2OJGA

Crystal structure of erk2 in complex with n,n-dimethyl-4-(4-phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
337
Chain Sequence
FDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojgA01
4ZEGA 3NLBA 3OBJA 2X6DA 5D1JA 1KUTA 1T46A 4PMTA 2ZM3A 3BYOA 3EKKA 3UGCA 1E9HA 2HELA 4D55A 2R3KA 4D4VA 4F6WA 5JQ8A 1OL1A 4ASXA 4IH8A 3NNVA 2QOHA 2C6LA 2J9MA 4FTOA 4AA0A 5DYJA 4C4HA 3ZZEA 4X6QC 3GOKA 2QLUA 3PY0A 2W1IA 4Q2AA 5CSPA 5JN2A 2VWVA 3LQ3A 2ESMA 4AGCA 5BQ0A 2VWWA 4LL0A 3GCQA 5CU3A 4F9BA 5IQEA 1R78A 3VVHA 2PUNA 2PZ5A 4RBLA 1OM1A 4TNDA 3UBDA 4C61A 2W05A 1SYKA 3PY3A 1KE8A 5D7AA 4DEAA 4FV3A 3PDTA 1XH7A 3VS4A 4QPMA 4BDEA 4YBKA 4AZWA 5M44A 2XB7A 3EYGA 2WELA 3MH0A 4GKHA 4FV6A 4EZ3A 2BMCA 1ZXEA 5E8ZA 5J9LA 2WTDA 4FKLA 2PVFA 3PLSA 4O6EA 4J7BA 4AP7A 3D94A 1MUOA 3D5UA 3EL7A 4DGMA 3NUUA 4O7SA 4RVLA 3ORPA 4BICA 4MXZA 4P7EA 3I81A 1HCLA 3BBWA 3GQIA 4H3BA 4IW0A 1UNLA 5GJDA 3ORKA 1WAKA 2R3RA 4PL3A 3S2PA 4E4XA 3UP7A 5KMMA 1FVTA 1Y6AA 4QYEA 4FEWA 4JRVA 1CKPA 3RGFA 5BX0A 4ZSAA 2PULA 2WU6A 2CGVA 4FSQA 3OCGA 4C4FA 3KULA 4EK4A 3DNDA 1KSWA 4WOVA 4E5BA 2C6TA 2ITWA 4ANMA 4IADA 3UIBA 4F9CA 4ZAUA 5AEPA 2UVXA 4ZY6A 5LWNA 5EKNA 2CN5A 3R8UA 2PE1A 4PTCA 3KULB 2XP2A 2PK9A 5GINE 5IUGA 4BI2A 2OGVA 2Y8OA 3P0MA 2PU8A 1YQJA 4NKAA 4FZFB 3OY3A 5EW3A 3BYVA 1SVEA 4MQ2A 4AACA 3NRMA 4CKJA 2X0GA 3AC8A 3CE3A 4I94A 4NUSA 5KHXA 4PP9A 1P4FA 4XH6A 3R7EA 4KA3A 2JIUA 3O8PA 4J8MA 2H8HA 4CEGA 3SLSA 3QQKA 2ZAZA 3PLAE 1SNUA 4M84A 1FGIA 4J99A 5I3OA 4GT5A 1FINA 2P33A 3A2CA 2Y9QA 2W1CA 4EH7A 5ANIA 4XG3A 2WMBA 3IOKA 4QQJA 2W7XA 1NXKA 3LOKA 4RWKA 4CRSA 5GZ8A 3OC1A 5CALA 3QD0A 5I9WA 1GNGA 3HDMA 2CN8A 5KMKA 1WBTA 2WEVA 2R0IA 3RK5A 5LVOA 4JQ8A 2XIZA 3OUKA 4HPUE 3ID6C 3IKAA 4FF8A 3NIZA 3ZCLA 4JQ7A 3PSBA 4O2PA 4AN3A 5JZJA 4YU2A 2F57A 3JUHA 3VUKA 3UO5A 3AT3A 5C03A 4PL4A 1ZOGA 2GNGA 2NO3A 3O96A 4FVQA 2QCSA 3NX8A 5KMNA 5JFXA 3HMOA 3QWJA 2CCIA 4L46A 3KMMA 3F5XA 5M06A 4FX3A 2QKRA 4IAZA 5CAPA 1UVRA 4IFGA 2R7IA 2Y7JA 5AP0A 2UVZA 2YCQA 3V8TA 3VBXA 4FL3A 5IMEA 1BUHA 4TKSA 4UYNA 4CG8A 3MBLA 3PXKA 4L44A 4IZ7A 3JVRA 4IZYA 5F95A 4CFXA 1STCE 3D5XA 3UODA 4O22A 4HNFA 4D5HA 5L2TA 4ZLOA 3QUDA 4XV9A 5JGDA 4CKIA 3IQ7A 4RJ7A 4USEA 3S1HA 4CTBA 1PMNA 5HCZA 1XH5A 2OBJA 2WMWA 3R83A 3MW1A 3CSVA 3UPXA 1GY3A 4M14A 5AR2A 4MBJA 5DVRA 3BU6A 1IRKA 3LCKA 4FODA 5AX9A 4EUTA 3V5JA 2YEXA 2WQNA 3LXNA 1K2PA 2W1EA 4W4YA 3R7VA 4O82A 2UZDA 3KMWA 5AADA 3W16A 2QO9A 3MVJA 1QCFA 4G17A 3EQRA 4IX5A 3LFSA 1YVJA 5BMSA 3QXPA 4UMQA 3UIXA 5HLNA 4WA9A 4K11A 3LMHA 5ANGA 3VUMA 5CASA 5EFQA 3LIJA 3HV6A 3H4JA 3CPCA 1NT2A 2OFUA 3HEGA 3LFNA 4M15A 3SGCA 4BKYA 3KCKA 3QZGA 2A4LA 4DEGA 4IAIA 3F2RA 4ENXA 3UMWA 2ITPA 4ZJJA 4F0GA 3BGPA 2XNEA 4KKHA 4BDHA 3THBA 3ZLWA 1SVHA 3OTVA 2X81A 5IF1A 4BDGA 2FA2A 3O50A 3NYXA 2PZRA 4RWLA 5JFSA 2QR7A 2YM3A 2OXYA 3F61A 2XH5A 4O0TA 2RKUA 2WZJA 3DKOA 4Q9SA 2C6DA 3EWHA 3HV4A 4J52A 4W4WA 2VNYA 3AMAA 4LGGA 3NZ0A 5TE0A 2VO0A 4WRGA 4B8MA 3ZO2A 4FGRA 4IWPA 3A99A 4C35A 3UQCA 3HV3A 2OSCA 4I92A 2XNPA 2OJIA 2JLDA 5CSVA 3QRIA 4IVDA 4X3FC 3V5QA 2JEDA 4QMVA 3DFAA 1WFCA 3BIZA 4ZTSA 5F94A 5HBJA 3ULZA 2HZ4A 1PXKA 2YAAA 2PVNA 2PMOX 3BU5A 3TXOA 5IQFA 5AAGA 3H10A 2WPAA 3C4XA 2OH4A 4DG0E 2B54A 4FNZA 3FLSA 4RZVA 3O2MA 1S9IA 2BKZA 4U3YA 4D0WA 3WF8A 4FTNA 2FGIA 1YWVA 4D9UA 3COKA 3FHRA 2WMSA 3QD3A 1ZZLA 4EONA 5DRBA 5IDPA 4XP0A 2R7BA 3GU4A 4P5QA 5FTQA 4ZMEA 2HY81 4NL0A 2WAJA 1ZYCA 2WTKB 4E6CA 1OUYA 4DT9A 3LLTA 3IG7A 4PV0A 3ZFYA 1ND4A 2WQBA 4XLIA 4I1ZA 2PZPA 3LZBA 4BL1A 3JY0A 4OTFA 4BKZA 3HAVA 3LCSA 3POOA 1QL6A 3CC6A 1F3MC 2WOTA 4WBBB 5C4LA 4GV1A 2W9FB 4D2SA 2V0DA 3R0TA 5CF6A 2C69A 3SG9A 4ZIMA 5ANEA 3RWQA 3TM0A 4H58A 3F66A 4BBEA 3VUIA 4O7ZA 1JNKA 1OMWA 4NK9A 5JMSA 1ZWSA 1IG1A 4IMYA 4NU1A 4DINA 3JXWA 2YIXA 3PIXA 2C68A 1H26A 2O3PA 5FBNC 5J9YA 3C7QA 4IB5A 1YI6A 2VV9A 5HORA 3ANRA 1IR3A 5GIOE 1DAWA 3E5AA 5C26A 1H25A 3MIYA 3MA3A 3W8QA 4AW1A 5IEYA 4IE9A 4F99A 4F9AA 4F6UA 4O38A 4Z7GA 1GIJA 3DT1A 3D83A 4GJ3A 4BCOA 2EU9A 3BYSA 4QP8A 2OXDA 3R8PA 3Q6UA 4DEEA 4EOPA 3NDMA 5EM8A 4R3RA 2ZMCA 2B9FA 4YP8A 5KZIA 2I0HA 3HA6A 3TJDA 1J7UA 3A4PA 3MIAA 1CDKA 4BTFA 2PVHA 1M7NA 3LAUA 2WFYA 3OY1A 4B99A 5IMXA 2Z60A 2W17A 4ZY4A 1M52A 2JIVA 3RPSA 3PYYA 5EHOA 3A4OX 3A7IA 3S0OA 4C7TA 3R28A 2OW3A 2WMXA 3OEFX 4HYUA 4JAJA 5AUYA 3K3JA 3UO6A 3BBTB 5AJQA 5LCJA 2CKQA 2PY3A 3ULIA 4G6NA 4RIXA 2VTLA 4ZZNA 3C0HA 3U55A 2R3OA 4E4LA 2G1TA 2F9GA 2ITNA 2ITVA 2B55A 4DITA 5A4TA 3LFQA 4DAWA 4E26A 3DJ6A 2Y6MA 5HU3A 3GU5A 2O65A 4BDBA 3R71A 5J9ZA 2YIWA 3MJ1A 3PXRA 1V0BA 4RIXB 3CR0A 5HZNA 4IVCA 4RVMA 1DI9A 3QL8A 4FUYA 3I6WA 2WMVA 5A46A 4QP7A 5EYKA 1FVRA 1VR2A 3VS5A 3KEXA 4RJ6A 4JL9A 3ZLYA 3AG9A 5BUIA 2VTMA 4JS8A 4LQMA 1UNHA 1YXUA 2ZM1A 4HGLA 4RC3A 4EEVA 5EQEA 2NP8A 2IJMA 4D4RA 1OPKA 5AR5A 4XEYA 5FDXA 2W5BA 4XOYA 1URCA 1W82A 4TXCA 4DG3E 5JQ5A 2VTIA 4MWHA 4O84A 3UNKA 5I0BA 1GIIA 5AX3A 1YI3A 4C3PA 5TKDA 4DE4A 5ANJA 4N6YA 4HVSA 2ITTA 4A4LA 4PMMA 3QD4A 4RVTA 5BVNA 3CGOA 3FQSA 2YFXA 3NGAA 3PJCA 2NNWB 4FG7A 4X2NA 2H6DA 1JKTA 3R7YA 5HTBA 4GVAA 5T3QA 2VX1A 3NUSA 1YHSA 3OT8A 5AR3A 4A7CA 4ITIA 1ZARA 2P2IA 3MTLA 2YDKA 3R1YA 2BRMA 4JLCA 4QMWA 2JBOA 4FSUA 2VTPA 3W2SA 2Y6OA 1ZOEA 1K9AA 3DOGA 3F5GA 2C5YA 4XV1A 3FE3A 3GENA 1FBNA 4BN1A 4ZOGA 3U51A 3V6SA 4E5WA 3QLGA 5BYZA 4HGSA 4JG7A 2WMRA 4M7IA 3QTZA 4KKGA 4O1PA 4R5YA 2GQGA 3CKWA 1XWSA 3M11A 4KINA 5JRSA 5CEIA 3SXSA 2VWUA 3V01A 3VS1A 4QYGA 3FMMA 3RHKA 3HECA 1KV1A 2VX3A 4QMMA 1Q8WA 4DT8A 3MPMA 4BTKA 3Q5IA 4G9CA 4BCNA 3FHIA 3HMIA 4AZFA 3QRUA 2Q0BA 1TQPA 2VO3A 2FO0A 2YZAA 4FKWA 4YJTA 3TUCA 4FKGA 5LCKA 1BI8A 2XMYA 3VUTA 1FMKA 4BRXA 3NUXA 1JVPP 1H8FA 1MQBA 3EN9A 4FT7A 5DOSA 3ZU7A 3R9RA 2VU3A 2CNQA 4V05A 4I4FA 4DFZE 2JDSA 5HVKA 1ZAOA 2PVLA 3IGGA 4ZS0A 5EHYA 5B2LA 3CTHA 2GFCA 2BIKB 2WMTA 3FZPA 3PTGA 4E5AX 1CM8A 5L8LA 4H39A 3LCDA 4UYAA 3VF9A 4D9TA 1YW2A 4G9RA 5AR4A 2ONLA 3H0YA 5IA5A 3U9NA 4ITJA 3BZ3A 4BF2A 2CKOA 2BZIB 4N57A 5KX8A 4M0YA 1PMEA 1W98A 3BE9A 5HO6A 2QOKA 3SHEA 2XS0A 3WYYA 4UX9A 4ZS4A 4NTTA 4EK5A 3LM0A 2V7OA 5FM3A 1RJBA 3Q4UA 4FTCA 4CYJA 4G5PA 3EN6A 3HL7A 4XRLA 4YHFA 4DA5A 3OHTA 4YC6A 5CU4A 5E8VA 4CV9A 3LFCA 1PXJA 5L6WL 4C02A 4H1MA 4CQGA 3QA0A 1H4LA 3F3ZA 2PPQA 2UZVA 3BU3A 4Y8DA 3EKNA 3N51A 4AXAA 5DPVA 4MCVA 3GI3A 4H05A 4YO6A 5HO7A 4FZAB 4DTBA 2SRCA 1QPJA 3U6HA 2QOQA 4IAYA 4M8TA 5IA3A 4BDDA 4KAOA 2PMNX 4E6QA 3F3WA 2ZV8A 1YWRA 2PVRA 4PX6A 4YLKA 1CKJA 3QHRA 4G3DA 4LRMA 3IOPA 3LHJA 3E93A 3OOMA 3VQUA 3ALOA 3ANQA 2RFNA 2WIHA 1QMZA 2PZIA 4Z3VA 4ACCA 4FYNA 2GTMA 1KOBA 4AE9A 1L3RE 4TL0A 4OLIA 2RIOA 3SQQA 3ZUVA 4BCIA 4FZ7A 4EQMA 2YACA 5CAQA 4NM7A 3U4UA 3BELA 3WF7A 4MF0A 3UC3A 3JY9A 4XNEA 5HG5A 5HNIX 3MFUA 2YCRA 4QNYA 5CVFA 5DT0A 4NJ3A 3W2CA 5J95A 2J2IB 3I60A 3QZIA 5J8IA 1BMKA 4GK2A 4FNYA 4C4IA 4F65A 3AD5A 4PDOA 2O64A 4ZTLA 2AC3A 4ZSGA 3ZRMA 2R3FA 4GG7A 5FGKA 5HHWA 3ZH8A 4F0IA 3OWPA 2BPMA 2VTTA 3DB8A 3FMLA 2PMIA 3TV6A 2PUIA 5CT0A 1NVRA 3Q6WA 4FV1A 1OKZA 4UY9A 1YHVA 2R3MA 3H0ZA 4OT5A 5LMAA 3GU6A 5A4QA 3I5NA 2F49A 3I1AA 3PG3A 3Q4ZA 4NFNA 3LMGA 1CMKE 3ZO3A 2YIYA 3DZQA 2EXMA 2GFSA 4ZTHA 4FIHA 3BHHA 3RAKA 4RVKA 4ORKA 1Q8YA 3DS6A 1XH4A 3CQEA 2ZYBA 4IXPA 2OF4A 3PA3A 4GT4A 4JBOA 2VX0A 5ANKA 2XCHA 3R9NA 2ITQA 5J5SA 5AIRA 4BIBA 1ERKA 2HAKA 2WIPA 4MTAA 4A4OA 2HZNA 3PPZA 3Q9WA 2R5TA 2EB2A 3IW6A 5B2MA 4MXCA 4XG2A 4R1YA 2WTWA 4UZDA 3U6JA 4UMUA 3FMHA 3E3PA 1YKRA 2VTSA 3SOAA 4EH9A 3VBTA 1GZ8A 3HKOA 1UU7A 1WBWA 5HTCA 3L8VA 5CXZA 3R01A 4FIJA 3VS2A 3G9LX 3HNGA 4U44A 1YOLA 4PF4A 5HGIA 4KIPA 5EK7A 4A07A 4DN5A 1KV2A 5E8WA 2QOFA 4E4MA 2XM8A 2YCSA 3BQCA 4OT6A 4FV4A 2YIQA 4ZSEA 5FXRA 3KRRA 4CLJA 4O91A 1PMUA 4FV9A 4K6ZA 5HIBA 4ZP5A 5TO8A 4U3ZA 4YO4A 2RG6A 3AT2A 5BVKA 3EQCA 2F7EE 4AAAA 3LLAA 3G6GA 2E2BA 4I6QA 1H0WA 4Y5HA 3D5VA 4YLJA 2C6IA 2UUEA 3FDNA 4WIHA 3QKKA 3RALA 4RSSA 5L3AA 3SVVA 3VS0A 4IM0A 2B9JA 3UOKA 3WI6A 4JI9A 1UNGA 3OF0A 4OGRA 2VWYA 4TYEA 4O7RA 4EKLA 4PDYA 3F69A 3VBYA 3ENMA 3FXXA 1XH9A 5M56A 3HMNA 1OPLA 2Y0AA 5CYIA 5IISA 2W1DA 4RLLA 3LKMA 5IQIA 3EQIA 3V51A 2BAKA 3MPTA 2V5QA 3DQXA 4FT5A 1V0OA 2B0QA 4JG8A 3ROCA 5I3RA 2CKEA 2CHLA 4PPAA 4LM5A 3PJ8A 4LV5A 3OD6X 4FICA 4MQ1A 4FKSA 5A6NA 2X9FA 1PYXA 4S34A 1IAHA 3FEGA 4NM0A 3JYAA 4J96A 2GNIA 3DLSA 3TKIA 5FXSA 3F3VA 2J6MA 4MKCA 5DT4A 2QG7A 3TUBA 2OF2A 4IB0A 5F9EA 3EHAA 4EUUA 3F3TA 5C8KA 1WCCA 2C1BA 4WNKA 4FTQA 4ZXTA 4EL9A 4CZUA 3FMKA 2ZDTA 1WBOA 4I41A 3C50A 3NYNA 2EVAA 4EC8A 3T8OA 3U4WA 4F6SA 4H36A 3I7BA 3D14A 3IPHA 5BUEA 1SVGA 3SDJA 2Z8CA 4U0IA 4MWIA 1XO2B 3F88A 3UQGA 4FTJA 1FOTA 1WVXA 1PKDA 5HE1A 5DMZA 3ZONA 3FC2A 2R3IA 5TF9A 4WO5A 4C34A 3MB6A 4LYNA 3CIKA 4WNOA 3SKCA 1R39A 2QURA 1YRPA 3DAJA 1W83A 3C13A 3G0EA 4EOLA 4QMUA 4X3JA 4W8DA 3GC0A 4YSMA 4QYHA 3NUAA 4YLLA 3TZ7A 4AQCA 4AZSA 4HZRA 4S32A 4U45A 2HW7A 3F82A 3R21A 4ASDA 4M69A 4PTEA 2UZTA 2JDRA 1SM2A 3Q9XA 3W10A 3ATSA 4XOZA 2VTOA 4JJRA 2PL0A 4QYFA 3WARA 3C51A 3EL8A 1KOAA 1YOMA 3GCUA 5CLPA 5CEOA 5L8KA 3P78A 4HYIA 5K3YA 5A54A 4M69B 3FL4A 5AWMA 3OMVA 3R6XA 1F5QA 2QHNA 4IJ9A 3WZUA 3GCSA 1H28A 2C3KA 3PJ2A 5IQGA 1APME 4I6HA 4YTFA 3BGQA 2IVVA 2ONLC 2Y4PA 4BHNA 3TV7A 5AV4A 3MVHA 3SA0A 4QT1A 3WZDA 2WQMA 5AA8A 2XVDA 4YPDA 4HOKA 5K5NA 3QU0A 3GQLA 3DTWA 2Z7QA 1BL6A 3Q2JA 5CT7A 3OEZA 3O0GA 4FV8A 2DQ7X 3EQBA 1PY5A 2OIBA 3P4KA 5FP5A 1PXIA 3TTJA 1PKGA 5LMBA 3EFKA 4EYMA 3VUHA 4R78A 1U4DA 4DH1A 3QRTA 3KN6A 4IIRA 1OPJA 3AD6A 3L8PA 4DGOA 4XV3A 1TKIA 3K2LA 3QGYA 3AC2A 2CLXA 3MTFA 3COMA 3ZM4A 4D58A 4KWPA 2AYPA 5M51A 3EQFA 4USDA 2PHKA 4IFCA 4HVGA 4HGEA 4HPTE 1G8SA 4EZ5A 3PWYA 2XYUA 3NNXA 2EUFB 3R73A 4C36A 2X7GA 4Q5HA 4LOPA 4ZJIA 4C59A 4ANSA 1OZ1A 4BBMA 4IACA 5KNJA 2G2FA 3L9LA 4L42A 5AV1A 2CGXA 5LVPA 5AUWA 2VO6A 3HRBA 4DC2A 4W9XA 2PMLX 5IEVA 4GCJA 3WF6A 3F3UA 4KNBA 2YM7A 3VUGA 1P5EA 1Y8YA 3EH9A 4KBAA 4O1OA 3AC4A 3UZPA 4EJ7A 3OWJA 3ZC6A 4FI1A 2YAKA 3TZ9A 1GJOA 5I9XA 3F9NA 1XHAA 2I1MA 3E63A 4L68A 2XM9A 1ZYSA 4G34A 4FA2A 1IA9A 1J91A 3PVUA 3R63A 1DI8A 5CQWA 1M2RA 1Y57A 2C6KA 3QKMA 3BLRA 3ORIA 3KRWA 1OIRA 5DR2A 3VRYA 5CVHA 2J7TA 1WMKA 4CTCA 4FIEA 4BI0A 1ZYJA 2WHBA 5FTGA 3BCEA 3Q9YA 4QNAA 2X6EA 3CY3A 4GMYA 2BHHA 4AGUA 3DXPA 2ZV7A 5D12A 3S3IA 4PMPA 1OL5A 1OKYA 2P4IA 4FIIA 4L9IA 5AV2A 3S95A 5H9BA 4U7ZA 4C2VA 1QPDA 4KIQA 4NEUA 4HVIA 3A8WA 4PWNA 3LJ2A 4JOAA 2BZKB 1WBVA 4EOQA 3FYJX 2RF9A 4PMSA 4EOOA 4YJRA 3QX2A 4FSNA 4M97A 2ZJWA 1ZLTA 5CSHA 3HP2A 3VS6A 5J1WA 1IAJA 2C5OA 4R7BA 2YLFA 4DLIA 4JNWA 4O7NA 3QHWA 3FMJA 2ITZA 3Q4CA 3RZBA 3UO4A 5IQBA 2HOGA 5FXQA 3H9OA 2DYLA 5ANDA 4E3CA 4CGAA 2IG7A 2Q83A 1ZMVA 4U81A 5HIEA 3VQHA 3DZOA 3EMGA 5AV3A 2BVAA 4G6LA 4WNPA 3O71A 1H1QA 2C3JA 2JGZA 5HEZA 3TCPA 5ICPA 2QI8A 3KN5A 2RSVA 2QKWB 4O27B 5CEKA 2X1NA 2OZOA 3I4BA 3LFDA 4XV2A 3IW8A 4BCGA 3QQGA 5A4EA 3NVMB 3R1NA 3WZEA 4RJ3A 2A2AA 4RIWA 3FQEA 4APCA 4EOSA 5CANA 3ZRLA 4FSTA 2C6EA 4G1WA 3V5LA 4NM3A 5T6KA 4ACGA 4DH7A 3UMXA 2W99B 3MH3A 5HU9A 2UZLA 3DJ7A 3KA0A 3KC3A 1TQMA 4QRCA 3F5PA 2X4FA 4R3PA 3T3VA 3E8NA 4RIWB 3VBQA 4EBVA 3M1SA 5D9HA 4R7IA 5IA2A 3ZEPA 3RHXA 4Y46A 3R8VA 2Z2WA 4I6FA 5HE3A 4DEIA 4YZ9A 3IO7A 5JZNA 3PA4A 5HBHA 3SG8A 4ZTRA 1ZMUA 4G6OA 1OKWA 2GNHA 4ERKA 5JGBA 4ZZMA 3TT0A 1Q8ZA 3GVUA 4QMOA 2XKFA 3QWKA 3K5VA 3D5WA 5GJFA 2GQSA 1OITA 3R2YA 4U79A 2C0TA 3NUPA 3ZM9A 4LUEA 3ODZX 4M66A 4K8AA 4OW8A 4PQNA 2VAGA 3A7JA 3TIYA 3VW6A 3ZEWA 4EWHA 4OR5A 5FUTA 4F63A 1G3NA 4X2FA 4RX9A 3KF7A 5DG5A 3TL8A 1BX6A 5TT7A 4QMNA 3D2IA 4FK3A 4WT6A 2X2KA 2YISA 3KXHA 3VO3A 1Q62A 2OIDA 4IJPA 4D28A 5A14A 4PTGA 4ASEA 4ARKA 4M13A 3COHA 1H1PA 3O23A 4FTIA 5EDQA 3ORZA 5D41A 4ANLA 4OAUC 2VTQA 2RL5A 4E73A 4I24A 1YI4A 1T45A 4TTHB 1RE8A 4AFJA 3RINA 3TN8A 2OWBA 4DEBA 4Q9ZA 1J7IA 4R6VA 3DKFA 1LPUA 4FEQA 4ID7A 1JPAA 1ZY5A 4Y5QA 4RG0A 2PZYA 2XNNA 2PSQA 3BQRA 2AC5A 3RPYA 4DHFA 3UQFA 1BKXA 4B0GA 4WG5A 5HG7A 5FTOA 2JIIA 3KL8A 1Q3WA 4M67A 4C57A 5AFVA 3LFEA 4XBUA 2HIWA 1VYZA 5K5XA 3QZFA 3VHEA 3W18A 5H3QA 2IWIA 1E1VA 4QMPA 4MNEA 3CXWA 1RW8A 3O8TA 3DPKA 4A9YA 1LEWA 3V04A 5GHVA 3GOPA 2WEIA 3ELJA 2XIRA 3PWDA 4QMZA 2UW4A 1JKKA 4O83A 3DGKA 4AF3A 4ALWA 2C0OA 4C4EA 2VNWA 3DK3A 2R9SA 5K0KA 3WE4A 3ZLSA 2HXQA 1V0PA 4QTAA 4QQTA 5C1QB 3JS2A 2FB8A 3T9TA 4FGBA 2P2HA 3NNWA 4EQCA 3QTRA 2YZLA 4RQKA 3UOHA 1VZOA 2ERZE 5CU0A 4OTGA 3ZTXA 4DGGA 3PJ1A 4IWDA 3RZFA 3EN5A 2UVYA 5JEBA 4UB7A 4IHPA 2R3GA 4FL2A 3DFCB 4H3QA 4B8LA 3HGKA 4YJVA 4XLVA 1H1SA 3RI1A 4OAVB 3PVWA 5CVGA 2REIA 4QTEA 4JIKA 3SAYA 3CD3A 1H08A 2PVMA 3MA6A 4KSPA 4NJDA 4YJUA 2XK3A 3F2NA 3TACA 2W4OA 3NAYA 2WXVA 4JR3A 5F20A 3UYTA 4YNEA 1YDTE 2J5FA 4F1TA 4V0GA 3RAWA 4CVAA 4GK3A 3R1QA 3DDQA 4GFMA 4GFGA 4BDJA 2YJRA 4E8AA 5HNGA 4NTSA 1QPCA 4LI5A 2O5KA 2GDOA 3FI3A 1NY3A 4I5PA 4V0GB 3OOGA 2W5AA 4I20A 4FE2A 1PYEA 4UWYA 2I6LA 2X4ZA 4IDTA 3QTXA 3WYXA 3DXNA 1JSVA 3BX5A 4IX4A 3Q5ZA 4V04A 5LARA 3QA8A 4C0TA 4FKPA 4JG6A 4XYFA 1SMHA 3MYGA 2H96A 4QPSA 5CU2A 1F0QA 4XP2A 3D7TA 1GOLA 5I4NA 4XCUA 3NSZA 4NKSA 3W32A 2UZWE 1JAMA 4ZSLA 3RAHA 4RJ4A 5E8YA 4QYYA 3LM5A 3SW7A 3E3BX 3N9XA 4IANA 3NWWA 4BYJA 2WGJA 3R8ZA 4D2PA 5JKGA 1Q41A 4KBKA 1GZNA 3GCVA 3HP5A 4EOMA 5AUXA 1PXMA 2BAJA 3D7ZA 3NYVA 4QP1A 3WF9A 1J1BA 2BDJA 1Z9XA 3O7LD 3R30A 3H3CA 4P90A 2BALA 3NUNA 5KBQA 1OIYA 4AZVA 2HW6A 3E8EA 4O86A 3MH1A 4DFXE 3R04A 4GJ2A 4WNMA 5KO1A 5DR9A 3OZ6A 2CJMA 2HZIA 4GRBA 3ENHA 1UU8A 1P14A 3FJQE 3G9NA 4NCTC 2XEZA 3QLFA 3TV4A 2CDZA 4BCJA 4ZSJA 5CAUA 3ATTA 1IASA 3Q9ZA 2HYYA 4I0RA 2FSOX 1BI7A 4F09A 3R7GA 4DCAA 3SW4A 3CJFA 5CSWA 4D1ZA 2UZOA 5DHJA 3ZFXA 2VWXA 5CAOA 2YM6A 4ONAA 4JDIA 3RAIA 2IVUA 4XS2A 3A62A 3GT8A 4L7FA 4F9WA 2F7XE 4NW5A 2BTRA 4BCMA 5J7BA 5L2QA 4WUNA 3DKCA 4MAOA 2CPKE 4QO9A 1JWHA 2VTHA 5HD7A 4M68A 2GPHA 4G5JA 3V6RA 2J51A 2JDTA 4YPSA 4C8BA 3RBWA 4Z9LA 3LQ8A 3AXWA 5KZ0A 3NVKI 1K3AA 3GEQA 2ZDUA 2B1PA 2PUUA 2WD1A 4L52A 4O2ZA 4DYMA 5AUUA 5CEPA 5FDPA 3D15A 2OJFE 2BRGA 5M4FA 2QHMA 3QX4A 4X2GA 4RC2A 3CS9A 3VF8A 3I79A 3FY2A 3HRFA 4MXAA 3NAXA 1O9UA 2BIYA 3A7HA 5BNJA 5HOAA 4QMXA 3ORMA 4NYEA 1BL7A 2I0YA 4JX3A 4PUZA 1LP4A 3ORNA 4O21A 2QO7A 4H3PA 4XG9A 3UNJA 3FY0A 2G01A 4ENYA 3G6HA 2C5VA 3ZUTA 3R9HA 4ACHA 4TWCA 5KHWA 3ACKA 5IA0A 5BVFA 3FUPA 5LOHA 4CRLA 1KE5A 2XNGA 3IGOA 2A19B 5M4IA 4FZDB 3ERKA 3FKOA 4OTQA 5L2IA 4RFYA 4UN0C 5ETCA 3AC3A 2OJJA 4N6ZA 1DM2A 5AV0A 3EN7A 4LGHA 4V01A 4BZDA 4OTHA 4XG6A 2VUWA 2X7FA 4AU8A 5L6OA 5A3XA 3TJCA 1XBAA 3FZTA 4BWPA 3PIYA 2CSNA 3E88A 4FL1A 3NCZA 3CGFA 5K9IA 5IA1A 3PP0A 3CKXA 4L45A 3BYMA 4AT5A 1NVQA 4IDVA 1FPUA 2EXCX 5H8EA 2W1GA 3GU8A 4BDKA 4KIKA 3BEGA 5HX8A 4F7NA 4NFMA 1ZY4A 3NW6A 3EZVA 2C1AA 2XK7A 5IQDA 4XX9A 1XH8A 5HO8A 3TNQB 4AWIA 2V22A 5KKRC 4BDFA 4FR4A 4OTIA 1GZOA 2DS1A 1PMVA 3OCTA 4Y83A 3W33A 4KIKB 5CNNA 4RWIA 4GK4A 4HNIA 1EH4A 2QC6A 2W4KA 2B9IA 3UZRA 4MD8E 4FK6A 4EH6A 4UXLA 5CS6A 3MFTA 4I93A 4BKJA 1J7LA 3VRZA 3VWAA 4GH2A 2E9OA 3CY2A 3BHTA 3PUPA 3R1SA 5EDRA 2ZV9A 3ZUUA 4A4XA 3S00A 2C0IA 2GU8A 3OCSA 3MSSA 3Q32A 3F5UA 4S33A 3PSCA 4NIFA 4PNIA 4QP2A 4U97A 4FZ6A 4L00A 4A9RA 4QP4A 3P7AA 1VJYA 2UW0A 5AR7A 4F08A 1JOWB 3PE2A 3O7LB 3T9IA 5F1ZA 5CF4A 2OO8X 3QQUA 3R7OA 4DBNA 3BWFA 4UMRA 2YA9A 4NIFB 3OW4A 3R7IA 2ITXA 2OXXA 3EN4A 3CTQA 3EFLA 4PPBA 4USFA 3HV5A 3HDNA 4UWBA 3DLZA 4XG4A 1PXOA 2QO2A 4R3CA 3PVBA 3Q53A 2LAVA 4MNFA 4XJ0A 1REJA 2GQRA 3RWPA 4CV8A 1U54A 5KMLA 4FKUA 4OTWA 2GHLA 4MD7E 3UP2A 1MRVA 5EG3A 3OXZA 3MS9A 2P3GX 4RQVA 3C4FA 1VEBA 2QOLA 3FLQA 4MEDA 2WQOA 4AX8A 3HV7A 3N4TA 5L8JA 2YN8A 3L1SA 4UMPA 4TWPA 1U54B 3ORLA 1OL2A 5ACBC 4A06A 1M2PA 3NEWA 2ITYA 2UW3A 1H27A 4KD1A 2IW9A 2YDIA 4MXXA 4EJNA 4I0SA 1W8CA 4O0RA 2HWOA 4YJOA 3W8LA 3MFSA 3ZDIA 4ALUA 5CF8A 2YIRA 4GKIA 2QNJA 4AGDA 1YXTA 2B9HA 3GC7A 3PPJA 4J8NA 3PRFA 4RGJA 4UWCA 3SX9A 3PXYA 3TI1A 3ORTA 4BCQA 4S30A 3ZS5A 1SZMA 4FKQA 3FZRA 1U5QA 4RIYA 1MQ4A 1UU3A 3SD0A 4UXQA 3GGFA 5AM7A 3ITZA 4MXYA 3BPRA 3G90X 3QKLA 2WMUA 3OXIA 2HK5A 4I23A 3V5TA 4FC0A 4MD9E 5E8UA 4R8QA 4DFUA 1XR1A 2OI4X 2WTVA 4I21A 4RIYB 4EZ7A 3NUYA 4KB8A 5HLPA 5G1XA 3QRJA 4G3EA 1O6LA 5EI8A 4FSYA 1PXLA 4L3PA 2BILB 4TNBA 4GL9A 5JT2A 2J5EA 2BDFA 2OFVA 3QTQA 4NW6A 5LVLA 4IQ6A 4XHKB 2WKMA 5D7VA 5DRDA 2C5NA 3U54A 5HE2A 5M4CA 5M08A 5IZFA 4NSTA 3UTOA 2PYWA 4GIIA 2X39A 1GIHA 4NM5A 4D2TA 3OVVA 2C30A 1H07A 3QCXA 3FZSA 3HMPA 5CNOA 2VGPA 3DBFA 5J1VA 2WQEA 5KCVA 3KK9A 3D0EA 3KKVA 1M14A 2YHVA 4FIGA 5IPJA 3FPQA 2DUVA 3R8LA 1O6KA 3OWKA 4GYGA 4HYSA 1KE6A 2QQ7A 4IX6A 4I6BA 5C8MA 3WIGA 4APPA 4CFUA 5L2WA 2CKPA 4AN2A 4C3FA 1XH6A 3PXZA 2R4BA 3FLZA 4IBMA 3ZC5A 4E20A 3U6IA 1ATPE 2E9PA 4ANNA 4H1JA 4TN6A 4O7WA 2YITA 4OBQA 5L4QA 3C0GA 2X8DA 1P2AA 4QD6A 4QTBA 4HYHA 1B6CB 2YM4A 3QYWA 4JR7A 5M09A 1Q8UA 1WVYA 3FQHA 4X7QA 3OROA 3AOXA 4ZTNA 2GS7A 1Y91A 3TNPC 4O7VA 2Q0NA 4GIHA 4BCHA 3FMNA 4WG3A 1KWPA 4LUDA 3BE2A 4P4CA 2IN6A 2XNOA 1OL6A 1WBNA 4W8EA 1H00A 4Y72A 4CLIA 1FMOE 1RDQE 1OI9A 4IX3A 4QMYA 2OU7A 3AGMA 2CNVA 4FG9A 4TYIA 4FKTA 3W2QA 2UV2A 3EQPA 2BAQA 3LCOA 4QP6A 5FG8A 2BTSA 3IS5A 5CEQA 5CWZA 4GW8A 5J5TA 3Q04A 3A7GA 5KMOA 2GSFA 4FUXA 3TTIA 3TKHA 4BB4A 3K54A 4CT1A 5EM6A 4FOBA 2HENA 4U80A 4BTMA 4RFMA 4EOJA 2CCHA 4FTKA 5ETAA 1KE9A 1REKA 2PVKA 3PJ3A 4W9WA 3BYUA 2XKDA 1H1RA 2XYNA 3PXQA 4XMOA 5AP2A 2Y4IB 2XJ2A 2PVJA 5D10A 3U8WA 3FWQA 4AE6A 4L8MA 3VBVA 2BROA 4RX7A 5BVDA 2WMAA 3UZTA 4DTAA 2IVTA 3FYKX 2X2LA 3TWJA 3SXRA 4E7WA 2B52A 2J90A 2OJ9A 5FWKK 4ERWA 2ZB1A 4F0FA 4DBXA 4TT7A 3BHVA 5AP1A 3BHUA 4WG4A 5LJJA 2VN9A 5TOZA 4BCPA 3C4ZA 1ZMWA 3EYHA 4DH8A 2VTNA 4K1BA 4E4NA 5IH6A 2PUPA 1XKKA 4J98A 3I6UA 3BGZA 5EI6A 2OKRA 3OP5A 3Q2MA 3QCSA 3PG1A 5IQAA 4UBAA 3TNIA 4L7SA 4YMJA 4BGGA 2ETKA 4HCUA 2QD9A 2VD5A 4GFOA 4EHEA 4AGWA 4AUAA 4A9UA 4FNWA 2WNTA 4KKEA 4K9YA 2QOIA 3UG1A 3UOLA 3FL5A 4FSRA 4G3CA 4DLJA 1WZYA 3NIEA 3UC4A 2YABA 3KRLA 4W4VA 4D2RA 1WBSA 4BHZA 5DBXA 3PY1A 3MY0A 5IH4A 2XNMA 3W55A 3CD8A 3NPCA 2XK4A 1YXVA 1M17A 2QU6A 3EOCA 3GP0A 3UYSA 1OUKA 4KS7A 4J97A 3L8SA 4XUFA 3DAKA 2GNFA 4O0YA 4AT3A 5HX6A 3FLNC 2XRWA 3MJ2A 3NMUF 5AAFA 3MFRA 3ZMMA 1UWHA 1JQHA 2E9UA 5L6PA 4R1VA 3TNWA 2XBAA 5TR6A 2R3QA 3PA5A 4GUBA 4LOOA 3S4QA 5J7HA 2QG5A 4F4PA 2IVSA 3VS3A 3VAPA 4C3RA 3ZSHA 1AGWA 5EYCA 2IPXA 4BZNA 4DF3A 4JBQA 4JVGA 4M3QA 2JITA 4JIAA 4PDPA 3C0IA 3U87A 4X2KA 4HCTA 3P5KA 5I5ZA 1R0EA 4YBJA 4CFWA 4O96A 2ITUA 4CFVA 2H9VA 4TYGA 5JSMA 2GTNA 2VTJA 4GT3A 4RC4A 4A9SA 4QQ5A 2BR1A 4YZBA 3WILA 3MVLA 4MHAA 5E4HA 3MPAA 1MRYA 3MVMA 4QTDA 1UKHA 3MWUA 3R2BA 3MESA 5EYDA 2BZHB 2J50A 4HGTA 5CSXA 4C4GA 4EI4A 2YLEA 1OECA 3G33A 4CMUA 5KBRA 1AQ1A 2QU5A 5AP6A 5J79A 1G5SA 4E6AA 3Q52A 2W5HA 4LG4A 4RMZA 5E1SA 2I7QA 3NYOA 3QQJA 3SV0A 4AOIA 2JKMA 3L8XA 2BRHA 3UVPA 2OLCA 3PVGA 3I7CA 3A60A 3QC4A 2VTAA 3M42A 2VWBA 3RNIA 1Q4LA 2HWPA 4ZJVA 4FYOA 3GCPA 3UVQA 2X8EA 1TQIA 2BZJA 2FVDA 3BRBA 3OT3A 5C27A 3WBLA 3G51A 5BVWA 5FBOA 2W1FA 3HRCA 3KXXA 4IWOA 4ANBA 3LCTA 4GSBA 5CENA 4RRVA 4DH5A 2HXLA 3V5WA 3K3IA 4NWMA 3DCVA 3KXMA 4O0XA 1NW1A 3H9RA 2ZV2A 2XNBA 4FT3A 4RIOA 2R3PA 1JKSA 3EFWA 4B4LA 5D11A 4FKOA 1OVEA 3BI6A 2XZSA 5FRIA 4EKKA 4YHTA 3FMDA 3IW5A 3LMIA 3CJGA 2XEYA 4CCUA 2GCDA 3GUBA 5EQYA 4FKJA 5I9VA 3HUBA 4FG8A 2J0MB 1W0XC 2JFMA 3BLQA 5FEEA 2NRYA 4FV2A 5IU2A 3QXOA 5HLWA 4I5CA 2GHMA 3W2RA 3GC9A 4CQEA 2E9VA 5GJGA 1H0VA 4R77A 1OBDA 2I40A 3IW7A 4JX7A 4M0ZA 4DTKA 4C2WA 3HA8A 4EH3A 5IA4A 2Z02A 2JFLA 4QMLA 4FSMA 4CNHA 3BV2A 5CX9A 3ZHPC 2JD5A 5GIPE 4NCTA 2HY0A 3KB7A 2JC6A 4JDKA 2NPQA 1M2QA 4DGNA 4TZRA 2V55A 5EI2A 4BTJA 4QP9A 4C38A 2BKKA 1H01A 1YXSA 3BWJA 3C1XA 4AFEA 3DXQA 3VS7A 2Z7SA 3PIZA 3ORXA 4JAIA 3GBZA 5CZIA 5K4JA 3QTUA 4KSQA 3QAME 3VUDA 4BIEA 2W1ZA 2XIKA 5EM7A 1NA7A 3E8CA 2GMXA 4ZK5A 3LQ5A 2J0IA 3LPBA 3AC5A 3E8DA 3SXFA 1YDSE 3ZYAA 4JDJA 5M53A 3IECA 4FKRA 5JK3A 2RG5A 4UALA 5E8TA 2WB8A 3P86A 4MF1A 5HBEA 3N4VA 3K5UA 4OBPA 3IDCA 3KXNA 2WU7A 5CZHA 4DGLC 1UU9A 2XKEA 3EFJA 4EYJA 5EDPA 5E90A 2IW8A 3ZOSA 3RK9A 4Z16A 4FTRA 3PZHA 4GUEA 4AZEA 3COIA 2E9NA 3ZXZA 3LE6A 3HAMA 4RZWA 4LL5A 3CQUA 2FH9A 3D9VA 1PW2A 3FMEA 4R7HA 1U46A 5A4LA 5IEXA 1Q97A 4FMQA 2IO6A 4M12A 4BZOA 3OW3A 1AD5A 1W84A 3FXZA 4AS0A 4X21A 5LVNA 3DU8A 3ZBXA 4GEOA 3FC1X 5BVOA 4WKQA 3TDVA 3UIUA 3RPRA 3P7CA 4EK3A 4N0SA 4C33A 3QZHA 3BV3A 2Y4IC 2XJ1A 2V7AA 2R0UA 1S9JA 3LW0A 3MY5A 4K18A 5M55A 2G15A 2RGPA 3ZFMA 5HQ0A 4CFFA 4D2VA 5BYYA 2F4JA 5LXMA 3NNUA 4U42A 3CQWA 4DFLA 4W4XA 3DK7A 4CFNA 2DWBA 3UDBA 3F6XA 3HUCA 4AG8A 2GNLA 2BDWA 2Z7LA 4IEBA 4J71A 4WD5A 3VNTA 5A6OA 1PF8A 4JBPA 1Z5MA 4QP3A 2W96B 4LFIA 5IQHA 5ETIA 3UJGA 4CXAA 4EORA 1B38A 3QCQA 3TKUA 2JAMA 2B7AA 4EH2A 2XCKA 4QTCA 3EIDA 4FIFA 4IAKA 5KKRB 1DAYA 2XJ0A 3Q4TA 3CBLA 4C58A 4FKVA 5E9EA 3VW8A 4ZTMA 5CF5A 3OWLA 4RX8A 3MV5A 3C4WA 4Q5EA 2ACXA 2ETRA 4O7YA 3IDPA 4YZNA 4G31A 3SOCA 1SNXA 3ZRKA 1B39A 4DG2E 5FLFA 3B8RA 4UZHA 4ANQA 4ZLYA 3KQ7A 4Y95A 3FPMA 1NVSA 4IC8A 2UW9A 4AW0A 3GFWA 2J0LA 1OBGA 3CLYA 2CNUA 2C3LA 4UMTA 4F64A 3KY2A 4G16A 2X2MA 3KXGA 4FTAA 4OBOA 4BI1A 3LXPA 4QMQA 1Y8GA 5HE0A 3DBCA 5J87A 4MXOA 2QOOA 3KK8A 4HW7A 4EQUA 3P08A 4LRKA 5AUVA 4YJPA 3CEKA 3NW5A 4BWXA 3RJCA 2O63A 1IA8A 3RVGA 1FVVA 3O51A 4TW9A 3NW7A 5JH6A 4BFMA 4DFYA 2V62A 5EW9A 4FVRA 1J3HA 1HOWA 2CMWA 3MGYA 4MNEB 4DFBA 3JVSA 2JKOA 2F7ZE 3OTUA 4OTRA 2QVSE 4WSQA 2QLQA 2R3LA 3I5ZA 5AIKA 3VC4A 4J53A 3KFAA 1A9UA 4WHZA 1UWJA 3FV8A 3Q60A 2GHGA 3FSKA 4FT9A 4U43A 3P7BA 2C5XA 4EWQA 1I09A 5ACKA 3L9PA 2WTIA 3GC8A 1YXXA 3NCGA 2EXEA 2X7OA 2HZ0A 4PNKA 2CGWA 3DAEA 3QUEA 3D2KA 1URWA 3PSDA 4ANOA 3LFFA 3N4UA 5B0XA 5HNBA 3QCYA 4AZTA 3VHKA 4I4EA 3EZRA 4G2FA 3DA6A 3G5DA 5DFPA 4QMSA 2G2HA 3RCJA 3AGLA 4UEUA 4EK6A 1WBPA 4O0WA 2OZAA 3BKBA 5DLSA 2YM8A 1Q5KA 4EH5A 4BCFA 2RFSA 3OFMA 2O0UA 4U6RA 3TG1A 4K2RA 3MB7A 3QC9A 1XBBA 5HG9A 5HKMA 3SC1A 2OZAB 2A27A 4IZAA 4NH1A 5CQUA 5HD4A 2LGCA 5B2KA 5AM6A 4YTIA 2ERKA 5LQFA 2XK6A 3H9FA 3RTPA 4CKRA 4O7TA 1U59A 5AP3A 3AQVA 3HYHA 2GS2A 1ZRZA 4IC7A 4U9AA 4PY1A 4WRSA 4IVAA 3RMFA 1R3CA 3ZSGA 3UG2A 5AUZA 4EH4A 4ZY5A 4MX9A 4B6LA 4I5HA 3M2WA 4PL5A 2R3JA 3FZOA 1JKLA 4MYGA 3C5UA 3OCBA 4L43A 3BHYA 5GZ9A 1MP8A 1CTPE 5EOBA 2P0CA 4F7JA 4RPVA 2C47A 3DBDA 3DBEA 3D7TB 3GNIB 4JBVA 3EQDA 3H30A 3DTCA 3IK3A 3W2PA 5M4UA 5CI7A 4CG9A 4XP3A 4YUQA 5KMIA 4JDHA 2PVYA 3E92A 5EKOA 2B53A 3E7VA 3R02A 2QOCA 1I44A 1W7HA 2YERA 3Q3BA 3LJ0A 4XBRA 4ZZOA 3WZKA 3B2TA 3ZDUA 2QODA 3HZTA 2C4GA 5E8SA 5IDNA 4FEXA 2UW5A 2OIQA 3ET7A 1U5RA 2R2PA 2UZNA 3ALNA 3MH2A 5DIAA 3EQGA 1IEPA 4BDAA 3P9JA 5E7RA 4XRJA 4YJSA 4J95A 2AUHA 4U40A 3RCDA 4YJNA 1PXPA 3DQWA 4YHJA 2PE0A 4ZTQA 4RX5A 1UKIA 4ACDA 2YM5A 3P23A 3VJNA 5GZAA 3GB2A 1OKVA 2F2CB 2NRUA 3PZEA 3WIKA 3TUDA 4EOKA 1H24A 2WTJA 4GS6A 5CY3A 5HI2A 5EQPA 3R9DA 5CEMA 2ZM4A 3KRJA 3DJ5A 4GU9A 4CMOA 2GS6A 1L8TA 2R64A 3DK6A 5GNKA 2OG8A 4KIOA 2R3HA 4TWOA 2YWVA 1Q3DA 4TY1A 4D4YA 3HLLA 3AMBA 4K77A 4AW5A 4ASZA 5AAEA 3AD4A 4D1SA 4KBCA 4YSJA 5A9UA 4RFZA 3L9NA 5BYLA 5C4KA 2JAVA 4D5KA 2IW6A 5HIDA 4BBFA 1UV5A 5BVEA 4AA4A 2JDVA 4X2JA 5EW8A 3QQLA 3RP9A 4JRNA 1UA2A 3E87A 3JPVA 3V3VA 4BIDA 4EOIA 1DS5A 1PHKA 2ZMDA 2J0KA 5A4CA 2JBPA 4L3LA 3ZXTA 4BDIA 4L67A 5I9ZA 4F1MA 4LV8A 3QALE 4MK0A 2WTCA 5LWMA 2OICA 5LMKA 2VO7A 4TRLA 5CU6A 2VTRA 3REPA 2ETMA 5IKWA 3B8QA 2YWPA 4U5JA 4IZ5A 5DWRA 4C62A 4YC8A 2OK1A 3II5A 5CTPA 2RFEA 4D2WA 4FTMA 2IZUA 2UZBA 3OUNB 4FEUA 4RWJA 3DV3A 1OB3A 4BDCA 5M57A 4PDSA 2C3IB 1LUFA 2YCFA 3RPOA 4RA5A 3FI8A 4I22A 3VJOA 5G6VA 4ZMFA 5DT3A 1A06A 4BVUA 3QUPA 5IG1A 2Z7RA 4MBIA 1R1WA 3V8SA 5CI6A 2QOBA 2O2UA 3HVCA 4NT4A 4E1ZA 2A1AB 4JT3A 3OXTA 1FGKA 1R0PA 4FV5A 1XJDA 3FXWA 3PP1A 5HVJA 5C8NA 4JQEA 4AA5A 1J1CA 1MRUA 4FSZA 2O8YA 2BHEA 3WF5A 4G3FA 4N70A 5EYMA 3DNEA 2UZUE 3FKNA 2BRNA 4BR3A 5HCYA 5EOLA 4BCKA 4DFNA 2BFYA 1JSUA 3L9MA 3DDPA 3PFQA 4U8ZA 4YZCA 4F7LA 4LOQA 1A48A 4FTTA 4KUJA 2FSTX 3MN3A 3O8UA 4FVPA 4CSVA 2BCJA 3ZSIA 5L2SA 1OIQA 3KREA 4O7LA 5FEQA 3KGAA 5EHLA 4TWNA 4B7TA 3ETAA 1ZYDA 4DH3A 3DB6A 3ZBFA 4O81A 2VRXA 3AC1A 1Q8TA 5ETFA 4AOTA 3Q96A 4Z55A 4ZLZA 4HVDA 4YJQA 2OH0E 4J1RA 5AP4A 3VBWA 3HMMA 3FBVA 3OS3A 4GG5A 4S2ZA 2A0CX 2HCKA 3UVRA 4O0UA 4PPCA 4EK8A 5DN3A 5H8BA 4UV0A 5FD2A 4BY9E 2VGOA 3R00A 3DY7A 3IONA 3F7ZA 4CCBA 4PRJA 4KS8A 4Z7HA 5E1EA 3QYZA 1XQZA 4IVBA 3RM7A 5E92A 3UIMA 4FKIA 3BLHA 1OIUA 3UPZA 5DGZA 3F2AA 5T68A 3HX4A 5DA3A 2H34A 3DBQA 3ZLXA 2UZEA 5FP6A 4E6DA 1P4OA 2RFDA 3WOWA 1CSNA 1ZZ2A 3C9WA 2ITOA 4YZMA 2X9EA 5H2UA 3UE4A 2FSLX 3R22A 2R3NA 3VN9A 3WE8A 2CGUA 4IM3A 4BYIA 3PXFA 3FLWA 3NR9A 3WZJA 5BPYA 4D1XA 4BGQA 3RM6A 4OUCA 4EHGA 2KTYA 2VWIA 5H8GA 3GU7A 3P79A 4FBXA 4L6QA 3JR1A 5JRQA 4KABA 2W1HA 3C4EA 2WO6A 4ITHA 3C4CA 5JFWA 4I5MA 1OL7A 1E1XA 4HCVA 5DEYA 2UW7A 2W0JA 5HG8A 4YR8A 2IZSA 2W9ZB 2QR8A 3NS9A 2IZTA 3R9OA 3C5IA 2ZVAA 3LXKA 1XBCA 2ZB0A 4O6LA 4QQCA 3QD2B 4FTLA 2WTKC 5FM2A 3PRIA 5HCXA 3QRKA 4LMNA 3UOJA 2FYSA 3RPVA 5AA9A 4MVFA 2JDOA 4I0TA 4X0MA 3KRXA 2I0VA 5B7VA 5BMMA 3G15A 4CFMA 5K4IA 4II5A 3T3UA 1V1KA 5DEWA 4AOJA 4L53A 4EC9A 5BUJA 4R5SA 4QOXA 2XBJA 2CLQA 4FNXA 3KU2A 4F70A 3KXZA 4MBLA 2UW6A 4U41A 3CCNA 4Y73A 5KUPA 2W4JA 3EJ1A 2FUMA 4YGAA 1YHWA 1JBPE 3DKGA 3QQHA 4IAAA 3QTIA 1PJKA 3PE1A 4RJ8A 2XIXA 3CPBA 4FTUA 3ZO4A 2I0EA 1YWNA 4L3JA 2JKQA 4DCEA 2BUJA 4LRJA 2OJGA 4GYIA 4TPTA 1H1WA 3RK7A 3P1AA 5IH5A 3TIZA 3POZA 4TYJA 4G3GA 4XG7A 4YNOA 4EH8A 3FI2A 3FAAA 1GZKA 3QBNA 4PP7A 1RQQA 4WUAA 2W06A 5JGAA 3D4QA 2WOUA 4O0SA 5DH3A 4IM2A 3LVPA 5E91A 4C37A 5CAVA 4EHZA 2VZ6A 1BLXA 3E7OA 3GXLA 2YJSA 3QQFA 5HESA 3V8WA 3U9CA 4ALVA 2XK9A 5I9YA 2G9XA 5DR6A 1TVOA 5IUHA 3LFAA 3QF9A 2PTKA 2C6OA 3KF4A 3TNHA 4FT0A 2UW8A 1JSTA 1PXNA 4CMTA 4JXFA 1G8AA 4KRDA 5FQDC 2XIYA 5ANOA 3EQHA 3F7WA 1LEZA 2IZRA 5DI1A 2KULA 3VIDA 1Q24A 2JKKA 3A8XA 5DE2A 2PE2A 3IDBA 1Z57A 3QGWA 1YDRE 5KE0A 3KVWA 3EB0A 4DEHA 4KRCA 4EHVA 4F9YA 2PWLA 3GFEA 4RA4A 5C9CA 1GAGA 2EWAA 4YTCA 4CT2A 3TZ8A 4K33A 3LJ1A 4YZDA 1VYWA 2XUUA 5IQCA 4AN9A 1QPEA 4YURA 4CYIA 2C6MA 5K0XA 1BYGA 3RKBA 5LMKC 3R7UA 3W2OA 4N4SA 2YDJA 3LXLA 3TDWA 2FSMX 3FLYA 2ZOQA 4GVJA 4E93A 2XK8A 5KMJA 2GNJA 5LVMA 4B9DA 3OBGA 4HVHA 5M07A 1O6YA 5F4NA 3A7FA 4FOCA 3R8MA 5I9UA 3ODYX 4FEVA 4NZWB 3ZZWA 1X8BA 2X8IA 3PPKA 5C01A 4HJOA 3E62A 3QTWA 1Q61A 1YOJA 3CP9A 3KMUA 3FI4A 4L01A 1M7QA 4YC3A 4CZTA 1CKIA 5DNRA 4A9TA 4FSWA 4BGHA 4AT4A 5HTIA 4WBOA 3FSFA 5CXHA 3RNYA 3TEIA 3LFBA 4YTHA 3IW4A 4IAFA 2VWZA 4LGDA 4QMTA 2XF0A 4IB1A 1FQ1B 4X6RA 3MY1A 3FZ1A 3W1FA 3VULA 2XKCA 3MI9A 3MDYA 4K0YA 5AP7A 1Y6BA 1LR4A 3QFVA 4LMUA 5E8XA 3E64A 2QONA 2B4SB 3FKLA 4EBWA 2P55A 5IUIA 3ROYA 3AT4A 4HZSA 2BFXA 1Q99A 3V5PA 3B2WA 3KCFA 3UNZA 4AW2A 5EH0A 5AP5A 3I0QA 4FV7A 1KE7A 2BRBA 4DEDA 4S31A 3G0FA 4OTDA 4TYHA 4MH7A 5FEDA 3AMYA 4RJ5A 4GU6A 4RLKA 3BEAA 5ITAA 5AR8A 4BC6A 4F7SA 2G2IA 4RT7A 5EM5A 4P5ZA 4CZYB 2WMQA 4Y85A 2J4ZA 3G2FA 4TYHB 4X3FA 4BWKA 4CD0A 1ZOHA 4F1OA 3I0OA 3SRVA 3TZMA 3O17A 4O0VA 3QTSA 4P2KA 3CTJA 4OTPA 4I3ZA 4IWQA 4QPAA 4XG8A 4WSYA 1OGUA 2F2UA 3ACJA 4C4JA 3ZO1A 1PRYA 4X3FB 1HCKA 2EB3A 3A61A 2J0JA 3OG7A 5AUTA 1ZYLA 3SRVB 4D4SA 1WVWA 2XA4A 2XRUA 5AMNA 3KVXA 5HVYA 4ACMA 4D0XA 4IB3A 5JFVA 5HICA 1JLUE 4FV0A
chains in the Genus database with same CATH superfamily
4ZEGA 3NLBA 3OBJA 2X6DA 5D1JA 1KUTA 1T46A 4PMTA 2ZM3A 3BYOA 3EKKA 3UGCA 1E9HA 2HELA 4D55A 2R3KA 4D4VA 4F6WA 5JQ8A 1OL1A 2XAOA 4ASXA 4DHZA 4IH8A 3NNVA 2QOHA 2C6LA 2J9MA 4FTOA 4AA0A 5DYJA 4C4HA 3ZZEA 4X6QC 3GOKA 2QLUA 3PY0A 2W1IA 4Q2AA 5CSPA 5JN2A 2VWVA 1TFFA 3LQ3A 2ESMA 4AGCA 5BQ0A 2VWWA 4LL0A 3GCQA 5CU3A 4F9BA 5IQEA 1R78A 3VVHA 2PUNA 2PZ5A 4RBLA 1OM1A 4TNDA 3UBDA 4C61A 2W05A 1SYKA 3PY3A 1KE8A 5D7AA 4DEAA 4FV3A 3PDTA 1XH7A 3VS4A 4QPMA 4BDEA 4YBKA 4AZWA 5M44A 2XB7A 3EYGA 2WELA 3MH0A 4GKHA 4FV6A 4EZ3A 2BMCA 1ZXEA 5E8ZA 5J9LA 2WTDA 4FKLA 2PVFA 3PLSA 2IEWA 4J7BA 4O6EA 3D94A 1MUOA 3D5UA 3EL7A 4AP7A 3NUUA 4DGMA 4RVLA 4O7SA 3ORPA 4BICA 4MXZA 4P7EA 3I81A 1HCLA 3BBWA 3GQIA 4H3BA 4IW0A 1UNLA 5GJDA 3ORKA 1WAKA 2R3RA 4PL3A 3S2PA 4E4XA 3UP7A 5KMMA 1FVTA 1Y6AA 4QYEA 4FEWA 4JRVA 1CKPA 3RGFA 5BX0A 4ZSAA 2PULA 2WU6A 2CGVA 4FSQA 3OCGA 4C4FA 3KULA 4EK4A 3DNDA 1KSWA 4WOVA 4E5BA 2C6TA 2ITWA 4ANMA 4IADA 3UIBA 4F9CA 4ZAUA 5AEPA 2UVXA 4ZY6A 5LWNA 5EKNA 2CN5A 3R8UA 2PE1A 4PTCA 3KULB 2XP2A 2PK9A 5GINE 5IUGA 4BI2A 2OGVA 2Y8OA 3P0MA 2PU8A 1YQJA 4NKAA 4FZFB 3OY3A 5EW3A 3BYVA 1SVEA 4MQ2A 3AKLA 4AACA 3NRMA 4CKJA 2X0GA 3AC8A 3CE3A 4I94A 4NUSA 5KHXA 4PP9A 1P4FA 4XH6A 3R7EA 4KA3A 2JIUA 3O8PA 4J8MA 2H8HA 4CEGA 3SLSA 3QQKA 2ZAZA 3PLAE 1SNUA 4M84A 1FGIA 4J99A 5I3OA 4GT5A 1FINA 2P33A 3A2CA 2Y9QA 2W1CA 4EH7A 5ANIA 4XG3A 2WMBA 3IOKA 4QQJA 2W7XA 1NXKA 3LOKA 4RWKA 4CRSA 5GZ8A 3OC1A 5CALA 3QD0A 5I9WA 1GNGA 3HDMA 2CN8A 5KMKA 1WBTA 2WEVA 2R0IA 3RK5A 5LVOA 4JQ8A 2XIZA 3OUKA 4HPUE 3ID6C 3IKAA 4FF8A 3NIZA 3ZCLA 4JQ7A 3PSBA 4O2PA 4AN3A 5JZJA 4YU2A 2F57A 3JUHA 3VUKA 3UO5A 3AT3A 5C03A 4PL4A 1ZOGA 2GNGA 2NO3A 3O96A 4FVQA 2QCSA 1XMLA 3NX8A 5KMNA 5JFXA 3HMOA 3QWJA 2CCIA 4L46A 3KMMA 3F5XA 5M06A 4FX3A 2X0QA 2QKRA 4IAZA 5CAPA 1UVRA 4IFGA 2R7IA 2Y7JA 5AP0A 2UVZA 2YCQA 3V8TA 3VBXA 4FL3A 5IMEA 1BUHA 4TKSA 4UYNA 4CG8A 3MBLA 3PXKA 4L44A 4IZ7A 3JVRA 4IZYA 5F95A 4CFXA 1STCE 3D5XA 3UODA 4O22A 4HNFA 4D5HA 5L2TA 4ZLOA 3QUDA 4XV9A 5JGDA 4CKIA 3IQ7A 4RJ7A 4USEA 3S1HA 4CTBA 1PMNA 5HCZA 1XH5A 2OBJA 2WMWA 3R83A 3MW1A 3CSVA 3UPXA 1GY3A 4M14A 5AR2A 4MBJA 5DVRA 3BU6A 1IRKA 3LCKA 4FODA 5AX9A 4EUTA 3V5JA 2YEXA 2WQNA 3LXNA 1K2PA 2W1EA 4W4YA 3R7VA 4O82A 2UZDA 3KMWA 5AADA 3W16A 2QO9A 3MVJA 1QCFA 4O4EA 4G17A 3EQRA 4IX5A 3LFSA 1YVJA 5BMSA 3QXPA 4UMQA 3UIXA 5HLNA 4WA9A 4K11A 3LMHA 5ANGA 3VUMA 5CASA 5EFQA 3LIJA 3HV6A 3H4JA 3CPCA 1NT2A 2OFUA 3HEGA 3LFNA 4M15A 3SGCA 4BKYA 3KCKA 3QZGA 2A4LA 4DEGA 4IAIA 3F2RA 4ENXA 3UMWA 2ITPA 4ZJJA 4F0GA 1W2CA 2XNEA 3BGPA 4KKHA 4BDHA 3THBA 3ZLWA 1SVHA 3OTVA 2X81A 5IF1A 4BDGA 2FA2A 3O50A 2XANA 3NYXA 2PZRA 4RWLA 5JFSA 2QR7A 2YM3A 2OXYA 2AQXA 3F61A 2XH5A 4O0TA 2RKUA 2WZJA 3DKOA 4Q9SA 2C6DA 3EWHA 3HV4A 4J52A 4W4WA 2VNYA 3AMAA 4LGGA 3NZ0A 5TE0A 2VO0A 4WRGA 4B8MA 3ZO2A 1W2DA 4FGRA 4IWPA 3A99A 4C35A 3UQCA 3HV3A 2OSCA 4I92A 2XNPA 2OJIA 2JLDA 5CSVA 3QRIA 4IVDA 4X3FC 3V5QA 2JEDA 4QMVA 3DFAA 1WFCA 3BIZA 4ZTSA 5F94A 5HBJA 3ULZA 2HZ4A 1PXKA 2YAAA 2PVNA 2PMOX 3BU5A 3TXOA 5IQFA 5AAGA 3H10A 2WPAA 3C4XA 2OH4A 3AKJA 4DG0E 2B54A 4FNZA 3FLSA 4RZVA 3O2MA 2XAMA 1S9IA 2BKZA 4U3YA 4D0WA 3WF8A 4FTNA 2FGIA 1YWVA 4D9UA 3COKA 3FHRA 2WMSA 3QD3A 1ZZLA 4EONA 5DRBA 5IDPA 4XP0A 2R7BA 3GU4A 4P5QA 5FTQA 4ZMEA 2HY81 4NL0A 2WAJA 1ZYCA 2WTKB 4E6CA 1OUYA 4DT9A 3LLTA 3IG7A 4PV0A 3ZFYA 1ND4A 2WQBA 4XLIA 4I1ZA 2PZPA 3LZBA 4BL1A 3JY0A 4OTFA 4BKZA 3HAVA 3LCSA 3POOA 1QL6A 3CC6A 1F3MC 2WOTA 4WBBB 5C4LA 4GV1A 2W9FB 4D2SA 2V0DA 3R0TA 5CF6A 2C69A 3SG9A 4ZIMA 5ANEA 3RWQA 3TM0A 4H58A 3F66A 4BBEA 3VUIA 4O7ZA 1JNKA 1OMWA 4NK9A 5JMSA 1ZWSA 1IG1A 4IMYA 4NU1A 4DINA 3JXWA 2YIXA 3PIXA 2C68A 1H26A 2O3PA 5FBNC 5J9YA 3C7QA 4IB5A 1YI6A 2VV9A 5HORA 3ANRA 1IR3A 5GIOE 1DAWA 3E5AA 5C26A 1H25A 3MIYA 3MA3A 3W8QA 4AW1A 5IEYA 4IE9A 4F99A 4F9AA 4F6UA 4O38A 4Z7GA 1GIJA 3DT1A 3D83A 4GJ3A 4BCOA 3W0OA 2EU9A 3BYSA 4QP8A 2OXDA 3R8PA 3Q6UA 4DEEA 4EOPA 3NDMA 5EM8A 4R3RA 2ZMCA 2B9FA 4YP8A 5KZIA 2I0HA 3HA6A 3TJDA 1J7UA 3A4PA 3MIAA 1CDKA 4BTFA 2PVHA 1M7NA 3LAUA 2WFYA 3OY1A 4B99A 5IMXA 2Z60A 2W17A 4ZY4A 1M52A 2JIVA 3RPSA 3PYYA 5EHOA 3A4OX 3A7IA 3S0OA 4C7TA 3R28A 2OW3A 2WMXA 3OEFX 4HYUA 4JAJA 5AUYA 3K3JA 3UO6A 3BBTB 5AJQA 5LCJA 2CKQA 2PY3A 3ULIA 3UDTA 4G6NA 4RIXA 2VTLA 4ZZNA 3C0HA 3U55A 2R3OA 4E4LA 2G1TA 2F9GA 2ITNA 2ITVA 2B55A 4DITA 5A4TA 3LFQA 4DAWA 4E26A 3DJ6A 2Y6MA 5HU3A 3GU5A 2O65A 4BDBA 3R71A 5J9ZA 2YIWA 3MJ1A 3PXRA 1V0BA 4RIXB 3CR0A 5HZNA 4IVCA 4RVMA 1DI9A 3QL8A 4FUYA 3I6WA 2WMVA 5A46A 4QP7A 5EYKA 1FVRA 1VR2A 3VS5A 3KEXA 4RJ6A 4JL9A 3ZLYA 3AG9A 5BUIA 2VTMA 4JS8A 4LQMA 1UNHA 1YXUA 2ZM1A 4HGLA 4RC3A 4EEVA 5EQEA 2NP8A 2IJMA 4D4RA 1OPKA 5AR5A 4XEYA 5FDXA 2W5BA 4XOYA 1URCA 1W82A 4TXCA 4DG3E 5JQ5A 2VTIA 4MWHA 4O84A 3UNKA 5I0BA 1GIIA 5AX3A 1YI3A 4C3PA 5TKDA 4DE4A 5ANJA 4N6YA 4HVSA 2ITTA 4A4LA 4PMMA 3QD4A 4RVTA 5BVNA 3CGOA 3FQSA 2YFXA 3NGAA 3PJCA 2NNWB 3BLAA 4FG7A 4X2NA 2H6DA 1JKTA 3R7YA 5HTBA 4GVAA 5T3QA 2VX1A 3NUSA 1YHSA 3OT8A 5AR3A 4A7CA 4ITIA 1ZARA 2P2IA 3MTLA 2YDKA 3R1YA 2BRMA 4JLCA 4QMWA 2JBOA 4FSUA 2VTPA 3W2SA 2Y6OA 1ZOEA 1K9AA 3DOGA 3F5GA 2C5YA 4XV1A 3FE3A 3GENA 1FBNA 4BN1A 4ZOGA 3U51A 3V6SA 4E5WA 3QLGA 5BYZA 4HGSA 4JG7A 2WMRA 4M7IA 3QTZA 4KKGA 4O1PA 4R5YA 2GQGA 3CKWA 1XWSA 3M11A 4KINA 5JRSA 5CEIA 3SXSA 2VWUA 3V01A 3VS1A 4QYGA 3FMMA 3RHKA 3HECA 4O4FA 1KV1A 2VX3A 4QMMA 1Q8WA 4DT8A 3MPMA 4BTKA 3Q5IA 4G9CA 4BCNA 3FHIA 3HMIA 4AZFA 3QRUA 2Q0BA 1TQPA 2VO3A 2FO0A 2YZAA 4FKWA 4YJTA 3TUCA 4FKGA 5LCKA 1BI8A 2XMYA 3VUTA 1FMKA 4BRXA 3NUXA 1JVPP 1H8FA 1MQBA 3EN9A 4FT7A 5DOSA 3ZU7A 3R9RA 2VU3A 2CNQA 4V05A 4I4FA 4DFZE 2JDSA 5HVKA 1ZAOA 2PVLA 3IGGA 4ZS0A 5EHYA 5B2LA 2GFCA 2WMTA 2BIKB 3CTHA 3FZPA 3PTGA 4E5AX 1CM8A 5L8LA 4H39A 3LCDA 4UYAA 3VF9A 4D9TA 1YW2A 4G9RA 5AR4A 2ONLA 3H0YA 5IA5A 3U9NA 4ITJA 3BZ3A 4BF2A 2CKOA 2BZIB 4N57A 5KX8A 4M0YA 1PMEA 1W98A 3BE9A 5HO6A 2QOKA 3SHEA 2XS0A 3WYYA 4UX9A 4ZS4A 4NTTA 4EK5A 3LM0A 2V7OA 5FM3A 1RJBA 3Q4UA 4FTCA 4CYJA 4G5PA 3EN6A 3HL7A 4XRLA 4YHFA 4DA5A 3OHTA 4YC6A 5CU4A 5E8VA 4CV9A 3LFCA 1PXJA 5L6WL 4C02A 4H1MA 4CQGA 3QA0A 1H4LA 3F3ZA 2PPQA 2UZVA 3BU3A 4Y8DA 3EKNA 3N51A 4AXAA 5DPVA 4MCVA 3GI3A 4H05A 4YO6A 5HO7A 4FZAB 4DTBA 2SRCA 1QPJA 3U6HA 2QOQA 4IAYA 4M8TA 5IA3A 4BDDA 4KAOA 2PMNX 4E6QA 3F3WA 2ZV8A 1YWRA 2PVRA 4PX6A 4YLKA 3TMOA 1CKJA 3QHRA 4G3DA 4LRMA 3IOPA 3LHJA 3E93A 3OOMA 3VQUA 3ALOA 3ANQA 2RFNA 2WIHA 1QMZA 2PZIA 4Z3VA 4ACCA 4FYNA 2GTMA 1KOBA 4AE9A 1L3RE 4TL0A 4OLIA 2RIOA 3SQQA 3ZUVA 4BCIA 4FZ7A 4EQMA 2YACA 5CAQA 4NM7A 3U4UA 3BELA 3WF7A 4MF0A 3UC3A 3JY9A 4XNEA 5HG5A 5HNIX 3MFUA 2YCRA 4QNYA 5CVFA 5DT0A 3P5JC 4NJ3A 3W2CA 5J95A 2J2IB 3I60A 3QZIA 5J8IA 1BMKA 4GK2A 4FNYA 4C4IA 4F65A 3AD5A 4PDOA 2O64A 4ZTLA 2AC3A 4ZSGA 3ZRMA 2R3FA 4GG7A 5FGKA 5HHWA 3ZH8A 4F0IA 3OWPA 2BPMA 2VTTA 3DB8A 3FMLA 2PMIA 3TV6A 2PUIA 5CT0A 1NVRA 3Q6WA 4FV1A 1OKZA 4UY9A 1YHVA 2R3MA 3H0ZA 4OT5A 5LMAA 3GU6A 5A4QA 3I5NA 2F49A 3I1AA 3PG3A 3Q4ZA 4NFNA 3LMGA 1CMKE 3ZO3A 2YIYA 3DZQA 2EXMA 2GFSA 4ZTHA 4FIHA 3BHHA 3RAKA 4RVKA 4ORKA 1Q8YA 3DS6A 3KIOC 1XH4A 3CQEA 2ZYBA 4IXPA 2OF4A 3PA3A 4GT4A 4JBOA 2VX0A 5ANKA 2XCHA 3R9NA 2ITQA 5J5SA 5AIRA 4BIBA 1ERKA 2HAKA 2WIPA 4MTAA 4A4OA 2HZNA 3PPZA 3Q9WA 2R5TA 2EB2A 3IW6A 5B2MA 4MXCA 4XG2A 4R1YA 2WTWA 4UZDA 3U6JA 4UMUA 3FMHA 3E3PA 1YKRA 2VTSA 3SOAA 4EH9A 3VBTA 1GZ8A 3HKOA 1UU7A 1WBWA 5HTCA 3L8VA 5CXZA 3R01A 4FIJA 3VS2A 3G9LX 3HNGA 4U44A 1YOLA 4PF4A 5HGIA 4KIPA 5EK7A 4A07A 4DN5A 1KV2A 5E8WA 2QOFA 4E4MA 2XM8A 2YCSA 3BQCA 4OT6A 4FV4A 2YIQA 4ZSEA 5FXRA 3KRRA 4CLJA 4O91A 1PMUA 4FV9A 4K6ZA 5HIBA 4ZP5A 5TO8A 4U3ZA 4YO4A 2RG6A 3AT2A 5BVKA 3EQCA 2F7EE 4AAAA 3LLAA 3G6GA 2E2BA 4I6QA 1H0WA 4Y5HA 3D5VA 4YLJA 2C6IA 2UUEA 3FDNA 4WIHA 3QKKA 3RALA 4RSSA 5L3AA 3SVVA 3VS0A 4IM0A 2B9JA 3UOKA 3WI6A 4JI9A 1UNGA 3OF0A 4OGRA 2VWYA 4TYEA 4O7RA 4EKLA 4PDYA 3F69A 3VBYA 3ENMA 3FXXA 1XH9A 5M56A 3HMNA 1OPLA 2Y0AA 5CYIA 5IISA 2W1DA 4RLLA 3LKMA 5IQIA 3EQIA 3V51A 2BAKA 3MPTA 2V5QA 3DQXA 4FT5A 1V0OA 2B0QA 4JG8A 3ROCA 5I3RA 2CKEA 2CHLA 4PPAA 4LM5A 3PJ8A 4LV5A 3OD6X 4FICA 4MQ1A 4FKSA 5A6NA 2X9FA 1PYXA 4S34A 1IAHA 3FEGA 4NM0A 3JYAA 4J96A 2GNIA 3DLSA 3TKIA 5FXSA 3F3VA 2J6MA 4MKCA 5DT4A 2QG7A 3TUBA 2OF2A 4IB0A 5F9EA 3EHAA 4EUUA 3F3TA 5C8KA 1WCCA 2C1BA 4WNKA 4FTQA 4ZXTA 4EL9A 4CZUA 3FMKA 2ZDTA 1WBOA 4I41A 3C50A 3NYNA 2EVAA 4EC8A 3T8OA 3U4WA 4F6SA 4H36A 3I7BA 3D14A 3IPHA 5BUEA 1SVGA 3SDJA 2Z8CA 4U0IA 4MWIA 1XO2B 3F88A 3UQGA 4FTJA 1FOTA 1WVXA 1PKDA 5HE1A 5DMZA 3ZONA 3FC2A 2R3IA 5TF9A 4WO5A 4C34A 3MB6A 4LYNA 3CIKA 4WNOA 3SKCA 1R39A 2QURA 1YRPA 3DAJA 1W83A 3C13A 3G0EA 4EOLA 4QMUA 4X3JA 4W8DA 3GC0A 4YSMA 4QYHA 3NUAA 4YLLA 3TZ7A 4AQCA 4AZSA 4HZRA 4S32A 4U45A 2HW7A 3F82A 3R21A 4ASDA 4M69A 4FRFA 4PTEA 2UZTA 2JDRA 3NFGB 1SM2A 3Q9XA 3W10A 3ATSA 4XOZA 2VTOA 4JJRA 2PL0A 4QYFA 3WARA 3C51A 3EL8A 1KOAA 1YOMA 3GCUA 5CLPA 5CEOA 5L8KA 3P78A 4HYIA 5K3YA 5A54A 4M69B 3FL4A 5AWMA 3OMVA 3R6XA 1F5QA 2QHNA 4IJ9A 3WZUA 3GCSA 1H28A 2C3KA 3PJ2A 5IQGA 1APME 4I6HA 4YTFA 3BGQA 2IVVA 2ONLC 2Y4PA 4BHNA 3TV7A 5AV4A 3MVHA 3SA0A 4QT1A 3WZDA 2WQMA 5AA8A 2XVDA 4YPDA 4HOKA 5K5NA 3QU0A 3GQLA 3DTWA 2Z7QA 1BL6A 3Q2JA 3UDZA 5CT7A 3OEZA 3O0GA 4FV8A 2DQ7X 3EQBA 1PY5A 2OIBA 3P4KA 5FP5A 1PXIA 3TTJA 1PKGA 5LMBA 3EFKA 4EYMA 3VUHA 4R78A 1U4DA 4DH1A 3QRTA 3KN6A 4IIRA 1OPJA 3AD6A 3L8PA 4DGOA 4XV3A 1TKIA 3K2LA 3QGYA 3AC2A 2CLXA 3MTFA 3COMA 3ZM4A 4D58A 4KWPA 2AYPA 5M51A 5BV3A 3EQFA 4USDA 2PHKA 4IFCA 4HVGA 4HGEA 2A98A 4HPTE 1G8SA 4EZ5A 3PWYA 4I6LA 2XYUA 3NNXA 2EUFB 3R73A 4C36A 2X7GA 4Q5HA 4LOPA 4ZJIA 4C59A 4ANSA 1OZ1A 4BBMA 4IACA 5KNJA 2G2FA 3L9LA 4L42A 5AV1A 2CGXA 5LVPA 5AUWA 2ZFYA 2VO6A 3HRBA 4DC2A 4W9XA 2PMLX 5IEVA 4GCJA 3WF6A 3F3UA 4KNBA 2YM7A 3VUGA 1P5EA 1Y8YA 3EH9A 4KBAA 4O1OA 3AC4A 3UZPA 4EJ7A 3OWJA 3ZC6A 4FI1A 2YAKA 3TZ9A 1GJOA 5I9XA 3F9NA 1XHAA 2I1MA 3E63A 4L68A 2XM9A 1ZYSA 4G34A 4FA2A 1IA9A 1J91A 3PVUA 3R63A 1DI8A 5CQWA 1M2RA 1Y57A 2C6KA 3QKMA 3BLRA 3ORIA 3KRWA 1OIRA 5DR2A 3VRYA 5CVHA 2J7TA 1WMKA 4CTCA 4FIEA 4BI0A 1ZYJA 2WHBA 5FTGA 3BCEA 3Q9YA 4QNAA 2X6EA 3CY3A 4GMYA 2BHHA 4AGUA 3DXPA 2ZV7A 5D12A 3S3IA 4PMPA 1OL5A 1OKYA 2P4IA 4FIIA 4L9IA 5AV2A 3S95A 5H9BA 4U7ZA 4C2VA 1QPDA 4KIQA 4NEUA 4HVIA 3A8WA 4PWNA 3LJ2A 4JOAA 2BZKB 1WBVA 4EOQA 3FYJX 2RF9A 4PMSA 4EOOA 4YJRA 3QX2A 4FSNA 4M97A 2ZJWA 1ZLTA 5CSHA 3HP2A 3VS6A 5J1WA 1IAJA 2C5OA 4R7BA 2YLFA 4DLIA 4JNWA 4BJJA 4O7NA 3QHWA 3FMJA 2ITZA 3Q4CA 3RZBA 3UO4A 5IQBA 2HOGA 5FXQA 3H9OA 2DYLA 5ANDA 4E3CA 4CGAA 2IG7A 2Q83A 1ZMVA 4U81A 5HIEA 3VQHA 3DZOA 3EMGA 5AV3A 2BVAA 4G6LA 4DDIA 4WNPA 3O71A 1H1QA 2C3JA 2JGZA 5HEZA 3TCPA 5ICPA 4BJJB 2QI8A 3KN5A 2RSVA 2QKWB 4O27B 5CEKA 2X1NA 2OZOA 3I4BA 3LFDA 4XV2A 3IW8A 4BCGA 3QQGA 3W0QA 5A4EA 3NVMB 3R1NA 3WZEA 4RJ3A 2A2AA 4RIWA 3FQEA 4APCA 4EOSA 5CANA 3ZRLA 4FSTA 2C6EA 4G1WA 3V5LA 4NM3A 5T6KA 4ACGA 4DH7A 3ML1A 3UMXA 2W99B 3MH3A 5HU9A 2UZLA 3DJ7A 3KA0A 3KC3A 1TQMA 4QRCA 3F5PA 2X4FA 4R3PA 3T3VA 3E8NA 4RIWB 3VBQA 4EBVA 3M1SA 5D9HA 4R7IA 5IA2A 3ZEPA 3RHXA 4Y46A 1TZDA 3R8VA 2Z2WA 4I6FA 5HE3A 4DEIA 4YZ9A 3IO7A 5JZNA 3PA4A 5HBHA 3SG8A 4ZTRA 1ZMUA 4G6OA 1OKWA 2GNHA 4ERKA 5JGBA 4ZZMA 3TT0A 1Q8ZA 3GVUA 3W0PA 4QMOA 2XKFA 3QWKA 3K5VA 3D5WA 5GJFA 2GQSA 1OITA 3R2YA 4U79A 2C0TA 3NUPA 3ZM9A 4LUEA 3ODZX 4M66A 2AEGA 4K8AA 4OW8A 4PQNA 2VAGA 3A7JA 3TIYA 3VW6A 3ZEWA 4EWHA 4OR5A 5FUTA 4F63A 1G3NA 4X2FA 4RX9A 3KF7A 5DG5A 3TL8A 1BX6A 5TT7A 4QMNA 3D2IA 4FK3A 4WT6A 2X2KA 2YISA 3KXHA 3VO3A 4QDEA 1Q62A 2OIDA 4IJPA 4D28A 5A14A 4PTGA 4ASEA 4ARKA 4M13A 3COHA 1H1PA 3O23A 4FTIA 5EDQA 3ORZA 5D41A 4ANLA 4OAUC 2VTQA 2RL5A 4E73A 4I24A 1YI4A 1T45A 4TTHB 1RE8A 4AFJA 3RINA 3TN8A 2OWBA 4DEBA 4Q9ZA 1J7IA 4R6VA 3DKFA 1LPUA 4FEQA 4ID7A 1JPAA 1ZY5A 4Y5QA 4RG0A 2PZYA 2XNNA 2PSQA 3BQRA 2AC5A 3RPYA 3BL9A 4DHFA 3UQFA 1BKXA 4B0GA 4WG5A 5HG7A 5FTOA 2JIIA 3KL8A 1Q3WA 4M67A 4C57A 5AFVA 3LFEA 4XBUA 2HIWA 1VYZA 5K5XA 3QZFA 3VHEA 3W18A 5H3QA 2IWIA 1E1VA 4QMPA 4MNEA 3CXWA 1RW8A 3O8TA 3DPKA 4A9YA 1LEWA 3V04A 5GHVA 3GOPA 2WEIA 3ELJA 2XIRA 3PWDA 4QMZA 2UW4A 1JKKA 4O83A 3DGKA 4AF3A 4ALWA 2C0OA 4C4EA 2VNWA 3DK3A 2R9SA 5K0KA 3WE4A 3ZLSA 1W2FA 1V0PA 2HXQA 4QTAA 4QQTA 3JS2A 5C1QB 2FB8A 3T9TA 1OGYA 4FGBA 2P2HA 3NNWA 4EQCA 3QTRA 2YZLA 4RQKA 3UOHA 1VZOA 2ERZE 5CU0A 4OTGA 3ZTXA 4DGGA 3PJ1A 4IWDA 3RZFA 3EN5A 2UVYA 5JEBA 4UB7A 4IHPA 2R3GA 4FL2A 3DFCB 4H3QA 4B8LA 3HGKA 4YJVA 4XLVA 1H1SA 3RI1A 4OAVB 3PVWA 5CVGA 2REIA 4QTEA 4JIKA 3SAYA 3CD3A 1H08A 2PVMA 3MA6A 4KSPA 4NJDA 4YJUA 2XK3A 3F2NA 3TACA 2W4OA 3NAYA 2WXVA 4JR3A 5F20A 3UYTA 4YNEA 1YDTE 2J5FA 4F1TA 4V0GA 3RAWA 4CVAA 4GK3A 3R1QA 3DDQA 4GFMA 4GFGA 4BDJA 2YJRA 4E8AA 5HNGA 4NTSA 1QPCA 4LI5A 2O5KA 2GDOA 3FI3A 1NY3A 4I5PA 4V0GB 3OOGA 2W5AA 4I20A 4FE2A 1PYEA 4UWYA 2I6LA 2X4ZA 4IDTA 3QTXA 3WYXA 3UDSA 3DXNA 1JSVA 3BX5A 4IX4A 3Q5ZA 4V04A 5LARA 3QA8A 4C0TA 4FKPA 4JG6A 4XYFA 1SMHA 3MYGA 2H96A 4QPSA 5CU2A 1F0QA 4XP2A 3D7TA 1GOLA 5I4NA 4XCUA 3NSZA 4NKSA 3W32A 2UZWE 1JAMA 4ZSLA 2IF8A 1ST4A 3RAHA 4RJ4A 5E8YA 4QYYA 3LM5A 3SW7A 3E3BX 3N9XA 4IANA 3NWWA 4BYJA 2WGJA 3R8ZA 4D2PA 5JKGA 1Q41A 4KBKA 1GZNA 3GCVA 3HP5A 4EOMA 5AUXA 4AXEA 1PXMA 2BAJA 3D7ZA 3NYVA 4QP1A 3WF9A 1J1BA 2BDJA 1Z9XA 3O7LD 3R30A 3H3CA 4P90A 2BALA 3NUNA 5KBQA 1OIYA 4AZVA 2HW6A 3E8EA 4O86A 3MH1A 4DFXE 2NYAA 3R04A 4GJ2A 4WNMA 5KO1A 5DR9A 3OZ6A 2CJMA 2HZIA 4GRBA 3ENHA 1UU8A 1P14A 3FJQE 3G9NA 4NCTC 2XEZA 3QLFA 3TV4A 2CDZA 4BCJA 4ZSJA 5CAUA 3ATTA 1IASA 3Q9ZA 2HYYA 4I0RA 2FSOX 1BI7A 4F09A 3R7GA 4DCAA 3SW4A 3CJFA 5CSWA 4D1ZA 2UZOA 5DHJA 3ZFXA 2VWXA 5CAOA 2YM6A 4ONAA 4JDIA 3RAIA 2IVUA 4XS2A 3A62A 3GT8A 4L7FA 4F9WA 2F7XE 4NW5A 2BTRA 4BCMA 5J7BA 5L2QA 4WUNA 3DKCA 4MAOA 2CPKE 4QO9A 1JWHA 2VTHA 5HD7A 4M68A 2GPHA 4G5JA 3V6RA 2J51A 2JDTA 4YPSA 4C8BA 3RBWA 4Z9LA 3LQ8A 3AXWA 5KZ0A 3NVKI 1K3AA 3GEQA 2ZDUA 2B1PA 2PUUA 2WD1A