2OJGA

Crystal structure of erk2 in complex with n,n-dimethyl-4-(4-phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
337
Chain Sequence
b'FDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojgA01
2ITVA 3QL8A 3HMMA 2UZLA 4V04A 3TZ8A 4C33A 4BCFA 1H08A 1YI6A 2OIBA 2VV9A 4PF4A 3UE4A 3ZO2A 4DG0E 3PLAE 4YZ9A 3QU0A 4R5SA 4DGLC 1MRYA 3E63A 3FMDA 4FKPA 4QMPA 3BZ3A 2BRBA 4MD8E 4PMMA 5JRSA 3ZRLA 1KE7A 2WTJA 3NIZA 4GRBA 2YDIA 5EM5A 3QKKA 5AUZA 1VEBA 3NNVA 3IG7A 4WG5A 3PWDA 3N9XA 4AAAA 4TL0A 2XNEA 2IVUA 1CTPE 1YXXA 2ZM3A 4FTLA 3EHAA 4FV8A 4CTCA 5AP5A 5H2UA 2ZYBA 4P5QA 3TZ7A 4GIHA 2GFCA 3BEGA 4DGMA 1Z57A 3MFRA 4EH6A 5JFSA 5KMIA 4FYOA 1OKVA 4NM0A 3ZC6A 5DG5A 4UMPA 3EN5A 5ANOA 4MTAA 5F1ZA 4YTIA 2QODA 4XLVA 4EHVA 4HVHA 1RQQA 2CGWA 4K2RA 3EN4A 3IS5A 2CDZA 1GNGA 2REIA 5AX9A 1CKIA 2B52A 3R8UA 4K11A 3V5TA 5M4IA 2GS2A 4WOVA 4HZSA 4BCJA 4H3BA 1H1WA 3QUEA 5HNBA 2VTAA 5HZNA 4DA5A 3BV2A 2AC5A 5FEEA 5EH0A 2B7AA 2EXEA 3C1XA 3OS3A 2QOFA 4YC3A 4BDAA 2C6KA 1G8AA 3F3UA 5IH5A 2Q83A 2YA9A 4MXZA 3VC4A 1XR1A 4GMYA 2P2IA 4QTBA 4AS0A 4BHNA 4FKJA 4MXYA 1OVEA 4L43A 4XRLA 1Y57A 5M07A 3TM0A 5EHLA 3ZCLA 1H8FA 4ACCA 4BY9E 2VGOA 3FZPA 3HA6A 4FF8A 5K9IA 3P9JA 3WIGA 4KRCA 5L2WA 1P4FA 5FP5A 1OECA 2WB8A 3NYNA 4ZY6A 3BI6A 4E6CA 3TKHA 4TXCA 4K18A 2NRYA 3LMIA 5DIAA 5AEPA 4O86A 3ORIA 4PPAA 3DGKA 5JQ5A 5ANJA 1Q8TA 3U54A 1PXKA 2PVNA 4QMZA 5JKGA 4H3PA 1E9HA 4RZWA 4CYIA 4EK8A 3G5DA 4BCHA 2ITTA 1OUYA 1SZMA 3EN7A 2X9EA 3SW4A 5E91A 2WD1A 3QD4A 3MN3A 2R0IA 5BVEA 2WMUA 4GH2A 2W4JA 4JG7A 4E8AA 3P79A 1Q3WA 4HVDA 2V55A 2PVFA 1Q61A 5HTBA 5IKWA 1U59A 3HDNA 5HNGA 3WE8A 3WYYA 2XIRA 4ZLZA 2Y7JA 4S34A 5ANIA 3QRTA 3QD3A 3R63A 2DS1A 4FTJA 4IXPA 4XRJA 3VBYA 3C4XA 4FZAB 4FSWA 4D0WA 5M44A 4J8NA 3GCVA 5IMXA 4USDA 3UC4A 4C4IA 4WHZA 5CAOA 4ASDA 4CFUA 4EKLA 3ZSHA 4TYEA 1YOMA 5EKOA 1WZYA 4S31A 3W32A 4AZFA 4BCMA 2XBJA 4WBBB 3EQDA 3LW0A 4GS6A 5BVKA 3UIUA 4FEWA 4CKRA 3DTWA 4C4EA 1PKDA 1YOLA 4FV9A 4K9YA 3ORNA 4OTRA 2BTSA 4U97A 1XKKA 4FKOA 4CG8A 4EZ5A 4KBCA 4TYHB 3E8NA 4O2PA 2HW7A 3MPTA 4RIWB 4YMJA 3GGFA 3RI1A 2R9SA 4I0TA 3FEGA 5EHYA 2YDJA 2C0TA 4CFVA 4C57A 3AG9A 4DLIA 3KN5A 3QALE 4L6QA 4UWYA 4EL9A 4GKIA 3OVVA 5KZ0A 3KY2A 3PPJA 2X6EA 2B55A 1QMZA 5J5SA 1PHKA 3HP2A 3IGOA 4LV5A 4RJ7A 3V5PA 4F7LA 1UVRA 1L3RE 4ZJVA 2J7TA 1TQPA 4O0VA 3Q4ZA 4FV0A 2WTIA 3GC9A 5IA1A 5CZIA 4XOZA 4NWMA 4ANLA 3WZDA 5B2MA 5BYLA 3PVGA 4XX9A 2OXDA 2QO9A 4FV7A 4CFMA 2Y0AA 2UZOA 4NIFB 2ITPA 4O38A 3JY0A 3VUGA 4BR3A 4BKZA 3ATTA 5C26A 4V05A 1DI8A 3TTIA 4I41A 4BDGA 5BUIA 1W0XC 4Y73A 4FOBA 4I6BA 5AX3A 3M11A 4C3PA 3JR1A 4ZMEA 4I24A 3KMUA 2GNIA 3GU8A 3DPKA 2X2LA 4Q9SA 4ALUA 3A8WA 2BZKB 5CSVA 3TACA 1PJKA 3DTCA 4CV8A 4BVUA 4C35A 4E20A 5LVMA 3NSZA 1PXIA 3R7UA 3F6XA 2YEXA 3QYWA 4AZVA 4AZWA 2W06A 3NAYA 1GJOA 4HJOA 4EOJA 2XK6A 1CKPA 2VAGA 3V5LA 2X39A 2J0MB 2YCRA 3TNIA 3ZTXA 3BU6A 2VWXA 5DH3A 2IG7A 4KKHA 5EK7A 5DEYA 2EUFB 2VTHA 4EHEA 4EOSA 4A07A 4LL0A 3FSFA 2PE1A 4E93A 4TPTA 4O0RA 2CPKE 4RQVA 3W2CA 1PMEA 3VHEA 4HYUA 4BHZA 2VTRA 4EQUA 4FG7A 3LE6A 1U5QA 5I9ZA 2G2HA 2W1DA 5H8EA 2ZM4A 3UPZA 2QC6A 3COMA 3QWJA 3LFAA 5D7VA 3HX4A 4ZTLA 3N4UA 5CNNA 4I23A 1QPCA 4D2VA 5F9EA 1PF8A 3EFKA 3Q4CA 4EH7A 5A46A 4F1MA 5HTIA 3LFBA 4KIKB 5C27A 4FE2A 2PMLX 4FT5A 4AE9A 5A6NA 3NW6A 3I81A 2WTWA 4QP7A 5EFQA 3SRVA 2R64A 2PVHA 3GENA 3VBQA 3VBTA 4ZJIA 1BX6A 1CDKA 3QQUA 3R2BA 4XH6A 5HD4A 2Z2WA 4DCAA 2QLQA 2WU6A 4M69A 4ACGA 2HELA 1WFCA 1YDRE 4IX4A 4EOOA 4RIXB 3DK6A 5CU3A 2BCJA 4GW8A 5DHJA 4S33A 2WMBA 2X4ZA 5FLFA 4BDJA 4CQEA 1FGIA 4AA4A 5DGZA 2HW6A 3BYVA 4WSYA 3A2CA 1GIJA 1U54A 3GP0A 2QI8A 1ZOEA 4IB0A 2PE2A 3NUNA 4WG4A 4EH2A 3MH3A 4FKLA 3ODZX 3PVBA 2OJIA 4YJNA 4M0YA 4NFNA 5E92A 3R83A 4BZOA 4HCUA 3Q04A 3IDPA 3L8VA 3LCSA 4IAAA 2VNYA 4IVDA 1T46A 2O8YA 5CF4A 5KMMA 4G9CA 4CFXA 2QR8A 1KE6A 2C3KA 3PY1A 5EI8A 5AV3A 3RALA 3UO6A 4DG3E 4YO4A 3D7TB 4U3YA 3VS1A 3W10A 1OL7A 3FLZA 2QKWB 2VWIA 4MEDA 5CI6A 1Y6AA 1IA8A 4RG0A 5I0BA 4E5BA 4QO9A 4CLJA 2W9ZB 4QRCA 5IZFA 4RWKA 2J6MA 3Q4TA 2ETKA 2G2FA 4Y5QA 3R9RA 2VO6A 4EHGA 3R9HA 3AQVA 3IECA 1XBAA 2JGZA 4RIOA 3AGMA 1OPKA 1OL1A 5CEMA 3NWWA 4PX6A 5B0XA 1YQJA 2PHKA 4QYFA 3R2YA 3HDMA 3KXXA 4FEQA 4YZMA 4OTHA 3TL8A 5IQBA 3FUPA 2ZB0A 1LR4A 2PL0A 3BEAA 4JQ8A 1XH4A 2VU3A 5IQCA 1Q8WA 2YDKA 5J5TA 4XV9A 2R3MA 4QTAA 4QT1A 3ORPA 3C4FA 4FSRA 5L2IA 3MJ1A 1SVHA 3CLYA 3R01A 2QG7A 5AP3A 2JDRA 4AT3A 4ALVA 5L2TA 3TNQB 1OBDA 4YTHA 3E7VA 4MWHA 5EI2A 1SMHA 3ZM4A 2YISA 2AUHA 4D4VA 3P7AA 3N51A 4N4SA 3DJ6A 3I7BA 1W8CA 1GIHA 4BTMA 4W8DA 5AV4A 4F6SA 3R1YA 3GVUA 1KV1A 3MA3A 3DBEA 4R3CA 4FEUA 5HQ0A 4O7NA 5CZHA 3OY1A 4BWXA 3PVUA 1YWNA 5D11A 3DU8A 3VUMA 3C0GA 3P0MA 5FBNC 2F57A 2XBAA 1R0EA 3CSVA 2R3QA 2VZ6A 4BCOA 5TOZA 4JS8A 3MFSA 1BYGA 2JDSA 3MYGA 3CQWA 5ETCA 5LVLA 3QTSA 4FC0A 4RC4A 3UNKA 4O91A 4DFYA 1ND4A 4UWBA 3CY2A 5EOLA 2OFUA 5KBRA 4KUJA 3LM5A 1BMKA 3LQ5A 4CVAA 1P4OA 4YO6A 2ITUA 4DT8A 3FI3A 2WMTA 2GQGA 4JDJA 4PL4A 4RC3A 2XK8A 3IKAA 3ORTA 3G2FA 4QMTA 3PDTA 4LI5A 3ZO4A 3WZUA 3COHA 5GIPE 1RW8A 2YM5A 4OGRA 4RIYA 2CJMA 1QL6A 3FMNA 3R9OA 1ZYCA 4N70A 4JRNA 3RPYA 1H00A 3L8SA 5CANA 4GCJA 4MNEB 4BWPA 4DFNA 1PYEA 4DC2A 5C1QB 1DS5A 1UNGA 4FKGA 4CEGA 1ATPE 5M06A 4ITJA 4WNKA 2YIYA 3CD8A 3ZUVA 3BYUA 2HWOA 2YN8A 4Y95A 2Y4IB 3R8VA 2JITA 4YSJA 3ORLA 3QD0A 3BLHA 4WNOA 1P14A 4WSQA 1O6LA 1UWHA 3NNUA 2GPHA 3VNTA 4PNKA 3VS7A 2ITZA 4C58A 2HZ0A 4RJ5A 5EM8A 2X2MA 3R0TA 4F63A 4ID7A 5D1JA 4EI4A 1JOWB 2F9GA 4KABA 2IWIA 3OTVA 4R77A 2R4BA 2X4FA 4HOKA 2QU6A 2C4GA 3V6SA 2HIWA 4EOIA 4MF1A 2WMSA 3P7CA 4Y83A 4EONA 3S0OA 2QNJA 3LM0A 2BKZA 2B9JA 2JBOA 4KWPA 1MQ4A 2X8EA 3CY3A 3ZBFA 5EW8A 3C50A 3E92A 3L1SA 1FBNA 3HV3A 2QHMA 4EQCA 4GKHA 1B6CB 3NCZA 3GI3A 5AFVA 4CZUA 3H0ZA 4EOLA 3DS6A 5KBQA 4U44A 5FGKA 4AOTA 4C62A 1XO2B 4RFYA 4XP0A 4MK0A 4IX5A 4FTNA 5E9EA 1Y6BA 2E9VA 4F9CA 4ERKA 4AGDA 4DGNA 1KOBA 3FQEA 3SQQA 2EXMA 2BILB 1JBPE 3VVHA 1F0QA 2ITXA 4CMUA 1H0WA 1X8BA 4DAWA 4E4NA 4YJSA 4PP7A 4FNYA 4H58A 4JR7A 4D4SA 3H9RA 3S2PA 3WILA 1E1VA 3KB7A 4BCNA 5BPYA 3DZQA 3NUYA 1R78A 4ZLOA 2BRMA 4DYMA 3MVHA 4A9TA 4GJ3A 2WTKC 5HICA 3H9OA 1OIYA 5M4FA 3S4QA 3CKXA 2JFLA 2BDFA 4P5ZA 4ZTMA 3LLAA 2VX3A 1RE8A 3C51A 3UNJA 3RAKA 1UNLA 4UWCA 4BB4A 2HZIA 2XCHA 3HEGA 3R8PA 4OTPA 4CGAA 3BU3A 4XLIA 3G9LX 4JT3A 5A3XA 3C5IA 3SXSA 3TEIA 2HXQA 4XG6A 1DM2A 5I3RA 4G3GA 2CHLA 5HO8A 1OPLA 4MAOA 5DI1A 1SM2A 4RWIA 3AGLA 4M84A 3FDNA 2WIPA 4BTFA 4V01A 3TWJA 5AP7A 3TNWA 3HV6A 5IISA 5T68A 3ZXTA 3PYYA 4AF3A 2YERA 3FC1X 4ASEA 3M1SA 4P4CA 5FM3A 4EK5A 4FSZA 3UQFA 4YUQA 4O2ZA 1IR3A 3FLSA 4QQCA 2PY3A 4MXOA 3PJCA 3LXLA 4RMZA 2GHMA 3DK3A 3EQCA 3EL8A 4BBEA 4L3JA 4ANBA 2H6DA 3FI2A 4JG6A 2C5YA 3OW3A 2WXVA 3I7CA 4RLLA 2P4IA 3H10A 5DFPA 3OT3A 4BCQA 4D2SA 2W1FA 3QTWA 1WVXA 2OH0E 3LFFA 4I5CA 4FIHA 4B0GA 4CFFA 4O7VA 4BL1A 3FMJA 4B6LA 4JL9A 3RK9A 4U81A 3JXWA 2FA2A 3A7HA 4J97A 3BHYA 1XH6A 4QTCA 1KUTA 1JKSA 4OBPA 3HMNA 4L68A 3Q9YA 3GC7A 4Q5HA 2PVLA 4Z3VA 4CKIA 3PA3A 4YZNA 5HCXA 2YIWA 2OWBA 3POZA 4G6LA 4XP2A 3WZKA 3ZU7A 4XNEA 4ZXTA 3EKKA 3IO7A 4O1PA 3LCOA 5TE0A 2R3JA 5AIRA 3OCBA 1BI7A 2X0GA 3CTHA 5C01A 5HEZA 1FINA 4K6ZA 3G90X 5FXRA 2CGVA 1XH8A 3TDWA 5LVPA 2V0DA 4BIEA 3KXZA 4X0MA 3SGCA 1STCE 1TQIA 3FY2A 4IWPA 3V51A 5A14A 4BN1A 3D9VA 4ALWA 5CNOA 4B8LA 5ETAA 4PUZA 2YWVA 1RDQE 4FSTA 4RX7A 3HUBA 4O7RA 3R30A 4RLKA 3QRJA 5HBHA 4ERWA 3Q4UA 5K5NA 4GYGA 4R78A 2P55A 3AMAA 2JEDA 3G0FA 4FBXA 1NVRA 2XEYA 4FSQA 4FZDB 3O17A 1OUKA 1LUFA 5EM7A 4XG8A 2GS6A 1O9UA 4A9YA 3A4OX 3I0QA 4FVRA 2IVTA 4AACA 3OUNB 3QTZA 4YZBA 4FTAA 2Z7RA 3NS9A 3LJ1A 4AZTA 2X9FA 5FDXA 4FUXA 4C4GA 1V0OA 4H39A 1BUHA 4I94A 5E1EA 3ZLSA 3QLGA 2BRHA 4FSUA 5ETFA 5FP6A 3ZDIA 4HVSA 2BROA 5HTCA 4R7BA 3FMKA 2UW5A 2XIKA 5CASA 2Z7QA 5IQIA 2UZVA 3ORZA 2HY81 5IA4A 3ORXA 4D5HA 1PXNA 1LPUA 1H1SA 4FG8A 1V0PA 2A1AB 1Y8GA 3OWKA 2VWZA 2WQBA 2NNWB 4S30A 3DA6A 3IW6A 3UG1A 3C4EA 5J9LA 3VW6A 3EQBA 5AA8A 3UG2A 3F88A 1YI3A 1URCA 4X3FA 4PDPA 3FBVA 3CR0A 3WI6A 3BQCA 2PULA 4PDOA 2EU9A 2B9HA 2JKKA 5E8UA 4C4JA 5LWNA 4WUNA 4D55A 1YWRA 5DN3A 3BGZA 3TZMA 3KQ7A 4BF2A 5JK3A 4I6FA 2I0HA 2V62A 3CJGA 3SXFA 5HG7A 1K3AA 4N57A 2YACA 2VTJA 3ZUUA 2OBJA 4GT3A 3PE1A 1O6KA 3TNHA 5D41A 4RQKA 5CXHA 4X2NA 2IVVA 2FYSA 4DEGA 1PW2A 4FKSA 2W1IA 4AX8A 4OLIA 3ZONA 5AUTA 3ROYA 4NTTA 3UIBA 4F70A 5FXQA 4KS7A 4ZTHA 4E4LA 4GUEA 2CCHA 3NIEA 3FI8A 2YM3A 5AWMA 4GK3A 4BWKA 3N4TA 4LRMA 4FTKA 4IZYA 4MKCA 5FQDC 3VAPA 3WIKA 3KN6A 3T3UA 4C38A 3V04A 4BBFA 2VX1A 4OUCA 3PY3A 5LJJA 4I20A 1BI8A 4ANNA 3EQHA 3EZRA 3W8LA 2WFYA 1VYWA 3DK7A 5H8GA 4UN0C 4ACHA 4HVGA 3W55A 3TKUA 5CAVA 1UA2A 3ZH8A 1BL7A 2BAQA 4UY9A 3COIA 2BHHA 1WBNA 4O6EA 3DKCA 4GUBA 4JI9A 1M2RA 3PSBA 4G1WA 5HNIX 4TNBA 2VTMA 3KULB 2IW6A 3OBJA 4XJ0A 1OKYA 3PPKA 1UU7A 3PG1A 3ZFMA 2WKMA 5FTGA 3HAMA 3O8TA 3BCEA 4QMMA 3VUHA 4O81A 1JPAA 3P78A 5ANDA 1H4LA 2OK1A 3QTIA 4NFMA 4TWNA 3AOXA 5AAGA 3A4PA 5HVYA 3VHKA 4D4RA 1ZAOA 5AP2A 2UZNA 3OXZA 4ZMFA 4MXXA 3TTJA 4H1MA 3NX8A 2FB8A 3GBZA 4OR5A 4QP3A 4OAVB 4IVAA 2OGVA 3VS2A 5E8SA 2GNLA 4GU6A 4LUEA 4XV2A 4DEHA 5GZAA 2I0YA 3Q32A 3W2QA 3IGGA 4EOPA 4QYYA 5L2QA 2VWYA 2XM8A 1ZOGA 3ALOA 3VBVA 2WGJA 4FV4A 4QQJA 3W2PA 3G6GA 3ZXZA 5CU2A 4G6NA 4BIBA 2XP2A 5IMEA 3UQGA 5HIBA 5HVJA 4ZK5A 4RFZA 1KE9A 5HGIA 2W5AA 4GV1A 4X3FC 5JN2A 2G1TA 4MD7E 2Y9QA 5GZ9A 2OXXA 4E7WA 3MDYA 3MIAA 3H9FA 3BHVA 4NKSA 4NZWB 4W9XA 3BGQA 4FNZA 4IHPA 3IW5A 4C0TA 3AC8A 4YTCA 2ESMA 2RGPA 1IASA 3EQIA 3R28A 5ETIA 4JIAA 2F7XE 3EH9A 3W33A 5AP0A 5CEKA 4JR3A 3P7BA 4XHKB 3R71A 3QKLA 2EB3A 3DCVA 5J87A 2WMQA 4Y46A 4EC9A 2BRNA 3FZRA 5GHVA 4TWCA 4XEYA 3NYVA 5EI6A 5BMMA 1Q8YA 1A06A 3PG3A 2YM7A 1OITA 1Q62A 3D5UA 3MFTA 5L8JA 4TN6A 4A9SA 5IQEA 3MY0A 4AWIA 4YLKA 4LRJA 5HG8A 3W2RA 4AXAA 3WF8A 3FWQA 3U4UA 1PYXA 2UW7A 1Q3DA 2WMVA 4O7ZA 3B2WA 4CSVA 3MY1A 4MBLA 2WQMA 4AW2A 1H28A 1APME 4V0GA 4U0IA 4C8BA 5CF8A 1M7NA 1J1CA 2WO6A 3MH0A 4FKVA 5HOAA 3I4BA 2W0JA 4ANSA 3O7LB 3O0GA 3QX2A 3F5PA 2VTLA 1T45A 2P3GX 4FUYA 4UYNA 3SX9A 2ZDUA 3F82A 1FVVA 3LZBA 3OEFX 3MJ2A 3KF4A 4I0SA 4I93A 4NU1A 3WF7A 2HY0A 3MESA 4IFCA 5AV1A 1Z5MA 2VGPA 3DY7A 4C2VA 2G2IA 1OPJA 3DT1A 4I0RA 4EH5A 3UOKA 2C6IA 4NM3A 4RFMA 5ANKA 3FXXA 2FH9A 2UUEA 3B8QA 5CQWA 3P5KA 3QQHA 4KS8A 3F3VA 4KB8A 1JKTA 2UVYA 3E7OA 5EHOA 3UNZA 1A48A 3F7WA 4L53A 5BYZA 2CKPA 4EJNA 2QONA 2OFVA 1RJBA 3LXKA 5J95A 2R3FA 3LCTA 3C4ZA 2ACXA 1H1RA 2X7OA 3ANRA 4DEBA 5IEXA 4IB1A 4IANA 2YHVA 3OROA 4CRSA 2ITNA 4M14A 5AMNA 4F64A 4UV0A 2PK9A 2LGCA 2WMRA 2UW6A 3BHUA 2A4LA 4C37A 3KXGA 4FG9A 5BMSA 3OF0A 3V3VA 4RA4A 4BGHA 1P5EA 2ZOQA 4F9YA 3UQCA 3Q52A 3QCQA 3FI4A 3R22A 2IZTA 5AAFA 3UP2A 5HE2A 3CGOA 4LGGA 4FGRA 2VD5A 5JFWA 3GEQA 2BZJA 1SYKA 5HBEA 4BDKA 4D2PA 3TV6A 3RTPA 3G0EA 3BKBA 2I40A 4DFBA 3PXRA 5F4NA 2WZJA 3F5XA 3VUIA 1BKXA 2WAJA 1IG1A 2RFNA 3P86A 3SA0A 3WOWA 3PZHA 3F2AA 4FKIA 2WMXA 4C4HA 1MP8A 2CGXA 3LFQA 3OFMA 3V6RA 1UWJA 4NJDA 5I5ZA 3U4WA 3QTUA 2GNJA 5HESA 3KU2A 3KRWA 4DEDA 3UO5A 4DCEA 3V01A 1YXTA 4NKAA 5IDNA 3I0OA 3FPQA 2X2KA 3ZM9A 4RPVA 1FVRA 4QTDA 3VS0A 2R7IA 3ZC5A 3C0HA 2VWBA 3Q96A 3FZTA 2RKUA 4GG7A 4I4FA 5AP4A 4FV3A 4AN2A 2VO0A 3KA0A 2B54A 2HWPA 4FMQA 4EWHA 2P2HA 4L7SA 1NW1A 1WVYA 5K5XA 1K2PA 2C6DA 5HLNA 5GINE 3DXPA 4FTRA 3FE3A 2OKRA 1OIUA 1ERKA 3QXPA 2O65A 2I0VA 4UALA 4BI0A 4RGJA 2XNBA 1UU3A 2UW8A 4XG7A 4AW0A 2QQ7A 4CCUA 3EYGA 3AT4A 3I6WA 2W96B 3HV4A 4ITHA 4LL5A 4O7YA 4JX7A 4ZP5A 5HVKA 1B38A 4PTEA 4TY1A 1H01A 3FC2A 5FRIA 2C69A 5F95A 2ZMDA 3COKA 3KCKA 4Z16A 4Y5HA 4M67A 3UC3A 5J9YA 2UZDA 4KAOA 2W5BA 5C9CA 3V5QA 3MIYA 3QQJA 1BL6A 3CP9A 2JIIA 2YFXA 2R3HA 4A4OA 3BU5A 2GS7A 3GU5A 4F9BA 3KRJA 4ONAA 5KMKA 4IACA 5CAQA 3VUKA 4MD9E 3QFVA 2VTSA 4AA0A 5FDPA 4B4LA 1NA7A 3BQRA 3ETAA 3TI1A 4I1ZA 4Y85A 5M55A 3R7GA 4Q2AA 3NUSA 3R1NA 4F1OA 3PJ1A 5AR3A 5EYMA 3I5NA 3UJGA 4BIDA 2KULA 3POOA 5EOBA 4ASXA 2C1BA 3MVJA 5FEQA 5KKRB 4CZTA 2JDVA 2VTQA 4RBLA 1DAYA 1LEWA 1ZWSA 1Q4LA 3VULA 3W18A 4FKRA 4JJRA 4J8MA 3QC4A 5I9XA 5CT7A 5DVRA 3RWQA 3QA0A 4D0XA 2CKQA 4IADA 4M7IA 3IOKA 4HCTA 5CS6A 2WPAA 3CJFA 3KXNA 4NTSA 5CVGA 4BFMA 5JGDA 4AGWA 4AN3A 2R5TA 4YJTA 3MTFA 3HUCA 4TZRA 4RRVA 4TYJA 2OW3A 1JAMA 2R3KA 3GOKA 3SG9A 4FKWA 5ANEA 4UEUA 3ZSGA 2HXLA 4X2JA 2PMIA 4ZTSA 2F4JA 1H1QA 3UYTA 1E1XA 4D5KA 3KC3A 4EUUA 4FVPA 2YJRA 1ZZLA 2H96A 3HKOA 4KA3A 5FM2A 3QZIA 3MW1A 2C68A 2GNHA 3QXOA 4ZSLA 5BVDA 4CV9A 3TKIA 1MRUA 1J3HA 2QR7A 4BZDA 4L45A 1VYZA 3ZBXA 3OWPA 4FTMA 5M08A 4XBUA 3NNXA 3LCDA 2OF4A 3QUPA 4K1BA 1JQHA 3O71A 2YLEA 4GJ2A 2X8IA 4WT6A 3UZRA 3RZFA 2R3GA 3AMBA 4UZHA 4J95A 3SD0A 2XIXA 3MVMA 3DOGA 4JDKA 4EOKA 2WELA 3NGAA 1JLUE 4ZOGA 5FTOA 4PL3A 3QQGA 2OIQA 3PPZA 2J2IB 2NRUA 3RAIA 5JQ8A 2ITOA 5AUYA 4IVBA 1UNHA 4W9WA 4L8MA 4A4XA 4GVAA 4BCPA 3U8WA 2BTRA 4W4VA 2BHEA 3NZ0A 4HGEA 5CSPA 2B9FA 1XWSA 4KSQA 4TKSA 4WRGA 5IUIA 4NW5A 4QMXA 4ZZNA 3DBCA 3GQIA 1PMNA 2XRWA 5BVNA 3FMLA 3H4JA 4AW1A 2HK5A 3V5JA 4IAKA 1YKRA 3UGCA 2J4ZA 4IB5A 3SKCA 2YCQA 3D94A 4K77A 3W8QA 5BYYA 5JEBA 5HCZA 2BR1A 3F3TA 4FKTA 5M56A 4O82A 1JWHA 5E8ZA 5L6OA 2QHNA 2OJGA 4HZRA 3O51A 3EWHA 2BRGA 4M69B 3G15A 2YAKA 3KK9A 4FT7A 3DBFA 1PXLA 4D58A 4JAJA 4BGQA 1PKGA 4IDVA 3L8XA 1VZOA 4FTCA 4OBOA 3W2SA 2PZPA 2HYYA 4R5YA 4X7QA 3CTQA 5M09A 3PJ2A 2C47A 4PTCA 4RJ8A 3R9DA 2V22A 1KE5A 4FV2A 3SC1A 3RNYA 2C6TA 2DYLA 3ENHA 1AD5A 3TJCA 2OZAA 4M97A 3S00A 3GB2A 3K3IA 4YPDA 5AR8A 5JGBA 3R1QA 2IZUA 5JFXA 5AV2A 2Y6OA 4CZYB 4D9UA 4Q9ZA 3EFWA 3JS2A 2QLUA 1U5RA 5FUTA 5AR2A 2V7OA 4U9AA 1Q41A 4QYGA 4CT2A 4C7TA 4MQ1A 5A6OA 5GNKA 4JXFA 3ZO3A 3DBQA 5DT3A 3F66A 2HZ4A 3PSDA 3RM7A 4C2WA 3PXQA 3MGYA 2FSOX 4ENXA 4O83A 1YWVA 2F7EE 4NM5A 5AUVA 4QP8A 4DFUA 2R3LA 4FSYA 1ZY5A 4PY1A 2OXYA 4F7NA 2QVSE 3MB6A 3TCPA 2ETMA 1YOJA 5HE3A 3KXMA 3RJCA 2W4KA 4GFMA 1S9JA 3BELA 2FSMX 2IJMA 4TNDA 5CU0A 3TIYA 1HCKA 2QU5A 2YZAA 5CSWA 5L4QA 1ZMUA 4DTAA 5EQPA 3OTUA 3CD3A 2PUPA 5CSXA 5CVHA 1WMKA 2WTVA 2GQRA 4IM3A 5M4UA 3HECA 2PTKA 4DT9A 1CM8A 5H3QA 4L3LA 4N0SA 3DBDA 4FK3A 4RWLA 4F99A 4G31A 5JZNA 4G5PA 3D2IA 4FTTA 5DNRA 3DAEA 2RFDA 4UMQA 4DFLA 5J7BA 5LVNA 5DBXA 5CEOA 4FT0A 5HU9A 4FIIA 4MXAA 4YR8A 4CFWA 1GOLA 2H8HA 4YJOA 1H24A 4UXLA 4CD0A 2I7QA 5IPJA 4FZ6A 3E8EA 4M0ZA 5KMJA 3KVWA 4HGTA 4IVCA 2PE0A 4JBVA 3D5WA 4AZSA 2IW8A 3QX4A 4ZAUA 4RVTA 3GC8A 3AD4A 1G5SA 4FK6A 2ETRA 5E4HA 4QYHA 4HGSA 4U8ZA 4BDEA 4AT5A 2V5QA 2XEZA 1JKLA 3HP5A 5TO8A 5GJFA 5CU6A 3HYHA 1YW2A 3ERKA 2ERZE 2ZV2A 1M17A 4BDBA 4EQMA 3WF6A 3QWKA 3RMFA 3WBLA 4ZS0A 5IEYA 3PJ3A 4X6QC 5ANGA 3R00A 1YXUA 1IAHA 2OI4X 2PZIA 3P08A 4PV0A 2UZTA 3MA6A 4MQ2A 2YJSA 4H05A 3KREA 3A7FA 1OKZA 3HAVA 2ITWA 1FQ1B 1W83A 3BLRA 3JUHA 3S1HA 3FMMA 3PIYA 4U79A 5JFVA 4ZSAA 4YLJA 2XKCA 2WTKB 2QOLA 3BE2A 2YCFA 3DB8A 3TZ9A 2EWAA 4U3ZA 3AMYA 4IB3A 5IH4A 3GT8A 4QP6A 4B9DA 2IZRA 4GL9A 2ONLA 2F2CB 3FL4A 3ALNA 2RFSA 4J96A 4RIYB 5K4JA 3GXLA 4JDIA 4OTQA 5KCVA 3MH2A 1J7UA 2QURA 3PVWA 1KOAA 1U46A 2PMOX 3CGFA 2WOTA 4AG8A 2YITA 1YXVA 2W17A 3BHTA 3FLYA 3OZ6A 2IVSA 5CEPA 1XH5A 3NVKI 1KV2A 3LJ0A 4G34A 3QTRA 2VTNA 1LP4A 1M2PA 2RG5A 4TTHB 1PMVA 3Q9XA 2YIXA 4FV1A 4RX5A 2XIYA 4JBQA 3JPVA 3QUDA 2C5VA 1V0BA 4U45A 3LHJA 4IMYA 3TJDA 2W5HA 4KBKA 5CT0A 1XHAA 3R8LA 4Z7HA 3DJ5A 3QD2B 4IX3A 1JSUA 5L6WL 5CEQA 4G3CA 5BVFA 2IPXA 4C3RA 4FYNA 5C8MA 2GTNA 5ITAA 3SDJA 4GT4A 1SNUA 2WMAA 2Z7SA 3C0IA 2XZSA 1XH7A 3CKWA 4B99A 4HPUE 4PNIA 5E7RA 4YP8A 5IF1A 4XOYA 2QG5A 1OL5A 2JDTA 5KMLA 5FG8A 2YWPA 2XNGA 2IZSA 5E8XA 1R3CA 3VF8A 2BZIB 2O2UA 2YAAA 5G1XA 2HOGA 2VTPA 4RA5A 1Y8YA 4QD6A 3II5A 4GEOA 4QMSA 1UKIA 4DTBA 3KRXA 3FKLA 4FIFA 2R3NA 4EH4A 4YHTA 2J51A 5J7HA 5DWRA 4G2FA 4O7LA 2XYNA 4FTOA 2WQOA 2ZV9A 3LQ8A 5CTPA 4LRKA 2B53A 4CXAA 5B2LA 5CAUA 1WBOA 3UMWA 3VF9A 1CKJA 5AV0A 3O23A 2YLFA 3SAYA 3ZS5A 4AOJA 3FY0A 4FL1A 4EH8A 2CGUA 4IDTA 3ZDUA 4I6HA 5JRQA 2OF2A 3BWFA 3KVXA 4U6RA 4RZVA 1UU9A 4IJ9A 4M15A 3WARA 4E73A 1XJDA 2Z8CA 4IH8A 1F5QA 1OZ1A 4O1OA 4QP4A 2GNFA 4H36A 1KWPA 5IDPA 4MNFA 4LMUA 4YBJA 4EWQA 3CXWA 4XP3A 5KHWA 4PPBA 3DFCB 3GU7A 5AIKA 4CTBA 3EQFA 3KRRA 3F5UA 1QPEA 5BVOA 5T3QA 3Q5ZA 5F20A 4CG9A 2J0KA 4HCVA 3VJNA 4Z55A 4LMNA 2ONLC 4BDHA 3AC2A 3K54A 4UMUA 3PA4A 5EDPA 1IAJA 3NUUA 3DDQA 5AR7A 3ANQA 3T9IA 2XK4A 4YZDA 2XF0A 3K3JA 3WE4A 3NUPA 4QTEA 2AC3A 2O64A 2YM6A 3AD6A 3QF9A 4O0UA 2UW9A 2PYWA 4XV3A 4S2ZA 3LKMA 3WF5A 4KIPA 1VJYA 3RPVA 4QP9A 3UOJA 3FHIA 4JBOA 2DUVA 4F6WA 4U40A 4ZSGA 3UIMA 4D1XA 4YJPA 3D14A 5FTQA 4O96A 4DH7A 3HRCA 4NJ3A 2FGIA 4WD5A 5EDQA 4O0WA 2XRUA 3LIJA 4ZTRA 4C34A 3D7ZA 3CCNA 5DOSA 3ELJA 4TT7A 5FEDA 3SHEA 3EMGA 4G16A 4JDHA 3IW4A 4E4MA 3MS9A 3G9NA 3AXWA 2PZ5A 1P2AA 3LCKA 5E1SA 5AA9A 3OCTA 1JSTA 3FKOA 3PZEA 3RAWA 2A27A 2WNTA 3UYSA 4FX3A 4NW6A 3G33A 4CYJA 5LQFA 4X3JA 3RM6A 3WF9A 5I3OA 3ZLYA 3SG8A 1PMUA 3H30A 3C4WA 4L46A 4JG8A 5KNJA 4IX6A 4L52A 2XMYA 4AU8A 4D2RA 3QCSA 3ODYX 5C4KA 3AD5A 3PTGA 4RJ3A 5AR5A 5JMSA 5L8LA 4J53A 3BBWA 4RJ4A 4L3PA 5KMOA 2XCKA 3HGKA 3IONA 1U4DA 3HVCA 4II5A 3MH1A 4W4XA 3ZZEA 5CF6A 4LYNA 2VTIA 2YIRA 4FKQA 4QMUA 4GK4A 4CRLA 2PZYA 1H27A 4D4YA 1UV5A 2CKOA 2CNUA 3VUTA 2PUNA 3ZLXA 4F7JA 4XG2A 5IUGA 4BZNA 5HBJA 4L42A 3FKNA 2G01A 4IAZA 3EIDA 3V8WA 4EK6A 4FT9A 2C6MA 3P4KA 4FV6A 4YBKA 1NT2A 3EZVA 2W1ZA 5ACKA 4GG5A 4ZSJA 3R7IA 2OIDA 2UV2A 2Y6MA 1MUOA 4P7EA 5CAPA 1ZYLA 1GZKA 4EOMA 2OO8X 1O6YA 2J5FA 5IU2A 4QP2A 2VTTA 4O27B 1Q97A 3KGAA 4NH1A 3BYSA 4YHFA 4RC2A 5A4CA 2X6DA 4QMYA 5HLPA 3E3BX 3ID6C 3EQRA 3DDPA 4O0XA 5EYCA 1YVJA 3PE2A 1PXOA 3DAJA 2WEIA 3OUKA 4NK9A 5D9HA 3RK5A 4G9RA 4J98A 4FEXA 4LM5A 3VUDA 3Q6WA 1TVOA 3RK7A 4QQ5A 4O84A 4I21A 3KKVA 2I0EA 3FZSA 2XNMA 2CCIA 3HNGA 4GSBA 4QMOA 3IW7A 3SOAA 4QMQA 1QPDA 3RKBA 3ZFXA 4EBVA 4NCTA 3PY0A 3P1AA 3KL8A 4DTKA 3UZTA 3E3PA 3MV5A 4KINA 3FXWA 5L8KA 4YJUA 3DKGA 2ZVAA 3QTQA 3GOPA 5AR4A 3UZPA 4EUTA 4G17A 4O0SA 4W4YA 2PVMA 3AC4A 5DRBA 5HORA 4EJ7A 4E1ZA 3HV7A 4ARKA 3LXNA 4MH7A 3MI9A 4OTIA 2E9UA 4F0IA 4YU2A 5HE1A 2ZV8A 3U51A 5IA3A 3HZTA 2H9VA 3F3ZA 5A4QA 1Z9XA 3DLSA 3ZSIA 2BKKA 5G6VA 3OT8A 4QMVA 4GFGA 3FXZA 2X7FA 4M3QA 4HW7A 1WAKA 3PP1A 4KKEA 2XKEA 2H34A 4X3FB 5DT4A 1JKKA 4G3FA 2C5XA 3P23A 1LEZA 4QPAA 5CQUA 1H1PA 1YXSA 4KBAA 4DINA 5DEWA 2XA4A 5JH6A 4GU9A 1FMKA 3R9NA 3OWLA 3FQHA 4MYGA 2BZHB 1ZYJA 3RHKA 5J9ZA 1OBGA 3QRIA 3NNWA 4GK2A 2LAVA 3ZUTA 4YZCA 3GU6A 2CNVA 3RAHA 3RPRA 2ITQA 1YHWA 5HD7A 1IRKA 4K8AA 4DH1A 4FIEA 4YC6A 4OW8A 4I5HA 5LMBA 4C02A 4WNMA 4WIHA 3QAME 5B7VA 4JVGA 5BX0A 3Q6UA 5T6KA 2F7ZE 4DGGA 4IEBA 3D83A 3A60A 2VWWA 3QTXA 2FVDA 4NL0A 1H07A 1ZOHA 4F0GA 2W4OA 4Z7GA 3FJQE 3I60A 3S3IA 4I4EA 4LFIA 3VWAA 2DQ7X 3JVSA 3PIXA 3ZHPC 2CNQA 3Q2JA 3TDVA 4MXCA 5K4IA 4RSSA 3QKMA 4JQ7A 2Q0BA 3C5UA 3OEZA 4FL2A 2NP8A 2RL5A 4TYHA 3VBXA 4EYJA 4RIWA 3WZJA 3R7OA 3F7ZA 4M13A 3ZRKA 3V8SA 4U41A 2CLXA 4UMRA 3FYKX 2BDWA 3KXHA 4IZ5A 3ZEWA 4WO5A 1I09A 4ACDA 4R3RA 4TYIA 4UMTA 4A7CA 4DEIA 5IA5A 1ZZ2A 5CLPA 4LGHA 3HMOA 3RP9A 4NCTC 5F94A 3DB6A 4KD1A 1FMOE 3PUPA 5I9WA 5H9BA 3ULIA 3FSKA 3IK3A 3KK8A 4BTJA 2JC6A 4NIFA 1TQMA 2ZDTA 4PP9A 5DLSA 2JIUA 1WCCA 2VRXA 4IAFA 4Y8DA 3CS9A 4X6RA 4FL3A 3C13A 5J1WA 2UW0A 4RVKA 4QYEA 3Q60A 1XQZA 4XYFA 5DRDA 5ICPA 3LQ3A 3GQLA 4BCIA 3R8MA 3PWYA 4E6QA 1OL2A 2WMWA 3FMHA 3OOGA 4S32A 4U7ZA 2GNGA 4WNPA 4OTWA 3RPOA 4DH8A 2Q0NA 3CE3A 2XVDA 3TN8A 2JKOA 5EM6A 1Q8UA 2B4SB 2OSCA 3QZGA 4J52A 3GU4A 3BWJA 3LMHA 2JIVA 4HVIA 3UIXA 2C5NA 3AT3A 4CMOA 5TT7A 4DEAA 4RWJA 2JAVA 2JKMA 5KUPA 2QO7A 4FSMA 5JGAA 3R7YA 3BYMA 2RSVA 2BIKB 4OT5A 2R2PA 2XNPA 1YDSE 4EH9A 4F7SA 1DAWA 5AM6A 4J1RA 3GCPA 1M7QA 2JBPA 5IQHA 4FODA 3ZOSA 5GIOE 3L9PA 5BNJA 3HRFA 5DR9A 3OWJA 3UVPA 3ZRMA 2IN6A 4DH3A 3QGYA 4F6UA 5DPVA 5HCYA 4AW5A 4BRXA 4KIKA 3Q2MA 2HENA 4IBMA 3DLZA 5BUJA 2C5OA 5C8KA 4NEUA 2C0OA 2C6EA 2CKEA 2OJJA 3OBGA 5C4LA 2F2UA 4EORA 5IUHA 3NCGA 1W7HA 5IG1A 4RVMA 3NW7A 2GMXA 2WHBA 3QGWA 4USEA 5HU3A 4V0GB 2OG8A 3TIZA 4TRLA 3UBDA 4RIXA 4RX8A 2QD9A 4GVJA 3MBLA 5TF9A 3TV7A 4BDDA 4F09A 3UVRA 5JZJA 3B2TA 3TG1A 3T3VA 4FKUA 5A4TA 4PTGA 1REJA 4WG3A 4HNIA 3K5UA 1OKWA 3M42A 3NYOA 4D2TA 5DR6A 2ZAZA 4F4PA 5K3YA 4IWOA 4ORKA 3NLBA 1Q8ZA 2JKQA 5I9UA 3A61A 3ORKA 2B9IA 3U87A 4JX3A 2UZBA 2VTOA 4FSNA 2C3LA 5C03A 1FGKA 1Q24A 3DV3A 2WQNA 4I5MA 4AZEA 4AGCA 3W1FA 4CCBA 4G5JA 3OXTA 1G8SA 4X21A 5HO6A 5A4LA 4BTKA 3LOKA 1OMWA 5CXZA 3FZOA 2ERKA 3RVGA 3NDMA 4LG4A 3ACKA 4QNYA 3L9NA 3SW7A 2SRCA 3R7VA 2C3JA 2FUMA 5A9UA 4E4XA 3BPRA 4BI1A 3D7TA 1H25A 1W84A 4A4LA 2B1PA 3ORMA 4DF3A 1GY3A 3NW5A 3GFEA 3PFQA 3L8PA 4U42A 2Z7LA 4XG3A 2C30A 3CPCA 3O8PA 4CFNA 1KSWA 2WTDA 3IOPA 2GSFA 3ITZA 4OTFA 2V7AA 4HYHA 1YHVA 4EKKA 5GZ8A 1FOTA 2XYUA 1SVEA 4W4WA 3EOCA 5JSMA 5A54A 2VWVA 3HRBA 2W99B 3MSSA 3NUAA 5CI7A 1REKA 2OZOA 1I44A 2QOCA 1WBWA 4R1VA 4WRSA 4ANQA 5HX8A 2J0LA 4IE9A 4PPCA 3FLQA 2RIOA 1CSNA 3UOLA 4CT1A 3SLSA 2EB2A 3UMXA 5I9YA 2R3PA 3WYXA 4YJRA 4B8MA 2WIHA 3O96A 5ACBC 3VS6A 2PWLA 4PWNA 2VUWA 4W8EA 4DEEA 4IZ7A 3OCGA 3EQGA 3HA8A 3CIKA 4XS2A 2XB7A 5EKNA 5IA2A 3GC0A 5DR2A 3V8TA 5KKRC 2WQEA 4ZZOA 5DA3A 3D0EA 4ITIA 3VIDA 3TXOA 3OC1A 3L9MA 2YCSA 3U9CA 3MWUA 2XKDA 2PSQA 1W98A 3O2MA 1YI4A 4FT3A 5GJDA 4DITA 4D9TA 2PVJA 3E5AA 3QYZA 2C0IA 3Q53A 3VN9A 4AFEA 2UW3A 3EN6A 4FV5A 1TKIA 1OIRA 3QA8A 4IQ6A 5E8YA 5CVFA 3ZEPA 4E3CA 4JAIA 2J0JA 4HYIA 5IQDA 5AADA 4FI1A 4BKYA 4I5PA 3EQPA 1WBVA 5IQFA 3GCUA 3OP5A 5DT0A 4ANOA 3IQ7A 4C3FA 3RNIA 3VRZA 4FIGA 4JBPA 1BLXA 4D1SA 3KF7A 1WBPA 4FIJA 3DXQA 3KRLA 3FYJX 3QZHA 4O0YA 2GDOA 2J90A 2VX0A 3A8XA 3JY9A 4PDYA 4YLLA 1JSVA 5D10A 1PRYA 4E26A 3R8ZA 4AQCA 4Y72A 1OB3A 4G3DA 1QPJA 4F0FA 3RCJA 3U6IA 4FEVA 5CSHA 5J79A 2WEVA 1KE8A 1PXPA 3NYXA 2CMWA 4GT5A 5BVWA 4A06A 4BCGA 2PUIA 4MVFA 2VN9A 3MFUA 3PRFA 3TV4A 2PVYA 4R8QA 3UVQA 4MNEA 5CYIA 3GFWA 4UZDA 3THBA 5AUUA 3NR9A 3I1AA 3QHRA 4U5JA 4BKJA 1ZXEA 3CEKA 3SRVB 1GZ8A 2PVRA 3OY3A 4P2KA 3RPSA 4RJ6A 2E9PA 4O22A 2EXCX 3DQXA 4DBNA 4CKJA 4LOQA 3UTOA 5CY3A 2VNWA 3RWPA 4IZAA 5LWMA 2ZB1A 3M2WA 2CN5A 3FPMA 2XK7A 4FTIA 4JLCA 3KMMA 4MBIA 5J1VA 3GUBA 4DFXE 2X7GA 3T8OA 4IFGA 4QNAA 4IWDA 2QOOA 3OXIA 4YURA 3A7JA 3D5VA 4XV1A 2PZRA 5CF5A 2R3IA 3PIZA 4M68A 2W1EA 5GJGA 1J7IA 2BPMA 1U54B 3CQUA 4C61A 4LGDA 3FL5A 4I3ZA 3K2LA 4ZTQA 4YPSA 2PUUA 4OT6A 5A4EA 4ZY5A 2C6LA 3IPHA 5M57A 3CPBA 3BIZA 3R21A 4PMSA 5LCJA 4PMTA 5CWZA 4C59A 3LXPA 4I92A 3DKOA 1ZLTA 3F61A 1M2QA 3V5WA 4TYGA 3HL7A 3DZOA 3DJ7A 2KTYA 3LAUA 4JOAA 3VS5A 5LARA 1ZMWA 3FLWA 3DNDA 2G15A 4R7HA 5C8NA 5HHWA 3F5GA 1J91A 1H0VA 4X2KA 1SNXA 3I5ZA 2E2BA 1WBSA 4DHFA 1M52A 1B39A 3DNEA 4RT7A 4C36A 4EOQA 1J1BA 2C6OA 5HX6A 5KX8A 2B0QA 4EZ7A 3RBWA 3OOMA 4ZSEA 3QC9A 4YC8A 1R0PA 5EW3A 4A9RA 3BBTB 4FR4A 4I22A 5CX9A 4MWIA 4R3PA 4QP1A 2Z02A 2IO6A 2OJFE 3F69A 3NUXA 1GAGA 4NUSA 5B2KA 3C4CA 4IM0A 3IDBA 4L9IA 4APCA 1VR2A 1WBTA 3FHRA 1EH4A 2GHGA 2O3PA 2VO7A 4BICA 4EBWA 4F1TA 5LMKA 1QCFA 3A7IA 2GCDA 4F08A 5HG9A 3EL7A 1YRPA 2FO0A 2W05A 3FV8A 4U43A 4EK3A 3ZO1A 5IH6A 1PXMA 4TW9A 2OLCA 5EQYA 3R02A 4ZZMA 3PXFA 3UODA 1AQ1A 2HZNA 3QHWA 4MF0A 3PRIA 4EK4A 4JQEA 4FVQA 5DE2A 2BDJA 5EW9A 2QO2A 3I79A 5KHXA 2Y4PA 4R6VA 1MRVA 4BGGA 3U9NA 5JT2A 2GQSA 1Q5KA 2AYPA 2A19B 3VQHA 4GYIA 5HLWA 4FOCA 3W2OA 3SXRA 1ZMVA 3PA5A 4UBAA 2Y8OA 3FQSA 2BFYA 4AN9A 3ULZA 4MHAA 2E9NA 4DLJA 2EVAA 5KE0A 3PJ8A 3H3CA 2OU7A 3GNIB 4TWOA 5AM7A 3KEXA 2Y4IC 3PXKA 3LFEA 1GIIA 3BV3A 4OBQA 3E8DA 2C3IB 4O21A 1XH9A 4KIOA 4AUAA 3G6HA 2RFEA 2GTMA 2QOKA 5E8TA 4A9UA 3R6XA 4Q5EA 1M14A 5J8IA 3LFNA 4QMNA 4AE6A 2QOHA 2OZAB 2QCSA 3FMEA 3TUBA 1JNKA 4X2FA 1Y91A 3LFSA 3QQLA 2QOBA 2NO3A 3DAKA 3RCDA 3BHHA 4M66A 2HAKA 3E88A 3LVPA 2JFMA 2R7BA 3Q9WA 2QOQA 4UYAA 4CMTA 1A9UA 5LCKA 5TR6A 2NPQA 3DKFA 5CALA 2OICA 3OHTA 4YTFA 2BAKA 2PU8A 3CQEA 3OCSA 4L01A 3NPCA 3LFDA 4OTDA 4IC8A 4HYSA 1JVPP 1ZYSA 2RG6A 3KCFA 2J5EA 4GFOA 4IIRA 3SOCA 3T9TA 4APPA 4ZLYA 3F2RA 4YNOA 4N6ZA 1AGWA 3BRBA 4G6OA 3AC3A 3LMGA 5HKMA 2UZEA 2W9FB 4U80A 5CEIA 1SVGA 2DWBA 4BYIA 4E6DA 3HMPA 4E5AX 5HIDA 3NRMA 3TNPC 4KIQA 5IEVA 3ATSA 5CU4A 2A2AA 4IM2A 3RINA 4KRDA 3GCQA 4LOPA 4C4FA 2E9OA 5LMAA 3E64A 4R7IA 5LMKC 5M4CA 2R3OA 2PMNX 3A7GA 3PLSA 2XJ1A 3G51A 4F9AA 4FTQA 4UX9A 4WA9A 4MCVA 4KNBA 4NYEA 1H26A 5FBOA 3VW8A 2J9MA 3NMUF 1FVTA 4B7TA 3PXYA 4AFJA 3U6HA 3R7EA 2YIQA 5EYKA 4ENYA 4OTGA 2J50A 4E6AA 5HG5A 3BYOA 1OI9A 3O8UA 4R1YA 5LVOA 4NM7A 1HOWA 2JDOA 1K9AA 4YGAA 2XJ2A 5EDRA 3O50A 1W82A 4GIIA 4IWQA 3VS3A 4YHJA 3B8RA 5M51A 5IQGA 2XUUA 5IQAA 4HPTE 4IJPA 4L67A 4O6LA 3K5VA 2P33A 2X8DA 3LLTA 3QRUA 2RF9A 2XS0A 3OMVA 4YJVA 5EQEA 2HCKA 3E93A 4DG2E 3IW8A 4ZS4A 2XKFA 4TWPA 1URWA 3VS4A 4J99A 2YM4A 3EN9A 5M53A 4QMWA 2OJ9A 1ZYDA 4MBJA 3HMIA 3BGPA 4J7BA 4L7FA 4QMLA 3W16A 4EH3A 2CLQA 2A0CX 2W1GA 4BYJA 3HLLA 4DE4A 1YHSA 5L6PA 3JYAA 2BVAA 3QRKA 4IAIA 4RVLA 4UXQA 2XJ0A 3E87A 3UDBA 4EC8A 4D28A 3MPAA 3E62A 4EEVA 4XG9A 3A99A 4K0YA 3C9WA 3AT2A 2ZV7A 5HO7A 2GHLA 3BX5A 3PXZA 5IA0A 1V1KA 3HV5A 2GFSA 3IDCA 4WUAA 5E8VA 4CNHA 1UU8A 1L8TA 3DQWA 4XBRA 1MQBA 3QLFA 3QZFA 2ZM1A 4HNFA 3C7QA 4F65A 4DGOA 3LFCA 2JD5A 3U6JA 3REPA 4LUDA 3QBNA 3D5XA 1NVQA 2BAJA 3UO4A 5BQ0A 3QQFA 4ZTNA 1ZARA 4DBXA 2F49A 2X1NA 4FGBA 4PQNA 3ZZWA 4DFZE 2QOIA 2UW4A 3EYHA 4DN5A 5L2SA 3QQKA 2I6LA 3QCXA 5LOHA 3MTLA 2FSTX 3QCYA 3ACJA 3EFJA 4LOOA 3LJ2A 1YDTE 3JVRA 3BE9A 4JIKA 4ZIMA 2IW9A 2BMCA 2WU7A 2J0IA 3ENMA 3LPBA 2R0UA 3MPMA 3OW4A 5AP6A 4AOIA 1DI9A 4QOXA 4BCKA 4YJQA 2BIYA 2XK9A 3BLQA 4FZFB 4NSTA 2G9XA 3MB7A 4PRJA 1NVSA 2CN8A 2JAMA 5FWKK 2PPQA 2X81A 5EYDA 4H1JA 3GCSA 5BUEA 3CBLA 4AT4A 1ZRZA 2ZJWA 2W7XA 2XM9A 2XNOA 4KKGA 2VO3A 3ZYAA 3OG7A 4CLIA 3R1SA 3UOHA 4AGUA 2C1AA 4OAUC 4JRVA 4FNWA 3FZ1A 4QQTA 3F2NA 3U55A 3PSCA 2YABA 3RGFA 4PDSA 5KO1A 3Q9ZA 4PMPA 5LXMA 3TUDA 4ASZA 3D2KA 4O7WA 4YSMA 2XNNA 1XBBA 4I6QA 5KMNA 4IAYA 1GZOA 3R73A 3KULA 4ZEGA 4FICA 4G3EA 3PP0A 4IW0A 2ZMCA 1OGUA 3L9LA 4XMOA 2VWUA 3CC6A 3DFAA 5CENA 2YM8A 3VO3A 3VRYA 3WZEA 3ZMMA 4EZ3A 5DYJA 1IEPA 4XCUA 4Z9LA 4H3QA 5HE0A 4O7SA 4DH5A 4RX9A 4IC7A 3ZFYA 5L3AA 3A62A 5D12A 3NVMB 4BBMA 3VBWA 3I6UA 2WTCA 3FLNC 4O0TA 4ZJJA 3D15A 5AAEA 1WVWA 1ZY4A 4M12A 2UZWE 2UZUE 2XH5A 4HGLA 4BDFA 1OIQA 4J71A 1NY3A 1Q99A 5E90A 5AUWA 4XUFA 3H0YA 5KZIA 5AJQA 2P0CA 4WKQA 4BI2A 2PVKA 3TT0A 5D7AA 3VJOA 5EG3A 3F9NA 1OM1A 5I4NA 4FZ7A 2ITYA 4N6YA 5FD2A 3ZLWA 2R3RA 4YNEA 4MX9A 2BUJA 3S95A 1R39A 4FTUA 2O0UA 5HIEA 5K0XA 3CTJA 2Z60A 1CMKE 4QPSA 2WOUA 4M8TA 4CQGA 4ANMA 4WBOA 3EJ1A 5DMZA 2FSLX 3AC1A 2QKRA 4D2WA 4XG4A 4K33A 3Q3BA 3R04A 2BFXA 5TKDA 5K0KA 1OL6A 3UPXA 4BC6A 1PY5A 2BALA 3O7LD 1FPUA 4FA2A 2GU8A 1UKHA 1HCLA 1NXKA 3NEWA 2CSNA 5H8BA 4QPMA 4F9WA 3DXNA 2OH4A 3SV0A 4D1ZA 2XK3A 1J7LA 5AP1A 4AA5A 3ROCA 3KFAA 3KMWA 4EYMA 4X2GA 3TUCA 4KSPA 2UVXA 3UP7A 3EFLA 4BDCA 4FNXA 4ACMA 5HI2A 4USFA 1G3NA 2O5KA 3FAAA 2YZLA 3Q5IA 1IA9A 4UB7A 5FXSA 3SVVA 4O7TA 4L44A 1XBCA 4ZY4A 3EB0A 4AP7A 1GZNA 3N4VA 4E5WA 2JLDA 4JNWA 2O63A 4LQMA 1R1WA 1S9IA 3ET7A 1PXJA 4P90A 5I9VA 2W1CA 4EHZA 3EKNA 2I1MA 3RZBA 3E8CA 4NT4A 3MVLA 3RHXA 2W1HA 4PL5A 5AUXA 3NAXA 2XIZA 3OD6X 3AC5A 4LV8A 4L00A 4BDIA 3D4QA 1F3MC 2UVZA 3MY5A 5E8WA 3F3WA 3VQUA
chains in the Genus database with same CATH superfamily
2ITVA 3QL8A 3HMMA 2UZLA 4V04A 3TZ8A 4C33A 4BCFA 1H08A 1YI6A 2OIBA 2VV9A 4PF4A 3UE4A 3ZO2A 4DG0E 3PLAE 4YZ9A 3QU0A 4R5SA 4DGLC 1MRYA 3E63A 3FMDA 4FKPA 4QMPA 3BZ3A 2BRBA 4MD8E 4PMMA 5JRSA 3ZRLA 1KE7A 2WTJA 3NIZA 4GRBA 2YDIA 5EM5A 3QKKA 5AUZA 1VEBA 3NNVA 3IG7A 4WG5A 3PWDA 3N9XA 4AAAA 4TL0A 2XNEA 2IVUA 1CTPE 1YXXA 2ZM3A 4FTLA 3EHAA 4FV8A 4CTCA 5AP5A 5H2UA 2ZYBA 4P5QA 3TZ7A 4GIHA 2GFCA 3BEGA 4DGMA 1Z57A 3MFRA 4EH6A 5JFSA 5KMIA 4FYOA 1OKVA 4NM0A 3ZC6A 5DG5A 4UMPA 3EN5A 5ANOA 4MTAA 5F1ZA 4YTIA 2QODA 4XLVA 4EHVA 4HVHA 1RQQA 2CGWA 4K2RA 3EN4A 3IS5A 2CDZA 1GNGA 2REIA 5AX9A 1CKIA 2B52A 3R8UA 4K11A 3V5TA 5M4IA 2GS2A 4WOVA 3P5JC 4HZSA 4BCJA 4H3BA 1H1WA 3QUEA 5HNBA 2VTAA 5HZNA 4DA5A 3BV2A 2AC5A 5FEEA 5EH0A 2B7AA 2EXEA 3C1XA 3OS3A 2QOFA 4YC3A 4BDAA 2C6KA 1G8AA 3F3UA 5IH5A 2Q83A 2YA9A 4MXZA 3VC4A 1XR1A 4GMYA 2P2IA 4QTBA 4AS0A 4BHNA 4FKJA 4MXYA 1OVEA 4L43A 3BLAA 4XRLA 1Y57A 5M07A 3TM0A 5EHLA 3ZCLA 1H8FA 4ACCA 4DHIB 4BY9E 2VGOA 3FZPA 3HA6A 4FF8A 5K9IA 3P9JA 3WIGA 4KRCA 5L2WA 1P4FA 5FP5A 1OECA 2WB8A 3NYNA 4ZY6A 3BI6A 4E6CA 3TKHA 4TXCA 4K18A 2NRYA 3LMIA 5DIAA 5AEPA 4O86A 3ORIA 4PPAA 3DGKA 5JQ5A 5ANJA 3KIOC 1Q8TA 3U54A 1PXKA 2PVNA 4QMZA 5JKGA 4H3PA 1E9HA 4RZWA 4CYIA 4EK8A 3G5DA 4BCHA 2ITTA 1OUYA 1SZMA 3EN7A 2X9EA 3SW4A 5E91A 2WD1A 3QD4A 3MN3A 2R0IA 5BVEA 2WMUA 4DDGA 4GH2A 2W4JA 4JG7A 4E8AA 2NYAA 3P79A 1Q3WA 4HVDA 2V55A 2PVFA 1Q61A 5HTBA 5IKWA 1U59A 3HDNA 5HNGA 3WE8A 3WYYA 2XIRA 4ZLZA 2Y7JA 4S34A 5ANIA 3QRTA 3QD3A 3R63A 4AXDA 2DS1A 4FTJA 4IXPA 4XRJA 3VBYA 3C4XA 4DHJA 4FZAB 4FSWA 4D0WA 5M44A 4J8NA 3GCVA 5IMXA 4USDA 3UC4A 4C4IA 4WHZA 5CAOA 4ASDA 4CFUA 4EKLA 3ZSHA 4TYEA 1YOMA 5EKOA 1WZYA 4S31A 3W32A 4AZFA 4BCMA 2XBJA 4WBBB 3EQDA 3LW0A 4GS6A 5BVKA 3UIUA 4FEWA 4CKRA 3DTWA 3W0OA 4C4EA 1PKDA 1YOLA 4FV9A 4K9YA 3ORNA 4OTRA 2BTSA 4U97A 1XKKA 4FKOA 4CG8A 4EZ5A 4KBCA 4TYHB 3E8NA 4O2PA 2HW7A 3MPTA 4RIWB 4YMJA 3GGFA 3RI1A 2R9SA 4I0TA 3FEGA 5EHYA 2YDJA 2C0TA 4CFVA 4C57A 3AG9A 4DLIA 3KN5A 3QALE 4L6QA 4UWYA 4EL9A 4GKIA 3OVVA 5KZ0A 3KY2A 3PPJA 2X6EA 2B55A 1QMZA 5J5SA 1PHKA 3HP2A 3IGOA 4LV5A 4RJ7A 3V5PA 4F7LA 1UVRA 1L3RE 4ZJVA 2J7TA 1TQPA 4O0VA 2IEWA 3Q4ZA 4FV0A 2WTIA 3GC9A 5IA1A 5CZIA 4XOZA 4NWMA 4ANLA 3WZDA 5B2MA 4O4BB 5BYLA 3PVGA 4XX9A 2OXDA 2QO9A 4FV7A 4CFMA 2Y0AA 2UZOA 4NIFB 2ITPA 4O38A 3JY0A 3VUGA 4BR3A 4BKZA 3ATTA 5C26A 4V05A 1DI8A 3TTIA 4I41A 4BDGA 5BUIA 1W0XC 4Y73A 4FOBA 4I6BA 5AX3A 3M11A 4C3PA 3JR1A 4ZMEA 4I24A 3KMUA 2GNIA 3GU8A 3DPKA 2X2LA 4Q9SA 4ALUA 3A8WA 2BZKB 5CSVA 3TACA 1PJKA 3DTCA 4CV8A 4BVUA 4C35A 4E20A 5LVMA 3NSZA 1PXIA 3R7UA 3F6XA 2YEXA 3QYWA 4AZVA 4AZWA 2W06A 3NAYA 1GJOA 4HJOA 4EOJA 2XK6A 1CKPA 2VAGA 3V5LA 2X39A 2J0MB 2YCRA 3TNIA 3ZTXA 3BU6A 2VWXA 5DH3A 2IG7A 4KKHA 5EK7A 5DEYA 2EUFB 2VTHA 4EHEA 4EOSA 4A07A 4LL0A 3FSFA 2PE1A 4E93A 4TPTA 4O0RA 2CPKE 4RQVA 3W2CA 1PMEA 3VHEA 4HYUA 4BHZA 2VTRA 4EQUA 4FG7A 3LE6A 1U5QA 5I9ZA 2G2HA 2W1DA 5H8EA 2ZM4A 3UPZA 2QC6A 3COMA 3QWJA 3LFAA 5D7VA 3HX4A 4ZTLA 3N4UA 5CNNA 4I23A 1QPCA 4D2VA 5F9EA 1PF8A 3EFKA 3Q4CA 4EH7A 5A46A 4F1MA 5HTIA 3LFBA 4KIKB 5C27A 4FE2A 2PMLX 4FT5A 4AE9A 5A6NA 3NW6A 3I81A 2WTWA 4QP7A 5EFQA 3SRVA 2R64A 2PVHA 3GENA 3VBQA 3VBTA 4ZJIA 1BX6A 1CDKA 3QQUA 3R2BA 4XH6A 5HD4A 2Z2WA 4DCAA 2QLQA 2WU6A 4M69A 4ACGA 2HELA 1WFCA 1YDRE 4IX4A 4EOOA 4RIXB 3DK6A 5CU3A 2BCJA 4GW8A 5DHJA 4S33A 2WMBA 2X4ZA 5FLFA 4BDJA 4CQEA 1FGIA 4AA4A 5DGZA 2HW6A 3BYVA 4WSYA 3A2CA 1GIJA 1U54A 3GP0A 2QI8A 1ZOEA 4IB0A 2PE2A 3NUNA 4WG4A 4EH2A 3MH3A 4FKLA 3ODZX 3PVBA 2OJIA 4YJNA 4M0YA 4NFNA 5E92A 3R83A 4BZOA 4HCUA 3Q04A 3IDPA 3L8VA 3LCSA 4IAAA 2VNYA 4IVDA 1T46A 2O8YA 5CF4A 5KMMA 4G9CA 4CFXA 2QR8A 1KE6A 2C3KA 3PY1A 5EI8A 5AV3A 3RALA 3UO6A 4DG3E 4YO4A 3D7TB 4U3YA 3VS1A 3W10A 1OL7A 3FLZA 2QKWB 2VWIA 4MEDA 5CI6A 1Y6AA 1IA8A 4RG0A 5I0BA 4E5BA 4QO9A 4CLJA 2W9ZB 4QRCA 5IZFA 4RWKA 2J6MA 3Q4TA 2ETKA 2G2FA 4Y5QA 3R9RA 2VO6A 4EHGA 3R9HA 3AQVA 3IECA 1XBAA 2JGZA 4RIOA 3AGMA 1OPKA 1OL1A 5CEMA 3NWWA 4PX6A 5B0XA 1YQJA 2PHKA 3BL7A 4QYFA 3R2YA 3HDMA 3KXXA 4FEQA 4YZMA 4OTHA 3TL8A 5IQBA 3FUPA 2ZB0A 1LR4A 2PL0A 3BEAA 4JQ8A 1XH4A 2VU3A 5IQCA 1Q8WA 2YDKA 5J5TA 4XV9A 2R3MA 4QTAA 4QT1A 3ORPA 3C4FA 4FSRA 5L2IA 3MJ1A 1SVHA 3CLYA 1G8KA 3R01A 2QG7A 5AP3A 2JDRA 4AT3A 4ALVA 5L2TA 3TNQB 1OBDA 4YTHA 3E7VA 4MWHA 5EI2A 1SMHA 3ZM4A 2YISA 2AUHA 4D4VA 3P7AA 3N51A 4N4SA 3DJ6A 3I7BA 1W8CA 1GIHA 4I6LA 4BTMA 4W8DA 5AV4A 4F6SA 3R1YA 3GVUA 1KV1A 3MA3A 3DBEA 4R3CA 4FEUA 5HQ0A 4O7NA 5CZHA 3OY1A 4BWXA 1XMMA 3PVUA 1YWNA 5D11A 3DU8A 3VUMA 3C0GA 3P0MA 5FBNC 2F57A 2XBAA 1R0EA 3CSVA 2R3QA 2VZ6A 4BCOA 5TOZA 4JS8A 3MFSA 1BYGA 2JDSA 3MYGA 3CQWA 5ETCA 5LVLA 3QTSA 4FC0A 4RC4A 3UNKA 4O91A 4DFYA 1ND4A 4UWBA 3CY2A 5EOLA 2OFUA 5KBRA 4KUJA 3LM5A 1BMKA 3LQ5A 4CVAA 1P4OA 4YO6A 2ITUA 4DT8A 3FI3A 2WMTA 2GQGA 4JDJA 4PL4A 4RC3A 2XK8A 3IKAA 3ORTA 3G2FA 4QMTA 3PDTA 4LI5A 3ZO4A 3WZUA 3COHA 5GIPE 1RW8A 2YM5A 4OGRA 4RIYA 2CJMA 1QL6A 3FMNA 3R9OA 1ZYCA 4N70A 4JRNA 3RPYA 1H00A 3L8SA 5CANA 4GCJA 4MNEB 4BWPA 4DFNA 1PYEA 4DC2A 5C1QB 1DS5A 1UNGA 4FKGA 4CEGA 1ATPE 5M06A 4ITJA 4WNKA 2YIYA 3CD8A 3ZUVA 3BYUA 2HWOA 2YN8A 4Y95A 2Y4IB 3R8VA 2JITA 4YSJA 3ORLA 3QD0A 3BLHA 4WNOA 1P14A 4WSQA 2AEGA 1O6LA 1UWHA 3NNUA 2GPHA 3VNTA 4PNKA 3VS7A 2ITZA 4C58A 2HZ0A 4RJ5A 5EM8A 2X2MA 3W0RA 3R0TA 4F63A 4ID7A 5D1JA 4EI4A 1JOWB 2F9GA 4KABA 2IWIA 3OTVA 4R77A 2R4BA 2X4FA 4HOKA 2QU6A 2C4GA 3V6SA 2HIWA 4EOIA 4MF1A 2WMSA 3P7CA 4Y83A 4EONA 3S0OA 2QNJA 3LM0A 2BKZA 2B9JA 2JBOA 4KWPA 1MQ4A 2X8EA 3CY3A 3ZBFA 5EW8A 3C50A 3E92A 3L1SA 1FBNA 3HV3A 2QHMA 4EQCA 4GKHA 1B6CB 3NCZA 3GI3A 5AFVA 4CZUA 3H0ZA 4EOLA 3DS6A 5KBQA 4U44A 5FGKA 4AOTA 4C62A 1XO2B 4RFYA 4XP0A 4MK0A 4IX5A 4FTNA 5E9EA 1Y6BA 2E9VA 4F9CA 4ERKA 4AGDA 4DGNA 1KOBA 3FQEA 3SQQA 2EXMA 2BILB 1JBPE 3VVHA 1F0QA 2ITXA 4CMUA 1H0WA 1X8BA 4DAWA 4E4NA 4YJSA 4PP7A 4FNYA 4H58A 4JR7A 4D4SA 3H9RA 3S2PA 3WILA 1E1VA 3KB7A 4BCNA 5BPYA 3DZQA 3NUYA 1R78A 4ZLOA 2BRMA 4DYMA 3MVHA 4A9TA 4GJ3A 2WTKC 3PUFC 5HICA 3H9OA 1OIYA 5M4FA 3S4QA 3CKXA 2JFLA 2BDFA 4P5ZA 4ZTMA 3LLAA 2VX3A 1RE8A 3C51A 3UNJA 3RAKA 1UNLA 4UWCA 4BB4A 2HZIA 2XCHA 3HEGA 3R8PA 4OTPA 4CGAA 3BU3A 4XLIA 3G9LX 4JT3A 5A3XA 3C5IA 3SXSA 3TEIA 2HXQA 4XG6A 1DM2A 5I3RA 2A98A 4G3GA 2CHLA 5HO8A 1OPLA 4MAOA 5DI1A 1SM2A 4RWIA 3AGLA 4M84A 3FDNA 2WIPA 4BTFA 4V01A 3TWJA 5AP7A 3TNWA 3HV6A 5IISA 5T68A 3ZXTA 3PYYA 4AF3A 2YERA 3FC1X 4ASEA 3M1SA 4P4CA 5FM3A 4EK5A 4FSZA 3UQFA 4YUQA 4O2ZA 1IR3A 3FLSA 4QQCA 2PY3A 4MXOA 3PJCA 3LXLA 4RMZA 2GHMA 3DK3A 3EQCA 3EL8A 4FRFA 4BBEA 4L3JA 4ANBA 2H6DA 3FI2A 4JG6A 3O5AA 2C5YA 3OW3A 2WXVA 3I7CA 4RLLA 2P4IA 3H10A 5DFPA 3OT3A 4BCQA 4D2SA 2W1FA 3QTWA 1WVXA 2OH0E 3LFFA 4I5CA 4FIHA 4B0GA 4CFFA 4O7VA 4BL1A 3FMJA 4B6LA 4JL9A 3RK9A 4U81A 3JXWA 2FA2A 1TZDA 3A7HA 3BHYA 4J97A 1XH6A 4QTCA 3AKKA 1KUTA 1JKSA 4OBPA 3HMNA 4L68A 3Q9YA 3GC7A 4Q5HA 2PVLA 4Z3VA 4CKIA 3PA3A 4YZNA 5HCXA 2YIWA 2OWBA 3POZA 4G6LA 4XP2A 3WZKA 3ZU7A 4XNEA 4ZXTA 3EKKA 3IO7A 4O1PA 3LCOA 5TE0A 2R3JA 5AIRA 3OCBA 1BI7A 2X0GA 3CTHA 5C01A 5HEZA 1FINA 4K6ZA 3G90X 5FXRA 2CGVA 1XH8A 3TDWA 5LVPA 2V0DA 4BIEA 3KXZA 4X0MA 3SGCA 1STCE 1TQIA 3FY2A 4IWPA 3V51A 5A14A 4BN1A 3D9VA 4ALWA 5CNOA 4B8LA 5ETAA 4PUZA 2YWVA 1RDQE 4FSTA 4RX7A 3HUBA 4O7RA 3R30A 4RLKA 3QRJA 5HBHA 4ERWA 3Q4UA 5K5NA 4GYGA 4R78A 2P55A 3AMAA 2JEDA 3G0FA 4FBXA 1NVRA 2XEYA 4FSQA 4FZDB 3O17A 1OUKA 1LUFA 5EM7A 4XG8A 2GS6A 1O9UA 4A9YA 3A4OX 3I0QA 4FVRA 2IVTA 4AACA 3OUNB 3QTZA 4YZBA 4FTAA 2Z7RA 3NS9A 3LJ1A 4AZTA 2X9FA 5FDXA 4FUXA 4C4GA 1V0OA 4H39A 1BUHA 4I94A 5E1EA 3ZLSA 3QLGA 2BRHA 4FSUA 5ETFA 5FP6A 3ZDIA 4HVSA 2BROA 5HTCA 4R7BA 3FMKA 2UW5A 2XIKA 5CASA 2Z7QA 5IQIA 2UZVA 3ORZA 2HY81 5IA4A 3ORXA 4D5HA 1PXNA 1LPUA 1H1SA 4FG8A 1V0PA 2A1AB 1Y8GA 3OWKA 2VWZA 2WQBA 2NNWB 4S30A 3DA6A 3IW6A 3UG1A 3C4EA 5J9LA 3VW6A 3EQBA 5AA8A 3UG2A 3F88A 1YI3A 1URCA 4X3FA 4PDPA 3FBVA 3CR0A 3WI6A 3BQCA 2PULA 4PDOA 2EU9A 2B9HA 2JKKA 5E8UA 4C4JA 5LWNA 4WUNA 4D55A 1YWRA 5DN3A 3BGZA 3TZMA 3KQ7A 4BF2A 5JK3A 4I6FA 2I0HA 2V62A 3CJGA 3SXFA 5HG7A 1K3AA 4N57A 2YACA 2VTJA 3UDSA 3ZUUA 2OBJA 4GT3A 3PE1A 1O6KA 3TNHA 5D41A 4RQKA 5CXHA 4X2NA 2IVVA 2FYSA 4DEGA 1PW2A 4FKSA 3NFGB 2W1IA 4AX8A 4OLIA 3ZONA 5AUTA 3PFYA 3ROYA 4NTTA 3UIBA 4F70A 5FXQA 4KS7A 4ZTHA 4E4LA 4GUEA 2CCHA 3NIEA 3FI8A 2YM3A 2YZLA 5AWMA 4GK3A 4BWKA 3N4TA 4LRMA 4FTKA 4IZYA 4MKCA 5FQDC 3VAPA 3WIKA 3KN6A 3T3UA 4C38A 3V04A 4BBFA 2VX1A 4OUCA 3PY3A 5LJJA 4I20A 1BI8A 4ANNA 3EQHA 3EZRA 3W8LA 2WFYA 1VYWA 3DK7A 5H8GA 4UN0C 4ACHA 4HVGA 3W55A 3TKUA 5CAVA 1UA2A 3ZH8A 1BL7A 2BAQA 4UY9A 4LDTA 3COIA 2BHHA 1WBNA 4O6EA 3DKCA 4GUBA 4JI9A 1M2RA 3PSBA 4G1WA 5HNIX 4TNBA 2VTMA 3KULB 2IW6A 3OBJA 4XJ0A 1OKYA 3PPKA 1UU7A 3PG1A 3ZFMA 2WKMA 5FTGA 3HAMA 3O8TA 3BCEA 4QMMA 3VUHA 4O81A 1JPAA 3P78A 5ANDA 1H4LA 2OK1A 3QTIA 4NFMA 4TWNA 3AOXA 5AAGA 3A4PA 5HVYA 3VHKA 4D4RA 1ZAOA 5AP2A 2UZNA 3OXZA 4ZMFA 4MXXA 3TTJA 4H1MA 3NX8A 2FB8A 3GBZA 4OR5A 4QP3A 4OAVB 4IVAA 2OGVA 3VS2A 5E8SA 2GNLA 4GU6A 4LUEA 4XV2A 4DEHA 5GZAA 2I0YA 3Q32A 3W2QA 3IGGA 4EOPA 2XANA 4QYYA 5L2QA 2VWYA 2XM8A 1ZOGA 3ALOA 3VBVA 2WGJA 4FV4A 4QQJA 3W2PA 3G6GA 3ZXZA 5CU2A 4G6NA 4BIBA 2XP2A 5IMEA 3UQGA 5HIBA 5HVJA 4ZK5A 4RFZA 1KE9A 5HGIA 2W5AA 4GV1A 4X3FC 5JN2A 2G1TA 4MD7E 2Y9QA 5GZ9A 2OXXA 4E7WA 3MDYA 3MIAA 3H9FA 3BHVA 4NKSA 4NZWB 4W9XA 3BGQA 4FNZA 4IHPA 3IW5A 4C0TA 3AC8A 4YTCA 2ESMA 2RGPA 1IASA 3EQIA 3R28A 5ETIA 4JIAA 2F7XE 3EH9A 3W33A 5AP0A 5CEKA 4JR3A 3P7BA 4XHKB 3R71A 3QKLA 2EB3A 3DCVA 5J87A 2WMQA 4Y46A 4EC9A 2BRNA 3FZRA 5GHVA 4TWCA 4XEYA 3NYVA 5EI6A 5BMMA 1Q8YA 1A06A 3PG3A 2YM7A 1OITA 1Q62A 3D5UA 3MFTA 5L8JA 4TN6A 4A9SA 5IQEA 3MY0A 4AWIA 4YLKA 4LRJA 5HG8A 3W2RA 4AXAA 3WF8A 3FWQA 3U4UA 1PYXA 2UW7A 1Q3DA 2WMVA 4O7ZA 3B2WA 4CSVA 3MY1A 4MBLA 2WQMA 4AW2A 1H28A 1APME 4V0GA 4U0IA 4C8BA 5CF8A 1M7NA 1J1CA 2WO6A 3MH0A 4FKVA 5HOAA 3I4BA 2W0JA 4ANSA 3O7LB 3O0GA 3QX2A 3F5PA 2VTLA 1T45A 2P3GX 4FUYA 4UYNA 3SX9A 2ZDUA 3F82A 1FVVA 3LZBA 3OEFX 3MJ2A 3KF4A 4I0SA 4I93A 4NU1A 3WF7A 2HY0A 3MESA 4IFCA 5AV1A 1Z5MA 2VGPA 3DY7A 4C2VA 2XAOA 2G2IA 1OPJA 3DT1A 4I0RA 4EH5A 3UOKA 2C6IA 4NM3A 4RFMA 5ANKA 3FXXA 2FH9A 2UUEA 3B8QA 5CQWA 3P5KA 3QQHA 4KS8A 3F3VA 4KB8A 1JKTA 2UVYA 3E7OA 5EHOA 3UNZA 1A48A 3F7WA 4L53A 5BYZA 2CKPA 4EJNA 2QONA 2OFVA 1RJBA 3LXKA 5J95A 2R3FA 3LCTA 3C4ZA 2ACXA 1H1RA 2X7OA 3ANRA 4DEBA 5IEXA 4IB1A 4IANA 2YHVA 3OROA 4CRSA 2ITNA 4M14A 5AMNA 4F64A 4UV0A 2PK9A 2LGCA 2WMRA 2UW6A 3BHUA 2A4LA 4C37A 3KXGA 4FG9A 5BMSA 3OF0A 3V3VA 4RA4A 4BGHA 1P5EA 2ZOQA 4F9YA 3UQCA 3Q52A 3QCQA 3FI4A 3R22A 2IZTA 5AAFA 3UP2A 5HE2A 3CGOA 4LGGA 4FGRA 2VD5A 5JFWA 3GEQA 2BZJA 1SYKA 5HBEA 4BDKA 4D2PA 3W0QA 3TV6A 3RTPA 3G0EA 3BKBA 2I40A 4DFBA 3PXRA 5F4NA 2WZJA 3F5XA 3VUIA 1BKXA 2WAJA 1IG1A 2RFNA 3P86A 3SA0A 3WOWA 3PZHA 3F2AA 4FKIA 2WMXA 4C4HA 1MP8A 2CGXA 3LFQA 3OFMA 3V6RA 1UWJA 4NJDA 5I5ZA 3U4WA 3QTUA 2GNJA 5HESA 3KU2A 3KRWA 4DEDA 3UO5A 4DHZA 4DCEA 3V01A 1YXTA 4NKAA 5IDNA 3I0OA 3FPQA 2X2KA 3ZM9A 4RPVA 1FVRA 4QTDA 3VS0A 2R7IA 3ZC5A 3C0HA 4AXEA 2VWBA 3Q96A 3FZTA 2RKUA 4GG7A 4I4FA 5AP4A 4FV3A 4AN2A 2VO0A 3KA0A 2B54A 2HWPA 4FMQA 4EWHA 2P2HA 4L7SA 1NW1A 1WVYA 5K5XA 1K2PA 2C6DA 5HLNA 5GINE 3DXPA 4FTRA 3FE3A 2OKRA 1OIUA 1ERKA 3QXPA 2O65A 2I0VA 4UALA 4QDEA 4BI0A 4RGJA 2XNBA 1UU3A 2UW8A 4XG7A 4AW0A 2QQ7A 4CCUA 3EYGA 3AT4A 3I6WA 2W96B 3HV4A 4ITHA 4LL5A 4O7YA 4JX7A 4ZP5A 5HVKA 1B38A 4PTEA 4TY1A 1H01A 3FC2A 5FRIA 2C69A 5F95A 2ZMDA 3COKA 3KCKA 4Z16A 4Y5HA 4M67A 3UC3A 5J9YA 2UZDA 4KAOA 2W5BA 5C9CA 3V5QA 3MIYA 3QQJA 1BL6A 3CP9A 2JIIA 2YFXA 2R3HA 4A4OA 3BU5A 2GS7A 3GU5A 4F9BA 3KRJA 4ONAA 5KMKA 4IACA 5CAQA 3VUKA 4MD9E 3QFVA 2VTSA 4AA0A 5FDPA 4B4LA 1NA7A 3BQRA 3ETAA 3TI1A 4I1ZA 4Y85A 5M55A 3R7GA 4Q2AA 3NUSA 3R1NA 4F1OA 3PJ1A 5AR3A 5EYMA 3I5NA 3UJGA 4BIDA 2KULA 3POOA 5EOBA 4ASXA 2C1BA 3MVJA 5FEQA 5KKRB 4CZTA 2JDVA 2VTQA 4RBLA 1DAYA 1LEWA 1ZWSA 1Q4LA 3VULA 3W18A 4FKRA 4JJRA 4J8MA 3QC4A 5I9XA 5CT7A 5DVRA 3RWQA 3QA0A 4D0XA 2CKQA 4IADA 4M7IA 3IOKA 4HCTA 5CS6A 2WPAA 3CJFA 3KXNA 4NTSA 4AAYA 5CVGA 4BFMA 5JGDA 2ZFYA 4AGWA 4AN3A 2R5TA 4YJTA 3MTFA 3HUCA 4TZRA 4RRVA 4TYJA 2OW3A 1JAMA 2R3KA 3GOKA 3SG9A 4FKWA 5ANEA 4UEUA 3ZSGA 2HXLA 4X2JA 2PMIA 4ZTSA 2F4JA 1H1QA 3UYTA 1E1XA 4D5KA 3KC3A 4EUUA 4FVPA 2YJRA 1ZZLA 2H96A 3HKOA 4KA3A 5FM2A 3QZIA 3MW1A 2C68A 2GNHA 1W2CA 3QXOA 4ZSLA 5BVDA 4CV9A 3TKIA 1MRUA 1J3HA 2QR7A 4MUQA 4BZDA 4L45A 1VYZA 3ZBXA 3OWPA 4FTMA 5M08A 4XBUA 3NNXA 3LCDA 2OF4A 3QUPA 4K1BA 1JQHA 3O71A 2YLEA 4GJ2A 2X8IA 4WT6A 3UZRA 3RZFA 2R3GA 3AMBA 4UZHA 4J95A 3SD0A 2XIXA 3MVMA 3DOGA 4JDKA 4EOKA 2WELA 3NGAA 1JLUE 4ZOGA 5FTOA 4PL3A 3QQGA 2OIQA 3PPZA 2J2IB 2NRUA 3RAIA 5JQ8A 2ITOA 5AUYA 4IVBA 1UNHA 4W9WA 4L8MA 4A4XA 4GVAA 4BCPA 3U8WA 2BTRA 4W4VA 2BHEA 3NZ0A 4HGEA 5CSPA 2B9FA 1XWSA 4KSQA 4TKSA 4WRGA 5IUIA 4NW5A 4QMXA 4ZZNA 3DBCA 3GQIA 1PMNA 2XRWA 5BVNA 3FMLA 3H4JA 4AW1A 2HK5A 3V5JA 4IAKA 1YKRA 3UGCA 1VLRA 2J4ZA 4IB5A 3SKCA 2YCQA 3D94A 4K77A 3W8QA 5BYYA 5JEBA 5HCZA 2BR1A 3F3TA 4FKTA 5M56A 4O82A 1JWHA 5E8ZA 5L6OA 2QHNA 2OJGA 4HZRA 3O51A 3EWHA 2BRGA 4M69B 3G15A 2YAKA 3KK9A 4FT7A 3DBFA 1PXLA 4D58A 4JAJA 4BGQA 1PKGA 4IDVA 3L8XA 1VZOA 4FTCA 4OBOA 3W2SA 2PZPA 2HYYA 4R5YA 4X7QA 3CTQA 5M09A 3PJ2A 2C47A 4PTCA 4RJ8A 3R9DA 2V22A 1KE5A 4FV2A 3SC1A 3RNYA 2C6TA 2DYLA 3ENHA 1AD5A 3TJCA 2OZAA 4M97A 3S00A 3GB2A 3K3IA 4YPDA 5AR8A 5JGBA 3R1QA 2IZUA 5JFXA 5AV2A 2Y6OA 4CZYB 4D9UA 4Q9ZA 3EFWA 3JS2A 2QLUA 1U5RA 5FUTA 5AR2A 2V7OA 4U9AA 1Q41A 4QYGA 4CT2A 4C7TA 4MQ1A 5A6OA 5GNKA 4JXFA 3ZO3A 3DBQA 5DT3A 3F66A 2HZ4A 3PSDA 3RM7A 4C2WA 3PXQA 3MGYA 2FSOX 3AKLA 4ENXA 4O83A 1YWVA 2F7EE 4NM5A 5AUVA 4QP8A 4DFUA 2R3LA 4FSYA 1ZY5A 4PY1A 2OXYA 4F7NA 2QVSE 3MB6A 3TCPA 3VONA 2ETMA 1YOJA 5HE3A 3KXMA 3RJCA 2W4KA 4GFMA 1S9JA 3BELA 2FSMX 2IJMA 4TNDA 5CU0A 3TIYA 1HCKA 2QU5A 2YZAA 5CSWA 5L4QA