5HG7A

Egfr (l858r, t790m, v948r) in complex with 1-{(3r,4r)-3-[5-chloro-2-(1-methyl-1h-pyrazol-4-ylamino)-7h-pyrrolo[2,3-d]pyrimidin-4-yloxymethyl]-4-methoxy-pyrrolidin-1-yl}propenone (pf-06459988)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
280
Chain Sequence
ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of 1-{(3R,4R)-3-[({5-Chloro-2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-pyrrolo[2,3-d]pyrimidin-4-yl}oxy)methyl]-4-methoxypyrrolidin-1-yl}prop-2-en-1-one (PF-06459988), a Potent, WT Sparing, Irreversible Inhibitor of T790M-Containing EGFR Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 280
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hg7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hg7A01
3KKVA 2PVKA 2UW3A 4X3FA 2GQRA 4HVGA 2BZHB 2HW6A 5I3OA 2X4ZA 3OWKA 3FZOA 5BX0A 4ZZMA 2EB2A 4BTFA 4YO6A 3D94A 3H0ZA 4FV4A 4OUCA 4XLVA 5DOSA 5AWMA 4WBBB 3C0GA 3TUCA 5CASA 3SG8A 1BYGA 3VC4A 4O6EA 5GINE 3RNIA 5AX3A 5AIRA 1Y91A 4GMYA 4QYFA 5G1XA 3NYXA 1UKHA 2UZVA 4IE9A 4UMTA 4UALA 4NW5A 4A9TA 2C47A 4ZY6A 3P1AA 2JEDA 1PXKA 1Q61A 5DGZA 2BPMA 3DKGA 3FMEA 3R9NA 4I20A 3RM6A 5BQ0A 3K3IA 3GGFA 4BIEA 1IG1A 3U6JA 3ZFXA 2CGXA 3PVGA 4Y46A 5BVOA 1ZAOA 1FGKA 4L9IA 2VTHA 4YNOA 2G1TA 2VUWA 4E1ZA 3PRFA 3RPOA 2XH5A 4EORA 5EOLA 3ZLSA 2F2CB 2OIQA 3R21A 4TTHB 5GZ9A 4AA0A 4DCEA 4UMRA 3DBCA 4IH8A 4L8MA 3SXSA 3LFBA 2UZWE 5EM7A 4F70A 3VUGA 4DH8A 3DBDA 2F7XE 1SMHA 4O1OA 4ZTHA 3T9IA 4ERWA 5C03A 5HBJA 5H8BA 2BHHA 3EYGA 3ORLA 5IH4A 5JMSA 3EQPA 1IAJA 3QUEA 3IDPA 4ZSEA 5AP3A 1XH8A 4ACHA 1JVPP 2EXEA 3JS2A 2ERKA 4E5WA 3HDNA 2Y6OA 4U80A 5HCXA 1SNUA 4O0UA 3BE9A 3GFEA 3RK9A 4GUBA 3W33A 4EL9A 4TY1A 1LEZA 3FQSA 3MY0A 3PXKA 2W4OA 3ZLYA 5TOZA 4CT2A 4F9WA 4Q9ZA 2PVHA 3E8EA 3DU8A 4YJNA 3VF8A 1AQ1A 2I40A 3ENMA 2IO6A 4P5ZA 3ODZX 1M7QA 3HMIA 3PVBA 3Q4CA 1ZMWA 4IWOA 5EYDA 3HECA 3RAIA 5KMMA 4FVRA 2FVDA 1Q99A 4IADA 2YIRA 5M09A 3SW4A 3EQGA 4ACDA 4F6SA 2OF4A 1OIUA 4H1MA 4J7BA 4NT4A 3CJFA 5IG1A 4H39A 4NM7A 3WYXA 4BC6A 5E8VA 4C3RA 1NT2A 2OXXA 2W17A 4AT3A 1VEBA 3A4PA 4A9SA 3DBEA 4PTCA 4NJDA 3P7CA 3EFKA 1WBTA 1KE9A 2YDJA 4L44A 4FTRA 3RP9A 3HRCA 4CCUA 5A6OA 3DQWA 3AGMA 4E3CA 2GHGA 4W4WA 4FTCA 4MXCA 3R30A 1APME 2HXQA 3FYKX 3CIKA 5HBEA 2Z7SA 3CPCA 2R3FA 4AA4A 1XH5A 2ZMDA 4DH3A 4BRXA 2BILB 4PMPA 4I0SA 4ALWA 3PJCA 3Q9ZA 2YLEA 5FXQA 3RHXA 2LGCA 3L8PA 3O8TA 2R9SA 4QYGA 3F3UA 4I4EA 4IHPA 5A9UA 2QLUA 2O5KA 3OCTA 3UE4A 5JFWA 3BYSA 4EHZA 3I81A 3IDBA 5AP1A 3ZFMA 1YOJA 3NUUA 4YC3A 3F2NA 4AACA 2X39A 3MY5A 2JFLA 4MYGA 4G3FA 4PNIA 3OW4A 4AW1A 3EZRA 4XP0A 4BCKA 2VTAA 4RZVA 4F1MA 2PK9A 3VS4A 5IQHA 1KE6A 4IVDA 3WOWA 5IUIA 5EYMA 5J87A 2A0CX 2R4BA 3DFAA 2JBPA 3NUPA 4PMTA 5G6VA 3ZSGA 1G8SA 4B4LA 5CALA 1MRUA 4LOOA 4H36A 3VS5A 2OXYA 2Z7RA 4CVAA 2I7QA 2WZJA 3QXPA 4F1TA 3TL8A 3R83A 2B1PA 4DH7A 1RDQE 3R8PA 3WIGA 2QOQA 2WTCA 5DT0A 1OBGA 2PMLX 1SM2A 3ZOSA 3D83A 5CQUA 1YWRA 3ZSHA 4XEYA 3C0HA 4FUXA 4RWLA 1STCE 1WBWA 2UW6A 4XLIA 4CRLA 3I0QA 3FKOA 3IDCA 3TKIA 3NLBA 3RPYA 2ZB1A 2W05A 2BTSA 4GK4A 4GUEA 2BAJA 2CCIA 4PPBA 3PLAE 3DA6A 4H3QA 4OTWA 4EK8A 2XYUA 1FINA 2CGUA 2QONA 3HMPA 3MV5A 2XJ0A 4PPCA 3ZO2A 3FWQA 1PXOA 5CU3A 2Q0BA 2BROA 4G31A 4ID7A 2QO9A 4KRDA 1I09A 3R8MA 4BIDA 1YXXA 4DEHA 3HDMA 3OXTA 1ERKA 4YJRA 2YITA 4CV9A 2GNIA 2BKZA 2PMOX 4UV0A 3ERKA 3L9NA 3D5WA 1YOLA 4FI1A 3TUDA 2VTMA 3F5XA 3VQHA 4ZY4A 3ZM4A 3LW0A 2W7XA 3PWDA 3P86A 2ZV8A 3OD6X 5EQYA 2KTYA 2HWPA 1A9UA 3R9HA 1U4DA 4FGBA 2OG8A 4NIFA 4XRJA 3ZZWA 5FBOA 3S4QA 3D2KA 1M7NA 4EKLA 4S32A 5CEMA 5JGBA 3MESA 3LMHA 3MA3A 4ENXA 3C13A 3GNIB 5GJFA 3TTJA 4EQUA 1A48A 2ZDTA 3FV8A 4IJPA 3QC4A 3RTPA 2BRMA 3UDBA 4KA3A 5E8UA 5HBHA 2AUHA 3SXRA 4A9YA 5ICPA 4TWPA 3QQKA 2C30A 2WMTA 2R3PA 3A8XA 3ANRA 3FYJX 3ORIA 4AZWA 1E1VA 3CQUA 5HGIA 4BCIA 5AAEA 2X2LA 4MHAA 4XG7A 4DGLC 3LJ1A 4TT7A 2ITPA 2C6MA 5A6NA 2G15A 2QR8A 3D5XA 1PXPA 2HENA 2CSNA 4NIFB 1TQMA 1W0XC 4BY9E 1P2AA 3WZKA 3ZM9A 2OFUA 3PJ1A 1FVTA 5FDXA 1R39A 3NUNA 3PTGA 4FT9A 1XH7A 4ZSLA 3UIMA 1ZARA 2JKOA 4ITIA 4FTOA 5E1SA 5GNKA 3D5VA 4QPAA 3V5JA 4BICA 5M53A 4KUJA 2CN8A 3GEQA 2OIDA 3QCQA 5LVMA 5HLPA 3QWKA 5FEDA 5EHLA 3ACJA 1O6YA 4Y5HA 4FSWA 2YIWA 2RG5A 3ODYX 4D2RA 1SYKA 4LOQA 5DLSA 3E8CA 5IQGA 2XJ2A 4XHKB 4J99A 2W4KA 4C36A 2WEIA 4IM3A 4G6NA 2HZ4A 2CHLA 3UVPA 3ZS5A 5I5ZA 3QALE 2CLXA 5JT2A 3MTFA 3U54A 5FXRA 4M0YA 4DEGA 3PG1A 1GIHA 5A4TA 4ALUA 4FIGA 4RQKA 2GNLA 4O7SA 3CS9A 3RKBA 1AD5A 5IMEA 4C2VA 4H05A 4OBOA 4QOXA 4AGCA 4AZSA 3FJQE 4XNEA 3LOKA 5AR3A 2X9FA 1LUFA 5FG8A 4EH7A 4IVAA 2XVDA 3SA0A 4K6ZA 4ZTQA 3UNZA 3RAWA 1E1XA 2X6DA 3O50A 4NEUA 2UW9A 3EL8A 3OWPA 4IWPA 3GU6A 5B2KA 3TJDA 2PVNA 2ZV2A 4OTQA 3AT4A 4B8LA 1BMKA 2JKKA 3S3IA 2CNQA 3CBLA 1ZYDA 2BMCA 3COIA 4YZNA 3QC9A 3LPBA 5J8IA 4NH1A 4HNFA 3VVHA 4NCTA 3R00A 4GJ2A 3UMWA 3KN5A 5F1ZA 5D11A 1M14A 4EC8A 5A4LA 5CAPA 3TM0A 2VWXA 2XNMA 2I0HA 2Y8OA 3R2BA 4GH2A 4XV1A 3SVVA 4FG8A 2UZBA 3QKLA 3E62A 2YN8A 1NVSA 3RINA 2YACA 3D5UA 5HE0A 5L8LA 4LM5A 4U79A 4BHZA 3O8UA 4KNBA 2B9HA 3KK9A 3O0GA 4CMTA 1QL6A 4WNPA 1XH6A 2YM3A 3DTCA 4IB1A 4DINA 3EQRA 4BFMA 4PF4A 3MFUA 4DGOA 4J95A 1WVWA 4YJQA 4ZTRA 1BL6A 4QQJA 2H9VA 5EK7A 1T45A 2YIXA 4YJPA 3C4ZA 5HE1A 4EH4A 1GNGA 1W84A 5A4CA 2PVFA 1H4LA 2ITTA 2JGZA 2Z2WA 3ETAA 3FC1X 3KU2A 2R7IA 2UVXA 3LMGA 1TQPA 4FEQA 4QP7A 3MJ2A 2YCSA 2WKMA 3OWJA 1U46A 3PWYA 4DG2E 3QTSA 1YW2A 3AC8A 3P7AA 3V6RA 5I3RA 4R3CA 3DK6A 3UNKA 2P2IA 3ALOA 4UEUA 1L8TA 3TEIA 5CVFA 4YTIA 1URWA 5T68A 4C34A 2QG7A 3B8RA 4BWKA 3C5UA 4CKJA 2IZUA 1ZRZA 3F3ZA 1OZ1A 5CYIA 3HV3A 3FC2A 4OT6A 4EH6A 3V5PA 3WI6A 4CQGA 3FSKA 2YDKA 2XNPA 3PY0A 2CMWA 4IWDA 4NKSA 1Z57A 1YXTA 2IZRA 3E7VA 3TZ9A 1T46A 3UP7A 4ZLYA 1LEWA 1NA7A 4I5CA 5CEIA 4DAWA 3G0FA 4CFXA 4FT0A 3UC3A 2C6TA 2JDVA 3NDMA 4ITJA 4ONAA 3MGYA 2EU9A 4UYAA 3W18A 3TJCA 1ZLTA 4B8MA 4FK6A 3CY3A 2J2IB 3MB6A 5J5SA 4D1XA 5I9VA 5EDQA 3F7WA 1K3AA 4Z7GA 1K2PA 3S0OA 3TI1A 3ZLXA 5H8EA 5DPVA 4OTRA 1JAMA 3RWPA 4FEXA 2BRNA 2PSQA 1OPJA 1TKIA 2YWPA 3C4FA 3R02A 2GHLA 2FO0A 2C0OA 3ZUUA 4DTAA 4FG9A 2B53A 1GY3A 1PXNA 3MJ1A 3OY1A 4FL2A 5E91A 3UG2A 1UV5A 3JYAA 3O2MA 2WB8A 4GCJA 4R5SA 4X0MA 3S1HA 4DCAA 2B7AA 3WILA 2BIKB 3NW7A 3NUSA 4BYJA 4YHJA 4FV9A 4DC2A 1RQQA 3BU5A 1W98A 5IUHA 4DEIA 3Q2JA 4ZMEA 4FKSA 4EI4A 1PXIA 4JLCA 1YI4A 4S2ZA 4V05A 4EK4A 2JC6A 2VTJA 3MFSA 3PDTA 4KABA 5C9CA 2XM8A 3EJ1A 3F82A 1XR1A 4WSYA 3BYMA 3F3TA 3ORZA 5CT7A 3CKWA 4FVQA 5EHOA 5GIPE 1J3HA 1P4OA 5CSPA 5K5NA 3R7GA 2RFEA 2FSMX 4ANQA 4OR5A 1H1SA 4DH1A 2BCJA 2WMAA 4C3FA 5KMOA 3RCJA 3QTZA 1ZOEA 1DI9A 3FXXA 3DNEA 5CI7A 4Z7HA 3A61A 3S95A 3UZPA 3LJ2A 5AUTA 3R8VA 1B38A 4UMQA 1J1CA 2R3MA 4ZTNA 4S34A 2X7FA 5D7VA 4O0WA 5HI2A 4M0ZA 3KRRA 3RMFA 3UO6A 2R0IA 3VW8A 4BKYA 1FPUA 5IQFA 3BHTA 3Q60A 2QU6A 2ZOQA 3FLZA 2QOBA 2QOLA 3CE3A 5FEEA 4D2PA 5DR2A 4O7RA 3ZO4A 4BR3A 2YM8A 3AGLA 4PV0A 5LQFA 3MWUA 3S00A 4QQ5A 4WG5A 4C02A 3FLYA 4K0YA 3PYYA 4MWHA 5IZFA 3OG7A 1Z5MA 4HGLA 3QFVA 4F0IA 4O0RA 4YJVA 4EOKA 2WQNA 1OKYA 4CFWA 3OCSA 4IJ9A 4QP8A 4MBJA 2W1HA 3QRUA 3LFCA 3BWFA 4IB0A 3EIDA 5CY3A 3DTWA 5GZ8A 4C0TA 3R04A 3PY3A 4MX9A 4AA5A 2WIPA 3QQJA 3Q4UA 5DYJA 3SD0A 3GC0A 2IVSA 4FTLA 5E8SA 3QA8A 3NSZA 4XCUA 3QHRA 1JLUE 4OLIA 5E90A 3Q2MA 1OPLA 4ANSA 3EL7A 1PMEA 3G0EA 2J0KA 3NUXA 5CEPA 1W82A 4RFMA 5HNIX 3R22A 4ANLA 2YCQA 5AR8A 4XRLA 2PZIA 2VWUA 4IEBA 2CGWA 4H3BA 4F9YA 4EOQA 5AEPA 1BUHA 4I4FA 2YHVA 3BU6A 5IEYA 4YTHA 2BIYA 4I41A 5AUYA 4MEDA 4PDYA 3REPA 5L2TA 4IB5A 4FTJA 3FUPA 4ERKA 4FYNA 4G1WA 1WBVA 4FIFA 4X3FC 4XJ0A 5IISA 3EQCA 4OTGA 2V22A 3HUCA 4L46A 1P14A 3EQIA 4LRJA 4OAUC 3OTUA 4O82A 5KZIA 3E92A 1MQBA 4QTAA 5DMZA 1VYZA 1KV2A 3ZONA 4UMPA 2VO3A 3NWWA 4D0WA 5L6OA 3P78A 4FEVA 2YDIA 4RVMA 4D1SA 3HMNA 3ZMMA 4BBFA 2RSVA 3IONA 4C2WA 4CNHA 2OH4A 4KIQA 3DY7A 5AUZA 1H07A 2OWBA 2R3JA 5EDPA 4QNYA 5C4LA 3UPZA 5LARA 4FMQA 3GOPA 4LQMA 3UPXA 3QRKA 2XM9A 2W9FB 3BEAA 3VIDA 3R7EA 3TXOA 5KMJA 3RWQA 5L6PA 2ETKA 3U6HA 1DAYA 1NVRA 4AXAA 5LXMA 3W8LA 2C6KA 4DT8A 1MUOA 2C0TA 3LLAA 3KRWA 3ZLWA 3C50A 4JIKA 4PMSA 3OOGA 4RIYB 1JSVA 2C5OA 3EYHA 3GUBA 4BKJA 4JDIA 4BZDA 3BKBA 3G9LX 4FVPA 5HO6A 3L8SA 4IAZA 4IX3A 1PRYA 5CNOA 5D41A 1OB3A 3KY2A 5AJQA 3UIUA 4FL1A 4TYHA 2F2UA 4QD6A 1YXSA 4QTDA 3HX4A 4AE6A 4BWPA 4YJOA 4A4XA 3DGKA 3Q3BA 5KNJA 3U6IA 4QMTA 2C3LA 3IW5A 5ANEA 2HW7A 3R7UA 3F9NA 3SOCA 1YXUA 3I0OA 4HCTA 4FV5A 2VNWA 4E5AX 3V8TA 4RVLA 2VWBA 4KB8A 5LWNA 2XK9A 3HV4A 3KXNA 4MD8E 4IVCA 4YLLA 2WQBA 2JDTA 1SZMA 3C9WA 4UB7A 4Y85A 2YABA 3QTUA 1OI9A 3A60A 3OROA 4NUSA 3RPRA 5CNNA 3BLRA 2C6IA 1P5EA 3OCGA 2Z7LA 4E26A 3IK3A 4N6YA 5CEOA 4X2GA 5IUGA 5L8JA 3G51A 3II5A 4QTBA 4YGAA 3IW8A 4XOZA 2GDOA 3FLNC 3KEXA 4MD7E 4TYHB 5ANJA 4WSQA 4A07A 3O8PA 2DWBA 4DA5A 2J0IA 4I22A 4IC7A 3I60A 4IAFA 2ITNA 3PSDA 5L8KA 3L9PA 1F3MC 4NM0A 5JN2A 2J7TA 4HOKA 4EUUA 4DYMA 2WMWA 3PRIA 2XJ1A 4UY9A 4AN3A 5FLFA 3TACA 4F1OA 3E3BX 4CD0A 4RWJA 3OF0A 2NPQA 4ZTSA 2CKPA 4XG2A 5I0BA 3R73A 4AQCA 4LI5A 3DKFA 3H9RA 3PA4A 2E9VA 4QNAA 5HOAA 2WFYA 3FZRA 1URCA 4FSZA 5B2MA 4RFYA 1IRKA 2OJIA 4CT1A 2NRYA 1OUKA 3DAJA 1BL7A 2ITYA 4MAOA 1IASA 1ZYCA 5HG5A 3TNHA 5J5TA 4IAAA 4M15A 4QMZA 3O7LD 4KS8A 2WMSA 1ZMUA 4L45A 1Q8WA 1YDSE 1SVGA 3COKA 3QYZA 5DA3A 5E8TA 3GXLA 4RX7A 2P55A 4AF3A 3RPVA 2B9FA 2QHNA 2W0JA 4DGGA 3MS9A 5L3AA 3JXWA 1JWHA 5LCKA 1Q3WA 4YJTA 2PUUA 2OJ9A 2B4SB 4O27B 3F69A 3MPTA 1H8FA 5AUVA 2EXMA 2JIIA 2GNJA 3S2PA 5JZJA 3G5DA 4L3PA 5HVKA 3VJOA 4GSBA 2XK3A 3FZ1A 4BWXA 5LVLA 5E92A 2QNJA 3M1SA 1G3NA 3OC1A 5EM6A 3PVWA 3BIZA 2GHMA 3NAYA 2PVYA 2QVSE 2V62A 4DLJA 4XG8A 4UN0C 3PE2A 2UZTA 4U42A 3QRIA 4RX9A 5HG9A 3FLQA 5AR5A 3PZHA 4U8ZA 4B7TA 4H58A 2BTRA 4HYUA 4IFCA 4GEOA 2Y6MA 2QODA 4LGDA 3UOJA 3D9VA 5BNJA 3VO3A 4OBPA 4O7TA 5JSMA 1F5QA 3PXFA 3KMUA 4R7BA 3L9MA 3N4TA 1K9AA 2PUNA 4P2KA 3QCXA 2FYSA 1QCFA 3NRMA 3EWHA 4LGHA 5DT3A 5A4EA 4YU2A 4O7WA 3KXZA 2WTIA 4TKSA 5DFPA 4ASZA 5HIEA 5EI8A 4TYIA 4F09A 4QT1A 2EB3A 3TDVA 2OJGA 4BDCA 2XIZA 4USEA 2YM6A 5KMNA 5FQDC 3ATTA 4QPMA 2IVVA 2R3IA 3AC5A 5DR6A 3UOHA 3V8WA 2RF9A 3K3JA 3MI9A 2J5EA 2VNYA 4IX6A 3R8LA 3A99A 1Y8YA 4YHFA 3POZA 4FBXA 5HLWA 5HD4A 1H01A 4KAOA 3NUAA 4R78A 2QU5A 1FOTA 4W4XA 5K3YA 3MH1A 4RC2A 3T9TA 4C59A 1WBPA 2F49A 5HG7A 3SKCA 4FICA 4GIIA 5AA9A 3G6GA 4JQ7A 3RPSA 5IDNA 5KCVA 1Q5KA 5M56A 5JEBA 2ZB0A 5CANA 4YR8A 3I4BA 1HCKA 4X3FB 5HTCA 2C5YA 4O91A 5ANDA 3HRFA 4ASEA 4TZRA 2X4FA 4U3YA 4EK3A 5K4JA 1U54A 2PVRA 4MF0A 4FKIA 3LLTA 4U0IA 4D5KA 2C68A 2G2IA 4FIIA 2OJJA 5EYCA 4EWQA 1SVHA 5CLPA 4EQMA 3CGFA 4Z3VA 2XKFA 2XEYA 2O63A 3EN4A 3GCPA 4R1YA 3HP5A 4K8AA 4Y8DA 5BMMA 2PULA 1Q3DA 4TYGA 3IECA 3HEGA 4PPAA 4X6QC 2FH9A 5AP6A 3V5QA 2XP2A 3W2CA 3F88A 4EH3A 2QCSA 2X7GA 4FKWA 2HIWA 1WVXA 4Z16A 2F7ZE 3P4KA 2PUIA 3AMYA 5DIAA 2VWZA 4L3JA 3BLHA 3NGAA 4GJ3A 2ITWA 2WQMA 4G3CA 4JBQA 4W9XA 3AMBA 4BF2A 4G3GA 3IG7A 4BDEA 5HLNA 4YZBA 5F9EA 4AP7A 3G15A 1JKSA 4FV3A 4KIPA 2WQEA 4YSMA 3BHHA 3ORXA 3SHEA 3VS1A 3CY2A 3N51A 1U54B 3MPMA 4NJ3A 1M52A 5FD2A 4CZYB 5IMXA 3VUMA 1XKKA 4QMWA 3PA5A 1R0EA 4I1ZA 4ZOGA 3KRLA 4D4YA 2Y4PA 4YJUA 3TZ8A 1B39A 5IA2A 5KHXA 3E8DA 4G9RA 3BV3A 3R7IA 2QG5A 3PP1A 4AGUA 5LVPA 1IA8A 3Q9YA 4BCMA 5HE2A 5E8WA 4G3EA 4BTKA 3HKOA 2O0UA 3GC9A 2HCKA 2VX3A 1KSWA 3QCSA 2UW8A 3C4WA 4TWOA 4XS2A 3IO7A 2YIQA 1XWSA 2YAKA 4FKRA 4JR7A 3W32A 5HQ0A 1A06A 5JGAA 4HYSA 4DGMA 3QLGA 5DWRA 4B99A 3RZFA 2XNBA 2Y4IC 5LMBA 3UP2A 3O96A 1WFCA 3GU4A 4Z55A 4YC6A 2ITQA 3GU7A 4ZTLA 4AOJA 4MNEA 2I0VA 4JQEA 4QTEA 2B0QA 4NCTC 2W1IA 3BHYA 3LIJA 4BB4A 1Y6AA 2WELA 4FV8A 5GHVA 3O7LB 1OIYA 3H4JA 4R77A 4FKUA 2YERA 2R3GA 3OWLA 4D55A 4RLKA 3O51A 3GCVA 4GW8A 1G5SA 3Q52A 2XBJA 3CTJA 3UIBA 3ZTXA 5AV1A 3QXOA 3LCSA 4X21A 2W9ZB 3UOKA 4FTAA 4YZCA 3BGQA 4USFA 3PP0A 4TWNA 5J9LA 4FNWA 3ZUTA 4D28A 3EN9A 5C4KA 2ITZA 2XKDA 2OKRA 2BZKB 4EOOA 4FA2A 5AV4A 4YURA 3QU0A 3Q53A 4J71A 4XMOA 3CTQA 1KE5A 5AX9A 2RGPA 3BEGA 3FQHA 4D58A 1W83A 4MNEB 3DJ6A 4YMJA 5HX8A 3A8WA 4RWIA 4BCGA 4KBAA 3JUHA 3RJCA 3UYSA 2E9NA 3WE4A 2GNHA 2X8IA 2YJSA 2IZSA 3U4WA 4LL0A 4F6UA 2YWVA 3DXPA 1H00A 3ANQA 3BGPA 1GZKA 4A4OA 3TNQB 5A46A 3RGFA 4O0VA 4E4LA 4OGRA 2ERZE 3GP0A 4RIOA 4RLLA 4FL3A 4YHTA 3H30A 4FNZA 4E6AA 5L2SA 5LMKA 1QMZA 1VJYA 4FT3A 3FMJA 4EONA 5DEWA 4OTHA 1YHWA 3F3WA 3E3PA 1Q41A 2PPQA 3NPCA 3BCEA 3KB7A 3OCBA 3EQFA 2X9EA 3LFNA 3I5NA 5CSHA 3U8WA 4LOPA 3LZBA 4LRMA 3EKKA 5DR9A 5HG8A 3ZC6A 4HVSA 2RIOA 1M2PA 3QQHA 3KXGA 5D9HA 4DFNA 1OM1A 1O6KA 5GJDA 2OLCA 4QMUA 3WIKA 1GAGA 4K1BA 4AAAA 4NM3A 4QYEA 5IH5A 2ZAZA 3ZU7A 5DT4A 4RA4A 3ZFYA 5CF8A 1U5QA 3Q9XA 2UV2A 4BTJA 1TQIA 3PXYA 5FWKK 4CQEA 4M13A 3KF4A 3A62A 2WQOA 3BE2A 2UVZA 2W1DA 3FMKA 3HV5A 5FXSA 3BI6A 3SXFA 4X3JA 1H26A 3RAKA 3CR0A 3SV0A 1M17A 5EDRA 2J6MA 4FSQA 4FTUA 3IQ7A 4RQVA 4AUAA 4B0GA 4YO4A 5DG5A 4FKGA 2HY0A 4QYHA 4WUAA 1G8AA 2QOOA 4O7NA 4G5PA 1J7LA 4AZFA 1XH4A 4CCBA 4C35A 3PJ2A 4I0RA 4FTTA 3OEFX 4HGEA 4JNWA 5AP2A 3H3CA 3DZOA 3UBDA 4C57A 5KMKA 3Q32A 4U9AA 3DBFA 3NCGA 5KZ0A 5L2WA 4GRBA 5FRIA 4QMNA 3UQCA 1CSNA 2W96B 1PF8A 3MVJA 4GVAA 2O64A 2XIRA 3ORKA 1J7IA 5A3XA 3W2RA 3U51A 2X81A 4FTKA 3QGYA 4IZAA 4OW8A 3TV4A 3VUTA 3WF9A 1KE8A 3EN7A 5DEYA 4FX3A 2J0MB 3OZ6A 5M4FA 3R7OA 1WBOA 4WHZA 5F20A 5EKNA 4BHNA 4D4VA 4MVFA 4FEUA 5KKRB 4E4XA 4NSTA 2UUEA 3Q04A 1OKZA 2IW8A 5D1JA 3IOKA 4QP9A 5CU2A 3F61A 1YXVA 1XHAA 5CS6A 3VBWA 4BDAA 1SVEA 3L1SA 3GCQA 4AU8A 2RG6A 4F7SA 4HVHA 4FKLA 5K0XA 3ALNA 2WMVA 4EZ7A 3KK8A 1XBBA 4L68A 4ZAUA 5IEXA 3OT3A 2V7AA 3P5KA 5BVNA 5LVOA 4BVUA 2C1BA 4MXZA 2PWLA 1HOWA 3UQFA 2RFDA 4L7FA 4X2FA 3FKLA 4TN6A 5IF1A 4CFNA 2BVAA 3BYOA 1WMKA 3DKCA 5E4HA 3DT1A 2IW9A 3FMLA 1YWVA 1FQ1B 3Q4TA 1JSTA 2W1GA 1PXMA 2GCDA 3KCKA 3GBZA 4F7NA 2OI4X 3R8ZA 4EBVA 2IG7A 3C0IA 4KKGA 3CXWA 5CTPA 4KKHA 2CPKE 3MH2A 3E8NA 5JFXA 2J5FA 3OP5A 5LVNA 4XYFA 3I6UA 1JSUA 3AC3A 5C26A 5IQIA 2XK8A 3MA6A 3EZVA 2C6LA 4FV0A 2WTJA 1PXJA 4YTCA 4D1ZA 4XX9A 4FOCA 5HCYA 3TIYA 4XG4A 4DTBA 3F5PA 4L01A 4I5HA 4MTAA 4ARKA 4WIHA 2PE1A 2PMNX 4DEDA 4XBUA 3EHAA 2O2UA 1GOLA 4U5JA 4KS7A 1E9HA 1H1RA 5GIOE 2J0LA 4D2SA 3VBTA 3Q6UA 4BI1A 5C8NA 2UW0A 3PZEA 4I92A 3TNPC 4NL0A 3W16A 2PY3A 3RVGA 1Q4LA 4FSYA 2C6EA 2F7EE 3GVUA 5JKGA 2Y4IB 1PMUA 2VTIA 2WO6A 3FMNA 4YBJA 3SC1A 4J97A 5KHWA 2IPXA 4EJ7A 3FZTA 4NFNA 4O7YA 3MFRA 4W4YA 4W8DA 4RC4A 3TG1A 5KBRA 4AGWA 3VS7A 4PDSA 3CQEA 3H9FA 4NYEA 4D2WA 4CKIA 2BAKA 4QMOA 1R0PA 3GC8A 2IW6A 4W8EA 2WAJA 5CXZA 4GKHA 3COHA 1CKPA 3EQBA 3EN6A 3PIXA 1H08A 2A19B 4KSQA 4ORKA 4CMOA 3T3VA 3BRBA 3FXWA 3JPVA 5ACBC 5HX6A 2I1MA 2GTMA 4RJ4A 5EW8A 5AAFA 2P33A 3FMMA 3TV6A 3MVHA 4K11A 5H2UA 1J91A 2A27A 4RG0A 2I0EA 3G2FA 4GK3A 1JOWB 1VZOA 3A7IA 5AIKA 5HU3A 4E7WA 2ZYBA 4FTQA 4UZHA 5JRQA 4NM5A 2W5AA 4WRSA 2QI8A 4E6DA 2JLDA 3FZPA 2BFYA 4MQ1A 4O0YA 5CSVA 4BDKA 1LR4A 2JBOA 5AV2A 4QMSA 4RT7A 2VV9A 4IW0A 4FK3A 4DBNA 4CLJA 4APCA 1FMOE 3VHEA 4ZJIA 4ACGA 4AOTA 2W5HA 3JVRA 4A7CA 4WUNA 2BUJA 4HGSA 3IW4A 5HO8A 3WZDA 4P4CA 3LE6A 3Q5IA 3F5UA 4QMQA 4F63A 5AADA 5L2IA 2W4JA 4EOSA 5JQ8A 4Y5QA 5E7RA 1WAKA 3SOAA 4WRGA 2XK7A 4ASDA 5CXHA 2CN5A 4FOBA 4BZOA 3D0EA 5J1WA 3DFCB 4PDPA 4S33A 3KREA 3BV2A 4G17A 3Q5ZA 1S9JA 4DEEA 4JAJA 2DQ7X 3GT8A 3NIZA 4D0XA 3BYVA 4KD1A 2W99B 5HIBA 2GQSA 3QTWA 2R64A 3ET7A 2ITOA 1FBNA 3IOPA 4G6LA 4YP8A 3LCOA 3OS3A 3ZDUA 2C4GA 3W8QA 4ALVA 5JFSA 3RK5A 4LV5A 3TKUA 5AR2A 2BRGA 1H0VA 2X8EA 4HGTA 2B52A 2OF2A 4FTMA 2V55A 3LCTA 4O2PA 1OIRA 4AN9A 3NCZA 5I9ZA 5DRDA 3PE1A 4U44A 5AP4A 2R3KA 3BGZA 4G2FA 1PW2A 4BDBA 2X1NA 3NR9A 4CZUA 4ANNA 4QO9A 4YZMA 2UZOA 4PL5A 3GU8A 3FI2A 2JAMA 3POOA 4I24A 5EI6A 2ETMA 3AT2A 3E7OA 3FDNA 4Q5HA 3MYGA 3I7BA 4DFYA 3RCDA 3DPKA 1X8BA 4K2RA 4BDDA 4XG3A 3KXXA 1CKJA 3V6SA 1KE7A 3G33A 3GQLA 3NW5A 4GT4A 4I6QA 3NVMB 2C5VA 4LRKA 3C4EA 4DLIA 5B2LA 3V04A 2EWAA 3IS5A 3W55A 3FHRA 3LMIA 2E9UA 5C01A 4CEGA 2XRUA 5CWZA 5EHYA 2XRWA 5ETFA 3UQGA 5EOBA 2WEVA 4IM0A 2VWVA 3QZGA 5CF4A 1JKKA 2OICA 3GB2A 3SAYA 3VJNA 4I3ZA 3CD3A 5TO8A 3E64A 4OT5A 2YEXA 3KL8A 5ITAA 3VUIA 3GC7A 1PMNA 5C27A 2VWWA 3FPMA 3A7HA 3K5VA 4QPSA 4TNBA 3FXZA 3D7ZA 5J1VA 2XNNA 3BBTB 4FSRA 3DB6A 3PIYA 5K4IA 3HUBA 5HNGA 3D4QA 5GZAA 5HE3A 2R3LA 3KMMA 4FIEA 4HZRA 4F9CA 2ETRA 3CSVA 3PPZA 4GT3A 3AD5A 4UYNA 4AFJA 1WCCA 4L42A 3UZTA 2C6DA 4JBOA 3ZC5A 1Q8YA 3B8QA 4BDFA 4FF8A 4FZFB 4FZ7A 4D2VA 4X6RA 2XIKA 2VTOA 2YCRA 4R8QA 2JFMA 4RJ8A 3WZJA 4JDKA 2BALA 2QD9A 4FTNA 4JVGA 1YQJA 2XBAA 3I6WA 3QUPA 4G34A 2WMBA 4DFZE 3UOLA 3I79A 4BDJA 3DXQA 2B9JA 4TYEA 2XCKA 5ETCA 3QD4A 2W1FA 2GTNA 3KXHA 2BFXA 4XG6A 3LQ3A 3DLZA 1ZYSA 3IW6A 3TNIA 4IACA 5DRBA 3WYYA 4LMUA 4APPA 1XH9A 4YZDA 4CSVA 4DGNA 1H24A 5DNRA 3TWJA 5CX9A 3JY9A 5FTOA 2HK5A 4MXAA 4GYGA 2QQ7A 1V1KA 1V0BA 2XMYA 2Z8CA 4CZTA 3ZXZA 2XUUA 3CP9A 2X6EA 3NEWA 4BKZA 5E1EA 1CMKE 4PP7A 4BCFA 1Q8UA 2VD5A 4DEAA 4M14A 2EVAA 5EG3A 2XF0A 3CD8A 4WOVA 4CG8A 3H10A 2C3IB 3LXLA 4O2ZA 4ZZOA 5FDPA 4EHEA 4IX4A 2ITUA 2ONLA 5FTGA 4FYOA 4O7LA 4ITHA 1OGUA 4Q9SA 3F2AA 3DQXA 5DE2A 2UZUE 3E87A 4QMXA 4QP3A 3A7GA 3ZUVA 3LFSA 1PJKA 4IZYA 2DUVA 4PY1A 4KIOA 3U87A 3ACKA 3KXMA 4LL5A 5CZHA 3VBXA 3N9XA 4EOIA 5M4IA 2WPAA 4DT9A 4FV2A 4HPUE 2R3HA 4KINA 4KWPA 4RJ5A 4QMVA 3VULA 3QQGA 3UG1A 5KE0A 2VZ6A 4MXOA 3QCYA 4QRCA 4OBQA 1FGIA 1KOAA 1YVJA 2PMIA 2VTPA 4WBOA 2VO7A 3KQ7A 4JR3A 4M68A 1MQ4A 5E8XA 4E20A 4AW0A 4HCVA 3B2WA 4I93A 2VAGA 5ACKA 5AA8A 5CSXA 3WZEA 3TKHA 1KV1A 5IQCA 5EQEA 1WZYA 5HZNA 2DS1A 3OBJA 4J8NA 2EXCX 2J9MA 3QA0A 4PX6A 2YAAA 5FM3A 4C4IA 5AUUA 4FG7A 3SG9A 3R9RA 4G3DA 4FNXA 2V0DA 2YM5A 3ZDIA 4DITA 3SQQA 2PZRA 1Q8TA 5I9WA 4FKPA 5L4QA 4BCHA 2B55A 3ROCA 3V51A 4FE2A 3ZYAA 4AS0A 2UW4A 3OMVA 4HJOA 5JFVA 2C3KA 3DCVA 3UYTA 4I5PA 4X7QA 4ANOA 4FKJA 5IA3A 3P79A 3R7VA 3LFAA 1W7HA 2W1CA 4FT5A 2OJFE 2QKRA 3DZQA 2OZOA 5M57A 5IQAA 5E8YA 4ZK5A 4DFXE 3A7JA 3FHIA 3L9LA 3QKMA 4M7IA 3VUDA 4BCQA 2Z02A 1S9IA 5CZIA 3FY0A 4BCPA 3F3VA 5HNBA 3CPBA 4O1PA 3RBWA 4JRNA 3NW6A 2XNGA 4M84A 4U3ZA 4PDOA 4GFGA 3F6XA 3MN3A 4QMMA 2ZVAA 4P5QA 4M8TA 3U9NA 1U59A 1ZY5A 3I5ZA 4UWBA 3CQWA 4PWNA 3QUDA 1YOMA 1YHVA 4IMYA 3FE3A 3NNXA 4N6ZA 5HESA 4AW5A 4ZY5A 3LKMA 3KN6A 4F64A 4M66A 2YM7A 3SLSA 3QTXA 3AT3A 3QGWA 1BX6A 4II5A 1OITA 2UZEA 4JX3A 2VTSA 3HNGA 3NZ0A 3JY0A 3AD4A 2WIHA 3EB0A 4MXXA 3UIXA 3Q96A 4XV3A 1GZ8A 4IDVA 2LAVA 1KWPA 3KMWA 4D4RA 2VX0A 4C33A 3OVVA 3DXNA 4PP9A 2UVYA 1GJOA 2WMUA 4ZSAA 4RPVA 1ZOGA 5M08A 4XV9A 2ACXA 2WTDA 2J50A 4XG9A 4X2JA 3OUKA 4FSMA 3H0YA 4PL3A 2CCHA 1VR2A 3ZBFA 5B0XA 5FP6A 3KF7A 1MRVA 3DV3A 4I6FA 4QP4A 4ZLZA 4L52A 3QTQA 4J1RA 3RAHA 4GV1A 2I6LA 1NVQA 2FSLX 4A06A 3V5TA 5LMKC 5LCJA 3ZH8A 3ZCLA 1UU8A 4RBLA 4HW7A 5BPYA 4CG9A 3UC4A 2QLQA 3DLSA 1ND4A 4CYJA 5HTIA 3LCDA 2H96A 3RALA 5HORA 2PL0A 3DJ5A 4Y73A 3FI8A 2CDZA 1ZWSA 3K54A 3ZO1A 5BVKA 2O3PA 4FZDB 5LOHA 5HD7A 5IPJA 5TKDA 2WD1A 4P7EA 1MRYA 3KFAA 5AP5A 3G6HA 2Q0NA 2R3OA 3RHKA 5AP0A 2A2AA 3A2CA 4WG4A 3OBGA 3QL8A 2QR7A 4M3QA 1WBNA 4K33A 3R1QA 3UO5A 3U4UA 4IDTA 1Z9XA 5D7AA 2HZNA 2GS6A 4QP2A 4CGAA 2IN6A 3EN5A 4MD9E 4ZEGA 2VWIA 4IC8A 3HAVA 5DH3A 2XIXA 3LAUA 4IIRA 4F99A 5D10A 1FMKA 4K77A 2E2BA 3W10A 5FUTA 3DB8A 3D14A 3KCFA 5KKRC 1CDKA 2VTQA 4JOAA 3HL7A 3FMDA 1XO2B 4N0SA 2QURA 2XYNA 4ZJJA 4RGJA 2X2KA 1ZY4A 3BHUA 3D2IA 2JITA 4AGDA 3MH3A 4EUTA 5IDPA 4L7SA 3BU3A 1QPDA 3KULA 4EOJA 4GVJA 3SDJA 4GU6A 3Q4ZA 4FC0A 4PTGA 4D9TA 4J8MA 4IAKA 3NYOA 4K9YA 3LJ0A 2B9IA 2KULA 1GIJA 4OTDA 4CXAA 4YNEA 1P4FA 1NXKA 4JS8A 4KRCA 1REJA 4FR4A 4CFFA 2C5NA 4RVKA 3QQFA 4AX8A 3GI3A 5CSWA 5D12A 2YM4A 2REIA 5ANOA 2UZNA 3M11A 2PE0A 4BYIA 2FB8A 2XIYA 5HCZA 5CAQA 4K18A 4EJNA 2ZM4A 3HA6A 5EFQA 3LFFA 3RI1A 1LP4A 3W1FA 1CKIA 2ZM3A 4JG7A 4CFVA 3KULB 3KRXA 4C4EA 2WGJA 1UU7A 2OW3A 2RFNA 3LFDA 3NUYA 2OFVA 3HV7A 4GYIA 3HLLA 4RVTA 5DN3A 4BIBA 2WU7A 4EOMA 3QWJA 1JPAA 3RNYA 2GMXA 3ZO3A 4C4HA 4XV2A 3QD2B 4YPSA 5BYZA 5K5XA 2Y0AA 3A7FA 4ASXA 3KVWA 4U40A 1VYWA 3SRVA 1YDRE 4EOLA 2GFCA 3Q9WA 4LYNA 4O21A 3V01A 2XK4A 2WOUA 3B2TA 1OECA 3GU5A 4OTIA 4R3RA 5IEVA 5BVDA 4I5MA 4BCNA 3CC6A 4RC3A 1LPUA 2QHMA 2GNGA 4IWQA 4FIHA 4AZVA 3ORNA 3W2QA 3ORPA 4UX9A 3BQRA 4AFEA 3P0MA 3ZRKA 3ITZA 3UZRA 4JDHA 4QMPA 1YKRA 3MW1A 5EQPA 3ULIA 3QTIA 3EFWA 2R5TA 4YZ9A 3OW3A 4MH7A 4TXCA 3LVPA 4CRSA 4EH2A 1RJBA 3C4CA 5AR4A 1YWNA 2C3JA 3PXQA 4GG5A 4U41A 2PUPA 3F7ZA 4ZS4A 2XB7A 4C58A 3VS3A 4O6LA 5BYLA 2OXDA 1SNXA 4GFOA 4WA9A 4F9BA 3SRVB 4I23A 1OVEA 4DG0E 3FLSA 4RSSA 2OK1A 5F4NA 2AC3A 4C62A 3C1XA 5C8MA 1ZOHA 3PVUA 1Y6BA 2W5BA 1OPKA 4RJ3A 2R3RA 3DNDA 4ENYA 4QQTA 2GFSA 4YC8A 4ZIMA 4IZ7A 3VF9A 3DKOA 4CKRA 2R2PA 3BELA 2GNFA 3QAME 3R01A 3QX2A 1BI7A 4MF1A 1JQHA 5M55A 3R28A 1NY3A 1Q97A 4I21A 5FGKA 5T6KA 3NNWA 3WBLA 3F2RA 2XNOA 5K0KA 2BRBA 4FSNA 4D9UA 3NX8A 3K5UA 2XZSA 4PMMA 2GSFA 5CU6A 1UNLA 4F0FA 5BVFA 1PY5A 3R6XA 2E9PA 2AYPA 5KUPA 3ORMA 1PKGA 3I1AA 2UZDA 3MIAA 2XA4A 5EKOA 2B54A 3EFJA 2IWIA 4LUDA 3WF8A 3F66A 4FV7A 1EH4A 4IVBA 5LWMA 3MDYA 5AV3A 2HELA 3EMGA 2ITVA 3K2LA 4DH5A 3VRZA 5JRSA 3AOXA 5BMSA 2W1EA 5EYKA 3DDPA 4EC9A 4KIKA 4V04A 4DTKA 4DG3E 1GIIA 3QKKA 4M97A 5J7HA 2VU3A 3JR1A 2WNTA 4WG3A 1AGWA 3BX5A 3PG3A 4AW2A 1OBDA 3ID6C 3PXRA 4LFIA 5IA1A 1WBSA 4JQ8A 2V5QA 1XBAA 2BDJA 4CFUA 2A4LA 1Q24A 5KBQA 1QPCA 4UBAA 5J95A 2OU7A 4UXQA 4RFZA 4E73A 4B9DA 3RK7A 3MIYA 3BWJA 1OUYA 3QTRA 2BR1A 4JT3A 4WO5A 5EI2A 2OGVA 2YISA 5BVEA 2P4IA 3VBYA 5JQ5A 2NNWB 4E8AA 4F7LA 4EYMA 2H8HA 4KIKB 3NYVA 2PTKA 4FZ6A 4O22A 4O96A 1UA2A 5JGDA 1Y57A 2ZJWA 4EZ3A 3CTHA 3FZSA 5BVWA 1Y8GA 1UU9A 1V0OA 3HMOA 3KA0A 5CU4A 1ZZ2A 1ZYLA 4FKQA 4IAIA 4JI9A 3TCPA 3ZEPA 4F4PA 3GCUA 5JK3A 4M69A 5KMLA 3IPHA 2NP8A 1CTPE 5B7VA 4Q2AA 4N70A 2G2HA 3CCNA 4RJ6A 4YBKA 4FT7A 4FV1A 3M2WA 4EQCA 5FP5A 4OAVB 2J90A 2PHKA 4BZNA 3PUPA 4CTCA 1H1PA 3DJ7A 2OSCA 2YZLA 2SRCA 5M07A 4FGRA 4TWCA 1BKXA 3UVQA 5CAVA 4O7ZA 3DAKA 3HP2A 3LXPA 3OXZA 4DEBA 4WNKA 3VS6A 3ENHA 3FI4A 3FLWA 4BDHA 3R2YA 3MY1A 4J52A 4DFLA 1H1QA 1MP8A 1XQZA 3IKAA 4FTIA 4IZ5A 4WT6A 4EHGA 4X2KA 3NNUA 4ZJVA 4IQ6A 3VAPA 4W4VA 4CMUA 5J79A 2VTLA 2CJMA 5EH0A 4ANBA 5IKWA 5AUWA 3D15A 3U9CA 1JKTA 2YA9A 3L8VA 4M69B 2GPHA 4MWIA 4TYJA 4FZAB 2QOIA 4HZSA 3QRTA 4Y72A 4ZTMA 1ZMVA 4J96A 2Y7JA 3HRBA 1OL5A 3E5AA 4CTBA 3HZTA 3OEZA 3V8SA 4DN5A 2IVTA 3KC3A 4EZ5A 1M2RA 4NU1A 4JDJA 2JIUA 3VNTA 3TUBA 2J0JA 4Q5EA 3R9DA 4BCJA 5KX8A 3ZXTA 2UW5A 4FSUA 3W2PA 3LCKA 3QBNA 2F57A 4KSPA 4XH6A 5GJGA 2F9GA 2WOTA 4IB3A 4V01A 3TIZA 4F7JA 3FBVA 2R3QA 3ATSA 3PSBA 3QX4A 3PJ8A 1IAHA 1PKDA 2O65A 3R63A 4RZWA 4AOIA 2BHEA 5CEKA 2CNUA 4FEWA 4MNFA 4YJSA 4GFMA 2R7BA 1UNHA 3L8XA 4GS6A 4U6RA 3V5WA 3NAXA 4P90A 3VRYA 2GQGA 1O6LA 2Q83A 4XP2A 3H9OA 4JAIA 4TNDA 4MCVA 4UXLA 1OL6A 5I9XA 4EYJA 3O17A 3PSCA 3THBA 5M06A 4MBIA 5FBNC 2VO0A 1NW1A 2P2HA 2XS0A 3PPJA 2HZIA 5TF9A 2H34A 5A14A 3OXIA 4DFUA 1JKLA 1PYEA 2ZM1A 4JXFA 4C8BA 3SX9A 1YI3A 3CJGA 3IW7A 3QRJA 2QO7A 3HMMA 3CLYA 4RRVA 4O38A 1HCLA 3QF9A 4C37A 1H28A 1XBCA 2G2FA 5EM8A 5CQWA 5I4NA 4D2TA 3VS0A 3N4UA 4YUQA 5AP7A 4UWCA 3C51A 2WTKC 4F65A 2JDRA 3KVXA 4X2NA 3TNWA 4UWYA 1DS5A 3TDWA 3PFQA 5M44A 2WHBA 2HYYA 4BI2A 4NKAA 2PZYA 4R6VA 4BDIA 4EHVA 4O0XA 2JAVA 4XBRA 3P08A 4XOYA 1IA9A 1R1WA 4BCOA 3OUNB 4OTPA 4ZLOA 2CGVA 3PA3A 4MK0A 2RKUA 5IQBA 2C69A 3SGCA 4QMLA 3C5IA 2PZ5A 2ONLC 4EBWA 3NYNA 4V0GA 3EQHA 3MVLA 4HPTE 3RZBA 1J1BA 3PIZA 2NO3A 4HNIA 2UW7A 5CU0A 3FL4A 5CI6A 4I0TA 4BDGA 3QZFA 5LMAA 5DVRA 2QOCA 1REKA 5F94A 5HU9A 3QYWA 4RX8A 3KRJA 1Q8ZA 4RIWA 3VHKA 4M12A 2C6OA 5BUJA 4E6CA 1JBPE 4L3LA 4AZTA 4AZEA 2FUMA 2E9OA 4DFBA 3TT0A 4IFGA 1BI8A 3WARA 3FEGA 4WNOA 4I6BA 5ETIA 3LQ8A 3WF6A 2BDWA 3JVSA 4JG6A 2WMQA 2X8DA 4KBCA 5HICA 3NMUF 1KOBA 3NNVA 4QP1A 2C0IA 3MSSA 2VTNA 3WF5A 1R3CA 4R7IA 5AM6A 4ZP5A 4EOPA 3VQUA 4BGGA 2HXLA 4V0GB 3EKNA 5CEQA 5FTQA 5IQDA 4FODA 3VS2A 2BZIB 3R1SA 4BTMA 2FGIA 3EH9A 3W2SA 3N4VA 5HVYA 5AFVA 4C61A 4E93A 4IANA 4BBEA 2JDOA 4OTFA 3ZSIA 4ZXTA 3PPKA 3QQLA 4NTTA 2VGOA 4RIWB 3PJ3A 4E4MA 2VX1A 2P0CA 4FKTA 4U45A 2V7OA 4HVDA 5F95A 3HVCA 3WZUA 4FV6A 5JH6A 4C7TA 2WU6A 1DAWA 3DS6A 4HYIA 4Z9LA 4TW9A 4D5HA 1H0WA 2GS7A 4H3PA 4RMZA 1DI8A 2CKQA 3F5GA 2XEZA 5L6WL 2WTWA 5IQEA 3BBWA 2PYWA 4AWIA 4HVIA 3OY3A 3BLQA 2QOKA 3QD3A 1PXLA 4J53A 3UJGA 1GZOA 3NIEA 4ZMFA 4PRJA 3BQCA 2VO6A 3UNJA 2XKCA 2QKWB 3C7QA 4UMUA 2VN9A 3AD6A 3VW6A 4AT4A 4O7VA 4XUFA 4O0TA 1YRPA 2VGPA 2VRXA 3UGCA 3ZZEA 5IA0A 4C3PA 3EFLA 1PYXA 3MVMA 1XJDA 4E5BA 3R8UA 2ZDUA 2OO8X 1IR3A 1ATPE 1UKIA 3VBVA 2BDFA 4G16A 4H1JA 1B6CB 2G01A 4JBPA 4R3PA 4QTCA 3IGGA 3WE8A 1TVOA 2GU8A 4DBXA 5AM7A 1JNKA 3TN8A 2W1ZA 5H8GA 5EW9A 2YFXA 3HA8A 4U81A 2F4JA 2A1AB 2PVJA 2IVUA 2X0GA 3BZ3A 3MTLA 3PLSA 3UO4A 4NK9A 1RE8A 3MH0A 1OIQA 4YPDA 4U7ZA 2XCHA 2YZAA 3SW7A 4WNMA 3CEKA 3G90X 4JX7A 2CKEA 5AAGA 4IX5A 4QP6A 4N4SA 3PXZA 3HAMA 5AUXA 4EH9A 4YSJA 3DOGA 1OMWA 1QPEA 3DBQA 3LFQA 3OT8A 5T3QA 3E88A 4JJRA 3OTVA 4GL9A 5I9UA 2ZV9A 5I9YA 2RL5A 5J9YA 4RX5A 1OKWA 2J51A 2WMRA 1F0QA 3FPQA 5H9BA 2ZV7A 4PNKA 5ANIA 1OL1A 5IU2A 3NVKI 5EM5A 4A9RA 4W9WA 5FEQA 4CV8A 5IA4A 3AC2A 4TL0A 3TZMA 4IXPA 5J7BA 3AC1A 4YLJA 2Y9QA 3CGOA 3LXNA 2HAKA 3P23A 3QHWA 2J4ZA 3RM7A 3LHJA 3VUHA 3ZHPC 3CKXA 4R7HA 4JRVA 3UTOA 4CLIA 4ZS0A 3P7BA 4F0GA 5K9IA 2PE2A 1UWHA 2OIBA 3R0TA 2QOHA 5KMIA 4O84A 1FVRA 4A9UA 1PHKA 3FMHA 3DK3A 3MB7A 4GKIA 2PZPA 4EK5A 2WMXA 3U55A 2IZTA 3E93A 3HV6A 3V5LA 1W8CA 1U5RA 2JD5A 3DDQA 4J98A 1OL7A 4PL4A 4RIYA 3T3UA 3T8OA 2FSOX 5CT0A 4GU9A 1BLXA 4JL9A 4F9AA 4LV8A 2CNVA 3G9NA 3AQVA 4JBVA 5DI1A 3FI3A 2QC6A 2HOGA 5CF5A 1Q62A 1R78A 4F6WA 5KO1A 1J7UA 4A4LA 2QO2A 5H3QA 4BBMA 2WXVA 3R9OA 3LM0A 5IA5A 2HY81 2VTRA 1UNGA 4IM2A 4EK6A 2W06A 5M51A 4C4FA 4HYHA 4U97A 4BGQA 4O81A 3M42A 4KKEA 4Y83A 3ZRLA 4AE9A 3NS9A 3DAEA 2WTKB 1UU3A 4Y95A 4D4SA 1O9UA 2Z60A 4RIXA 5CAUA 4ZZNA 4C4GA 3QQUA 1WVYA 4U43A 5CF6A 5L2QA 4EEVA 1FVVA 4DF3A 2BKKA 5HIDA 2BZJA 2FA2A 5ANKA 4EWHA 4LUEA 5CENA 1OL2A 2XKEA 3QLFA 4HCUA 4XP3A 5HKMA 4PQNA 4QYYA 4L6QA 3R7YA 3WF7A 1UWJA 3QZHA 5HTBA 2RFSA 4RWKA 4AN2A 4ZSGA 4BI0A 2JKMA 1M2QA 3BHVA 4C4JA 2JDSA 5ANGA 3GQIA 4TPTA 4GT5A 4L00A 4S31A 3UMXA 5CVHA 3GCSA 2ZMCA 4FKVA 4BN1A 4C38A 1KUTA 4YTFA 3TV7A 4IBMA 4UZDA 5HVJA 5BYYA 3MBLA 4GK2A 2X2MA 2CKOA 2GS2A 4JIAA 4USDA 4NW6A 3EOCA 2CLQA 3PY1A 2HWOA 4L43A 1YHSA 2OBJA 2O8YA 3AXWA 3KGAA 4FSTA 2XNEA 4RIXB 5DHJA 5M4CA 5AR7A 2UZLA 4BL1A 4FKOA 3UVRA 4GIHA 4EH5A 3MPAA 3EQDA 2PVLA 3ROYA 2H6DA 4G5JA 4QQCA 5M4UA 1YI6A 3FQEA 3BYUA 3FAAA 5TR6A 5CAOA 3D7TA 1OKVA 3HGKA 2PU8A 4LGGA 2OH0E 5E8ZA 4S30A 5C8KA 2FSTX 4ANMA 2OZAA 5DBXA 4ACMA 4MQ2A 5JZNA 3ORTA 2DYLA 1UVRA 2C5XA 1H25A 2R3NA 3R71A 2VTTA 1ZXEA 3LFEA 4G9CA 3LQ5A 2I0YA 2NRUA 2JKQA 4MXYA 4FUYA 4PTEA 4R5YA 3ULZA 4CFMA 3VN9A 3W2OA 4B6LA 1QPJA 3ZRMA 4L53A 1V0PA 3C4XA 4M67A 3QZIA 4EKKA 4DE4A 1ZYJA 4NZWB 1H27A 2PVMA 4I94A 1H1WA 1YDTE 3LM5A 4JG8A 3A4OX 3FL5A 1DM2A 1GZNA 3TTIA 2YLFA 2AC5A 3R1NA 3FKNA 3VWAA 3ELJA 4ZSJA 3E63A 4AG8A 2WTVA 3D7TB 4AT5A 2YIYA 2C1AA 3IGOA 5AMNA 4RA5A 3UODA 3P9JA 3OFMA 5J9ZA 4CYIA 2OZAB 3AC4A 4E6QA 2Z7QA 4BGHA 4R1VA 3AG9A 4F08A 2ESMA 5AV0A 1ZZLA 4GG7A 3TZ7A 2P3GX 4FNYA 3FSFA 3O71A 5HEZA 5ETAA 2YCFA 2ITXA 4NWMA 5IH6A 2YJRA 4PUZA 5FM2A 5BUEA 4KBKA 3V3VA 4NTSA 1CM8A 3VBQA 2HZ0A 1I44A 4MBLA 2BAQA 5HHWA 3ZEWA 4YLKA 4O83A 5LJJA 2BRHA 1L3RE 4NFMA 3FY2A 4E4NA 4N57A 3OHTA 3R1YA 4IAYA 4DHFA 3MFTA 4LMNA 2G9XA 1PMVA 4O86A 4QMYA 4FIJA 3DK7A 4TRLA 5A4QA 5E9EA 3GOKA 4MKCA 4O0SA 3Q6WA 3BPRA 5TE0A 2IJMA 3HYHA 4G6OA 4LG4A 4WD5A 2EUFB 2XK6A 4EH8A 1IEPA 3VUKA 3QD0A 2JIVA 3GENA 3O23A 4WKQA 4L67A 3COMA 4RJ7A 5BUIA 2X7OA 5A54A 3OOMA 5HO7A 5CVGA 2R0UA 2VWYA 5EW3A 5TT7A 3I7CA 1RW8A 2QOFA 4ACCA 3GFWA 3LXKA 3ZBXA 3AMAA 5C1QB 4I6HA
chains in the Genus database with same CATH superfamily
3KKVA 2PVKA 2UW3A 4X3FA 2GQRA 4HVGA 3BL9A 2BZHB 2HW6A 5I3OA 2X4ZA 3OWKA 3FZOA 5BX0A 4ZZMA 2EB2A 4BTFA 4YO6A 3D94A 3H0ZA 4FV4A 4OUCA 4XLVA 5DOSA 5AWMA 4WBBB 3C0GA 3TUCA 5CASA 3SG8A 1BYGA 3VC4A 4O6EA 5GINE 3RNIA 5AX3A 5AIRA 1Y91A 4GMYA 4QYFA 5G1XA 3NYXA 1UKHA 2UZVA 4IE9A 4UMTA 4UALA 4NW5A 4A9TA 2C47A 4ZY6A 3P1AA 2JEDA 1PXKA 1Q61A 5DGZA 2BPMA 3DKGA 3FMEA 3R9NA 4I20A 3RM6A 5BQ0A 3K3IA 3GGFA 4BIEA 1IG1A 3U6JA 3ZFXA 2CGXA 3PVGA 4Y46A 5BVOA 1ZAOA 1FGKA 4L9IA 2VTHA 4YNOA 2G1TA 2VUWA 4E1ZA 3PRFA 3RPOA 2XH5A 4EORA 2XAOA 5EOLA 3ZLSA 2F2CB 2OIQA 3R21A 4TTHB 5GZ9A 4AA0A 4DCEA 4UMRA 3DBCA 4IH8A 4L8MA 3SXSA 3LFBA 2UZWE 5EM7A 4F70A 3VUGA 4DH8A 3DBDA 2F7XE 1SMHA 4O1OA 4ZTHA 3T9IA 4ERWA 5C03A 5HBJA 5H8BA 2BHHA 3EYGA 4AXEA 3ORLA 5IH4A 5JMSA 3EQPA 1IAJA 3QUEA 3IDPA 4ZSEA 5AP3A 1XH8A 4ACHA 1JVPP 2EXEA 3JS2A 2ERKA 4E5WA 3HDNA 2Y6OA 4U80A 5HCXA 1SNUA 4O0UA 3BE9A 3GFEA 3RK9A 4GUBA 3W33A 4EL9A 4TY1A 1LEZA 3FQSA 3MY0A 3PXKA 2W4OA 3ZLYA 5TOZA 4CT2A 4F9WA 4Q9ZA 2PVHA 3E8EA 3DU8A 4YJNA 3VF8A 1AQ1A 2I40A 3ENMA 2IO6A 4P5ZA 3ODZX 1M7QA 3HMIA 3PVBA 3Q4CA 1ZMWA 4IWOA 5EYDA 3HECA 3RAIA 5KMMA 4FVRA 2FVDA 1Q99A 4IADA 2YIRA 5M09A 3SW4A 3EQGA 4ACDA 4F6SA 2OF4A 1OIUA 4H1MA 4J7BA 4NT4A 3CJFA 5IG1A 4H39A 4NM7A 3WYXA 4BC6A 5E8VA 3UDSA 4C3RA 1NT2A 2OXXA 2W17A 4AT3A 1VEBA 3A4PA 4A9SA 1W2DA 3DBEA 4PTCA 4NJDA 3P7CA 3EFKA 1WBTA 1KE9A 2YDJA 4L44A 4FTRA 3RP9A 3HRCA 4CCUA 5A6OA 3DQWA 3AGMA 4E3CA 2GHGA 4W4WA 4FTCA 4MXCA 3R30A 1APME 2HXQA 3FYKX 3CIKA 5HBEA 2Z7SA 3CPCA 2R3FA 4AA4A 1XH5A 2ZMDA 4DH3A 4BRXA 2BILB 4PMPA 4I0SA 4ALWA 3PJCA 3Q9ZA 2YLEA 5FXQA 3RHXA 2LGCA 3L8PA 3O8TA 2R9SA 4QYGA 3F3UA 4I4EA 4IHPA 5A9UA 2QLUA 2O5KA 3OCTA 3UE4A 5JFWA 3BYSA 4EHZA 3I81A 3IDBA 5AP1A 3ZFMA 1YOJA 3NUUA 4YC3A 3UDZA 3F2NA 4AACA 2X39A 3MY5A 2JFLA 4MYGA 4G3FA 4PNIA 3OW4A 4AW1A 3AKKA 3EZRA 4XP0A 4BCKA 2VTAA 4RZVA 4F1MA 2PK9A 3VS4A 5IQHA 1KE6A 4IVDA 3WOWA 5IUIA 5EYMA 5J87A 2A0CX 2R4BA 3DFAA 2JBPA 3NUPA 4PMTA 5G6VA 3ZSGA 1G8SA 4B4LA 5CALA 1MRUA 4LOOA 4H36A 3VS5A 2OXYA 2Z7RA 4CVAA 2I7QA 2WZJA 3QXPA 4F1TA 3TL8A 3R83A 4O4BB 2B1PA 4DH7A 1RDQE 3R8PA 3WIGA 2QOQA 2WTCA 5DT0A 1OBGA 2PMLX 1SM2A 3ZOSA 3D83A 5CQUA 1YWRA 3ZSHA 4XEYA 3C0HA 4FUXA 4RWLA 1STCE 1WBWA 2UW6A 4XLIA 4CRLA 3I0QA 3FKOA 3IDCA 3TKIA 3NLBA 3RPYA 2ZB1A 2W05A 2BTSA 4GK4A 4GUEA 2BAJA 2CCIA 4PPBA 3PLAE 3DA6A 4H3QA 4OTWA 4EK8A 2XYUA 1FINA 2CGUA 2QONA 3HMPA 3MV5A 2XJ0A 4PPCA 3ZO2A 3FWQA 1PXOA 5CU3A 2Q0BA 2BROA 4G31A 4ID7A 2QO9A 4KRDA 1I09A 3R8MA 4BIDA 1YXXA 4DEHA 3HDMA 3OXTA 1ERKA 4YJRA 2YITA 4CV9A 2GNIA 2BKZA 2PMOX 4UV0A 3ERKA 3L9NA 3D5WA 1YOLA 4FI1A 3TUDA 2VTMA 3F5XA 3VQHA 4ZY4A 3ZM4A 3LW0A 2W7XA 3PWDA 3P86A 2ZV8A 3OD6X 5EQYA 2KTYA 2HWPA 1A9UA 3R9HA 1U4DA 4FGBA 2OG8A 4NIFA 4XRJA 3ZZWA 5FBOA 3S4QA 3D2KA 1M7NA 4EKLA 4S32A 5CEMA 5JGBA 3MESA 3LMHA 3MA3A 4ENXA 3C13A 3GNIB 5GJFA 3TTJA 4EQUA 1A48A 2ZDTA 3FV8A 4IJPA 3QC4A 3RTPA 2BRMA 3UDBA 4KA3A 3BLAA 5E8UA 5HBHA 2AUHA 3SXRA 4A9YA 5ICPA 4TWPA 3QQKA 2C30A 2WMTA 2R3PA 3A8XA 3ANRA 3FYJX 3ORIA 4AZWA 1E1VA 3CQUA 5HGIA 4BCIA 5AAEA 2X2LA 4MHAA 4XG7A 4DGLC 3LJ1A 4TT7A 2ITPA 2C6MA 5A6NA 2G15A 2QR8A 3D5XA 1PXPA 2HENA 2CSNA 4NIFB 1TQMA 1W0XC 4BY9E 1P2AA 3WZKA 3ZM9A 2OFUA 3PJ1A 1FVTA 5FDXA 1R39A 3NUNA 3PTGA 4FT9A 1XH7A 4ZSLA 3UIMA 1ZARA 2JKOA 4ITIA 4FTOA 5E1SA 5GNKA 3D5VA 4QPAA 3V5JA 4BICA 5M53A 4KUJA 2CN8A 3GEQA 2OIDA 3QCQA 5LVMA 5HLPA 3QWKA 5FEDA 5EHLA 3ACJA 1O6YA 4Y5HA 4FSWA 2YIWA 2RG5A 3ODYX 4D2RA 1SYKA 4LOQA 5DLSA 3E8CA 5IQGA 2XJ2A 4XHKB 4J99A 2W4KA 4C36A 2WEIA 4IM3A 4G6NA 2HZ4A 2CHLA 3UVPA 3ZS5A 5I5ZA 3QALE 2CLXA 5JT2A 3MTFA 3U54A 5FXRA 4M0YA 4DEGA 3PG1A 1GIHA 5A4TA 4ALUA 4FIGA 4RQKA 2GNLA 4O7SA 3CS9A 3RKBA 1AD5A 5IMEA 4C2VA 1TFFA 4H05A 4OBOA 4QOXA 4AGCA 4AZSA 3FJQE 4XNEA 3LOKA 5AR3A 2X9FA 1LUFA 5FG8A 4EH7A 4IVAA 2XVDA 3SA0A 4K6ZA 4ZTQA 3UNZA 3RAWA 1E1XA 2X6DA 3O50A 4NEUA 2UW9A 3EL8A 3OWPA 4IWPA 3GU6A 5B2KA 3TJDA 2PVNA 2ZV2A 4OTQA 3AT4A 4B8LA 1BMKA 2JKKA 3S3IA 2CNQA 3CBLA 1ZYDA 2BMCA 3COIA 4YZNA 3QC9A 3LPBA 5J8IA 4NH1A 4HNFA 3VVHA 4NCTA 3R00A 4GJ2A 3UMWA 3KN5A 5F1ZA 5D11A 1M14A 4EC8A 5A4LA 5CAPA 3TM0A 2VWXA 2XNMA 2I0HA 2Y8OA 3R2BA 4GH2A 4XV1A 3SVVA 4FG8A 2UZBA 3QKLA 3E62A 2YN8A 1NVSA 3RINA 2YACA 3D5UA 5HE0A 5L8LA 4LM5A 4U79A 4BHZA 3O8UA 4KNBA 2B9HA 3KK9A 3O0GA 4CMTA 1QL6A 4WNPA 1XH6A 2YM3A 3DTCA 4IB1A 4DINA 3EQRA 4BFMA 4PF4A 3MFUA 4DGOA 4J95A 1WVWA 4YJQA 4ZTRA 1BL6A 4QQJA 2H9VA 5EK7A 1T45A 2YIXA 4YJPA 3C4ZA 5HE1A 4EH4A 1GNGA 1W84A 5A4CA 2PVFA 1H4LA 2ITTA 2JGZA 2Z2WA 3ETAA 3FC1X 3KU2A 2R7IA 2UVXA 3LMGA 1TQPA 4FEQA 4QP7A 3MJ2A 2YCSA 2WKMA 3OWJA 1U46A 3PWYA 4DG2E 3QTSA 1YW2A 3AC8A 3P7AA 3V6RA 5I3RA 4R3CA 3DK6A 3UNKA 2P2IA 3ALOA 4UEUA 1L8TA 3TEIA 4AAYA 5CVFA 4YTIA 1URWA 5T68A 4C34A 2QG7A 3B8RA 4BWKA 3C5UA 4CKJA 2IZUA 1ZRZA 3F3ZA 1OZ1A 5CYIA 3HV3A 3FC2A 4OT6A 4EH6A 3V5PA 3WI6A 4CQGA 3FSKA 2YDKA 2XNPA 3PY0A 2CMWA 4IWDA 4NKSA 1Z57A 1YXTA 2IZRA 3E7VA 3TZ9A 1T46A 3UP7A 4ZLYA 1LEWA 1NA7A 4I5CA 5CEIA 4DAWA 3G0FA 4CFXA 3NFGB 4FT0A 3UC3A 2C6TA 2JDVA 3NDMA 4ITJA 4ONAA 3MGYA 2EU9A 4UYAA 3W18A 3TJCA 1ZLTA 4B8MA 4FK6A 3CY3A 2J2IB 3MB6A 5J5SA 4D1XA 5I9VA 5EDQA 3F7WA 1K3AA 4Z7GA 1K2PA 3S0OA 3TI1A 3ZLXA 5H8EA 5DPVA 4OTRA 1JAMA 3RWPA 4FEXA 2BRNA 2PSQA 1OPJA 1TKIA 2YWPA 3C4FA 3R02A 2GHLA 2FO0A 2C0OA 3ZUUA 4DTAA 4FG9A 2B53A 1GY3A 1PXNA 3MJ1A 3OY1A 4FL2A 5E91A 3UG2A 1UV5A 3JYAA 3O2MA 2WB8A 4GCJA 4R5SA 4X0MA 3S1HA 4DCAA 2B7AA 3WILA 2BIKB 3NW7A 3NUSA 4BYJA 4YHJA 4FV9A 4DC2A 1RQQA 3BU5A 1W98A 5IUHA 4DEIA 3Q2JA 4ZMEA 4FKSA 4EI4A 1PXIA 4JLCA 1YI4A 4S2ZA 4V05A 4EK4A 2JC6A 2VTJA 3MFSA 3PDTA 4KABA 5C9CA 2XM8A 3EJ1A 3F82A 1XR1A 4WSYA 3BYMA 3F3TA 3ORZA 5CT7A 3CKWA 4FVQA 5EHOA 5GIPE 1J3HA 1P4OA 5CSPA 5K5NA 3R7GA 2RFEA 2FSMX 4ANQA 4OR5A 1H1SA 4DH1A 2BCJA 2WMAA 4C3FA 5KMOA 3RCJA 3QTZA 1ZOEA 1DI9A 3KIOC 3FXXA 3DNEA 5CI7A 4Z7HA 3A61A 3S95A 3UZPA 3LJ2A 5AUTA 3R8VA 1B38A 4UMQA 1J1CA 2R3MA 4ZTNA 4S34A 2X7FA 5D7VA 4O0WA 5HI2A 4M0ZA 3KRRA 3RMFA 3UO6A 2R0IA 3VW8A 4BKYA 1FPUA 5IQFA 3BHTA 3Q60A 2QU6A 2ZOQA 3FLZA 2QOBA 2QOLA 3CE3A 5FEEA 4D2PA 5DR2A 4O7RA 3ZO4A 4BR3A 2YM8A 3AGLA 4PV0A 5LQFA 3MWUA 3S00A 4QQ5A 4WG5A 4LDTA 4C02A 3FLYA 4K0YA 3PYYA 4MWHA 5IZFA 3OG7A 1Z5MA 4HGLA 3QFVA 4F0IA 4O0RA 4YJVA 4EOKA 2WQNA 1OKYA 4CFWA 3OCSA 4IJ9A 4QP8A 4MBJA 2W1HA 3QRUA 3LFCA 3BWFA 4IB0A 3EIDA 4O4FA 5CY3A 3DTWA 5GZ8A 4C0TA 3R04A 3PY3A 4MX9A 4AA5A 4DDIA 2WIPA 3QQJA 3Q4UA 5DYJA 3SD0A 3GC0A 2IVSA 4FTLA 5E8SA 3QA8A 3NSZA 4XCUA 3QHRA 1JLUE 4OLIA 5E90A 3Q2MA 1OPLA 4ANSA 3EL7A 1PMEA 3G0EA 2J0KA 3NUXA 4QDEA 5CEPA 1W82A 4RFMA 5HNIX 3R22A 4ANLA 2YCQA 5AR8A 4XRLA 2PZIA 2VWUA 4IEBA 2CGWA 4H3BA 4F9YA 4EOQA 5AEPA 1BUHA 4I4FA 2YHVA 3BU6A 4AXDA 5IEYA 4YTHA 2BIYA 4I41A 5AUYA 4MEDA 4PDYA 3REPA 5L2TA 4IB5A 4FTJA 3FUPA 4ERKA 4FYNA 4G1WA 1WBVA 4FIFA 4X3FC 4XJ0A 5IISA 3EQCA 4OTGA 2V22A 3HUCA 4L46A 1P14A 3EQIA 2XAMA 4LRJA 4OAUC 3OTUA 4O82A 5KZIA 3E92A 1MQBA 4QTAA 5DMZA 1VYZA 1KV2A 3ZONA 4UMPA 2VO3A 3NWWA 4D0WA 5L6OA 3P78A 4FEVA 2YDIA 4RVMA 4D1SA 3HMNA 3ZMMA 4BBFA 2RSVA 3IONA 4C2WA 4CNHA 2OH4A 4KIQA 3DY7A 5AUZA 1H07A 2OWBA 2R3JA 5EDPA 4QNYA 5C4LA 3UPZA 5LARA 4FMQA 3GOPA 4LQMA 3UPXA 3QRKA 2XM9A 2W9FB 3BEAA 3VIDA 3R7EA 3TXOA 5KMJA 3RWQA 5L6PA 2ETKA 3U6HA 1DAYA 1NVRA 4AXAA 5LXMA 3W8LA 2C6KA 4DT8A 1MUOA 2C0TA 3LLAA 3KRWA 3ZLWA 3C50A 4JIKA 4PMSA 2IEWA 3OOGA 4RIYB 1JSVA 2C5OA 3EYHA 3GUBA 4BKJA 4JDIA 4BZDA 3BKBA 3G9LX 4FVPA 5HO6A 3L8SA 4IAZA 4IX3A 1PRYA 5CNOA 5D41A 1OB3A 3KY2A 5AJQA 3UIUA 4FL1A 4TYHA 2F2UA 4QD6A 1YXSA 4QTDA 3HX4A 4AE6A 4BWPA 4YJOA 4A4XA 3DGKA 3O5AA 3Q3BA 5KNJA 2X0OA 3U6IA 4QMTA 2C3LA 3IW5A 5ANEA 2HW7A 3R7UA 3F9NA 3SOCA 1YXUA 3I0OA 4HCTA 4FV5A 2VNWA 4E5AX 3V8TA 4RVLA 2VWBA 3BL7A 4KB8A 5LWNA 2XK9A 3HV4A 3KXNA 4MD8E 4IVCA 4YLLA 2WQBA 2JDTA 1SZMA 3C9WA 4UB7A 4Y85A 2YABA 3QTUA 1OI9A 3A60A 3OROA 4NUSA 3RPRA 5CNNA 3BLRA 2C6IA 1P5EA 3OCGA 2Z7LA 4E26A 3IK3A 4N6YA 5CEOA 4X2GA 5IUGA 5L8JA 3G51A 3II5A 4QTBA 4YGAA 3IW8A 4XOZA 2GDOA 3FLNC 3KEXA 4MD7E 4TYHB 5ANJA 4WSQA 4A07A 3O8PA 2DWBA 4DA5A 2J0IA 4QEBA 4I22A 4IC7A 3I60A 4IAFA 2ITNA 3PSDA 5L8KA 3L9PA 1F3MC 4NM0A 5JN2A 2J7TA 4HOKA 4EUUA 4DYMA 2WMWA 3PRIA 2XJ1A 4UY9A 4AN3A 5FLFA 3TACA 4F1OA 3E3BX 4CD0A 4RWJA 3OF0A 2NPQA 4ZTSA 2CKPA 4XG2A 5I0BA 3R73A 4AQCA 4LI5A 3DKFA 3H9RA 3PA4A 2E9VA 4QNAA 5HOAA 2WFYA 3FZRA 1URCA 4FSZA 5B2MA 4RFYA 1IRKA 2OJIA 4CT1A 2NRYA 1OUKA 3DAJA 1BL7A 2ITYA 4MAOA 1IASA 1ZYCA 5HG5A 3TNHA 5J5TA 4IAAA 2XARA 4M15A 4QMZA 3O7LD 4KS8A 2WMSA 1ZMUA 4L45A 1Q8WA 1YDSE 1SVGA 3COKA 3QYZA 5DA3A 5E8TA 3GXLA 4RX7A 2P55A 4AF3A 3RPVA 2B9FA 2QHNA 2W0JA 4DGGA 3MS9A 5L3AA 3JXWA 1JWHA 5LCKA 1Q3WA 4YJTA 2PUUA 2OJ9A 2B4SB 4O27B 3F69A 3MPTA 1H8FA 5AUVA 2EXMA 2JIIA 2GNJA 3S2PA 5JZJA 3G5DA 4L3PA 5HVKA 3VJOA 4GSBA 2XK3A 3FZ1A 4BWXA 1G8KA 5LVLA 5E92A 2QNJA 3M1SA 1G3NA 3OC1A 5EM6A 3PVWA 3BIZA 2GHMA 3NAYA 2PVYA 2QVSE 2V62A 4DLJA 4XG8A 4UN0C 3PE2A 2UZTA 4U42A 3QRIA 4RX9A 5HG9A 3FLQA 5AR5A 3PZHA 4U8ZA 4B7TA 4H58A 2BTRA 4HYUA 4IFCA 4GEOA 2Y6MA 2QODA 4LGDA 3UOJA 3D9VA 5BNJA 3VO3A 4OBPA 4O7TA 5JSMA 1F5QA 3PXFA 3KMUA 4R7BA 3L9MA 3N4TA 1K9AA 2PUNA 4P2KA 3QCXA 2FYSA 1QCFA 3NRMA 3EWHA 4LGHA 5DT3A 5A4EA 4YU2A 4O7WA 3KXZA 2WTIA 4TKSA 5DFPA 4ASZA 5HIEA 5EI8A 4TYIA 4F09A 4QT1A 2EB3A 3TDVA 3ML1A 2OJGA 4BDCA 2XIZA 4USEA 1TZDA 2YM6A 5KMNA 5FQDC 3ATTA 4QPMA 2IVVA 2R3IA 3AC5A 5DR6A 3UOHA 3V8WA 2RF9A 3K3JA 3MI9A 2J5EA 2VNYA 4IX6A 3R8LA 3A99A 1Y8YA 4YHFA 3POZA 4FBXA 5HLWA 5HD4A 1H01A 4KAOA 3NUAA 4R78A 2QU5A 1FOTA 4W4XA 5K3YA 3MH1A 4RC2A 3T9TA 4C59A 1WBPA 2F49A 5HG7A 3SKCA 4FICA 4GIIA 5AA9A 3G6GA 4JQ7A 3RPSA 5IDNA 5KCVA 1Q5KA 5M56A 5JEBA 2ZB0A 5CANA 4YR8A 3I4BA 1HCKA 4X3FB 5HTCA 4F78A 2C5YA 4O91A 5ANDA 3HRFA 4ASEA 4TZRA 2X4FA 4U3YA 4EK3A 5K4JA 1U54A 2PVRA 4MF0A 4FKIA 3LLTA 4U0IA 4D5KA 2C68A 2G2IA 4FIIA 2OJJA 5EYCA 4EWQA 1SVHA 5CLPA 4EQMA 3CGFA 4Z3VA 2XKFA 2XEYA 2O63A 3EN4A 3GCPA 4R1YA 3HP5A 4K8AA 4Y8DA 5BMMA 2PULA 1Q3DA 4TYGA 3IECA 3HEGA 4PPAA 4X6QC 2FH9A 5AP6A 3V5QA 2XP2A 3W2CA 3F88A 4EH3A 2QCSA 2X7GA 4FKWA 2HIWA 1WVXA 4Z16A 2F7ZE 3P4KA 2PUIA 3AMYA 5DIAA 2VWZA 4L3JA 3BLHA 3NGAA 4GJ3A 2ITWA 2WQMA 4G3CA 4JBQA 4W9XA 3AMBA 4BF2A 4G3GA 3IG7A 4BDEA 5HLNA 4YZBA 5F9EA 4AP7A 3G15A 1JKSA 4FV3A 4KIPA 2WQEA 4YSMA 3BHHA 3ORXA 3SHEA 3VS1A 3CY2A 3N51A 1U54B 3MPMA 2A98A 4NJ3A 1M52A 5FD2A 4CZYB 5IMXA 3VUMA 1XKKA 4QMWA 3PA5A 1R0EA 4I1ZA 4ZOGA 3KRLA 4D4YA 2Y4PA 4YJUA 3TZ8A 1B39A 5IA2A 5KHXA 3E8DA 4G9RA 3BV3A 3R7IA 2QG5A 3PP1A 4AGUA 5LVPA 1IA8A 3Q9YA 4BCMA 5HE2A 5E8WA 4G3EA 4BTKA 3HKOA 2O0UA 3GC9A 2HCKA 2VX3A 1KSWA 3QCSA 2UW8A 3C4WA 4TWOA 4XS2A 3IO7A 2YIQA 1XWSA 2YAKA 4FKRA 4JR7A 3W32A 5HQ0A 1A06A 5JGAA 4HYSA 4DGMA 3QLGA 5DWRA 4B99A 3RZFA 2XNBA 2Y4IC 5LMBA 3UP2A 4BJJA 3O96A 1WFCA 3GU4A 4Z55A 4YC6A 2ITQA 3GU7A 4ZTLA 4AOJA 4MNEA 2I0VA 4JQEA 4QTEA 2B0QA 3W0SA 4NCTC 2W1IA 3BHYA 3LIJA 4BB4A 1Y6AA 2WELA 4FV8A 5GHVA 3O7LB 1OIYA 3H4JA 4R77A 4FKUA 2YERA 2R3GA 3OWLA 4D55A 4RLKA 3O51A 3GCVA 4GW8A 1G5SA 3Q52A 2XBJA 3CTJA 3UIBA 3ZTXA 5AV1A 3QXOA 3LCSA 4X21A 2W9ZB 3UOKA 4FTAA 4YZCA 3BGQA 4USFA 3PP0A 4TWNA 5J9LA 4FNWA 3ZUTA 4D28A 3EN9A 5C4KA 2ITZA 2XKDA 2OKRA 2BZKB 4EOOA 4FA2A 5AV4A 4YURA 3QU0A 3Q53A 4BJJB 4J71A 4XMOA 3CTQA 1KE5A 5AX9A 2RGPA 3BEGA 3FQHA 4D58A 1W83A 4MNEB 3DJ6A 4YMJA 5HX8A 3A8WA 4RWIA 4BCGA 4KBAA 3JUHA 3RJCA 3UYSA 2E9NA 3WE4A 2GNHA 2X8IA 2YJSA 2IZSA 3U4WA 4LL0A 4F6UA 2YWVA 3DXPA 1H00A 3ANQA 3BGPA 1GZKA 4A4OA 3TNQB 5A46A 3RGFA 4O0VA 4E4LA 4OGRA 2ERZE 3GP0A 4RIOA 4RLLA 4FL3A 4YHTA 3H30A 4FNZA 4E6AA 5L2SA 5LMKA 1QMZA 1VJYA 4FT3A 3FMJA 4EONA 5DEWA 4OTHA 1YHWA 3F3WA 3E3PA 1Q41A 2PPQA 3NPCA 3BCEA 3KB7A 3OCBA 3EQFA 2X9EA 3LFNA 3I5NA 5CSHA 3U8WA 4LOPA 3LZBA 4O4CA 4LRMA 3EKKA 5DR9A 5HG8A 3ZC6A 4HVSA 2RIOA 1M2PA 3QQHA 3KXGA 5D9HA 4DFNA 1OM1A 1O6KA 5GJDA 2OLCA 4QMUA 3WIKA 1GAGA 4K1BA 4AAAA 4NM3A 4QYEA 5IH5A 2ZAZA 3ZU7A 5DT4A 4RA4A 3ZFYA 5CF8A 1U5QA 3Q9XA 2UV2A 4BTJA 1TQIA 3PXYA 5FWKK 4CQEA 4M13A 3KF4A 3A62A 2WQOA 3BE2A 2UVZA 2W1DA 3FMKA 3HV5A 5FXSA 3BI6A 3SXFA 4X3JA 1H26A 3RAKA 3CR0A 3SV0A 1M17A 5EDRA 2J6MA 4FSQA 4FTUA 3IQ7A 4RQVA 4AUAA 4B0GA 4YO4A 5DG5A 4FKGA 2HY0A 4QYHA 4WUAA 1G8AA 2QOOA 4O7NA 4G5PA 1J7LA 4AZFA 1XH4A 4CCBA 4C35A 3PJ2A 4I0RA 4FTTA 3OEFX 4HGEA 4JNWA 5AP2A 3H3CA 3DZOA 3UBDA 4C57A 5KMKA 3Q32A 4U9AA 3DBFA 3NCGA 5KZ0A 5L2WA 4GRBA 5FRIA 4QMNA 3UQCA 1CSNA 2W96B 1PF8A 3MVJA 4GVAA 2O64A 2XIRA 3ORKA 1J7IA 5A3XA 3W2RA 3U51A 2X81A 4FTKA 3QGYA 4IZAA 4OW8A 3TV4A 3VUTA 3WF9A 1KE8A 3EN7A 5DEYA 4FX3A 2J0MB 3OZ6A 2X0PA 3R7OA 1WBOA 3W0QA 4WHZA 5F20A 5EKNA 4BHNA 4D4VA 4MVFA 4FEUA 5KKRB 4E4XA 4NSTA 2UUEA 3Q04A 1OKZA 2IW8A 5D1JA 3IOKA 4QP9A 5CU2A 3F61A 1YXVA 1XHAA 5CS6A 3VBWA 4BDAA 1SVEA 3L1SA 3GCQA 4AU8A 2RG6A 4F7SA 4HVHA 4FKLA 5K0XA 3ALNA 2WMVA 4EZ7A 3KK8A 1XBBA 4L68A 4ZAUA 5IEXA 3OT3A 2V7AA 3P5KA 5BVNA 5LVOA 4BVUA 2C1BA 2X0QA 4MXZA 2PWLA 1HOWA 3UQFA 2RFDA 4L7FA 4X2FA 3FKLA 4TN6A 5IF1A 4CFNA 2BVAA 3BYOA 1WMKA 1XMLA 3DKCA 5E4HA 3DT1A 2IW9A 3FMLA 1YWVA 1FQ1B 3Q4TA 1JSTA 2W1GA 1PXMA 2GCDA 3KCKA 3GBZA 4F7NA 2OI4X 3R8ZA 4EBVA 2IG7A 3C0IA 4KKGA 3CXWA 5CTPA 4KKHA 2CPKE 3MH2A 3E8NA 5JFXA 2J5FA 3OP5A 5LVNA 4XYFA 3I6UA 4O4DA 1JSUA 3AC3A 5C26A 5IQIA 2XK8A 3MA6A 3EZVA 2C6LA 4FV0A 2WTJA 1PXJA 4YTCA 4D1ZA 4XX9A 4FOCA 5HCYA 3TIYA 4XG4A 4DTBA 3F5PA 4L01A 4I5HA 4MTAA 4ARKA 4WIHA 2PE1A 2PMNX 4DEDA 4XBUA 3EHAA 2O2UA 1GOLA 4U5JA 4KS7A 1E9HA 1H1RA 5GIOE 2J0LA 4D2SA 3VBTA 3W0NA 3Q6UA 4BI1A 5C8NA 2UW0A 3PZEA 4I92A 3TNPC 4NL0A 3W16A 2PY3A 3RVGA 1Q4LA 4FSYA 2AEGA 2C6EA 2F7EE 3GVUA 5JKGA 2Y4IB 1PMUA 2VTIA 2WO6A 3FMNA 4YBJA 3SC1A 4J97A 5KHWA 2IPXA 4EJ7A 3FZTA 4NFNA 4O7YA 3MFRA 4W4YA 4W8DA 4RC4A 3TG1A 5KBRA 4AGWA 3VS7A 4PDSA 3CQEA 3H9FA 4NYEA 4D2WA 4CKIA 2BAKA 4QMOA 1R0PA 3GC8A 2IW6A 4W8EA 2WAJA 5CXZA 4GKHA 3COHA 1CKPA 3EQBA 3EN6A 3PIXA 1H08A 2A19B 4KSQA 4ORKA 4CMOA 3T3VA 3BRBA 3FXWA 3JPVA