2OJGA

Crystal structure of erk2 in complex with n,n-dimethyl-4-(4-phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
337
Chain Sequence
FDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojgA01
3G6GA 4C0TA 2JAVA 4CV9A 2PL0A 3OY3A 5A54A 5E1SA 3N4TA 4FOCA 4F9CA 3QUDA 4XS2A 1STCE 3GUBA 4FV5A 1GAGA 5FEDA 3VUIA 2G15A 1JOWB 3UNJA 2W4OA 4KKGA 3Q4CA 1W98A 4MF0A 3REPA 3OEFX 4OTRA 4MF1A 5I9XA 2VU3A 3B2WA 4EYMA 1XKKA 3SOAA 3DKGA 3A4PA 4D58A 2QKWB 3DBEA 3HP5A 3Q53A 4IAZA 4CRSA 2C0OA 3N4VA 3PXZA 3ORIA 4AGDA 5LQFA 4A9YA 2J5FA 1YWVA 2BIYA 4L68A 3UZTA 2BALA 4O91A 4BBFA 1BUHA 3Q9WA 4BDHA 2F49A 1H08A 2EWAA 1F5QA 2ZMDA 4IJPA 2BRNA 5D1JA 4E93A 4S30A 5KKRB 3P9JA 2C6TA 2R7IA 5C4LA 3BE9A 5FEEA 4O7YA 3HMPA 3DTCA 1YOJA 2V0DA 5AR8A 3NUPA 4FGBA 4E73A 2HY0A 3FQHA 4KS8A 1DI8A 5L8JA 3RM7A 1K2PA 1OL5A 4FG8A 3IGGA 1H1SA 4QMWA 4L9IA 3V51A 3HKOA 3MS9A 5LMAA 2BHHA 2PHKA 4GSBA 5EM7A 4JDHA 4NW6A 3Q52A 3FV8A 2HCKA 3A4OX 3R63A 2VO7A 1U5RA 4X2NA 3TNIA 3V01A 4MK0A 2C5OA 4AW5A 4KIOA 4IX6A 4RJ7A 1MRYA 4O6LA 4PMPA 4QP2A 3F3WA 4RX9A 5TKDA 5LWNA 4P5ZA 3ANRA 3VN9A 3UVRA 4O38A 4O7LA 3HMOA 2HOGA 1U5QA 3QC4A 2QO7A 2Z60A 4RC4A 1J3HA 4XJ0A 3WZKA 1GNGA 4KB8A 5LOHA 1LEZA 3JY0A 5J95A 4RPVA 3KULB 2WMVA 2C6DA 3ORMA 5AJQA 2GFSA 4YLJA 1G8SA 4MCVA 4RFMA 2WTJA 3BX5A 2QD9A 1YQJA 4FOBA 3QKLA 2I6LA 3COMA 3OUNB 4I5CA 4C61A 3AD5A 2WEVA 3GFEA 4I21A 3HUCA 3SC1A 3VHEA 3S00A 2ZB1A 2ITNA 2BUJA 4HGEA 4YBKA 2UW5A 3MJ1A 5CLPA 5A4EA 2O63A 5M44A 2ZB0A 5AEPA 2PE0A 2DWBA 4JRVA 4MQ2A 5IMEA 3BBTB 3PPJA 3L9PA 4DEDA 1CKJA 5FXSA 4PDOA 3DB8A 2ITPA 3QTWA 5EI8A 4UYAA 3FMLA 2J7TA 2VTHA 3B8QA 3MVLA 3PP1A 2I1MA 2GDOA 4FKTA 3OEZA 4ZK5A 3VBQA 3MN3A 4PF4A 3JXWA 4YC8A 3VS7A 1DS5A 2XNOA 1P2AA 1UKHA 2ITTA 3H3CA 3HMIA 4MWIA 3BIZA 3VBXA 3MI9A 4RIYA 3ALNA 3ZLSA 4YO4A 5HLNA 4KAOA 2PUIA 3LFSA 2GNIA 4LQMA 5I9WA 3RNIA 4WOVA 5J9ZA 4OTQA 1VYZA 3EYGA 3VS4A 4EUUA 3MB7A 5BYZA 4O7SA 3V3VA 1PMNA 4WIHA 1XBBA 3PVUA 2Y6MA 2X2MA 4OR5A 3V5QA 2Q0NA 3QC9A 4AF3A 5BVNA 3E5AA 3C0IA 2BDFA 4FYNA 4CZUA 4PRJA 2HWPA 2B53A 2UW0A 4IVDA 5CSWA 4ZTNA 5K3YA 1J1BA 4EUTA 3P7CA 2WHBA 4F0IA 2P4IA 2NRYA 2VTIA 4U9AA 1VYWA 3HNGA 3C4EA 4JX3A 4DFUA 4L01A 5JFXA 4YZNA 5DR2A 3D4QA 3ZS5A 1FMKA 4G2FA 4EH9A 4UWYA 4ENXA 3A8WA 5J1VA 3LMHA 3V5TA 4IC8A 4MVFA 2Z7QA 1H25A 3UZRA 2PZYA 4LMNA 5E92A 3SA0A 5I9UA 4X7QA 5BVDA 5GIPE 3MTFA 1O6LA 2W06A 4K77A 5HIDA 3CCNA 5J1WA 3G2FA 1ZZ2A 3UC3A 5J8IA 5DI1A 3FE3A 3E8EA 1ZAOA 3OZ6A 4EH7A 1Q3DA 4U6RA 3R9DA 3SRVA 3HX4A 4AW0A 4Z9LA 4HGSA 4ZLYA 4EC8A 4WNMA 3VBYA 3MH3A 4EH4A 3UOJA 4JR3A 1SM2A 2W1DA 1WBVA 5FD2A 2EUFB 3HMNA 4FX3A 4OW8A 4OTPA 4RWKA 4I5PA 3SG9A 3COKA 3OOGA 5E8YA 1RDQE 3HAMA 1OZ1A 3NZ0A 4NZWB 2QCSA 3HRBA 3TM0A 5K4IA 3UPXA 1O6YA 5CAUA 3ZH8A 4YTFA 5IA2A 3AMBA 3V5PA 2WMAA 4FKLA 4D4SA 3VHKA 4GKIA 3AXWA 4M68A 4C4EA 1YOMA 3DLZA 4FKSA 5TOZA 5CU0A 2I0VA 2I40A 3DDPA 3QAME 2WAJA 3DKFA 4FKGA 3ZEPA 4DH8A 4O0YA 5A3XA 2OSCA 4JLCA 3V5JA 3UOHA 2YM4A 5J9YA 2J50A 2HELA 4JR7A 4D2TA 4AW2A 3QXPA 4G6LA 4K0YA 4ZY6A 3DK3A 2UZLA 2A2AA 4ZZOA 2J0MB 4APCA 4ZMEA 5CTPA 4QQTA 2CGWA 3EYHA 1B38A 4CTBA 4X3FA 4E6CA 4FIFA 5IQCA 3JS2A 4BDIA 3PXYA 1BMKA 3MW1A 1PXOA 3FBVA 2HENA 4PMTA 2BFXA 2OZOA 5DHJA 4BTJA 2BFYA 5FXQA 4FTLA 1KE6A 3PXFA 3TN8A 3C0HA 4HCVA 3W2PA 3NSZA 3DOGA 5CVGA 5E91A 1W83A 3R21A 4FUYA 3P7AA 5E8TA 4G3DA 2UW3A 1UU3A 3BRBA 3ZZWA 5JK3A 2VWIA 4EOMA 2W96B 3TKUA 2FA2A 5CEMA 3V5WA 4FSNA 1PXLA 1AGWA 4IM3A 4EK4A 3OWJA 3ROYA 4D0XA 3KMMA 2GPHA 4C3PA 2YJRA 3KK9A 4R3PA 3COIA 4C34A 1PXMA 1Z57A 2C6OA 3BI6A 3R9NA 3T8OA 3JPVA 3I0QA 4IM2A 4V0GB 1OUKA 3E8NA 3QD0A 1JAMA 4RA4A 4UX9A 3A7GA 3AG9A 2ZVAA 1YI6A 3DNEA 1OL6A 4U81A 3WZUA 1CKPA 2ITXA 4F4PA 4R77A 5IEXA 4ANLA 5CENA 3F88A 3BU3A 4R3CA 2YISA 2IVSA 2SRCA 4ANOA 3RTPA 3F7WA 2WOUA 4DEGA 3UO6A 3BHYA 3EFWA 4B6LA 2R9SA 3FLYA 4BGGA 4DBNA 4K33A 4PTEA 4UEUA 2F4JA 2JKKA 4XHKB 2CKQA 3OD6X 1UNGA 5B2KA 4DTBA 1YXSA 3SD0A 3RALA 3CKXA 2UZEA 3PVBA 5CY3A 4FGRA 3AC8A 3IW8A 5IF1A 3BYMA 2R3MA 3VC4A 3KRXA 3UODA 4MBJA 3BYOA 3ERKA 3HUBA 5E4HA 2GQRA 4PL3A 4FKJA 3ELJA 2GHMA 4IANA 4LL5A 3T9TA 3IK3A 2C3LA 1WAKA 4W4WA 5KBQA 4D4VA 3UP2A 4KBCA 1Q8WA 4ZLOA 4Y46A 1OITA 4FTCA 1WBOA 3HGKA 1H1QA 3VW6A 1ZYSA 2WMRA 2IZRA 4O7RA 3ZXTA 4UXQA 3BEGA 5AR3A 4JJRA 3LFNA 4LFIA 3SHEA 2P33A 3R1NA 3QZHA 4H39A 5JRSA 5DN3A 4KBAA 4ASXA 2C0IA 4FVQA 5HU9A 2JEDA 2I0HA 3DK7A 3K3JA 5AIRA 5FP5A 5AX9A 5EKNA 5GINE 3P78A 3U4UA 4FKOA 4D5HA 3MV5A 2VUWA 2ACXA 3QL8A 5IISA 4TT7A 2W1ZA 3V04A 3MFUA 1UVRA 4F99A 1U54A 1WMKA 3TNWA 1E1VA 4L8MA 3RZBA 2BILB 5FM2A 3RK7A 5M4FA 3IDPA 3GXLA 2PPQA 1U46A 3L8SA 2C5YA 3UNKA 4BRXA 4DLIA 1M17A 4O2PA 2QOCA 3C51A 4TNBA 3VQUA 4B99A 2RFEA 1OIRA 3MIAA 2X81A 5BMSA 4MXCA 1EH4A 1R3CA 3NRMA 4I41A 5L3AA 4XP2A 3HV5A 4BCMA 5D41A 1M2RA 3LXKA 4EOIA 3OC1A 4QPAA 2IW9A 2XNGA 3MA6A 3ZMMA 3PIYA 4GVJA 5D11A 4QMYA 1R0PA 2Z7LA 3FZPA 2ZM1A 2VTNA 5A9UA 3EFJA 5KO1A 3RPSA 2J5EA 5F4NA 3FLWA 2IWIA 2W1IA 4M67A 4O6EA 5K4JA 3TTIA 5DH3A 3ZRMA 4I6HA 3FZTA 3VUGA 1QPCA 4EH6A 2W7XA 5KKRC 5H8BA 3QLFA 4TYGA 2X7FA 5CEOA 4J7BA 4EKLA 3WZJA 2HK5A 2QU5A 3BZ3A 4AN9A 2FB8A 2W05A 2XK7A 4YMJA 4E26A 3NWWA 5EQPA 4R7HA 2XYNA 4D4YA 2R3HA 4HGLA 2CHLA 5HD7A 2UUEA 1BLXA 4JS8A 1RE8A 1L3RE 2EB3A 2WMXA 4F6SA 2Z8CA 3E8CA 2PUNA 4IAAA 5GZ9A 4NTSA 1B39A 3MVJA 4PTGA 3R28A 2J90A 1REJA 4JDIA 4ZTSA 3FMHA 3K5UA 3PWYA 3QRIA 5KE0A 4XRJA 3DFAA 3U87A 3ZO3A 4F6WA 3E62A 3Q9XA 3OWLA 2R3PA 3RHKA 1ZRZA 2OJ9A 5AAFA 3ZSGA 3ACJA 3TDVA 2ITUA 3PFQA 5KZIA 2G2IA 4AOJA 4HVIA 3ATSA 4ACDA 1JQHA 3GCUA 4ZSAA 3CQEA 3P79A 4O0SA 5GJDA 3LLTA 3W1FA 5HG7A 2XK3A 2ETKA 5HU3A 5DNRA 3Q4UA 3PJ8A 2BRHA 2OIBA 2VWXA 3ZO1A 4II5A 4QOXA 1OIQA 3QHRA 4CFNA 4QQCA 4A07A 3O96A 3QWKA 2OXDA 4XG6A 2BZHB 2IVVA 2X1NA 2PY3A 3TNQB 4XH6A 4JVGA 4AFJA 4B8MA 2YLFA 4MD7E 5IUGA 3ZEWA 4H36A 3FI2A 4YSJA 1H00A 5EW3A 4ZS0A 4K8AA 2X8EA 3LM0A 3RI1A 3WIGA 3EJ1A 5JMSA 4D0WA 3LHJA 3VS0A 4M14A 3ZDUA 2E9VA 3DFCB 3JUHA 4GYIA 4PL4A 2GNLA 5F20A 4KIQA 3W8LA 3QTUA 5D12A 5BUIA 4BWKA 5JEBA 5IQAA 5GZ8A 2QOIA 2WMQA 5HNGA 3CSVA 1OIYA 3ZBFA 2C30A 4IJ9A 5KMLA 4L3PA 5L8KA 4GMYA 1SVEA 2GFCA 2IO6A 2QI8A 4HVDA 1F3MC 4DLJA 4PP9A 2RF9A 1U4DA 3QWJA 5DRDA 4IBMA 3QYZA 4XLVA 2CKPA 2OO8X 5FBNC 3EN6A 3ENMA 2YWVA 4JQ8A 2J6MA 3ORKA 4GUEA 1A06A 2W5HA 3IW4A 4QMTA 5EW8A 5EQEA 2ITVA 3NIZA 3UPZA 5HG5A 2RKUA 4RT7A 3RMFA 3U6IA 1IEPA 1GIJA 4IFCA 3TZMA 1ZYLA 3IO7A 3QQGA 4MXYA 4N6ZA 1H8FA 2R3GA 4IX4A 3FXZA 4YP8A 2R3IA 4ITJA 4C4HA 2PULA 5BVWA 5IDPA 3NR9A 4Z55A 5DFPA 4CFXA 4CFFA 3FMKA 2JDOA 4R5SA 4AA0A 4MHAA 1NA7A 3R9HA 1HOWA 4AP7A 3VUDA 4G3EA 4QP4A 5ICPA 3PA3A 3L8XA 4B9DA 2IVUA 4OGRA 1PW2A 4K18A 1NY3A 2HWOA 3D7TB 4JL9A 4XOZA 5JRQA 4R7BA 2BKKA 3MA3A 4MH7A 4GIIA 1BKXA 5T3QA 3HV4A 4FG7A 4GCJA 3W2QA 2FVDA 3DBDA 3LFDA 1T45A 2UVYA 2WQMA 4DFXE 5C26A 4F7JA 3FHIA 1DM2A 2YZLA 4FKQA 3G51A 1IAHA 3U51A 2RG5A 4LYNA 4LOOA 4L7FA 2EB2A 2BDWA 4JG6A 3SW4A 3DQXA 4TRLA 1H07A 5GNKA 4M0ZA 4C8BA 3UGCA 2QOHA 2VTAA 2A27A 5LVMA 3I7CA 4OTGA 4EKKA 2CN5A 4YHFA 4EH5A 2B9FA 4RVKA 3VS6A 2CDZA 2CNVA 4RVMA 2ZYBA 1FPUA 5AR4A 2BZIB 4OAUC 4G3GA 2YIXA 3DZQA 2F57A 5K5NA 3QHWA 1ZYJA 3R7EA 5CX9A 2R0IA 5HNIX 4BWXA 4KRCA 4TXCA 3P23A 5FGKA 2GU8A 3NDMA 4WG4A 3U55A 1IA9A 4LGDA 4D1ZA 3L9LA 3CQWA 4FV4A 3O0GA 3FHRA 3LLAA 3PRIA 3VJOA 3G0EA 1RQQA 3FKNA 3FY0A 4YPSA 4FZ6A 4NCTC 4F9BA 2GHGA 3DGKA 4E5WA 2R3OA 1H4LA 4KNBA 3S1HA 4X6RA 4FK6A 3HZTA 4GIHA 3DXNA 3E88A 4AE9A 2GQGA 3TZ9A 5I3OA 2F2CB 4JXFA 3EN4A 3MWUA 4MBLA 4NFMA 5JZNA 2B9HA 3UNZA 3C4FA 2OF2A 1GJOA 1LP4A 1PMEA 2X2KA 3CQUA 4BDJA 3DB6A 4BKJA 4CNHA 1DAYA 4D2VA 4CEGA 2YDKA 4ACHA 3EQDA 4K2RA 3HV6A 5H3QA 3SW7A 1NVRA 1TVOA 4Q5EA 4NM3A 2XRUA 4EZ7A 4IB5A 4BTKA 4RZWA 3QTXA 1Q5KA 4X6QC 2VWYA 3W18A 3ROCA 3UG1A 2QVSE 3FZSA 3FMJA 3G33A 5HCZA 1Y6BA 3GCPA 4FZ7A 4CRLA 3O17A 4L3JA 4YJVA 3F66A 3C7QA 3QCSA 3BKBA 3O50A 3GENA 3MH0A 2PVNA 3R7GA 5IEYA 4RWLA 4FKPA 2IG7A 2A0CX 1XWSA 1XH6A 4JNWA 2RIOA 3FYJX 1Q3WA 2ITZA 4FTAA 4N4SA 5LJJA 2XF0A 4JIAA 4FYOA 3QCQA 1Q41A 4U40A 3EWHA 3JVRA 5CQWA 4QRCA 2IZTA 3F61A 4TWPA 5CI6A 3I6WA 5LCJA 3HMMA 5LCKA 1TQIA 2XBJA 5EDPA 4TL0A 5TF9A 4ALWA 2F7ZE 2YIQA 4HYIA 4CLJA 3MY1A 2OBJA 2W4JA 3EOCA 3F3UA 4RMZA 4TYHA 4Y95A 2CLXA 4X2FA 3MGYA 3IOPA 4ERWA 3KXNA 4MNFA 5IQIA 4GG7A 1ZMUA 4DN5A 5HZNA 3ZBXA 3AQVA 2WU7A 2WQNA 5FTQA 5LVNA 4I93A 4RJ8A 3ID6C 2ERKA 3MVMA 2X4FA 3BHHA 4Q5HA 5CYIA 3FZOA 5AAEA 3CPCA 2BAJA 4QNYA 3ZFXA 3UQFA 2IN6A 3GU7A 4Z16A 4DYMA 1IAJA 2GS2A 4FNWA 3UG2A 4WNPA 3LJ2A 3TUBA 2W9ZB 1JKSA 1XR1A 3ZHPC 5AP1A 2YCQA 2R3FA 3VVHA 2CKOA 4NT4A 2RL5A 3UTOA 2XIRA 2XKFA 4DGGA 3F5GA 1MUOA 1J91A 3HRCA 4FTTA 4N0SA 4CTCA 1PHKA 5DGZA 4I6QA 2EXCX 5HVYA 1UWHA 4G1WA 4EH8A 3LE6A 4G5PA 2FSTX 4HCUA 2R5TA 3GU5A 3O51A 4QMSA 3SG8A 2OLCA 4S32A 4AACA 4L43A 2VTPA 2XCKA 3DBCA 3DJ6A 4RJ4A 4FKWA 3OFMA 4RRVA 2C4GA 1REKA 3QRKA 5DBXA 3OT8A 5CAQA 1SNUA 3PIZA 1V1KA 3O7LD 4OTDA 4NKSA 2DQ7X 4AWIA 3PY1A 1BI7A 3GU8A 1GZKA 3R1SA 3LQ8A 5CSXA 5HE3A 3MSSA 4AZWA 4IB3A 1PMUA 4C3RA 4GRBA 5IZFA 3RPYA 2R0UA 4I1ZA 4JOAA 4KINA 2J4ZA 3QFVA 4RIXA 1E1XA 3RVGA 3IDCA 3A2CA 5IUIA 1AQ1A 5EDRA 4B0GA 3PE1A 3NNXA 1HCLA 3QLGA 4QMPA 2ZDTA 2X39A 4XG7A 4L67A 4RC2A 5C03A 2J9MA 5DLSA 2YM3A 4LL0A 5HORA 2ITQA 4FV2A 4YBJA 3ALOA 5C8MA 3IONA 2BTRA 5ANGA 4XV3A 4FF8A 4LUDA 5CXHA 4RWJA 2ITWA 1L8TA 4GS6A 4FEVA 4O1PA 3QQJA 4IVBA 3R8LA 4QPMA 4GYGA 4FV9A 1W82A 3FSKA 2ZJWA 4I3ZA 2QKRA 4YSMA 1UU8A 3Q96A 1OUYA 4FKRA 4FT5A 4O2ZA 4U97A 3ZUUA 5GHVA 2UW9A 3CEKA 3NYOA 4HPTE 2BZJA 1XH9A 3LFQA 3POZA 4HZRA 4PMMA 4BB4A 3DLSA 4C2VA 3KF7A 2X7GA 3KK8A 2OZAA 3UQCA 2YN8A 1VEBA 3QTRA 3VS1A 4C62A 1PXPA 4AS0A 3TJCA 3MESA 3PA4A 5CZIA 3TIZA 4LGGA 4BIDA 4DH5A 1FBNA 3C5IA 4FTQA 5EM6A 3PA5A 3R1QA 4EZ3A 2CN8A 5CAPA 1Q97A 2P55A 3AC2A 2X0GA 3C4XA 4FTNA 4AN3A 3VS2A 4YUQA 4BKZA 3UOLA 2OXXA 5AUVA 3TL8A 4EC9A 5IKWA 4FSUA 5AUXA 2QR7A 4KIKA 4R5YA 4FEXA 5B0XA 3ZDIA 3D5UA 3NUYA 2B55A 4GV1A 4WSQA 2I7QA 5CU4A 3Q9YA 3NPCA 4ZTMA 2PZRA 4DG3E 2GSFA 4L00A 4QP9A 1BYGA 5DPVA 1KV1A 3BLRA 4NH1A 3LJ0A 2IW8A 3VULA 1YHSA 4ID7A 1KV2A 4JBVA 5HE0A 3RM6A 3WI6A 3ORXA 5TO8A 2XNBA 2XEYA 2HW6A 1YW2A 3OW4A 3DK6A 4GK4A 4GT3A 4O21A 5DT3A 3R8PA 1LEWA 5CT7A 4M69A 5BVOA 4IMYA 3JYAA 2RSVA 4R6VA 4WG3A 3QF9A 4CXAA 3WF8A 4XRLA 4E4LA 4D1SA 3E92A 4J97A 3OOMA 3AD6A 3R02A 2WPAA 3A7IA 4M0YA 5E8ZA 3UDBA 5A4LA 4L7SA 4IXPA 2QOQA 3BQCA 3QX2A 2R3QA 4S2ZA 4CFMA 5HNBA 3ZXZA 2BMCA 3E3PA 3RAKA 5JQ5A 4N70A 4E20A 4IWOA 5FLFA 4GUBA 3ZTXA 4I5HA 3NCZA 3DKOA 4MTAA 2PMIA 1WBNA 4IZYA 1YDSE 2JC6A 3OCTA 3CJGA 3A7HA 5LARA 2OJJA 3KMWA 1MQBA 4Z7GA 2YA9A 4DHFA 4EOKA 2JFMA 3R6XA 3AT2A 3OHTA 3PRFA 4M69B 2O2UA 5EYDA 5CAVA 4EBWA 3FQEA 3PY0A 4L44A 2JD5A 4QMLA 3QTQA 4TWCA 3QA0A 2WQBA 4PL5A 4O96A 4IE9A 2VTQA 4H58A 1J7IA 4C02A 4FKVA 3ZUTA 4ASZA 1M14A 2X9EA 2VX0A 3DAKA 3NEWA 3NUSA 4ZJIA 2WQOA 4RG0A 3S95A 4YJUA 2RFDA 3KVWA 4P4CA 3FUPA 3B8RA 5AV1A 3DT1A 3E7VA 4ZSJA 4GG5A 3BBWA 5ACKA 4HYUA 3BV2A 4G3CA 2YM7A 3Q6WA 5HTBA 5HEZA 4AA4A 2XM8A 3C1XA 4RSSA 1OKYA 3I4BA 1PRYA 1M2QA 4F9WA 4U5JA 4UBAA 3R04A 3PXQA 4YR8A 5M4IA 3NX8A 5CT0A 4RIYB 5JFVA 4EK8A 3KB7A 2JDTA 1WVXA 4XEYA 5HBJA 5A4QA 1GIHA 1H1PA 2PE1A 5IPJA 2OJFE 4A9UA 3CR0A 3QD4A 1S9JA 2WMUA 4BKYA 3F5UA 3TZ7A 1ERKA 4EWQA 3T3UA 4IVCA 4WHZA 4DEHA 1GZ8A 3MPTA 2QURA 3Q5IA 4JAIA 2VWZA 5A14A 4FT3A 4M12A 2UZWE 4C4FA 3ZOSA 2GNFA 4O7NA 2J2IB 3KCFA 1H01A 4YNOA 1SYKA 4ZSEA 3ET7A 2JKMA 2WOTA 3VJNA 5AMNA 3PSBA 3SQQA 3MPAA 3IGOA 4A9TA 3TV7A 4I0RA 2X6EA 3UIBA 4DT8A 4M8TA 4W4YA 1H1RA 3QQHA 3C9WA 4L46A 2YLEA 1OPJA 3CKWA 5E8UA 2YCSA 3R22A 5HCYA 4W4VA 4A4OA 4ZY5A 4JT3A 4DEAA 3RPOA 2VTOA 3ZM4A 2R7BA 5IUHA 2HZIA 4H1JA 2XK4A 3FPQA 4WNKA 3A7FA 5AP2A 5HOAA 4YTIA 1OPKA 1FOTA 1I09A 2E9PA 3C4ZA 1YHVA 1JKTA 1X8BA 2OW3A 2FYSA 4AT3A 2CGVA 3E3BX 4IB0A 4O7ZA 5TR6A 3V8TA 5EKOA 3U4WA 5A46A 3UZPA 3KXHA 4CMOA 2R4BA 3SRVB 1J1CA 3FL4A 3PJ3A 2B54A 3EQRA 4FODA 5I3RA 3ULZA 5CALA 2ETRA 3HV7A 4LM5A 2OU7A 4CMTA 4ZSGA 4ZJVA 3KVXA 5ETFA 4K6ZA 3SDJA 3UJGA 3H9RA 2WNTA 2XJ0A 4FIHA 3DU8A 2XUUA 4IAFA 5E9EA 4F0FA 4DGNA 3OT3A 4AZTA 2XZSA 3LCOA 4FSMA 2C5VA 2YJSA 4KIPA 4RWIA 1Q62A 4XLIA 5HD4A 1YXUA 5JN2A 4FICA 4AGUA 3BU6A 3QA8A 4EOLA 3M42A 5CVHA 3W2SA 2W4KA 3AC4A 4J99A 4FVPA 4X2JA 1FGIA 5AX3A 1Y8YA 3ACKA 2PYWA 2WIHA 3D94A 4QQ5A 4BDGA 5I9VA 3UIMA 2HZNA 4BDKA 3CP9A 5K5XA 3R01A 3OBGA 5T6KA 5AP5A 3PJCA 4QMVA 4CV8A 2X2LA 2VAGA 5HG9A 3GC7A 4C57A 1P5EA 4MXZA 5IQHA 4UB7A 4QMUA 3W55A 5DT4A 3II5A 4YURA 4FI1A 4X3FB 2VRXA 1AD5A 2WFYA 1PYXA 3IKAA 3LXPA 4MWHA 4BCJA 3G0FA 3TWJA 3DS6A 2I0YA 2XBAA 3ZO2A 2OJGA 1H28A 3GOKA 4RLKA 2CLQA 2W17A 3DDQA 3UVPA 3VUHA 3ZC5A 4U0IA 4BHNA 5JGDA 5CNOA 2VV9A 2GMXA 1R78A 4FV1A 5CF6A 1J7UA 4NFNA 4L52A 5HX8A 2B1PA 3OVVA 3UO4A 4AT4A 4GFMA 5GJGA 4NL0A 2ETMA 3AMAA 5KHWA 2XP2A 3U9CA 4W8EA 3R8MA 4AW1A 5AV3A 3VIDA 5T68A 3TG1A 1QL6A 2HXQA 4FNXA 1NT2A 4QQJA 4CFVA 4ZAUA 4O86A 4B4LA 2BVAA 4XOYA 1PXKA 5HGIA 4MAOA 5C8KA 3R8ZA 4DCEA 3VNTA 4Z7HA 2YWPA 4Q9SA 3R7YA 3FC2A 3Q04A 2WELA 1A48A 4CYJA 5FDXA 3RCJA 4J96A 3ATTA 5I5ZA 1JKLA 5G1XA 1SNXA 4AZVA 2WTKB 4BCQA 4R1VA 3M2WA 4ZLZA 3PZEA 4CFWA 4DFLA 1VR2A 2VNWA 3E93A 3P5KA 5FM3A 2PVYA 2QU6A 3LFEA 5IDNA 3H4JA 4RBLA 4FT9A 5M09A 3ZRKA 3HAVA 4OT5A 3GOPA 3R8UA 3NUXA 4J53A 3E7OA 3TEIA 4TNDA 2HY81 2YAKA 4M15A 4EQUA 2O0UA 3AC3A 2WMBA 3GEQA 4UMTA 3SV0A 2WGJA 2VO6A 2ONLA 4FT0A 4J95A 4GU9A 3K5VA 4KD1A 4DBXA 3KRLA 5KHXA 3I81A 3QZIA 4WD5A 4ZTLA 4UMRA 5KUPA 2OFUA 1FINA 3VF8A 4BR3A 4FSTA 4ZXTA 4DITA 2YIWA 3O23A 1R0EA 2WIPA 2P0CA 3GNIB 3LJ1A 5ANJA 1H27A 5BVFA 3F2NA 5K0KA 4KRDA 2EU9A 2EVAA 5FEQA 3C0GA 5E1EA 4ASDA 2J0KA 3UQGA 4BTMA 2DUVA 3VQHA 4FG9A 1GZNA 4BDBA 2QC6A 2RFSA 3PXKA 5A4TA 5AR7A 5M57A 3ENHA 2BHEA 3C13A 3FEGA 3QX4A 2H34A 4ZTHA 4I20A 1ZMVA 4QO9A 3PPKA 3BWFA 4XNEA 2CCIA 3OROA 3R0TA 3KU2A 1H26A 4DF3A 4RJ3A 2HYYA 3ANQA 4DH7A 2BDJA 4R1YA 5E8XA 2XNMA 2YITA 3THBA 4MD9E 5CNNA 4AGCA 3I5ZA 1U54B 5DRBA 4IX3A 1XBCA 4ITHA 5EHLA 3TJDA 3QTZA 2PVFA 4Y72A 4TYIA 5L6OA 4K11A 3EKKA 2BKZA 3EHAA 4CFUA 2X6DA 4RC3A 2XEZA 4RLLA 5IQBA 3M11A 4ONAA 4LV5A 3QRJA 3GU4A 1FQ1B 4B7TA 2AUHA 4RZVA 2Z7RA 4F63A 2Y7JA 3NUAA 4YTCA 5FUTA 2PUPA 3ITZA 2QOFA 4G31A 3FQSA 2JDVA 1IRKA 3EQGA 4I94A 3QKMA 1YWRA 4DEEA 4PNIA 1GOLA 3CY2A 4KWPA 4RIOA 3F7ZA 3MFRA 3PXRA 4BCKA 2ZDUA 4I22A 2HAKA 3LPBA 4L6QA 4QPSA 4F1MA 1OVEA 5LVPA 3CGFA 5EK7A 3GC8A 2B4SB 3VUTA 2C5XA 2IZSA 4PPAA 3WF9A 4E1ZA 1YRPA 3CBLA 3F2AA 3D7ZA 5H8EA 3CGOA 5AUWA 3OWKA 3TKIA 3ZONA 4E7WA 2YABA 5KMNA 5I9YA 3MY5A 3AC1A 2JGZA 4QTCA 1DAWA 3Q60A 2PE2A 2JLDA 4EHGA 1P4FA 4UWBA 1Z5MA 2JITA 3DNDA 2G1TA 3PYYA 4UMQA 4G17A 3PG3A 5B7VA 4M66A 3NUNA 3TKHA 5CF8A 1KE9A 4CQEA 2OICA 2BPMA 3WYXA 4BC6A 2IPXA 4I0TA 2YM5A 1JKKA 4CQGA 3U8WA 4DT9A 5C4KA 4MYGA 1LR4A 2PVHA 4S31A 4MNEA 4J8NA 5J5TA 4LRJA 4A4XA 3R71A 4H05A 4OBOA 4IFGA 2O5KA 3LAUA 3NNUA 5FP6A 4BY9E 4BICA 4CVAA 5L6PA 4UY9A 4DFZE 2R3JA 2WO6A 4PMSA 4XBRA 3TTJA 4TTHB 3FLQA 1FGKA 3PLSA 2QODA 4FTKA 2OKRA 3S0OA 3W8QA 3RNYA 4PWNA 3WF6A 3HEGA 2UZBA 4XBUA 3BHUA 2H6DA 3BHVA 4WBBB 4Y73A 4GEOA 2C68A 4IAKA 4O1OA 4HVGA 1OECA 2F7EE 4ZJJA 1VJYA 4E6QA 3KL8A 4RJ6A 3CC6A 3H9FA 2W1HA 4S33A 3V8SA 5L4QA 4JRNA 5AFVA 2UW7A 4Y85A 2V62A 5A6NA 3OMVA 2X9FA 5HE1A 5KZ0A 2E9NA 3TIYA 2H9VA 4GK2A 4YC6A 4GT4A 1SMHA 3EQHA 2QNJA 2YHVA 2WTIA 4P7EA 4HJOA 4RIWA 4APPA 4D2PA 1OMWA 3BYSA 2FSLX 4OLIA 4B8LA 4CT1A 3SLSA 2JDRA 2Y9QA 2J51A 2QO2A 5M4UA 3DV3A 3ZO4A 4FNZA 4M97A 4RA5A 1ZMWA 3VF9A 4DC2A 1RW8A 5BNJA 5CXZA 4G5JA 4CGAA 3L9MA 2ERZE 3TZ8A 3MDYA 1K9AA 5DR6A 3M1SA 1Y8GA 3FL5A 3R9OA 1FVVA 3NNWA 5LVOA 4FEWA 5E8SA 1LUFA 3KRRA 2QOLA 5DWRA 5FRIA 5AP3A 3C4WA 2VGPA 1S9IA 3MBLA 3A60A 4NIFA 1J7LA 3MJ2A 4NK9A 2QLUA 3QGYA 4BDAA 4RX8A 5K9IA 3Q6UA 5M56A 3FXXA 2JIVA 4JAJA 4EH2A 4RIWB 3ULIA 5EYMA 5KMIA 3KKVA 4PQNA 1UU9A 2OFVA 3IQ7A 5JH6A 2VNYA 4NM7A 5L2SA 3TACA 5F1ZA 4AZSA 4IAYA 4XP0A 3MVHA 4D2RA 4LOQA 4CG8A 2Y8OA 2QG7A 4GFOA 4H1MA 4DH3A 4AFEA 4IW0A 2Y4IB 2XB7A 5IQEA 3R73A 1I44A 4S34A 4FIGA 4RVLA 4YJRA 3FLZA 3KA0A 3QBNA 5HO6A 5CVFA 3W2OA 3TUCA 4IX5A 3BCEA 3UVQA 4U42A 2C6IA 2GNJA 4JQEA 4FC0A 5AUUA 3D14A 4EI4A 4AN2A 2BAQA 4E6DA 1TQMA 4IQ6A 3P08A 1YDRE 5JGBA 1XH5A 5KBRA 2QLQA 2VWWA 3OW3A 4BBMA 1WFCA 1OPLA 2BIKB 2XNEA 2C69A 1PMVA 1Q24A 3LCKA 4ANSA 2OG8A 3LCTA 5IEVA 1P14A 4ZZMA 4D9TA 3VRZA 2ZAZA 4U44A 5LXMA 5J9LA 4O7WA 5H2UA 3RAIA 3DZOA 3CPBA 5I4NA 3TUDA 4D28A 5AA9A 4Y83A 2CJMA 3CD3A 3ZSIA 2VX3A 4AG8A 5DE2A 1LPUA 3F9NA 5CEIA 4JBOA 3JY9A 2VN9A 5CEQA 4WRSA 3QCYA 3BYUA 5KMMA 5IA4A 3KXZA 3EFKA 4U3YA 3OG7A 5BVEA 3NW5A 3LXNA 4UZHA 3ZFYA 4DTAA 1KSWA 3B2TA 3VBVA 4BIBA 5KMKA 2GTNA 4BVUA 4DG0E 2WMSA 1B6CB 1ZYDA 4HZSA 1ZXEA 3GU6A 2Y4PA 3QZGA 3ZSHA 4FZDB 1MRVA 3HA6A 3EL8A 5L2WA 1Z9XA 3LMIA 3H0YA 2J0JA 4QTDA 4X0MA 4IZAA 3MPMA 3C5UA 1IA8A 2AYPA 1U59A 1V0PA 5FXRA 1BI8A 3V6SA 4E5AX 3S2PA 4I5MA 2JIUA 4EZ5A 4X3FC 2JAMA 4C38A 3FMEA 3BGZA 4JDKA 1APME 1YHWA 2NO3A 2WZJA 4WBOA 2NP8A 4IIRA 1R39A 3GQIA 3I1AA 3G5DA 2FSOX 4BCOA 1KE8A 3GI3A 2UW8A 1ZOHA 1PXJA 2XS0A 2G9XA 3T3VA 2HZ0A 4DH1A 2W99B 1URCA 4U7ZA 4FV0A 1JLUE 1NVQA 4ANQA 2UVXA 3W2RA 3ZRLA 3TDWA 3DXPA 1ZOEA 1UV5A 1ATPE 3FWQA 4G9CA 4LG4A 3BWJA 2QOBA 2A1AB 2GHLA 5AP7A 1XH7A 3W16A 2YDJA 2CNUA 2R64A 4WUAA 4PV0A 1KWPA 3CXWA 4O7TA 3KREA 4U45A 4CCUA 1R1WA 4G6OA 4TW9A 4FR4A 2WTKC 4JDJA 4F0GA 4PDYA 5M08A 1YXVA 3D5VA 2ZV2A 3EH9A 5IU2A 3MH2A 1O6KA 1JVPP 3KQ7A 4ANMA 2ZM4A 3KMUA 4FT7A 4JIKA 2UZTA 5AUYA 3CJFA 4TYHB 4QYHA 2PVMA 4YHJA 3RPRA 1RJBA 3TCPA 4HW7A 3G15A 2NRUA 3OP5A 1PY5A 5JFWA 4O81A 5E8WA 5A6OA 1QPDA 5AWMA 4PUZA 3FC1X 4YZ9A 4ZY4A 1IASA 2GTMA 4K1BA 5ANDA 4BIEA 4F9YA 3RHXA 3CTJA 4WRGA 4BL1A 4ACGA 3CS9A 4FZFB 2PVLA 2X4ZA 4IH8A 4D4RA 5M51A 3R7IA 4M7IA 4YZCA 3LQ5A 3BGPA 1OB3A 5C27A 5D7AA 5ETIA 1Q8UA 3O8UA 2YEXA 1SZMA 4H3PA 1FVRA 3LCSA 3DBFA 4PDSA 4KUJA 2BRBA 3TV6A 4ANBA 5IQGA 2BTSA 4ZS4A 5GIOE 3UE4A 3EKNA 1SVGA 4UALA 2FH9A 1UNHA 2PWLA 4YLLA 3P1AA 5FWKK 4I0SA 4AOTA 3F5XA 5KMOA 2OH4A 2I0EA 2PSQA 1OIUA 3LXLA 3PY3A 2VO0A 2QQ7A 3N51A 1PKDA 5DIAA 4DCAA 3QKKA 2ONLC 4Q9ZA 2C3JA 2WTWA 3AGLA 5JSMA 3A61A 4L3LA 1F0QA 2BCJA 2ZOQA 4USEA 2Y0AA 2CSNA 3FZ1A 2V55A 2HXLA 4U3ZA 5EH0A 3C50A 3ZU7A 4DA5A 5IG1A 2R3LA 3IG7A 4G34A 4QTBA 4ANNA 4C4JA 3OTVA 5G6VA 3DJ5A 5LVLA 3RBWA 5C1QB 2BR1A 2FSMX 3LOKA 3PE2A 4O22A 4BTFA 4BGQA 4RIXB 2VWBA 4TN6A 5E7RA 4OBQA 4ZP5A 2OI4X 3A99A 5AA8A 2C47A 5ANOA 2BRGA 3H0ZA 3LVPA 3FI8A 1E9HA 3IECA 5HTIA 3FPMA 4NJDA 3EZVA 4DGLC 3D9VA 4QT1A 1XHAA 3VUMA 2O3PA 4MBIA 3IW5A 2W9FB 1G8AA 4JBQA 4QP7A 4UXLA 4BYIA 4WA9A 4GL9A 4YJTA 1PJKA 3QCXA 4HPUE 2JBOA 3QALE 2Z2WA 4U43A 3UIXA 4AZEA 2CNQA 4DEIA 4R7IA 4FL3A 2F7XE 5KMJA 1TQPA 4FZAB 4JI9A 3OCSA 4RQKA 5AM7A 3K54A 3ZLWA 4MQ1A 2DYLA 3KEXA 3DBQA 2R3NA 4ACCA 3HL7A 3KULA 4LUEA 4X21A 3WF5A 4ASEA 3HLLA 5EYKA 3QGWA 2OZAB 3VBTA 4AUAA 4FKUA 4M3QA 2V22A 3RP9A 4E4MA 2WD1A 5BMMA 4YC3A 3BU5A 4ORKA 2A19B 4GW8A 2PZIA 4BZNA 3KXXA 4ZTQA 3COHA 1WBTA 4F70A 4HNFA 3EN7A 4FIIA 2BAKA 3ORLA 3SX9A 2OK1A 4FV7A 5CAOA 3MY0A 4J52A 3O71A 3VWAA 3O2MA 4KIKB 4EBVA 4HVHA 3ZCLA 4KS7A 3OCBA 5KX8A 3HV3A 4FV3A 5J5SA 3KN6A 1V0BA 3CLYA 5AM6A 5BUEA 2NPQA 4F7SA 3SVVA 3DY7A 3IW6A 5CANA 2JIIA 2JKQA 3P0MA 5HIBA 3MFTA 3DCVA 3UIUA 2LAVA 3V5LA 2UZUE 2XK8A 4CZTA 2QOKA 3LIJA 5BYYA 4FL1A 2YDIA 3DKCA 3ZZEA 3QYWA 2ITYA 4MX9A 2GNGA 4F65A 4OTWA 1UKIA 4PDPA 5CU6A 1UWJA 5BYLA 4OBPA 1ZARA 2RG6A 4I6FA 5L2TA 4G3FA 1XO2B 3BV3A 5M53A 2YFXA 5ANKA 3ZLXA 4UZDA 1W7HA 3DQWA 3AMYA 2R3KA 4FTJA 4E3CA 4EWHA 2CMWA 3KN5A 3D0EA 4A7CA 4F1OA 3PSDA 4QYGA 1PF8A 3BHTA 4ZIMA 4G6NA 4L45A 2LGCA 3UYSA 3EQFA 4KA3A 1CDKA 4IZ7A 3WE4A 3ORZA 4LV8A 1OM1A 4RJ5A 5IA1A 4ZEGA 3R7OA 1OGUA 5CU2A 1YI4A 2OIDA 5HESA 4BN1A 4BWPA 3QTIA 4ITIA 4N57A 3Q32A 3QD3A 3QD2B 3EIDA 2JBPA 2YACA 2UV2A 1WCCA 1ZYCA 4QD6A 5B2MA 5JT2A 4ZMFA 5IA5A 4O0UA 1WVWA 5I0BA 2PUUA 2W1GA 4HYSA 3IOKA 3DPKA 4Z3VA 2R2PA 3BLQA 3GC0A 3EQBA 4NM0A 4QMZA 2B0QA 3D83A 5JGAA 4WG5A 4AQCA 5CSPA 5DYJA 4C2WA 3I60A 4LGHA 2WXVA 5DEYA 4AU8A 5BVKA 4NEUA 3E64A 3RKBA 3RWPA 3BGQA 3PLAE 4FUXA 1OL7A 2RGPA 4EQCA 3NW6A 4BHZA 5I9ZA 1P4OA 3PIXA 4V01A 2C3KA 4O0XA 2UZVA 4ALVA 3UYTA 2UVZA 4JBPA 5HTCA 4KSQA 2UW6A 2PZPA 2E2BA 3P7BA 1M52A 2Y4IC 4JQ7A 5HVJA 2ZMCA 2F9GA 2XIXA 5ETCA 3FMDA 4GFGA 4EORA 2HW7A 3OS3A 4BI2A 2HZ4A 4BFMA 3A8XA 4GT5A 3PG1A 3MFSA 4JX7A 5IH4A 1YOLA 3SOCA 2YIYA 4IAIA 5BX0A 4NCTA 2OWBA 2ZV9A 1WBSA 3CTHA 4D9UA 3G90X 4G9RA 4AT5A 3PJ2A 2XJ2A 4JG8A 5AP4A 2CKEA 3T9IA 3QRTA 4ZZNA 4TYEA 5HCXA 4PY1A 3GT8A 4Y8DA 3D2IA 5EG3A 3F2RA 5LWMA 2XCHA 4IZ5A 3PVGA 1XJDA 3EQCA 1Y6AA 3H9OA 3ZFMA 1WZYA 4O82A 1H24A 3LFFA 4QP8A 2IZUA 4EHVA 4HNIA 4HVSA 3SGCA 3R7UA 3KGAA 4A9SA 3TV4A 3QUEA 2PMNX 2QHMA 5CWZA 3POOA 5CF5A 4YJOA 3ZM9A 3UO5A 3HECA 3E87A 4OTHA 5H8GA 2P2HA 1YVJA 1CKIA 1WBPA 2WKMA 4D2WA 2J0IA 3W32A 2OJIA 1VZOA 5HLWA 1NXKA 4QYFA 3ODYX 3NIEA 4I6BA 5HVKA 3LCDA 4PPCA 3NAYA 2PVRA 4DFNA 4EK3A 5M55A 5DMZA 3DAEA 2XJ1A 4LMUA 4MXAA 4M13A 4V0GA 3KY2A 2H96A 2B9JA 4LI5A 1UA2A 4FV8A 4YGAA 3GFWA 3R83A 4W9WA 3F3ZA 4FA2A 5B2LA 5HQ0A 2V5QA 3GCVA 4D2SA 5LMKA 3PVWA 5AV2A 5CF4A 3N4UA 3CY3A 5F9EA 2VWVA 1MP8A 3VRYA 4L53A 2WB8A 3WYYA 2VTLA 2QONA 4PTCA 4CSVA 1CMKE 4OTFA 4EH3A 4IDTA 3IDBA 1H1WA 2O8YA 3D15A 4AE6A 4NTTA 1W84A 2P2IA 2QOOA 3F69A 4BYJA 4C36A 1ZY4A 5DG5A 2GS7A 4CMUA 3R9RA 2H8HA 4TWNA 4YZDA 1GIIA 2WU6A 2Z02A 5IH6A 4IM0A 2ZV8A 4PP7A 1Q8TA 3R2YA 4DGMA 2FO0A 5DOSA 3G9NA 2C6KA 4RX7A 3PWDA 2QG5A 2KULA 3RK5A 3NS9A 3R2BA 3NUUA 3NYNA 5EFQA 3HDMA 4C7TA 5IH5A 2VD5A 2VTMA 3HDNA 3W10A 4IEBA 3S4QA 4C37A 4EONA 2XH5A 3F5PA 4ZOGA 3NMUF 1JBPE 3FZRA 5FG8A 2XK6A 2OF4A 4XV1A 2O65A 3EN9A 3PSCA 3R30A 4FVRA 4YJSA 5CSVA 3TNPC 3UOKA 3GQLA 3O8PA 4BCPA 4FEUA 4UMUA 4O84A 4FBXA 2G2FA 3D2KA 5AAGA 2C3IB 2B7AA 2WMTA 4EJNA 5IA3A 2XA4A 5D10A 1Y91A 2C1BA 3LFCA 2EXMA 4CKJA 5BPYA 3QQFA 5HLPA 4FEQA 4F6UA 3VO3A 2WTVA 4XG4A 4YLKA 4WKQA 4CKRA 2GS6A 3OY1A 2CCHA 4C4GA 1XH4A 3LFAA 4HGTA 2FGIA 3PUPA 4QP3A 1XH8A 1JSVA 2YM8A 4I23A 4UYNA 5E90A 4HCTA 4AAAA 4CKIA 5A4CA 4O0TA 2REIA 3OUKA 3MIYA 4QYYA 5ACBC 1TKIA 4I4EA 4QMQA 4O83A 5IA0A 3AD4A 3GVUA 4Q2AA 1KE5A 4A4LA 4HOKA 1Q99A 2YM6A 3WOWA 4C3FA 2W1CA 3BPRA 2AC3A 3NCGA 4DGOA 3VUKA 1KUTA 2W5AA 3FI4A 4EOOA 5JZJA 5ETAA 1JSTA 2C5NA 3Q4ZA 4RFZA 1JWHA 3AT4A 4F09A 4QMNA 2GCDA 2X8IA 3QZFA 3SXRA 1UU7A 2X7OA 4YJPA 5CS6A 4NW5A 2QO9A 3U6HA 4U80A 5KNJA 1JPAA 2XIYA 3C4CA 4NM5A 3EZRA 4CG9A 2XRWA 2WTDA 2ZM3A 4H3BA 4D55A 5J79A 3GGFA 2G01A 3FKOA 4FSZA 4W9XA 4YTHA 5AP0A 3I0OA 4MXXA 4A9RA 5BQ0A 2IVTA 4KBKA 4YJQA 2PTKA 5EM8A 4EK6A 4MD8E 4QTEA 3VW8A 1H0VA 3A62A 2QR8A 2WMWA 3TI1A 5HI2A 1ZWSA 5IMXA 3GCSA 2X8DA 1KOBA 1QMZA 5C8NA 4H3QA 2OIQA 2UW4A 4O27B 5J7HA 1O9UA 3FMNA 4DFBA 3ETAA 3CIKA 4EL9A 2IW6A 4C33A 1OBDA 3I7BA 5HIEA 4BGHA 1BL6A 4U8ZA 2C0TA 5AIKA 2UZDA 1BX6A 1ZLTA 1M2PA 1W8CA 3D5XA 3HVCA 3Q2MA 4IWDA 2E9OA 4FIJA 5AP6A 1Q61A 4XG2A 1G3NA 3AC5A 3D5WA 2C6LA 4YU2A 3BELA 3WBLA 5AADA 3FMMA 3KXGA 1K3AA 4WT6A 4BDDA 4F1TA 5HBEA 4IB1A 4LRMA 4C35A 4ENYA 3OWPA 1PKGA 1NW1A 3FLSA 4RQVA 3RPVA 4JG7A 4E6AA 5EW9A 4YNEA 3MYGA 1PXNA 1QPJA 4QP1A 4MXOA 5D7VA 5DVRA 4BCFA 1IR3A 1OL1A 3RZFA 3ODZX 4J8MA 5HHWA 4RGJA 3WF7A 1Q8ZA 3EFLA 3IS5A 3EQIA 5HICA 2PVJA 3VBWA 1OKVA 4XG9A 4FSYA 4E8AA 3QQUA 4FTIA 5HO7A 5CI7A 2NNWB 3OTUA 3PZHA 4KABA 1Q8YA 5CEPA 3S3IA 4MKCA 3AOXA 4BCHA 4HYHA 3L9NA 2VWUA 2YZAA 4EHZA 1FVTA 2C6MA 3FY2A 1SVHA 2XKEA 3OXTA 4PPBA 1OI9A 3SXSA 3IW7A 4BBEA 3NNVA 1CSNA 3Q2JA 1KOAA 4GK3A 3NYVA 1M7NA 4IVAA 2O64A 4USDA 3OCGA 4XV2A 5CASA 5JQ8A 3WZDA 3N9XA 4F9AA 3I6UA 2YERA 3I79A 4TKSA 1ZOGA 4EOJA 3ORNA 4OAVB 4C58A 1XQZA 1OKWA 2BROA 3EN5A 3QUPA 3KRJA 4ALUA 4ACMA 3SXFA 2W5BA 3FSFA 4KSPA 4M84A 5C9CA 3EB0A 1MQ4A 3LZBA 3NAXA 4MNEB 4EOQA 3RGFA 2BRMA 5DA3A 4EQMA 3OXZA 1JSUA 5H9BA 2DS1A 2W1EA 3L8VA 5IQDA 5GZAA 4NSTA 4BDFA 4FSRA 3L8PA 4BCGA 1PXIA 4NUSA 4NJ3A 4J1RA 2Z7SA 4P5QA 4DE4A 3LMGA 5TT7A 4FTMA 4KKEA 4RFYA 4NYEA 4O0WA 5EOBA 4WNOA 4FNYA 1ND4A 3F3VA 2C6EA 4X2KA 4XYFA 4ZSLA 3JR1A 3H10A 4FE2A 3FLNC 4CZYB 4EYJA 5AUTA 5JFSA 4CCBA 4BZOA 4BCIA 3PP0A 3Q5ZA 4E4XA 2JKOA 3G9LX 3UP7A 4N6YA 5EDQA 1YXTA 3HYHA 4TYJA 4Y5HA 5AUZA 5M06A 1ZY5A 3GBZA 4FL2A 1XBAA 3CTQA 3DTWA 3FYKX 3GP0A 3IPHA 3HA8A 3KFAA 4GU6A 5L2IA 3DXQA 3H30A 1CM8A 3WZEA 2XVDA 1WVYA 3Q4TA 2UZNA 3HRFA 3ZLYA 1HCKA 2VTTA 1W0XC 4QP6A 4P90A 3D7TA 2YIRA 4F7LA 3K3IA 1URWA 1YI3A 2C1AA 4MEDA 4TZRA 4UMPA 5LMBA 4J71A 1YDTE 2PMOX 4DEBA 1BL7A 3OF0A 4QYEA 5IQFA 3QQKA 5HE2A 4O0RA 3GB2A 3P86A 2JFLA 3PTGA 4I92A 4UWCA 4WUNA 3U9NA 4TPTA 2W1FA 4AA5A 4CLIA 5DR9A 4R78A 4W8DA 4FMQA 3NVMB 4FTRA 2PK9A 3R00A 4TY1A 5ANEA 1PYEA 4EHEA 2XKDA 5K0XA 4AXAA 4QMXA 3F6XA 3F82A 5AR5A 3LKMA 2B9IA 4IHPA 4NIFB 4FKIA 4OT6A 4O0VA 2CGXA 1NVSA 2VX1A 3WILA 4YJNA 3RAHA 3W2CA 1Q4LA 1QPEA 3WIKA 4DG2E 4E4NA 4EOSA 4F64A 3PDTA 4XP3A 5M4CA 2Y6OA 1CTPE 4QTAA 4ERKA 5EI2A 4F08A 1IG1A 3BLHA 3UMWA 4CT2A 2W0JA 3KF4A 5FQDC 5AV0A 5FBOA 5DEWA 2PVKA 5DT0A 2XKCA 1V0OA 5HG8A 2CGUA 3TT0A 4XV9A 3MB6A 2A4LA 4X2GA 4BI1A 2UZOA 4C59A 1T46A 4U41A 2XIZA 3OBJA 3SAYA 4RVTA 3KC3A 4RX5A 4R8QA 4FSQA 2G2HA 4FSWA 3UBDA 5J7BA 5BUJA 1FMOE 3DJ7A 2VO3A 3QRUA 3E8DA 4AZFA 3FI3A 5CU3A 2B52A 4XG8A 3DA6A 2OH0E 2V7AA 3BYVA 4YHTA 2F2UA 5EHYA 4DAWA 4A06A 4X3JA 3EQPA 3FDNA 4IADA 4NWMA 1ZZLA 2KTYA 3EMGA 3Q3BA 3FJQE 4XCUA 5CZHA 2EXEA 5AR2A 4C4IA 4PNKA 3ORTA 3ORPA 4XX9A 3RINA 3LFBA 4GH2A 4V05A 4CYIA 2ITOA 4TWOA 5EI6A 5JKGA 3BE2A 5J87A 4O7VA 4QNAA 5HKMA 5EOLA 4GVAA 3RWQA 2VTSA 3NVKI 4AX8A 4G16A 4J98A 5C01A 5M07A 1MRUA 5D9HA 3KXMA 3DAJA 4OUCA 5EHOA 2QHNA 2XK9A 4YZBA 3V8WA 3NW7A 2GNHA 4P2KA 3QQLA 2RFNA 3GC9A 4GJ2A 2Q83A 3NYXA 3LQ3A 3RCDA 5KCVA 3P4KA 2XMYA 5EM5A 4DFYA 2J0LA 4KKHA 3K2LA 3A7JA 4IWPA 4PX6A 1YXXA 4FTUA 4EJ7A 1GZOA 5EQYA 3WARA 5HX6A 3AGMA 3PPZA 1JNKA 4WSYA 2WTCA 3BEAA 3CE3A 2YAAA 3LM5A 4V04A 3WE8A 3ZYAA 3QU0A 3W33A 4AOIA 4YO6A 2ESMA 4I4FA 3SKCA 2ZV7A 1KE7A 4NU1A 3RAWA 3CD8A 2GQSA 2PMLX 3QTSA 2P3GX 3ZUVA 4IC7A 2E9UA 4DTKA 3FXWA 2YCRA 5E8VA 5EYCA 2IJMA 4EOPA 1UNLA 2BZKB 3HP2A 4K9YA 4WO5A 1H0WA 5GJFA 5L2QA 4EK5A 4UN0C 5CSHA 3I5NA 3JVSA 5AV4A 4IDVA 5ANIA 3TXOA 3R1YA 4FK3A 4LRKA 2WQEA 5TE0A 4YPDA 3VS5A 5LMKC 5F94A 4IWQA 4BF2A 5CQUA 2XNPA 4XUFA 3UMXA 2JDSA 3QXOA 3G6HA 4L42A 5FTOA 3FAAA 4BZDA 4EEVA 3NGAA 2V7OA 3EL7A 3MTLA 4R3RA 2PU8A 4D5KA 4BI0A 4QMOA 3PJ1A 2WEIA 2PZ5A 1Y57A 4W4XA 4BCNA 3V6RA 4E5BA 2CPKE 3VS3A 1OKZA 3NLBA 3AT3A 4GJ3A 5L6WL 4NKAA 1WBWA 4F7NA 2VZ6A 1G5SA 4U79A 3F3TA 4Y5QA 2XM9A 1OL2A 1DI9A 2VGOA 4LOPA 2R3RA 3VAPA 3O8TA 4BDEA 4IACA 1GY3A 2Q0BA 4UV0A 3Q9ZA 5F95A 3U6JA 4DINA 3UC4A 3ZC6A 4FV6A 1A9UA 2XIKA 2XNNA 3FKLA 3R8VA 4D1XA 4CD0A 1YKRA 4GKHA 2FUMA 3BQRA 4FIEA 4I24A 3RK9A 3OXIA 3L1SA 5FDPA 4USFA 1OBGA 3LW0A 4XG3A 4AGWA 1M7QA 3R7VA 4OTIA 3KCKA 2OGVA 2VTRA 5ITAA 2XYUA 3U54A 2VTJA 2HIWA 3KRWA 3O7LB 4ZTRA 4FTOA 4QMMA 2YCFA 4YZMA 2AC5A 3E63A 4ARKA 3RJCA 5FTGA 4BDCA 5L8LA 1YWNA 5HO8A 4XMOA 3MH1A 5HBHA 3TNHA 2OXYA 5CEKA 3GCQA 1QCFA
chains in the Genus database with same CATH superfamily
3G6GA 4C0TA 2JAVA 4CV9A 2PL0A 3OY3A 5A54A 5E1SA 3N4TA 4FOCA 4F9CA 3QUDA 4XS2A 1STCE 3GUBA 4FV5A 1GAGA 5FEDA 3VUIA 2G15A 1JOWB 3UNJA 2W4OA 4KKGA 3Q4CA 1W98A 4MF0A 3REPA 3OEFX 4OTRA 4MF1A 5I9XA 2VU3A 3B2WA 4EYMA 1XKKA 3SOAA 3DKGA 2XAMA 3A4PA 4D58A 2QKWB 3DBEA 3HP5A 3Q53A 4IAZA 4CRSA 2C0OA 3N4VA 3PXZA 3ORIA 4AGDA 5LQFA 4A9YA 2J5FA 1YWVA 2BIYA 4L68A 3UZTA 2BALA 4O91A 4BBFA 1BUHA 3Q9WA 4BDHA 2F49A 1H08A 2EWAA 1F5QA 2ZMDA 4IJPA 2BRNA 5D1JA 4E93A 4S30A 5KKRB 3P9JA 2C6TA 2R7IA 5C4LA 3BE9A 5FEEA 4O7YA 3HMPA 3DTCA 1YOJA 2V0DA 5AR8A 3NUPA 4FGBA 4E73A 2HY0A 3FQHA 4KS8A 1DI8A 5L8JA 3RM7A 1K2PA 1OL5A 4FG8A 3IGGA 1H1SA 4QMWA 4L9IA 3V51A 3HKOA 3MS9A 5LMAA 2BHHA 2PHKA 4GSBA 5EM7A 4JDHA 4NW6A 3Q52A 3FV8A 2HCKA 3A4OX 3R63A 2VO7A 1U5RA 4X2NA 3TNIA 3V01A 4MK0A 2C5OA 4AW5A 4KIOA 4IX6A 4RJ7A 1MRYA 4O6LA 4PMPA 4QP2A 3F3WA 4RX9A 5TKDA 5LWNA 4P5ZA 2ZFYA 3ANRA 3VN9A 3UVRA 4O38A 4O7LA 3HMOA 2HOGA 1U5QA 3QC4A 2QO7A 2Z60A 4RC4A 1J3HA 4XJ0A 3WZKA 1GNGA 4KB8A 5LOHA 1LEZA 3JY0A 5J95A 3W0NA 4RPVA 3KULB 2WMVA 2C6DA 3ORMA 5AJQA 2GFSA 4YLJA 1G8SA 4MCVA 4RFMA 2WTJA 3BX5A 2QD9A 1YQJA 4FOBA 3QKLA 2I6LA 4DHZA 3COMA 3OUNB 3KIOC 4I5CA 4C61A 4JMQA 3AD5A 2WEVA 3GFEA 4I21A 3HUCA 3SC1A 3VHEA 3S00A 2ZB1A 2ITNA 2BUJA 4HGEA 4YBKA 2UW5A 3MJ1A 5CLPA 5A4EA 2O63A 5M44A 2ZB0A 5AEPA 2PE0A 2DWBA 4JRVA 4MQ2A 5IMEA 3BBTB 3PPJA 3L9PA 4DEDA 1CKJA 5FXSA 4PDOA 3DB8A 2ITPA 3QTWA 5EI8A 4UYAA 3FMLA 2J7TA 2VTHA 3B8QA 3MVLA 3PP1A 2I1MA 2GDOA 4FKTA 3OEZA 4ZK5A 3VBQA 3MN3A 4PF4A 3JXWA 4YC8A 3VS7A 1DS5A 2XNOA 1P2AA 1UKHA 2ITTA 3H3CA 3HMIA 4MWIA 3BIZA 3VBXA 3MI9A 4RIYA 3ALNA 3ZLSA 4YO4A 5HLNA 4KAOA 2PUIA 3LFSA 2GNIA 4LQMA 5I9WA 3RNIA 4WOVA 5J9ZA 4OTQA 1VYZA 3EYGA 3VS4A 4EUUA 3MB7A 5BYZA 4O7SA 3V3VA 1PMNA 4WIHA 1XBBA 3PVUA 2Y6MA 2X2MA 4OR5A 3V5QA 2Q0NA 3QC9A 4AF3A 5BVNA 3E5AA 3C0IA 2BDFA 4FYNA 4CZUA 4PRJA 2HWPA 2B53A 2UW0A 4IVDA 5CSWA 4ZTNA 5K3YA 1J1BA 4EUTA 3P7CA 2WHBA 4F0IA 2P4IA 2NRYA 2VTIA 4U9AA 1VYWA 3HNGA 3C4EA 4JX3A 4DFUA 4L01A 5JFXA 4YZNA 5DR2A 3D4QA 3ZS5A 1FMKA 4G2FA 4EH9A 4UWYA 4ENXA 3A8WA 5J1VA 3LMHA 3V5TA 4IC8A 4MVFA 2Z7QA 1H25A 3UZRA 2PZYA 4LMNA 5E92A 3SA0A 5I9UA 4X7QA 5BVDA 5GIPE 3MTFA 1O6LA 2W06A 4K77A 5HIDA 3CCNA 5J1WA 3G2FA 1TFFA 1ZZ2A 3UC3A 5J8IA 5DI1A 3FE3A 3E8EA 1ZAOA 3OZ6A 4EH7A 3O5AA 1Q3DA 4U6RA 3R9DA 3SRVA 3HX4A 4AW0A 4Z9LA 4HGSA 4ZLYA 4EC8A 4WNMA 3VBYA 3MH3A 4EH4A 3UOJA 4JR3A 1SM2A 2W1DA 1WBVA 5FD2A 2EUFB 3HMNA 4FX3A 4OW8A 4OTPA 4RWKA 4I5PA 3SG9A 3COKA 3OOGA 5E8YA 1RDQE 3HAMA 1OZ1A 3NZ0A 4NZWB 2QCSA 3HRBA 3TM0A 5K4IA 3UPXA 1O6YA 5CAUA 3ZH8A 4YTFA 5IA2A 3AMBA 3V5PA 2WMAA 4FKLA 4D4SA 3VHKA 4GKIA 3AXWA 4M68A 4C4EA 1YOMA 3DLZA 4FKSA 5TOZA 5CU0A 2I0VA 2I40A 3DDPA 3QAME 2WAJA 3DKFA 4FKGA 3ZEPA 4DH8A 4O0YA 5A3XA 2OSCA 4JLCA 3V5JA 3UOHA 2YM4A 3UDSA 5J9YA 2J50A 2HELA 4JR7A 4D2TA 4AW2A 3QXPA 4G6LA 4K0YA 4ZY6A 3DK3A 2UZLA 2A2AA 4ZZOA 2J0MB 4APCA 4ZMEA 5CTPA 4QQTA 2CGWA 3EYHA 1B38A 4CTBA 4X3FA 4E6CA 4FIFA 5IQCA 3JS2A 4BDIA 3PXYA 1BMKA 3MW1A 1PXOA 3FBVA 2HENA 4PMTA 2BFXA 2OZOA 5DHJA 4BTJA 2BFYA 5FXQA 4FTLA 1KE6A 2AEGA 3PXFA 3TN8A 3C0HA 4HCVA 3W2PA 3NSZA 3DOGA 5CVGA 5E91A 1W83A 3R21A 4FUYA 3P7AA 5E8TA 4G3DA 2UW3A 1UU3A 3BRBA 3ZZWA 5JK3A 2VWIA 4EOMA 2W96B 3TKUA 2FA2A 5CEMA 3V5WA 4FSNA 1PXLA 1AGWA 4IM3A 4EK4A 3OWJA 3ROYA 3AKKA 4D0XA 3KMMA 2GPHA 4C3PA 2YJRA 3KK9A 2X0QA 3COIA 4R3PA 4C34A 1PXMA 1Z57A 2C6OA 3BI6A 3R9NA 3T8OA 3JPVA 3I0QA 4IM2A 4V0GB 1OUKA 3E8NA 3QD0A 1JAMA 4RA4A 4UX9A 3A7GA 3AG9A 2ZVAA 1YI6A 3DNEA 1OL6A 4U81A 3WZUA 1CKPA 2ITXA 4F4PA 4R77A 5IEXA 4ANLA 5CENA 3F88A 3BU3A 4R3CA 2YISA 2IVSA 2SRCA 4ANOA 3RTPA 3F7WA 3W0QA 2WOUA 4DEGA 3UO6A 3BHYA 3EFWA 4B6LA 2R9SA 3FLYA 4BGGA 4DBNA 4K33A 4PTEA 4UEUA 2F4JA 2JKKA 4XHKB 2CKQA 3OD6X 1UNGA 5B2KA 4DTBA 1YXSA 3SD0A 3RALA 3CKXA 2UZEA 3PVBA 5CY3A 4FGRA 3AC8A 3IW8A 5IF1A 3BYMA 2R3MA 3VC4A 3KRXA 3UODA 4MBJA 3BYOA 3ERKA 3HUBA 5E4HA 3BL7A 2GQRA 4PL3A 4FKJA 3ELJA 1TZDA 2GHMA 4IANA 4LL5A 3T9TA 3IK3A 2C3LA 1WAKA 4W4WA 5KBQA 4D4VA 3UP2A 4KBCA 1Q8WA 4ZLOA 4Y46A 1OITA 4FTCA 1WBOA 3HGKA 1H1QA 3VW6A 1ZYSA 2WMRA 2IZRA 4O7RA 3ZXTA 4UXQA 3BEGA 5AR3A 4JJRA 3LFNA 4LFIA 3SHEA 2P33A 3R1NA 3QZHA 4H39A 5JRSA 5DN3A 4KBAA 4ASXA 2C0IA 4FVQA 5HU9A 3AKJA 2JEDA 2I0HA 3DK7A 3K3JA 5AIRA 5FP5A 5AX9A 5EKNA 5GINE 3P78A 3U4UA 4FKOA 4D5HA 3MV5A 2VUWA 2ACXA 3QL8A 5IISA 4TT7A 2W1ZA 3V04A 3MFUA 1UVRA 4F99A 1U54A 1WMKA 3TNWA 1E1VA 4L8MA 3RZBA 2BILB 5FM2A 3RK7A 5M4FA 3IDPA 3GXLA 2PPQA 1U46A 3L8SA 2C5YA 3UNKA 4BRXA 4DLIA 3AKLA 1M17A 4O2PA 2QOCA 3C51A 4TNBA 3VQUA 4B99A 2RFEA 1OIRA 3MIAA 4BJJB 2X81A 5BMSA 4MXCA 1EH4A 1R3CA 3NRMA 4I41A 5L3AA 4XP2A 3HV5A 4BCMA 5D41A 1M2RA 3LXKA 4EOIA 3OC1A 4QPAA 2IW9A 2XNGA 3MA6A 3ZMMA 3PIYA 4GVJA 5D11A 4QMYA 1R0PA 2Z7LA 3FZPA 2ZM1A 2VTNA 5A9UA 3EFJA 5KO1A 3RPSA 2J5EA 5F4NA 3FLWA 2IWIA 2W1IA 4M67A 4O6EA 5K4JA 3TTIA 5DH3A 3ZRMA 4I6HA 3FZTA 3VUGA 1QPCA 4EH6A 2W7XA 5KKRC 5H8BA 3QLFA 4TYGA 2X7FA 5CEOA 4J7BA 4EKLA 1XMMA 3WZJA 2HK5A 2QU5A 3BZ3A 4AN9A 2FB8A 2W05A 2XK7A 4YMJA 4F78A 4E26A 3NWWA 5EQPA 4R7HA 2XYNA 4D4YA 2R3HA 4HGLA 2CHLA 5HD7A 2UUEA 1BLXA 4JS8A 1RE8A 1L3RE 2EB3A 2WMXA 4F6SA 2Z8CA 3E8CA 2PUNA 4IAAA 1XMLA 5GZ9A 4NTSA 1B39A 3MVJA 4PTGA 3R28A 2J90A 1REJA 4JDIA 4ZTSA 3FMHA 3K5UA 3PWYA 3QRIA 5KE0A 4XRJA 3DFAA 3U87A 3ZO3A 4F6WA 3E62A 3Q9XA 3OWLA 2R3PA 3RHKA 1ZRZA 2OJ9A 5AAFA 3ZSGA 3ACJA 3TDVA 2ITUA 3PFQA 5KZIA 2G2IA 4AOJA 4HVIA 3ATSA 4ACDA 1JQHA 3GCUA 4ZSAA 3CQEA 3P79A 4O0SA 5GJDA 3LLTA 3W1FA 5HG7A 2XK3A 2ETKA 5HU3A 5DNRA 3Q4UA 3PJ8A 2BRHA 2OIBA 2VWXA 3ZO1A 4II5A 4QOXA 1OIQA 3QHRA 4CFNA 4QQCA 4A07A 3O96A 3QWKA 2OXDA 4XG6A 2BZHB 2IVVA 1W2DA 2X1NA 2PY3A 3TNQB 4XH6A 4JVGA 4AFJA 4B8MA 2YLFA 4MD7E 5IUGA 3ZEWA 4H36A 3FI2A 4YSJA 1H00A 5EW3A 4ZS0A 4K8AA 2X8EA 3LM0A 3RI1A 3WIGA 3EJ1A 5JMSA 4D0WA 3LHJA 3VS0A 4M14A 3ZDUA 2E9VA 3DFCB 3JUHA 4GYIA 4PL4A 2GNLA 5F20A 4KIQA 3W8LA 3QTUA 5D12A 5BUIA 4BWKA 5JEBA 5IQAA 5GZ8A 2QOIA 2WMQA 5HNGA 3CSVA 1OIYA 3ZBFA 2C30A 4IJ9A 5KMLA 4L3PA 5L8KA 4GMYA 1SVEA 2GFCA 2IO6A 2QI8A 4HVDA 1F3MC 4DLJA 4PP9A 2RF9A 1U4DA 3QWJA 5DRDA 4IBMA 3QYZA 4XLVA 2CKPA 2OO8X 5FBNC 3EN6A 3ENMA 2YWVA 4JQ8A 2J6MA 3BLAA 3ORKA 4GUEA 1A06A 2W5HA 3IW4A 4QMTA 5EW8A 5EQEA 2ITVA 3NIZA 3UPZA 5HG5A 2RKUA 4RT7A 3RMFA 3U6IA 1IEPA 1GIJA 4IFCA 3TZMA 1ZYLA 3IO7A 3QQGA 4MXYA 4N6ZA 1H8FA 2R3GA 4IX4A 3FXZA 4YP8A 2R3IA 4ITJA 4C4HA 2PULA 5BVWA 5IDPA 3NR9A 4Z55A 5DFPA 4CFXA 4CFFA 3FMKA 2JDOA 4R5SA 4O4FA 2XALA 4AA0A 4MHAA 1NA7A 3R9HA 1HOWA 4AP7A 3VUDA 4G3EA 4QP4A 5ICPA 3PA3A 3L8XA 4B9DA 2IVUA 4OGRA 1PW2A 4K18A 1NY3A 2HWOA 3D7TB 4JL9A 4XOZA 5JRQA 4R7BA 2BKKA 3MA3A 4MH7A 4GIIA 1BKXA 5T3QA 3HV4A 4FG7A 4GCJA 3W2QA 2FVDA 3DBDA 3LFDA 1T45A 2UVYA 2WQMA 4DFXE 5C26A 4F7JA 3FHIA 1DM2A 2YZLA 4FKQA 3G51A 1IAHA 3U51A 2RG5A 4LYNA 4LOOA 4L7FA 2EB2A 2BDWA 4JG6A 3SW4A 3DQXA 4TRLA 1H07A 5GNKA 4M0ZA 4C8BA 3UGCA 2QOHA 2VTAA 2A27A 5LVMA 3I7CA 4OTGA 4EKKA 2CN5A 4YHFA 4EH5A 2B9FA 4RVKA 3VS6A 2CDZA 2CNVA 4RVMA 2ZYBA 1FPUA 5AR4A 4QDEA 2BZIB 4OAUC 4G3GA 2YIXA 3DZQA 2F57A 5K5NA 3QHWA 1ZYJA 3R7EA 5CX9A 2R0IA 5HNIX 4BWXA 4KRCA 4TXCA 3P23A 5FGKA 2GU8A 3NDMA 4WG4A 3U55A 1IA9A 4LGDA 4D1ZA 3L9LA 3CQWA 4FV4A 3O0GA 3FHRA 3LLAA 3PRIA 3VJOA 3G0EA 1RQQA 3FKNA 3FY0A 4YPSA 4FZ6A 4NCTC 4F9BA 2GHGA 3DGKA 4E5WA 2R3OA 1H4LA 4KNBA 3S1HA 4X6RA 4FK6A 3HZTA 4GIHA 3DXNA 3E88A 4AE9A 2GQGA 3TZ9A 5I3OA 2F2CB 4JXFA 3EN4A 3MWUA 4MBLA 4NFMA 5JZNA 2B9HA 3UNZA 3C4FA 2OF2A 1GJOA 1LP4A 1PMEA 2X2KA 3CQUA 4BDJA 3DB6A 4BKJA 4CNHA 1DAYA 4D2VA 4CEGA 2YDKA 4ACHA 3EQDA 4K2RA 3HV6A 5H3QA 3SW7A 1NVRA 1TVOA 4Q5EA 4NM3A 2XRUA 4EZ7A 4IB5A 4BTKA 4RZWA 3QTXA 1Q5KA 4X6QC 2VWYA 3W18A 3ROCA 3UG1A 2QVSE 3FZSA 3FMJA 3G33A 5HCZA 1Y6BA 3GCPA 4FZ7A 4CRLA 3O17A 4L3JA 4YJVA 3F66A 3C7QA 3QCSA 3BKBA 3O50A 3GENA 3MH0A 2PVNA 3R7GA 5IEYA 4RWLA 4FKPA 2IG7A 2A0CX 1XWSA 1XH6A 4JNWA 2RIOA 3FYJX 1Q3WA 2ITZA 4FTAA 4N4SA 5LJJA 2XF0A 4JIAA 4FYOA 3QCQA 1Q41A 4U40A 3EWHA 3JVRA 5CQWA 4QRCA 2IZTA 3F61A 4TWPA 5CI6A 3I6WA 5LCJA 3HMMA 5LCKA 1TQIA 2XBJA 5EDPA 4TL0A 5TF9A 4ALWA 2F7ZE 2YIQA 4HYIA 4CLJA 3MY1A 2OBJA 2W4JA 3EOCA 3F3UA 4RMZA 4TYHA 4Y95A 2CLXA 4X2FA 3MGYA 3IOPA 4ERWA 3KXNA 4O4EA 4MNFA 5IQIA 4GG7A 1ZMUA 4DN5A 5HZNA 3ZBXA 3AQVA 2WU7A 2WQNA 5FTQA 5LVNA 4I93A 4RJ8A 3ID6C 2ERKA 3MVMA 2X4FA 3BHHA 4Q5HA 5CYIA 3FZOA 5AAEA 3CPCA 2BAJA 4QNYA 3ZFXA 3UQFA 3UDZA 2IN6A 3GU7A 4Z16A 4DYMA 1IAJA 2GS2A 4FNWA 3UG2A 4WNPA 3LJ2A 3TUBA 2AQXA 2W9ZB 1JKSA 1XR1A 3ZHPC 5AP1A 2YCQA 2R3FA 3VVHA 2CKOA 4NT4A 2RL5A 3UTOA 2XIRA 2XKFA 4DGGA 3F5GA 1MUOA 1J91A 3HRCA 4FTTA 4N0SA 4CTCA 1PHKA 5DGZA 4I6QA 2EXCX 5HVYA 1UWHA 4G1WA 4EH8A 3LE6A 4G5PA 2FSTX 4HCUA 2R5TA 3GU5A 2A98A 3O51A 4QMSA 3SG8A 2OLCA 4S32A 4AACA 4L43A 2VTPA 2XCKA 3DBCA 3DJ6A 4RJ4A 4FKWA 3OFMA 4RRVA 2C4GA 1REKA 3QRKA 5DBXA 3OT8A 5CAQA 1SNUA 3PIZA 1V1KA 3O7LD 4OTDA 4NKSA 2DQ7X 4AWIA 3PY1A 1BI7A 3GU8A 1GZKA 3R1SA 3LQ8A 5CSXA 5HE3A 3MSSA 4AZWA 4IB3A 1PMUA 4C3RA 4GRBA 5IZFA 3RPYA 2R0UA 4I1ZA 4JOAA 4KINA 2J4ZA 3QFVA 4RIXA 1E1XA 3RVGA 3IDCA 3A2CA 5IUIA 1AQ1A 5EDRA 4B0GA 3PE1A 3NNXA 1HCLA 3QLGA 4QMPA 2ZDTA 2X39A 4XG7A 4L67A 4RC2A 5C03A 2J9MA 5DLSA 2YM3A 4LL0A 5HORA 2ITQA 4FV2A 4YBJA 3ALOA 5C8MA 3IONA 2BTRA 5ANGA 4XV3A 4FF8A 4LUDA 5CXHA 4RWJA 2ITWA 1L8TA 4GS6A 4FEVA 4O1PA 3QQJA 4IVBA 3R8LA 4QPMA 4GYGA 4FV9A 1W82A 3FSKA 2ZJWA 4I3ZA 2QKRA 4YSMA 1UU8A 3Q96A 1OUYA 4FKRA 4FT5A 4O2ZA 4U97A 3ZUUA 5GHVA 2UW9A 3CEKA 3NYOA 4HPTE 2BZJA 1XH9A 3LFQA 3POZA 4HZRA 4PMMA 4BB4A 3DLSA 4C2VA 3KF7A 2X7GA 3KK8A 2OZAA 3UQCA 2IF8A 2YN8A 1VEBA 3QTRA 3VS1A 4C62A 1PXPA 4AS0A 3TJCA 3MESA 3PA4A 5CZIA 3TIZA 4LGGA 4BIDA 4DH5A 1FBNA 3C5IA 4FTQA 5EM6A 3PA5A 3R1QA 4EZ3A 2CN8A 5CAPA 1Q97A 2P55A 3AC2A 2X0GA 3C4XA 4FTNA 4AN3A 3VS2A 4YUQA 4BKZA 3UOLA 2OXXA 5AUVA 3TL8A 4EC9A 5IKWA 4FSUA 5AUXA 2QR7A 4KIKA 4R5YA 4FEXA 5B0XA 3ZDIA 3D5UA 3NUYA 2B55A 4GV1A 4WSQA 2I7QA 5CU4A 3Q9YA 3NPCA 4ZTMA 2PZRA 4DG3E 2GSFA 4L00A 4QP9A 1BYGA 5DPVA 1KV1A 3BLRA 4NH1A 3LJ0A 2IW8A 3VULA 1YHSA 4ID7A 1KV2A 4JBVA 5HE0A 3RM6A 3WI6A 3ORXA 5TO8A 2XNBA 2XEYA 2HW6A 1YW2A 3OW4A 3DK6A 4GK4A 4GT3A 4O21A 5DT3A 3R8PA 1LEWA 5CT7A 4M69A 5BVOA 4IMYA 3JYAA 2RSVA 4R6VA 4WG3A 3QF9A 4CXAA 3WF8A 4XRLA 4E4LA 4D1SA 3E92A 4J97A 3OOMA 3AD6A 3R02A 2WPAA 3A7IA 4M0YA 5E8ZA 3UDBA 5A4LA 4L7SA 4IXPA 2QOQA 3BQCA 3QX2A 2R3QA 4S2ZA 4CFMA 5HNBA 3ZXZA 2BMCA 3E3PA 3RAKA 5JQ5A 4N70A 4E20A 3W0RA 4IWOA 5FLFA 4GUBA 3ZTXA 4I5HA 3NCZA 3DKOA 4MTAA 2PMIA 1WBNA 4IZYA 4QEBA 1YDSE 2JC6A 3OCTA 3CJGA 3A7HA 5LARA 2OJJA 3KMWA 1MQBA 4Z7GA 2YA9A 4DHFA 4EOKA 2JFMA 3R6XA 3AT2A 3OHTA 3PRFA 4M69B 2O2UA 5EYDA 5CAVA 4EBWA 3FQEA 3PY0A 4L44A 2JD5A 4QMLA 3QTQA 4TWCA 3QA0A 2WQBA 4PL5A 4O96A 4IE9A 2VTQA 4H58A 1J7IA 4C02A 4FKVA 3ZUTA 4ASZA 1M14A 2X9EA 2VX0A 3DAKA 3NEWA 3NUSA 4ZJIA 2WQOA 4RG0A 3S95A 4YJUA 2RFDA 3KVWA 4P4CA 3FUPA 3B8RA 5AV1A 3DT1A 3E7VA 4ZSJA 4GG5A 3BBWA 5ACKA 4HYUA 3BV2A 4G3CA 2YM7A 3Q6WA 5HTBA 5HEZA 4AA4A 2XM8A 3C1XA 4RSSA 1OKYA 3I4BA 1PRYA 1M2QA 4F9WA 4U5JA 4UBAA 3R04A 3PXQA 4YR8A 5M4IA 3NX8A 5CT0A 4RIYB 5JFVA 4EK8A 3KB7A 2JDTA 1WVXA 4XEYA 5HBJA 5A4QA 1GIHA 1H1PA 2PE1A 5IPJA 1ST0A 2OJFE 4A9UA 3CR0A 3QD4A 1S9JA 2WMUA 4BKYA 3F5UA 3TZ7A 1ERKA 4EWQA 3T3UA 4IVCA 4WHZA 4DEHA 1GZ8A 3MPTA 2QURA 3Q5IA 4JAIA 2VWZA 5A14A 4FT3A 4M12A 2UZWE 4C4FA 3ZOSA 2GNFA 4O7NA 2J2IB 3KCFA 1H01A 4YNOA 1SYKA 4ZSEA 3ET7A 2JKMA 2WOTA 3VJNA 5AMNA 3PSBA 3SQQA 3MPAA 3IGOA 4A9TA 3TV7A 4I0RA 2X6EA 3W0PA 3UIBA 4DT8A 4M8TA 4W4YA 1H1RA 3QQHA 3C9WA 4L46A 2YLEA 1OPJA 3CKWA 5E8UA 2YCSA 3R22A 5HCYA 4W4VA 4A4OA 4ZY5A 4JT3A 4DEAA 3RPOA 2VTOA 3ZM4A 2R7BA 5IUHA 2HZIA 4H1JA 2XK4A 3FPQA 4WNKA 3A7FA 5AP2A 5HOAA 4YTIA 1OPKA 1FOTA 1I09A 2E9PA 3C4ZA 1YHVA 1JKTA 1X8BA 2OW3A 2FYSA 4AT3A 2CGVA 3E3BX 4IB0A 4O7ZA 5TR6A 3V8TA 5EKOA 3U4WA 5A46A 3UZPA 2X0OA 3KXHA 4CMOA 2R4BA 3SRVB 1J1CA 3FL4A 3PJ3A 2B54A 3EQRA 4FODA 5I3RA 3ULZA 5CALA 2ETRA 4O4BB 3HV7A 4LM5A 2OU7A 4CMTA 3VONA 4ZSGA 4ZJVA 3KVXA 5ETFA 4K6ZA 3SDJA 3UJGA 3H9RA 3ML1A 2WNTA 2XJ0A 4FIHA 3DU8A 2XUUA 4IAFA 5E9EA 4F0FA 4DGNA 3OT3A 4AZTA 2XZSA 3LCOA 4FSMA 2C5VA 2YJSA 4KIPA 4RWIA 1Q62A 4XLIA 5HD4A 1YXUA 5JN2A 4FICA 4AGUA 3BU6A 3QA8A 4EOLA 3M42A 5CVHA 3W2SA 2W4KA 3AC4A 4J99A 4FVPA 4X2JA 1FGIA 5AX3A 1Y8YA 3ACKA 2PYWA 2WIHA 3D94A 4QQ5A 4BDGA 5I9VA 3UIMA 2HZNA 4BDKA 3CP9A 5K5XA 3R01A 3OBGA 5T6KA 5AP5A 3PJCA 4AXEA 4QMVA 4CV8A 2X2LA 2VAGA 5HG9A 3GC7A 4C57A 1P5EA 4MXZA 5IQHA 4UB7A 4QMUA 3W55A 5DT4A 3II5A 4YURA 4FI1A 4X3FB 2VRXA 1AD5A 2WFYA 1PYXA 3IKAA 3LXPA 4MWHA 4BCJA 3G0FA 3TWJA 3DS6A 2I0YA 2XBAA 3ZO2A 2OJGA 1H28A 3GOKA 4RLKA 2CLQA 2W17A 3DDQA 3UVPA 3VUHA 3ZC5A 4U0IA 4BHNA 5JGDA 5CNOA 2VV9A 2GMXA 1R78A 3PFYA 4FV1A 5CF6A 1J7UA 4NFNA 4L52A 5HX8A 2B1PA 3OVVA 3UO4A 4AT4A 4GFMA 5GJGA 4NL0A 2ETMA 3AMAA 5KHWA 2XP2A 3U9CA 4W8EA 3R8MA 4AW1A 5AV3A 3VIDA 5T68A 3TG1A 1QL6A 2HXQA 4FNXA 1NT2A 4QQJA 4CFVA 4ZAUA 4O86A 4B4LA 2BVAA 4XOYA 1PXKA 5HGIA 4MAOA 5C8KA 3R8ZA 4DCEA 3VNTA 4Z7HA 2YWPA 4Q9SA 3R7YA 3FC2A 3Q04A 2WELA 1A48A 4CYJA 5FDXA 3RCJA 4J96A 3ATTA 5I5ZA 1JKLA 5G1XA 1SNXA 4AZVA 2WTKB 4BCQA 4R1VA 3M2WA 4ZLZA 3PZEA 4CFWA 4DFLA 1VR2A 2VNWA 3E93A 3P5KA 5FM3A 2PVYA 2QU6A 3LFEA 5IDNA 3H4JA 4RBLA 4FT9A 5M09A 3ZRKA 3HAVA 4OT5A 3GOPA 3R8UA 3NUXA 4J53A 3E7OA 3TEIA 4TNDA 2HY81 2YAKA 4M15A 4EQUA 2O0UA 3AC3A 2WMBA 3GEQA 4UMTA 3SV0A 2WGJA 2VO6A 2ONLA 4FT0A 4J95A 4GU9A 3K5VA 4KD1A 3TMOA 3KRLA 5KHXA 3I81A 3QZIA 4WD5A 4ZTLA 4UMRA 5KUPA 2OFUA 1FINA 3VF8A 4BR3A 4FSTA 4ZXTA 4DITA 2YIWA 3O23A 1R0EA 1W2FA 2WIPA 2P0CA 3GNIB 3LJ1A 5ANJA 1H27A 5BVFA 3F2NA 5K0KA 4KRDA 2EU9A 2EVAA 5FEQA 3C0GA 5E1EA 4ASDA 2J0KA 3UQGA 4BTMA 2DUVA 3VQHA 4FG9A 1GZNA 4BDBA 2QC6A 2RFSA 3PXKA 5A4TA 5AR7A 5M57A 3ENHA 2BHEA 3C13A 3FEGA 3QX4A 2H34A 4ZTHA 4I20A 1ZMVA 4QO9A 3PPKA 3BWFA 4XNEA 2CCIA 3OROA 3R0TA 3KU2A