 4JR3A 3UG2A 2BDFA 3FZ1A 4X2FA 3R7OA 3PJ8A 4HVSA 2IPXA 3P5KA 3BQRA 4DE4A 4N70A 2XAOA 4QYHA 4BZNA 1M7QA 2J50A 5CU6A 4LOPA 3V01A 4EHGA 3PJ3A 4U42A 2J2IB 4WRGA 1G5SA 4C4FA 4FSZA 5DEWA 5D7VA 2HELA 5AR3A 4I41A 3OW3A 3RPSA 5CF4A 5HZNA 4O1PA 3HYHA 1H28A 4F99A 4IC8A 3CEKA 2J0LA 4IAYA 4HOKA 3RTPA 3VBXA 3I0QA 3GCQA 4AA0A 2XARA 3DK3A 1OI9A 4XS2A 2EXMA 4FYOA 1IR3A 1UKHA 2QOFA 3DFAA 4PTCA 3ZFXA 1WZYA 4YBKA 3TZ7A 4MUQA 2GNGA 2GPHA 4GUEA 3PJ1A 3TL8A 4I24A 5LMKC 2PVRA 3QKMA 4EBWA 1H26A 5ANDA 5AX9A 4IJ9A 3MY0A 2ITUA 3FYJX 4MVFA 4IQ6A 3AQVA 5KMLA 2X8EA 4X0MA 4AQCA 2YIWA 2HAKA 3JYAA 4R7HA 3B2WA 2QOKA 2FVDA 3BYUA 3LFAA 3G5DA 2IO6A 1YXVA 4I92A 1YRPA 1DI8A 1STCE 2VX0A 3VNTA 3L8VA 2Q0BA 2WTVA 2C0OA 4Y46A 4PL3A 4EH7A 4F0IA 3E8NA 5IQBA 3GU7A 4UXLA 5JRQA 4PNKA 3AKJA 5I4NA 3Q4TA 5LMKA 4QPSA 1FPUA 3L9MA 3WF5A 4RZVA 4R78A 4GU9A 4QDVA 4G6LA 4FTIA 4OTIA 3EQCA 5AUUA 4W4VA 5AAEA 1T46A 2VTJA 2YJSA 3EIDA 4JI9A 4L8MA 4WG3A 4IWQA 2ZB0A 3NAYA 5DG5A 3WYYA 4CV9A 2Z02A 3P7AA 3GC0A 3MI9A 5TKDA 5CEKA 4RRVA 3RAHA 2Y6OA 2XK4A 3FMJA 4L46A 4DFZE 4Z16A 3U55A 2BFXA 2PVKA 3OP5A 4FG8A 3UP2A 3IW5A 3ZO4A 3MYGA 4FGRA 2YIQA 1R78A 1OUKA 4L7FA 4DFLA 1GAGA 4HCVA 4AZEA 5GINE 5AIKA 5B0XA 1ZARA 2ERKA 5M44A 2R3KA 4IX5A 5GJGA 2OIQA 3EQFA 4DG0E 2X81A 3O51A 2GQGA 3W18A 3W2OA 4S31A 2PPQA 2BAKA 3OUNB 2BROA 4E3CA 3FDNA 4GVJA 4MXXA 2C3JA 4O86A 4IX3A 2J0JA 1J7IA 3UDSA 3WIKA 3BCEA 2IEWA 2R0IA 2WMAA 2RKUA 5HE0A 1ND4A 2ZV8A 4O0XA 2GFCA 1CTPE 3MV5A 4FF8A 4U7ZA 4AT5A 4HZRA 3ET7A 2P55A 1XH9A 2UW9A 1PMVA 3FI2A 2XB7A 2EUFB 2OWBA 4FKTA 3OXTA 4IC7A 4DGMA 3ZO2A 5IPJA 2I7QA 3D94A 3EB0A 4ZSJA 4C2VA 2BFYA 2HY81 2HY0A 2J6MA 2I0VA 4J1RA 4ARKA 4AUAA 4WD5A 5HORA 2C6KA 3LFNA 4C02A 4E5AX 3OBJA 4MAOA 3P23A 3CTHA 4S30A 3MFRA 2XBJA 4D2VA 1FBNA 5E9EA