5BMSA

Crystal structure of p21-activated kinase 4 in complex with an inhibitor compound 29
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Structure-Guided Design of Group I Selective p21-Activated Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bmsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bmsA01
3V04A 3ZXZA 4TT7A 3MB6A 4F09A 3LFFA 1XO2B 2WMBA 4W4YA 4ZXTA 2ZV2A 3C13A 3C9WA 2J9MA 4ALWA 4FGBA 1FOTA 2C6MA 3NWWA 4MX9A 4C0TA 4E5AX 4ASDA 3NVMB 1FVRA 3AT2A 3D5VA 3E62A 5HG5A 1DAYA 2R3PA 3CTHA 4BGGA 3ZONA 4FKWA 4ZP5A 5C27A 3UZRA 4UALA 2QKWB 3TTIA 2H34A 4M97A 4EZ3A 3RALA 2YN8A 3C4XA 3E63A 3KL8A 3Q3BA 3PJ8A 2FYSA 4JLCA 4KRDA 4WUAA 1PXJA 5EK7A 5EYMA 3ZFMA 4F6WA 4ZS0A 1OBGA 4FV7A 4O0XA 3PPKA 4DFXE 4IE9A 4R1VA 4HVSA 4AT5A 3ORPA 4YTFA 5HHWA 2VAGA 4BB4A 2G2HA 2KULA 4D5KA 3UNKA 4LRJA 1P4OA 2UZLA 2I40A 4HNIA 4HOKA 4EOOA 4CNHA 4YZBA 5HOAA 2E9UA 4I6FA 1FQ1B 4CXAA 5L6PA 2ZMCA 2OZOA 1RW8A 3EHAA 3TJCA 3UIXA 2YM5A 2YCRA 4QYGA 5IQDA 4NTSA 1QMZA 5FEDA 3IKAA 2QOIA 4M3QA 4BZDA 3W32A 4BDAA 4ZAUA 2ITUA 3TZ8A 4H58A 4QPMA 2PVRA 4HW7A 5HX6A 2VU3A 2OXDA 5IG1A 1DI9A 3HA6A 2X9FA 4FZ6A 2QC6A 3EFJA 3LW0A 4L44A 4A9SA 1YWRA 1NVRA 3TDWA 3ZLYA 5J95A 3RI1A 4EUUA 5A6NA 2XNGA 2GPHA 4FKOA 5HO8A 1FPUA 1LEWA 3KB7A 1XBAA 4H1JA 1U59A 3V5TA 1YRPA 3C0IA 3RK7A 3NAYA 2Z8CA 2HOGA 4FZAB 3EB0A 4KIQA 4II5A 4O0SA 2QOLA 4AZTA 3RPSA 5HKMA 5AM6A 2E9OA 4C38A 4E6CA 2PMOX 4FKTA 2A4LA 4NM7A 4BGHA 4CSVA 2IVUA 3DAJA 3EQBA 2BRGA 2W96B 3TM0A 2UZVA 3KK9A 3MJ2A 5E8YA 2XEZA 1W98A 2BROA 4D2SA 3Q60A 5CASA 5D12A 3RAKA 4FUYA 3VULA 2AC3A 4UYNA 2R2PA 1XH4A 2JIIA 3KK8A 3NVKI 4WBBB 3EIDA 3FMKA 4GG7A 1YXXA 2C69A 3H0YA 2GQRA 1G5SA 5JGAA 3KXXA 3RINA 4QMMA 2HIWA 3WZUA 4FF8A 2QU6A 3UPXA 4QMQA 4XG3A 3F82A 4IX6A 3MBLA 3GI3A 4BVUA 5JFXA 3SXFA 3QA0A 2PUIA 5H3QA 4XG7A 4JIAA 4O1OA 5EW8A 4I41A 3E8NA 2VTOA 3ORZA 2PVHA 4JBQA 4FEQA 1WVXA 3KMWA 3NYOA 3R7VA 2C6OA 3F2AA 1JQHA 3NRMA 3G5DA 4O7WA 2IO6A 4U6RA 4X7QA 4UXLA 4B8MA 2Z02A 2JFLA 4CZTA 2CGVA 3NLBA 4C2WA 2FSTX 5IA5A 4MK0A 2W1ZA 4F65A 5M4CA 2WTKB 5I0BA 3POZA 4HGSA 2WO6A 4WIHA 5B2KA 5J1VA 3MH2A 2RF9A 4GEOA 4W4VA 4P90A 5E8ZA 1IASA 2GU8A 3HDMA 5ETCA 4BCKA 2H96A 1M2QA 3K3JA 4XV9A 2WTKC 3UG2A 4YZMA 5EQYA 4A4LA 4EYMA 4RWIA 5FG8A 5HIBA 4BR3A 3DS6A 3QD2B 1J7LA 3FMNA 3VO3A 4MYGA 2VD5A 4KBCA 1F0QA 4G2FA 4YJVA 1U4DA 2XK3A 4FTTA 4NM5A 4RA5A 3LM5A 4EHVA 2C6IA 2PZYA 5JFWA 1S9IA 4G3FA 2WMRA 3CD3A 5DVRA 4YTIA 3MPTA 2PE1A 1JKSA 2WMXA 4D1ZA 4XG2A 4TXCA 2XK7A 3R7EA 2QLQA 1CKJA 4FTOA 4NK9A 4ACHA 2OK1A 2BHEA 5TOZA 2P2HA 3JS2A 4PP9A 4FV8A 2WIHA 1E1VA 1IEPA 4JX3A 2BUJA 4PPAA 4YLLA 3MFRA 1V0BA 4MKCA 4UB7A 1UNLA 3AG9A 4D2PA 4E7WA 3DK3A 1QCFA 3HYHA 3GU7A 3OFMA 5JZJA 4AACA 4BCFA 3FI8A 2J0MB 5M09A 2JAVA 3BLQA 4DGMA 1MQ4A 4RT7A 4RC2A 3DAKA 4ITJA 3ORIA 1PXOA 3R22A 4IIRA 2G2FA 4CEGA 4UMTA 2J4ZA 5EDRA 1OKZA 4FICA 3CQWA 4QMPA 5IA3A 4BF2A 3WILA 4AA0A 2QR7A 5CU6A 2H8HA 5JQ5A 5IEVA 2CGUA 2GHGA 4MD9E 4F9WA 5I4NA 2B9FA 3SQQA 4EL9A 3HVCA 4AU8A 3FZTA 3IW8A 1SYKA 2F7ZE 3A99A 3VS6A 2B53A 3KQ7A 4F6UA 4D5HA 3UO5A 3W33A 4AZEA 4XG9A 5A4QA 5HNBA 4DEIA 1UWHA 4HYHA 3DLSA 5DA3A 4IM3A 4UMQA 5FP5A 1JSUA 3R1SA 4NH1A 3FZRA 4QQ5A 4WNPA 5BNJA 2PL0A 4B7TA 4F0FA 4IWDA 2YM3A 3ZOSA 4DT8A 5M07A 5HIEA 2Q0BA 3R28A 3JXWA 2QURA 4FZ7A 5CQWA 1R0PA 3OXZA 3EL7A 4EH2A 3UVPA 5CEPA 4FSZA 3OCSA 4GYIA 3LZBA 2GNJA 5KO1A 4FSWA 4QTCA 4QNYA 4LL0A 4RIOA 3GCSA 3PXQA 2UW0A 4FV9A 4YTHA 3TIZA 3VJNA 3NIEA 3ID6C 5IQIA 3CCNA 5LMKC 2W1CA 3ORLA 5ANEA 4EH8A 2GHLA 5EDQA 2XKFA 5GJDA 3AGMA 3QYZA 4C58A 3QCYA 3AT4A 3BIZA 2XF0A 4H3BA 4N6ZA 3WBLA 4OTWA 4F1TA 4Q9ZA 1QPJA 3BLRA 2UW6A 3FI3A 4KAOA 3F7ZA 3QUDA 4U40A 4L3JA 3R2YA 4EUTA 4DFYA 4UXQA 4AGWA 2W0JA 3F2NA 4CCUA 3LXPA 4I94A 4PMMA 5CI6A 5IQEA 2YERA 2J5EA 4KIKB 4EH3A 4GU9A 4XH6A 1TKIA 4ZZMA 2GTMA 2XVDA 3NIZA 3QXOA 4IH8A 4RWKA 5CAUA 4FR4A 3OP5A 4EC9A 3F5XA 1ZY4A 4PP7A 2WHBA 3GVUA 1Q4LA 1Q8UA 3COHA 3LIJA 1WBWA 5HNGA 1OUYA 4X3FA 2E9PA 1K9AA 3F66A 4AT4A 3GENA 3Q96A 3CGOA 4FT9A 4RX8A 4P5ZA 4E4LA 3IQ7A 3PP1A 3COIA 4IAKA 4F0IA 1NW1A 4K9YA 3BHUA 3HV3A 4FTMA 4PWNA 4RLKA 2VO6A 4XG4A 3DFCB 3LFQA 5AP0A 5BVFA 1H07A 5E8UA 4CRSA 3REPA 3PRFA 2BZIB 2PVJA 4TNDA 3WZDA 4CVAA 5AFVA 4QTEA 1OL5A 1H0WA 3VUKA 4EKLA 3Q4UA 4J95A 3DQXA 5FWKK 4XG6A 2JGZA 5LCJA 2UZOA 2Y4PA 4M7IA 3TV7A 3VWAA 1QPCA 1I09A 3BI6A 3P78A 4X2FA 4TL0A 5A4EA 2BHHA 4RJ8A 1KOBA 2HW6A 3BHYA 3BYUA 1BYGA 3IDCA 5AUXA 4R3CA 3JVSA 2BPMA 1LUFA 2WQEA 3PRIA 5IQCA 4U8ZA 5JFSA 4F63A 1PMVA 4MH7A 2HY81 5BVEA 3V8SA 5BQ0A 1Y8GA 3TV6A 4CMTA 4RJ5A 3BELA 3Q9XA 2C68A 4AZVA 3FL4A 2QNJA 3U6IA 2PVLA 3D14A 4RC4A 4IWPA 3ZBFA 3FBVA 4F99A 3WIGA 5HGIA 4ZIMA 4J96A 3UPZA 4YJSA 2ITPA 4Z7GA 3LHJA 2XYNA 3O51A 3R71A 2PZ5A 5C8MA 2C6KA 2CPKE 3QX2A 2NO3A 4JI9A 2W4KA 2R0IA 4TYJA 1PHKA 1REKA 2R3IA 4B0GA 3QGYA 2HY0A 2YDKA 2AC5A 4RIXA 5CAOA 1W82A 2WTDA 4FIJA 1ZYSA 5GJFA 4IXPA 4F7JA 4KUJA 2OIBA 3ZSGA 1MP8A 1URWA 1UWJA 1ZMUA 1JPAA 2QCSA 1YOLA 1UNHA 3OWKA 4FYNA 3QCXA 2R4BA 1TQPA 2UVYA 3QQGA 4F7LA 4GW8A 3LE6A 4QYFA 4C02A 5CSPA 1DI8A 1PW2A 2SRCA 3DU8A 4IANA 3R1QA 3PPZA 3RWQA 5K0KA 3GNIB 4BTKA 5CSVA 4YHTA 1CDKA 5HTBA 3DK7A 3EJ1A 2GQSA 4IWQA 4YO4A 3TN8A 4ZK5A 1ATPE 5CYIA 5IDPA 1OECA 5FXQA 2B9JA 4RZWA 4CYJA 3UIMA 1NVQA 3IGOA 4QMXA 4ZMFA 4DFZE 2RL5A 4U42A 4G31A 3BE9A 5HO7A 2R64A 4HNFA 4FL1A 1CSNA 4CKRA 4CFMA 3EFKA 3NUUA 4EHGA 1M52A 4FTIA 4I0SA 3A7FA 4O0UA 4F0GA 3R6XA 4EI4A 3PY1A 4QYHA 4QP3A 3IPHA 4G9CA 3CBLA 3NS9A 4B99A 5JGDA 2XCKA 4Z55A 3IG7A 2VWXA 2XIZA 4DH1A 1FMKA 1GIHA 3W2QA 1WZYA 4FG9A 1BL7A 3I6UA 4QMNA 3PJCA 2XNOA 2RIOA 3G6HA 4YJUA 1CKIA 4C4EA 4I5HA 2IW8A 5HD4A 4QMOA 4O82A 1H25A 3Q9ZA 3VS4A 4X2JA 3HP5A 1X8BA 3MH3A 3HA8A 1QPDA 4PTGA 2VTPA 5CWZA 4DEBA 2C1BA 3UOJA 4F1MA 1OITA 2FA2A 3QZGA 4FZDB 4FTUA 2WMAA 3FYKX 5AV2A 3WE8A 4U44A 4J71A 3MVHA 3E8CA 4OTDA 3G0EA 3K54A 4ZTSA 3VS5A 3WZJA 4KWPA 3NR9A 4ZSJA 4IEBA 5GIPE 4H39A 4M13A 3UODA 4TYHA 1B39A 5M4UA 2IG7A 3O8PA 3VS2A 3NEWA 4AQCA 2QVSE 4GU6A 4FTRA 3DXNA 4LQMA 3NUXA 2B7AA 5CZHA 3ZRLA 4NW6A 4TZRA 4Y73A 3V6SA 4EK6A 2BAJA 4ITHA 3VBXA 4EORA 5CEOA 3FAAA 4G9RA 1UA2A 3OWJA 5J87A 3DPKA 2PUPA 4BICA 3RPOA 3LKMA 1H8FA 5AUTA 4CT1A 1YDTE 4TYIA 4CYIA 2WTCA 2BZJA 4FOCA 4KBKA 1IAJA 3E8DA 3MN3A 4BDJA 1UU9A 4KS8A 4BHZA 3V5PA 5HIDA 3R73A 3HV4A 4JQEA 4Z16A 3QQFA 2YIXA 3V8TA 4M69A 3RBWA 3U55A 1YQJA 5IQAA 4PL4A 3F3VA 3I6WA 3FLSA 3QTUA 4FNXA 4I23A 4BI1A 3G0FA 1U46A 5HESA 4Y46A 4MWHA 4WSQA 3RKBA 3ORTA 1PF8A 2WELA 4C35A 4AT3A 4UX9A 3I5ZA 3R7OA 4YHJA 2EB2A 3OWPA 3W18A 1H1QA 2JKQA 2P3GX 3EWHA 3E7VA 4KABA 3QCQA 3PG1A 2UVZA 1YI3A 3R30A 4Z9LA 2CCIA 2C5NA 4BY9E 4JRNA 4MNEA 5JRQA 4I0TA 3GUBA 2JDRA 3NUAA 1KWPA 2R3RA 3S00A 3NW7A 3A8WA 2PY3A 3CE3A 3Q4ZA 3RZFA 3SKCA 2ITOA 1M17A 3KCKA 2BR1A 4GUEA 4GK3A 2GNFA 3CEKA 5DEYA 5CT0A 4WBOA 3D5UA 3PXYA 3TNIA 5EHOA 4CZUA 4ASZA 2E9VA 3FEGA 1OIQA 4IADA 3HP2A 5EHYA 4Y8DA 4FGRA 3LXLA 3VW6A 2EU9A 4O2ZA 1QPEA 3FHRA 4FSTA 3N4TA 5KMKA 4RSSA 2XEYA 5ANKA 4G3CA 3QXPA 2VTQA 4O96A 5HX8A 3TTJA 2O2UA 5C4KA 1P2AA 5L2TA 4LV8A 3GCUA 5A6OA 2W7XA 4U3YA 1Q8TA 4OUCA 3GU5A 4XMOA 3ZU7A 3CS9A 3CY3A 5C1QB 4APCA 1J1CA 3WOWA 3NSZA 5M44A 2XA4A 2GNIA 3U9CA 5EKNA 4JVGA 4X0MA 4EOJA 3HMPA 4R3PA 2WMVA 3UO6A 1WBPA 4YNOA 4BBFA 5LWNA 3HAMA 4OTPA 3TWJA 3LJ1A 4BN1A 3BHTA 5H8BA 2X2MA 3QLGA 3UDBA 3OCTA 4DEGA 2B55A 3BX5A 3D5WA 1OL2A 4XBUA 5IA4A 4P4CA 3TUCA 1OVEA 2P33A 4GJ2A 5H2UA 2VN9A 5HG9A 5JFVA 4KSPA 4IBMA 4LI5A 4NFMA 4QP1A 2UW3A 3SG8A 3FKOA 2DQ7X 4OTFA 2PUNA 1YOJA 3VW8A 1WFCA 5LMKA 5JH6A 2QI8A 3HEGA 3SLSA 3IS5A 2R3NA 1YHSA 3A4OX 5AX9A 2ITQA 3QRUA 3S3IA 2A0CX 3DFAA 4FV4A 4IAFA 3MWUA 4OGRA 3PSBA 4KIPA 3R8UA 5M55A 4YP8A 3GU4A 4S32A 4QMTA 4U43A 2BDWA 3ORKA 3LMGA 5AJQA 5AX3A 3GC0A 3FPMA 1FMOE 1ZZ2A 2VTIA 4GFMA 4B8LA 4R7BA 1Q61A 3II5A 4YLJA 5D41A 3UC4A 2GQGA 5KBRA 5KX8A 2XRUA 3R9RA 4LL5A 1WCCA 1GIJA 3PE1A 5DG5A 4BHNA 2CDZA 4KKEA 5DFPA 3WF9A 1MQBA 5CNNA 4E5BA 4UWBA 3QRTA 3V01A 4P2KA 4LGDA 3FMMA 3HV5A 4LYNA 3SG9A 3BWFA 3OTVA 4IX5A 4QMLA 2YM6A 2XK6A 3D15A 2RFSA 3WIKA 2J0LA 5E7RA 4E93A 4C3RA 3PXFA 3U6JA 1H1PA 2ZV7A 5J7HA 1VYWA 4USFA 1CM8A 3B8RA 4YGAA 2ZMDA 2WKMA 3AC1A 3QYWA 2JBPA 4A9UA 2Y6OA 2YIWA 4L7FA 1MRUA 3LJ2A 5D11A 3R2BA 2Y8OA 3LMIA 3FY0A 3NNXA 4YC3A 3DZOA 4D2RA 5HBEA 3S1HA 3POOA 2V62A 3QA8A 1PKDA 5J9YA 4EQMA 1Q62A 3FLNC 4HZSA 4A4XA 1H0VA 3ZHPC 4C36A 4R1YA 3DLZA 3MH1A 4RA4A 5HU3A 5GNKA 2UZTA 4H36A 4JAIA 4KIOA 2IVTA 4A4OA 5AV4A 1HOWA 3EQCA 4K11A 3OOMA 1YDRE 4BKYA 3H0ZA 5EFQA 3W1FA 3H3CA 2OJJA 4EK5A 4PMPA 3IGGA 4PPBA 4FMQA 4IVCA 3WI6A 2CKQA 2O5KA 3SXSA 4DH8A 4MVFA 3CTJA 4LMNA 5TF9A 3AC2A 3RGFA 5AEPA 4AN3A 4YJQA 5J7BA 3R9DA 2W1DA 3EH9A 3EN6A 4WO5A 3G9LX 5H8EA 4BCGA 5J79A 3DBFA 5TE0A 4X3FB 2I7QA 3VUGA 3OWLA 5CY3A 4ERKA 2B1PA 3VNTA 3KULA 5EM8A 4DGOA 3ATTA 3RHXA 3LFDA 5IQBA 3PTGA 3RAHA 2OF2A 5KNJA 1PMNA 5F20A 3LFNA 4JOAA 3O50A 3IOKA 4EH5A 5EI6A 4OTRA 4CQEA 1E1XA 3VBVA 2ZV8A 2CGWA 4NYEA 4OW8A 5ACKA 5EYDA 3PUPA 3EKNA 4DTKA 3P9JA 3W8QA 5CAPA 3V5JA 3SDJA 2PVMA 2R3OA 1OIRA 3T9IA 1PKGA 1PYXA 3V5LA 3R0TA 2UW4A 3F5PA 4M8TA 4C4IA 1G8SA 2PZRA 3KC3A 3R1NA 2ZJWA 3D5XA 5CSHA 4XLVA 3UMXA 3R7UA 3KVWA 2UW9A 4LOPA 3DBQA 5F4NA 5CTPA 5HVYA 4GS6A 5A4LA 4PL5A 3QUEA 4DCAA 3A60A 2X2KA 3KU2A 1H26A 2HENA 5DR6A 4ACCA 5CVHA 4BBMA 1IA9A 3E64A 3JUHA 5L2SA 3DA6A 4DGLC 5B0XA 1URCA 4FV2A 5CVFA 3PXZA 3G51A 1FBNA 4U97A 4UMRA 5K3YA 3OTUA 1WBNA 3IW5A 3RNYA 4BDHA 3OHTA 4I1ZA 3KEXA 4BCPA 2VTSA 5IH6A 2C5YA 3OT8A 4FEWA 4CCBA 2PULA 2X2LA 4X2NA 2A2AA 3TCPA 3UGCA 4J98A 3LFEA 1UKIA 2ZOQA 4J53A 5HEZA 4D55A 4DEHA 2XS0A 4L52A 3V8WA 4ZTLA 1UKHA 4YMJA 4DG3E 3EN7A 3VJOA 1LP4A 2VNYA 4TWNA 4JR3A 3A4PA 4EONA 4F7NA 4IVBA 2GCDA 1GNGA 4F6SA 5FGKA 4DGGA 4FTQA 3AMAA 2CKPA 3GOKA 2UZNA 4KD1A 5F9EA 5DR2A 3OBGA 3UOKA 4R8QA 5GINE 3ROYA 4XP3A 3RPYA 2VX0A 5ETIA 3QQJA 4GK4A 3EKKA 3BEAA 4AA5A 2WPAA 4UWYA 3VIDA 3QLFA 4BDKA 4GKHA 3EYHA 4D0WA 2P55A 4GKIA 3COMA 2OBJA 4E4NA 4IJPA 2PVYA 3ZO3A 3VS3A 4K77A 4DYMA 5DOSA 3QKLA 1MRYA 3BQCA 2VTHA 4FT3A 5ITAA 4A07A 2F4JA 2HZIA 4QPSA 5CXZA 2RFEA 4Q5HA 2BZKB 2QU5A 5EW3A 4PL3A 3NW6A 3QQUA 5ANOA 4XUFA 3I0OA 5IQFA 3UVQA 5JT2A 5L6OA 4OLIA 3NYVA 4HYUA 4GIHA 4H1MA 5LARA 3T8OA 3UTOA 1KSWA 1REJA 3CQEA 4JNWA 4C4HA 1ZWSA 4JG7A 4DG2E 5E9EA 3ZM9A 3DGKA 2A19B 1KV1A 1YXVA 1MRVA 3QZHA 2C6TA 4FSYA 3G33A 4QD6A 4L43A 4G6LA 2FUMA 1R3CA 1TQIA 3NZ0A 4J1RA 4RLLA 4X2KA 5AV0A 5LVLA 4YPDA 2YACA 5DIAA 4GSBA 3LM0A 5JSMA 5KCVA 5AIRA 4TYHB 4XRLA 2CN5A 1Z9XA 4JX7A 4GV1A 4U7ZA 3L9NA 2XP2A 4WRGA 3AC5A 3Q5IA 4FL3A 4NSTA 2XK9A 4TN6A 4BCQA 5A14A 2YCSA 1OL6A 4IAZA 4AE6A 5GIOE 2C0TA 4L00A 1OMWA 1UU8A 2NP8A 1SVHA 4ZSEA 3NAXA 3O2MA 1DAWA 1LEZA 3BU3A 2BIYA 3VHKA 5LMAA 4RPVA 2OW3A 4F9CA 4F9YA 5JEBA 4OAUC 1B38A 3R01A 3HMMA 4ZLYA 5CEIA 4L01A 1WVWA 1T46A 2QONA 3TNHA 3VUMA 4RMZA 4BDFA 5HI2A 4FKQA 4A9TA 3MY1A 4C62A 4R3RA 4S31A 2DS1A 5BVKA 4M69B 2RFDA 3BWJA 2W4OA 3A61A 4UMUA 5JKGA 3L1SA 1YHWA 4QMUA 3BE2A 4NTTA 3MFUA 2YZAA 1M14A 3HV7A 2VTTA 4TNBA 3TUBA 3MFTA 3V51A 4TWOA 5CS6A 5AAGA 4MXXA 1O6LA 4MHAA 2OIQA 4RIYA 4BDEA 3FHIA 5I9ZA 2E9NA 3DTWA 4IAAA 5I5ZA 1JAMA 1YOMA 2C5XA 3AQVA 4QTAA 3IW4A 3NUSA 3WYXA 5IA1A 2WTWA 5F94A 1KV2A 3NDMA 3OROA 2IN6A 1JVPP 4MNEB 5G1XA 1SVGA 3VBTA 3CIKA 4EOQA 3GQLA 2VZ6A 4G6NA 2BAKA 4X21A 4CGAA 3ZSIA 4NFNA 3QD3A 5AAFA 5HLWA 1JBPE 4ALVA 4ANOA 4EKKA 3N51A 3PA3A 3DAEA 4MCVA 1RE8A 4YUQA 3QRKA 4XJ0A 3TL8A 3QWKA 3DB8A 3ZUVA 4M12A 4FIHA 4I4FA 4M14A 2C5OA 3FLWA 1FVVA 5D9HA 2IW9A 3HLLA 4EK8A 4WOVA 5CU0A 4AX8A 2HZ4A 1OM1A 4DFLA 4BIBA 2VO7A 3PJ1A 4J97A 3RPVA 2Q0NA 3BU5A 3UO4A 4B4LA 3P5KA 4IWOA 3ENMA 3D2IA 4BKZA 3O7LB 3HX4A 4C4GA 4D2TA 3MESA 3ALNA 4R78A 4FTCA 3UIUA 5LMBA 4LRMA 2F49A 1VR2A 2XNBA 4J52A 3K5VA 3NUNA 5CNOA 3EQGA 1ZMVA 4FG7A 4C59A 4E6AA 3PIXA 4TYGA 3ZO1A 4M0ZA 3Q4CA 3ZFYA 2XJ1A 2WNTA 4NKAA 1IAHA 1IA8A 4W8EA 4CZYB 3ETAA 4UN0C 1AQ1A 4QP7A 2JDVA 3U4UA 1YVJA 3BQRA 2BMCA 3P7CA 1Q99A 3NGAA 4W8DA 3UQGA 1SM2A 4RC3A 4F4PA 4YURA 3HV6A 1QL6A 5CX9A 3EOCA 1JSVA 1XBCA 2BFYA 4EZ7A 4IQ6A 4ZZOA 3R04A 4I6BA 3DQWA 3WF6A 3UQFA 3KRWA 4JDHA 4APPA 3R8PA 3DV3A 3ZUUA 1KOAA 3MY5A 4FKIA 4D0XA 3UE4A 4BZNA 2WEVA 3I4BA 3G6GA 3OUNB 1KE6A 5LVOA 1CMKE 2UVXA 2CMWA 2ESMA 2NRUA 2VO3A 4NIFA 2YWPA 4CQGA 4U0IA 5IMEA 4ZJJA 2XUUA 3OW3A 4GFOA 4C61A 4MAOA 5E8SA 5IDNA 1OI9A 5EDPA 3FMLA 3N4VA 3KRLA 2REIA 3TZ9A 1PMUA 3HRBA 4AUAA 2Z60A 3D7TA 4RJ4A 3WF5A 3ZYAA 4ALUA 3EFWA 4R7IA 5ETAA 4ITIA 4IC8A 3W2PA 1ZOEA 1H1RA 4AF3A 4L9IA 4FTAA 4N4SA 4PMSA 4AZWA 2P0CA 4C7TA 2CKEA 3FKLA 2BRMA 2FO0A 3ZLSA 1UVRA 3A8XA 5CEKA 2EXCX 3ERKA 2QHMA 1W83A 2JIVA 4QTBA 3Q9WA 4PNIA 3OMVA 2X8DA 3QKKA 4D4RA 4F9AA 3QAME 4XOZA 2XZSA 3KGAA 2ITXA 4YJPA 4O81A 2QG5A 2YITA 5EM6A 1V1KA 2IZTA 3BLHA 4AE9A 2YA9A 4IM2A 3MI9A 4AFJA 4Y95A 4FA2A 2XIXA 3E7OA 4FIIA 4UZDA 4C57A 4EWHA 2BIKB 1ZY5A 2Z7RA 5IF1A 1JOWB 2C47A 3C50A 1YWVA 2C5VA 2ITVA 5DLSA 4AA4A 2WGJA 5FDXA 4GT3A 4IAYA 3QZIA 5EYKA 3MS9A 5J5TA 1IG1A 3BCEA 3GB2A 5HVJA 3W2SA 5HTCA 5BVDA 4DC2A 4ZEGA 4EOIA 4PNKA 2WOTA 2W5AA 2YISA 3DDPA 3LOKA 1J7UA 5IH4A 1GJOA 2JKOA 1NA7A 2JD5A 2IZRA 1WAKA 3H9OA 3K3IA 4IJ9A 5KZ0A 5K0XA 4ZTRA 4IW0A 3F3UA 3FQSA 3H10A 5T6KA 3D94A 1JKKA 3ZC5A 3MJ1A 5DT0A 2F2CB 3OEFX 4OBQA 3VC4A 5AUUA 4IZAA 5A4CA 4PDYA 4J8MA 1FGKA 5D1JA 5AUVA 2Z7SA 5FBOA 4XRJA 3CJGA 4O0RA 4ANMA 3Q6UA 4RX7A 5AR3A 3GP0A 2QOBA 3VBYA 1T45A 4OR5A 5C4LA 4IB5A 2YEXA 4XX9A 4M67A 4BCOA 3PJ3A 4FKGA 3VUIA 3UOLA 1R78A 3NYXA 3KULB 3TKUA 3UZTA 3A7IA 4NZWB 4FKUA 5EOBA 3GFWA 4ACGA 4PUZA 4FX3A 2EWAA 2RG6A 4RJ3A 2WEIA 3NNVA 4DEAA 4PV0A 4DH5A 5FXRA 4R7HA 4RRVA 4YJOA 2VV9A 3NUPA 2PVKA 3QTZA 4TTHB 2J2IB 1XBBA 4QMWA 5DRBA 4O7LA 2EUFB 4EOPA 3C7QA 3FXWA 1ERKA 2Z2WA 3FLZA 4QQJA 3QTIA 3I0QA 4O38A 5AUYA 3ENHA 3DB6A 1OBDA 3GU6A 4BGQA 4RFZA 4YZDA 4NJDA 4NWMA 4JG8A 4ONAA 4O21A 3H4JA 2YJSA 4QRCA 4GYGA 4GJ3A 1SVEA 4JQ8A 4ZJVA 4O0WA 5L6WL 1XH6A 4UY9A 1DS5A 3ZO2A 4PMTA 4Q9SA 5HE1A 4UMPA 3LXNA 4GVAA 4XYFA 2Q83A 2JEDA 2IPXA 4TWCA 2GNHA 3FE3A 4RQKA 4JXFA 5BX0A 3QTXA 2I0YA 2PTKA 5I3OA 5CALA 2OLCA 1H28A 2W1HA 4V04A 4AZSA 3AC3A 4XHKB 4D9UA 4MBJA 4O7NA 3CP9A 4FSUA 4I6QA 2VTMA 4K33A 3PVUA 1Y6AA 4FSQA 4YPSA 2YM4A 1ZXEA 2BRNA 3OC1A 2FVDA 2JFMA 3ODYX 4GUBA 4BIEA 2WMQA 2WQNA 3C51A 3M1SA 3OY1A 3R02A 4JBPA 3PVWA 2IVVA 1L8TA 4BZOA 2VWUA 4FEXA 2FSMX 2J0KA 5E90A 1YDSE 4LMUA 3HMNA 2C0IA 5KMMA 4LUEA 4IMYA 4CLIA 4DE4A 2PVFA 1OB3A 3ULZA 2CJMA 3UMWA 3QD4A 4G5PA 1XR1A 2XYUA 4HPUE 4JS8A 2W99B 4ZTHA 5KBQA 5KMNA 1KE8A 4TWPA 4MXAA 3VS0A 5E1EA 3ZLXA 3WARA 4P5QA 5L8KA 1UV5A 5FXSA 5CLPA 4ZTMA 3COKA 3MPMA 2GNLA 1BL6A 2JITA 1NT2A 3PDTA 4YBJA 3HECA 3MVLA 3L8PA 4HZRA 5A3XA 1H1WA 3E87A 5I9YA 3ZBXA 3RP9A 3ROCA 4E26A 3F2RA 3JR1A 3QKMA 5AUWA 5HCZA 3OCGA 3DT1A 4LV5A 2W9FB 4RVTA 3ZTXA 3PA5A 5EKOA 1G8AA 2PSQA 4QQCA 4ORKA 5HBHA 4S30A 1GY3A 4LG4A 2ZYBA 3F5UA 3RAIA 3LLTA 4HGEA 4FKVA 2I0VA 4AW2A 3FYJX 4FODA 4CRLA 4C33A 4ZLOA 4L6QA 2VTRA 2WTIA 5M08A 2CN8A 1SZMA 2P4IA 5DT4A 1ZOGA 3A7JA 3OVVA 1U54A 5BYLA 2JLDA 3W2OA 4GFGA 1K2PA 2VUWA 3OCBA 4HCVA 4BFMA 3QL8A 4D58A 4WA9A 3EZVA 4XP2A 4AOJA 4EBWA 5C8KA 4ZMEA 3CJFA 2J0JA 4KB8A 3KF4A 5DE2A 3TZ7A 4CFUA 4RIWA 4Q2AA 4RVLA 3UQCA 4I93A 4QNAA 3C1XA 4RFYA 4BI0A 3ANRA 2JDSA 2VGPA 4BTJA 3MVMA 5DGZA 2C30A 5AADA 1W7HA 3N4UA 4YSJA 2CGXA 2GNGA 2QO2A 3ZDIA 5HORA 5E8WA 3GEQA 2WIPA 5JRSA 4ANNA 4DFUA 2OG8A 2YCFA 4Q5EA 4LFIA 2G2IA 3DZQA 3JPVA 3M11A 3CLYA 5DEWA 4EK3A 3W16A 2X7GA 2JDOA 4FV5A 4IZ7A 4WKQA 5CEQA 2X7FA 1M7QA 5KZIA 5I9WA 1P5EA 3KN6A 3R63A 3QHRA 3FJQE 5BMMA 4C8BA 4FKSA 1HCLA 2BZHB 1APME 3BV3A 2X81A 3LQ8A 4HGLA 5LXMA 4I6HA 4J8NA 3QGWA 4FV3A 4YU2A 5CVGA 2RG5A 4NM0A 3ZLWA 3P1AA 4O7SA 2OFVA 3MV5A 3DTCA 4FK6A 3PIZA 2UZEA 3OS3A 3OT3A 3ZZEA 4CV8A 4H3QA 3FSKA 5E91A 1RQQA 3QCSA 4H3PA 5JZNA 3BYMA 4F7SA 2J7TA 3SVVA 2XJ0A 4C34A 2R5TA 3P4KA 3SRVA 3EQHA 3F61A 4RIYB 1PRYA 2OH4A 3DY7A 3PE2A 2VTAA 4KKGA 3P7BA 4RVMA 4FTJA 5FM3A 5HE2A 4JL9A 4EH4A 2OU7A 5HE0A 3Q04A 3SX9A 4Y5HA 2ZM1A 4HVHA 4OTQA 4A9RA 4HVDA 4BYJA 4NUSA 1U5QA 3CXWA 3HMOA 3CKWA 4IB1A 4Z3VA 2HCKA 4FT0A 3TDVA 1UU3A 3FXXA 4FV6A 2Y4IC 1H00A 3TNPC 2BTSA 3V3VA 2Z7LA 4HVIA 5B2LA 3IOPA 3TZMA 5CF4A 2CNUA 5HTIA 4QTDA 2A1AB 2OH0E 3OD6X 4IVDA 5C01A 1F5QA 1AD5A 3I79A 1P14A 3CPBA 3PWYA 4U41A 5CENA 4JDJA 1E9HA 5FP6A 4CMUA 3FZPA 5DH3A 4O7ZA 2C4GA 3FY2A 5AA9A 2QLUA 2E2BA 2CLXA 4YNEA 4DTAA 5HVKA 3R7GA 5HICA 5IEYA 3G90X 3IW6A 3O8UA 3E88A 2VO0A 4IB0A 2C3KA 4IFCA 4LGHA 1ZYDA 3RAWA 5FTQA 1A06A 2PE0A 4BYIA 4L45A 4IX3A 1Y91A 5I9UA 3HAVA 5FQDC 1OPLA 5IMXA 3Q6WA 1NVSA 5M57A 2X4FA 1VYZA 2QD9A 3QX4A 3S95A 3SD0A 1OIYA 3MY0A 2DYLA 2A27A 5CT7A 3VF8A 4RJ7A 2JBOA 3KFAA 5L8JA 3F3ZA 3AT3A 2PK9A 4ANSA 3UIBA 2V0DA 2O3PA 5EHLA 4CG8A 4BDIA 4PX6A 4Y85A 5HZNA 3R7IA 2OSCA 3QC4A 4NIFB 3R83A 5AP1A 2UW5A 5BYZA 3AXWA 1Q8ZA 3BU6A 4QP8A 4EQUA 4D4SA 5J9ZA 4KNBA 3B2WA 3EN9A 2C0OA 2Y6MA 3FMHA 3I7BA 4KBAA 3ZMMA 4EK4A 3MIYA 1I44A 4N70A 4EWQA 1OIUA 3D7TB 4GH2A 4GT4A 4O7TA 5K4JA 3R1YA 4GCJA 4L3LA 4MXCA 3PSDA 5A4TA 4BKJA 4EOSA 3F7WA 5IA0A 2Z7QA 4CFXA 3IK3A 2VNWA 1ZARA 1K3AA 2Y7JA 4MWIA 3R9OA 3VS7A 4AN2A 1H1SA 2ZV9A 2BRHA 2EB3A 3KXGA 2CNVA 3BYSA 3MFSA 4BL1A 4YZNA 2B9HA 4OBPA 4N57A 3NCZA 5HLPA 4EHZA 1EH4A 4LUDA 2P2IA 1J7IA 4FTLA 5CXHA 3AD6A 1OGUA 5FRIA 1SNUA 4DA5A 1R1WA 5HNIX 2H6DA 3RZBA 3FI2A 3R8VA 4JR7A 2GS6A 3IDBA 3KRXA 3OW4A 4O22A 4ZY6A 4NEUA 4IZYA 5B7VA 3I60A 4ZJIA 2O64A 2QOFA 4GG5A 3JY0A 3THBA 3IO7A 4CFNA 3LFAA 2B9IA 3ULIA 3ZFXA 4BCHA 4CT2A 2JKMA 3ITZA 4RVKA 4K8AA 4ASEA 3R00A 4FOBA 5A54A 3BRBA 3MDYA 2DUVA 5C26A 5DR9A 1GAGA 3E3BX 3LCSA 2G15A 4O0VA 4QMZA 4IX4A 3ZEWA 2OICA 3P08A 4ZTNA 1Q41A 2BFXA 4FV1A 4G34A 1STCE 1W0XC 5EM5A 3ZEPA 4ZY4A 5F95A 4L67A 4ZOGA 2X8EA 5IH5A 5C03A 1GZKA 2G1TA 4D2WA 4HVGA 3U8WA 3VBQA 2JC6A 2YCQA 3PA4A 4K2RA 4FT5A 4OT6A 5EI2A 2X0GA 4U5JA 5JMSA 2QOKA 2GSFA 3TKHA 4ACDA 5J5SA 3ORXA 2R3MA 2X9EA 3O23A 4XV2A 4UWCA 4FT7A 3KRJA 4WG3A 5EW9A 2W17A 5BPYA 2WOUA 4AP7A 5L3AA 1KE9A 3EYGA 4S34A 1BI8A 3BBWA 3MW1A 1YXTA 2WQMA 3D83A 4D2VA 5LJJA 5CZIA 5CSWA 3PXRA 4AS0A 3VRYA 3LQ3A 5ANDA 4AN9A 2UZDA 5A46A 2GFSA 3O0GA 3QALE 4PF4A 5E92A 5FTOA 5KE0A 1OL7A 3BBTB 2OZAA 3OEZA 3P0MA 3SXRA 5BVOA 3F3TA 5HG7A 3EN4A 4RIXB 1M2PA 3FSFA 3C5UA 4AWIA 2OJFE 4W9WA 3V5QA 3PJ2A 4W9XA 3MPAA 3QZFA 3BGQA 2BALA 4O0YA 5BYYA 2XH5A 3VAPA 2YLFA 5I3RA 1OPKA 3U6HA 5TO8A 5CF6A 3QQHA 3HUBA 3FMDA 3R9HA 3W10A 4YHFA 5AR4A 1YI4A 4FG8A 1ZRZA 4L46A 5CU2A 5TT7A 2YWVA 3OOGA 4CTCA 4HYSA 4QP2A 2XNMA 3DJ6A 3LCDA 4G3GA 2UW8A 2YABA 4HGTA 1IRKA 5D10A 4I92A 4ASXA 2R0UA 1Q24A 3ZRMA 2PYWA 2UV2A 3PVGA 1PMEA 4MXYA 1F3MC 4G5JA 3A7HA 1H27A 1GZNA 5E8TA 4FNYA 4BIDA 4EH7A 3FLQA 5AP2A 4U81A 2RKUA 4KS7A 3RNIA 3PIYA 2ZM3A 3SOCA 3ODZX 1Q97A 1XHAA 3SAYA 4FTKA 3I7CA 4DT9A 3AC8A 4FSMA 2GS2A 2LGCA 3KCFA 3PXKA 3F6XA 5TR6A 5DBXA 5M4FA 5HBJA 2BTRA 3FC1X 4AW1A 3KXHA 5A9UA 2PMLX 2UZUE 5AA8A 3BGPA 3RK5A 3Q53A 1PXPA 4YO6A 3VBWA 3GC7A 3PLSA 3C4ZA 3EL8A 3GT8A 4GVJA 3PWDA 4YLKA 3VUDA 3KMMA 3DKCA 3VUHA 5E8XA 2G01A 3SOAA 1S9JA 1YXSA 2HYYA 2JKKA 3FPQA 3IONA 3GQIA 4BI2A 2GS7A 3LJ0A 5GZAA 3DXPA 4DF3A 5HLNA 2DWBA 3PYYA 5I9VA 4O84A 3KN5A 4FYOA 5DMZA 5FEQA 2XK4A 4BCNA 1G3NA 4EH6A 1OUKA 4OBOA 3DKGA 4EOMA 5BMSA 4ID7A 4MQ2A 5AV1A 2HK5A 3ELJA 2ZDTA 2OF4A 4C3FA 3DBEA 4NJ3A 2HWOA 3LLAA 5HU9A 2PWLA 3KA0A 4O7YA 1LR4A 2ZB1A 4YJRA 4U79A 1OKWA 3AOXA 4KINA 1PYEA 4FK3A 3RTPA 5ICPA 4D4VA 3U9NA 4CLJA 2WAJA 3W55A 4JQ7A 5L2WA 1BKXA 2CKOA 3UC3A 3DCVA 4IAIA 3FZSA 5L4QA 2VWVA 3W8LA 4FKPA 4S33A 4E73A 1U54B 1WBSA 5AR7A 3ZXTA 4D4YA 4YTCA 4PRJA 4XS2A 4F08A 2GTNA 3TEIA 3F88A 3CQUA 4FKLA 1XQZA 3VQHA 2HAKA 4M68A 4AG8A 4E1ZA 1ND4A 4FUXA 2V7AA 4WHZA 4ZTQA 3OUKA 4RIWB 3TNWA 4X2GA 5EH0A 3UOHA 3RCJA 4EJNA 4FE2A 4TY1A 2UZWE 3M42A 4D1SA 3Q4TA 1ZOHA 4JT3A 5JGBA 1PXIA 3KXZA 4AOIA 4JRVA 4E4XA 4EC8A 4F70A 3MB7A 4BWXA 3FDNA 2IVSA 3RPRA 3L9MA 2R3FA 3Q52A 2IZSA 4F1OA 2R3LA 2WTJA 4ZSGA 5FEEA 5K4IA 1J3HA 3PLAE 5EG3A 2PZIA 2W1FA 1XJDA 4E4MA 2XKEA 2ITNA 5T3QA 3FKNA 2CNQA 4QPAA 4YJNA 2VTLA 3QTQA 4TYEA 5AWMA 5HO6A 3P23A 4DFNA 3H30A 4AZFA 4DBXA 3Q2MA 2ITWA 4MF1A 3VS1A 3KF7A 3N9XA 4IB3A 2HELA 4L42A 4OT5A 5K5NA 4FEVA 2YJRA 3ZC6A 3UBDA 2XK8A 4XLIA 3K5UA 2OFUA 2VWIA 3LQ5A 4FNZA 2J6MA 3NW5A 3QTSA 2ONLA 2YFXA 3ACJA 4LM5A 5FD2A 4BCMA 2C1AA 3EQPA 5CSXA 2XNNA 5AR8A 4AW5A 2XIYA 3KKVA 1XH7A 3E5AA 3EQRA 3IW7A 3NNWA 4ACMA 4HPTE 4O0TA 3RVGA 3SC1A 1Q3WA 4MQ1A 2OWBA 3SRVB 2W4JA 4N0SA 3QWJA 2HZNA 5IUHA 2PE2A 2ERZE 1RDQE 4PDSA 4HCUA 4RQVA 3KREA 4USDA 1VJYA 4AFEA 4FVPA 4LGGA 2OJIA 1WBOA 4O2PA 4NU1A 2O65A 3MTFA 4R5SA 3OXTA 3D4QA 2R3GA 4RJ6A 2NPQA 3F9NA 2I0EA 2FB8A 2ITYA 4ANBA 3O17A 4EEVA 2VWWA 4BBEA 1IR3A 5AUZA 5AR5A 1SNXA 4DCEA 2ZAZA 5ETFA 3ZH8A 2KTYA 4FVQA 4PPCA 4NT4A 3GCPA 4RX9A 4F9BA 5LVNA 1FINA 3ATSA 2IW6A 3CKXA 5IQGA 1WBVA 2V5QA 4GMYA 3K2LA 4I5MA 4DHFA 4WUNA 3JYAA 5C8NA 5B2MA 2ITZA 4EQCA 3GBZA 3PY3A 3HRCA 4G6OA 2B54A 2NNWB 2YZLA 3Q5ZA 1Y6BA 3EQFA 4J99A 2BKZA 2R3JA 4MD7E 3GGFA 4ENYA 2BVAA 4L7SA 3TXOA 4UV0A 3M2WA 3QTWA 1H08A 1TQMA 5D7VA 5FUTA 4NCTA 2YDIA 2X8IA 3S2PA 4CTBA 3RM6A 4RFMA 3BEGA 3R8ZA 1XH9A 5H9BA 3WZKA 3L9PA 4QP6A 4FL2A 5ANJA 4AOTA 4DGNA 3C4FA 3MA3A 5FTGA 3ORNA 4EH9A 3BHHA 3BKBA 3C4WA 3R21A 4DINA 1YXUA 4XEYA 4HCTA 3LCTA 3KXNA 3SA0A 3QRJA 5CAVA 4HJOA 3FWQA 4TKSA 4ZLZA 3WZEA 2UW7A 3AD4A 3QF9A 4IDTA 4AXAA 3GXLA 4U45A 3RK9A 3D9VA 3FI4A 3VN9A 4YBKA 2F7XE 4YZ9A 4RG0A 4JDIA 4DTBA 5LWMA 4FIGA 1ZLTA 5M06A 5IEXA 3BHVA 3CC6A 3EN5A 4XP0A 2WD1A 2XKDA 4KRCA 5CAQA 5LQFA 1Q5KA 5HD7A 5EQPA 3L8SA 1Z5MA 2RSVA 1V0PA 4MTAA 4FVRA 1U5RA 3RMFA 2V7OA 3WE4A 3HDNA 5JK3A 3PVBA 4IVAA 4WD5A 1KUTA 2PMNX 5BUJA 2YIQA 2GDOA 4QMYA 3SHEA 3DKOA 1BLXA 1YWNA 3CPCA 4FSRA 4GRBA 3GOPA 3TACA 1GOLA 3FV8A 3FXZA 5IUGA 3RJCA 4RX5A 1M7NA 4IFGA 3T9TA 3BGZA 4AAAA 3NCGA 4L53A 4BWPA 2X7OA 1VZOA 3EFLA 1OZ1A 4ERWA 2R7IA 2YIRA 2IJMA 4ENXA 3UZPA 2J5FA 4DEEA 3KRRA 3E92A 4FIFA 1UU7A 4O6EA 3O7LD 5EYCA 3S0OA 4CV9A 5DN3A 4EJ7A 4LOQA 5DRDA 1A9UA 2JDTA 2ZM4A 3QTRA 4L68A 5HCXA 4IZ5A 3UYTA 2WMSA 1WVYA 4N6YA 4DFBA 1YI6A 2HWPA 5HG8A 2WTVA 5CF8A 1PXKA 4C2VA 4V0GA 4E5WA 2GFCA 3I5NA 1P4FA 3DKFA 2R3KA 4I5CA 5BVNA 3UJGA 2GMXA 3WYYA 2PHKA 3CGFA 4AGCA 4BRXA 2C3JA 5T68A 2Y0AA 4CKIA 3UP7A 1CTPE 1KE7A 2O63A 4K6ZA 1OPJA 4E8AA 1J91A 3RCDA 5DPVA 4TPTA 1BMKA 4KA3A 3PP0A 3MH0A 4MBIA 4U3ZA 2XNEA 3O71A 1JWHA 3DK6A 3LFSA 2XCHA 3RHKA 2XRWA 3U4WA 3G15A 1Q3DA 2R9SA 3DBDA 3ZCLA 4O6LA 1KE5A 2OO8X 2YM7A 5DI1A 3LFBA 3MIAA 4A06A 4XBRA 5LCKA 4A9YA 4ANQA 1WBTA 1A48A 1MUOA 2CHLA 4G17A 4O27B 4WNKA 4CFVA 2WQBA 4XV3A 3FQHA 1H01A 3ACKA 4WNOA 3UVRA 3QQLA 4EYJA 2XIRA 3DJ5A 3MGYA 5CU3A 3D2KA 4MF0A 3GC8A 2ERKA 4MNFA 2I0HA 3MSSA 2YDJA 5KMOA 1GIIA 2WXVA 5E1SA 3V6RA 4AGDA 2XBAA 3LAUA 2OGVA 1V0OA 2J51A 3GCVA 3LXKA 4BDBA 2XIKA 4EOKA 4EHEA 2X39A 5M56A 4WRSA 2ZVAA 4WG4A 4R5YA 4ANLA 1O9UA 2WQOA 2CCHA 2UZBA 2VWZA 1BUHA 2OXXA 2OZAB 3LVPA 3P7AA 3DDQA 4JJRA 2WZJA 2VX3A 1ZYCA 4V01A 3SV0A 2QKRA 2C6EA 3VQUA 3ZZWA 4DBNA 4FI1A 5IUIA 4F64A 5J8IA 4UEUA 3JY9A 3E8EA 3ANQA 4G3DA 3QD0A 5GZ9A 2QOHA 2HZ0A 2WMUA 2JIUA 3QRIA 3C4EA 4NKSA 3QFVA 2EXMA 3JVRA 3AMYA 1CKPA 3H9RA 4C4FA 3VRZA 5FLFA 1Y8YA 4FNWA 1XWSA 1ZYLA 3GC9A 4WT6A 4RZVA 1R0EA 3HKOA 2F7EE 3NMUF 2O0UA 3LPBA 2B0QA 2HXQA 4MBLA 2YIYA 4FSNA 3FUPA 4BDDA 4PQNA 2XJ2A 3TT0A 5IPJA 5AP5A 2PPQA 3HGKA 3VVHA 2VWBA 3BZ3A 3L8VA 3D7ZA 3AD5A 4IDVA 4QYYA 4WNMA 5BVWA 1J1BA 2JAMA 3MYGA 5CF5A 4NM3A 5AP6A 1Q8YA 3H9FA 2O8YA 3PG3A 2YLEA 1H4LA 2FGIA 4D1XA 4JIKA 2OI4X 2YAAA 3W2CA 4EOLA 2QR8A 2WU6A 2W1IA 4MXZA 4NW5A 2FH9A 1GZOA 3D0EA 3BYVA 3HUCA 4RWLA 3RWPA 4CKJA 3PSCA 5LVPA 2OJGA 2WU7A 4R6VA 3TI1A 4YR8A 3EQDA 5IISA 4R77A 3QQKA 3HMIA 3Q9YA 4UBAA 3ET7A 5F1ZA 4JBOA 3SW7A 2VRXA 1H24A 4RWJA 4X3JA 5M51A 1FVTA 4U80A 3R9NA 4FEUA 2B52A 2EXEA 3O96A 3PY0A 2PUUA 4XV1A 4WSYA 5CEMA 4G16A 4JDKA 3B2TA 3KXMA 4YC6A 5J1WA 2QODA 4I3ZA 4AGUA 4BTMA 2BDJA 3OZ6A 3CSVA 3UNJA 5ANGA 4E6DA 4ZS4A 4QT1A 2HW7A 3IDPA 4DAWA 4KKHA 3QUPA 1XH8A 3V5WA 4BCIA 4IC7A 1PJKA 4G3EA 5IZFA 2PU8A 3UNZA 2I6LA 2XBJA 3ORMA 2VTJA 4OTIA 1W8CA 2X1NA 4B9DA 5D7AA 4K0YA 3OY3A 4FV0A 4BWKA 3LMHA 3LFCA 2ACXA 4QOXA 4XNEA 4AW0A 5GZ8A 5LOHA 1JKTA 4EZ5A 1JLUE 4USEA 1O6KA 3FLYA 5LVMA 3TIYA 1NXKA 4LRKA 3A7GA 2LAVA 5J9LA 4G1WA 2RFNA 4XCUA 3CTQA 3EMGA 1YHVA 4NL0A 4C4JA 3CY2A 3AGLA 3TNQB 1TVOA 3AMBA 4PTCA 2ZDUA 3GU8A 4PDPA 4FIEA 3TKIA 4FKRA 3NPCA 4O1PA 4MXOA 5JQ8A 4V05A 3ZO4A 4O7VA 1FGIA 5HE3A 3C0GA 4WG5A 2NRYA 5FM2A 5IKWA 4CD0A 2QO7A 4UYAA 2C6DA 3RM7A 2W06A 3SGCA 3ALOA 1WMKA 4CMOA 2CSNA 3VF9A 2HXLA 3W2RA 1OL1A 4BTFA 4GT5A 5KKRB 2BCJA 3MTLA 4BDCA 2R3HA 2V55A 4I20A 1BX6A 1AGWA 2QG7A 4DH3A 4YC8A 2Y4IB 2WFYA 2PZPA 3LCKA 4L3PA 4M15A 3HZTA 2ETMA 2BILB 2WMWA 4UZHA 4X6QC 1PXMA 2OXYA 3C5IA 1JNKA 2XNPA 5KKRC 3IECA 1Z57A 4M66A 1ZZLA 5FBNC 4FTNA 4GIIA 2OJ9A 4TRLA 2ETKA 3NNUA 1RJBA 4L8MA 2FSLX 5IU2A 2X6EA 5AP4A 3G2FA 4CFFA 5CQUA 4DH7A 5DWRA 5L2IA 5L8LA 4QYEA 2G9XA 4HYIA 4O91A 2R3QA 2QO9A 5AAEA 2VTNA 4DITA 4E6QA 3FQEA 4K18A 1PXNA 3U51A 5E4HA 2ZB0A 3VUTA 3NUYA 3ZS5A 4I22A 5AP3A 4X6RA 2PMIA 5KMJA 3TV4A 3TJDA 3OG7A 4Y72A 2GHMA 2RGPA 4FC0A 2AUHA 5BUIA 5HQ0A 4QP9A 4OAVB 2ONLC 4YJTA 3Q2JA 4E3CA 2Y9QA 2B4SB 4I5PA 3F3WA 4K1BA 1OKYA 1PY5A 2EVAA 2OKRA 3F5GA 3B8QA 1W84A 1XKKA 3A62A 3FMEA 3L9LA 4JAJA 5EOLA 2XM9A 3FC2A 2W05A 2WMTA 4FZFB 3ZM4A 1Q8WA 3PZEA 3R7YA 5K5XA 2WB8A 3LCOA 3KMUA 2OIDA 1ZMWA 5ACBC 2XMYA 5ANIA 3PPJA 4U9AA 3NX8A 2C6LA 4QMSA 3QU0A 3QC9A 3NYNA 1Y57A 3GFEA 4PDOA 4BC6A 5IQHA 2YHVA 4MD8E 3KVXA 4I0RA 2XB7A 3I81A 2V22A 5HCYA 3UP2A 4W4XA 2C3LA 3QBNA 4I21A 3VHEA 3WF8A 4W4WA 4BDGA 4IACA 4C3PA 5M4IA 3MVJA 3ZUTA 4Y5QA 2X6DA 4I24A 4EBVA 2X4ZA 3F69A 1JKLA 5GJGA 5I9XA 5AIKA 1PXLA 2FSOX 2PVNA 3E93A 3PZHA 4XG8A 5CI7A 4Z7HA 1BI7A 3CD8A 5DYJA 4GK2A 3HRFA 3ZDUA 2CLQA 3C4CA 4FKJA 3E3PA 5EI8A 4KIKA 1R39A 2W5BA 5K9IA 4NCTC 5JN2A 4YZCA 4ZSAA 5GHVA 3TG1A 3MA6A 5M53A 4DLJA 2W5HA 5DT3A 3L8XA 3C0HA 5KMLA 1M2RA 4D28A 3DNEA 4OTHA 5AM7A 4C37A 1OKVA 1B6CB 4DLIA 4O83A 4JG6A 2AYPA 4ZSLA 5KUPA 4PTEA 3CR0A 3HNGA 3R8LA 3I1AA 2YM8A 4XOYA 4DN5A 2QQ7A 5CANA 5AR2A 4DG0E 3OF0A 1HCKA 2I1MA 2H9VA 3UG1A 2W9ZB 2XM8A 4PY1A 4QQTA 3DJ7A 3P86A 4CG9A 4Y83A 4B6LA 5DNRA 2BAQA 3WF7A 3EQIA 2YAKA 2C3IB 3DBCA 4D9TA 3OXIA 1UNGA 3FMJA 3FZ1A 5CU4A 4J7BA 4A7CA 5KHWA 3DXQA 4QP4A 5G6VA 3UYSA 4O86A 3KY2A 1DM2A 4M84A 2W1GA 3S4QA 3T3VA 3U54A 4OTGA 3GCQA 3OBJA 3BPRA 2QOOA 4MEDA 5IA2A 2BKKA 2VX1A 4QMVA 2R7BA 2F2UA 4QO9A 3EZRA 3HL7A 5L2QA 2J0IA 2W1EA 2VGOA 4LOOA 4BCJA 2UUEA 1LPUA 2BDFA 3AC4A 5H8GA 2VWYA 4P7EA 1YKRA 2F57A 1L3RE 1VEBA 2ITTA 1O6YA 4RBLA 2ETRA 4FBXA 3FZOA 4RGJA 3R8MA 5KHXA 1NY3A 3ZRKA 4IM0A 3FL5A 4YSMA 5EM7A 5C9CA 2F9GA 3P79A 5TKDA 1JSTA 3Q32A 2BRBA 3QHWA 4GL9A 5AP7A 4X3FC 1ZAOA 3U87A 2QOCA 4M0YA 2QHNA 5FDPA 1YW2A 4I4EA 2XKCA 4V0GB 5EQEA 1SMHA 4H05A 2QOQA 4IHPA 3BV2A 4S2ZA 5AV3A 3BYOA 1XH5A 4KSQA 1GZ8A 3O8TA 2IZUA 3A2CA 4E20A 4ARKA 3G9NA 4TW9A 2J90A 3TUDA 2IWIA 3T3UA 2J50A 4ZZNA 3SW4A 4ZY5A 5KMIA 1ZYJA 3DNDA 5DHJA 4O7RA 3PFQA 5BUEA 5E8VA 5AMNA 3ZSHA 4DEDA 3DOGA 4JBVA 4CFWA
chains in the Genus database with same CATH superfamily
3V04A 3ZXZA 4TT7A 3MB6A 4F09A 3LFFA 1XO2B 2WMBA 4W4YA 4ZXTA 2ZV2A 3C13A 3C9WA 2J9MA 4ALWA 4FGBA 1FOTA 2C6MA 3NWWA 4MX9A 4C0TA 4E5AX 4ASDA 3NVMB 1FVRA 3AT2A 3D5VA 3E62A 5HG5A 1DAYA 2R3PA 3CTHA 4BGGA 3ZONA 4FKWA 4ZP5A 5C27A 3UZRA 4UALA 2QKWB 3TTIA 2H34A 4M97A 4EZ3A 3RALA 2YN8A 3C4XA 3E63A 3KL8A 3Q3BA 3PJ8A 2FYSA 4JLCA 4KRDA 4WUAA 1PXJA 5EK7A 5EYMA 3ZFMA 4F6WA 4ZS0A 1OBGA 4FV7A 4O0XA 3PPKA 4DFXE 4IE9A 4R1VA 4HVSA 4AT5A 3ORPA 4YTFA 5HHWA 2VAGA 4BB4A 2G2HA 2KULA 4D5KA 3UNKA 4LRJA 1P4OA 2UZLA 2I40A 4HNIA 4HOKA 4EOOA 4CNHA 4YZBA 5HOAA 2E9UA 4I6FA 1FQ1B 4CXAA 5L6PA 2ZMCA 2OZOA 1RW8A 3EHAA 3TJCA 3UIXA 2YM5A 2YCRA 4QYGA 5IQDA 4NTSA 1QMZA 5FEDA 3IKAA 2QOIA 4M3QA 4BZDA 3W32A 4AXEA 4BDAA 4ZAUA 2ITUA 3TZ8A 4H58A 4QPMA 2PVRA 4HW7A 5HX6A 2VU3A 2OXDA 5IG1A 1DI9A 3HA6A 2X9FA 4FZ6A 2QC6A 3EFJA 3LW0A 4L44A 4A9SA 1YWRA 1NVRA 3TDWA 3ZLYA 5J95A 3RI1A 4EUUA 5A6NA 2XNGA 2GPHA 4FKOA 5HO8A 1FPUA 1LEWA 3KB7A 3TYKA 1XBAA 4H1JA 1U59A 3V5TA 1YRPA 3C0IA 3RK7A 3NAYA 2Z8CA 2HOGA 4FZAB 3EB0A 4KIQA 4II5A 4O0SA 2QOLA 4AZTA 3RPSA 5HKMA 5AM6A 2E9OA 4C38A 4E6CA 2PMOX 4FKTA 2A4LA 4NM7A 4BGHA 4CSVA 2IVUA 3DAJA 3EQBA 2BRGA 2W96B 3TM0A 2UZVA 3KK9A 3MJ2A 5E8YA 2XEZA 1W98A 2BROA 4D2SA 3Q60A 5CASA 5D12A 3RAKA 4FUYA 3VULA 2AC3A 4UYNA 2R2PA 1XH4A 2JIIA 3KK8A 3NVKI 4WBBB 3EIDA 3FMKA 4GG7A 1YXXA 2C69A 3H0YA 2GQRA 1G5SA 5JGAA 3KXXA 3RINA 4QMMA 2HIWA 3WZUA 4FF8A 2QU6A 3UPXA 4QMQA 4XG3A 3F82A 4IX6A 3MBLA 3GI3A 4BVUA 5JFXA 3SXFA 3QA0A 2PUIA 5H3QA 4XG7A 4JIAA 4O1OA 5EW8A 4I41A 3E8NA 2VTOA 3ORZA 2PVHA 4JBQA 4FEQA 1WVXA 3KMWA 3NYOA 3R7VA 3W0NA 2C6OA 3F2AA 1JQHA 3NRMA 3G5DA 4O7WA 2IO6A 4U6RA 4X7QA 4UXLA 4B8MA 2Z02A 2JFLA 4CZTA 2CGVA 3NLBA 4C2WA 2FSTX 5IA5A 4MK0A 2W1ZA 4F65A 5M4CA 2WTKB 5I0BA 3POZA 4HGSA 2WO6A 4WIHA 5B2KA 5J1VA 3MH2A 2RF9A 4GEOA 4W4VA 4P90A 5E8ZA 1IASA 2GU8A 3HDMA 5ETCA 4BCKA 2H96A 1M2QA 3K3JA 4XV9A 2WTKC 3UG2A 4YZMA 5EQYA 4A4LA 4EYMA 4RWIA 5FG8A 5HIBA 4BR3A 3DS6A 4DDGA 3QD2B 1J7LA 3FMNA 3VO3A 4MYGA 2VD5A 4KBCA 1F0QA 4G2FA 4YJVA 1U4DA 2XK3A 4FTTA 4NM5A 4RA5A 3LM5A 4EHVA 2C6IA 2PZYA 5JFWA 1S9IA 4G3FA 2WMRA 3CD3A 5DVRA 4YTIA 3MPTA 2PE1A 1JKSA 2WMXA 4D1ZA 4XG2A 4TXCA 2XK7A 3R7EA 2QLQA 1CKJA 4FTOA 4NK9A 4ACHA 2OK1A 2BHEA 5TOZA 2P2HA 3JS2A 4PP9A 4FV8A 2WIHA 1E1VA 1IEPA 4JX3A 2BUJA 4PPAA 4YLLA 3MFRA 1V0BA 4MKCA 4UB7A 1UNLA 3AG9A 4D2PA 4E7WA 3DK3A 1QCFA 3HYHA 3GU7A 3OFMA 5JZJA 4AACA 4BCFA 3FI8A 2J0MB 5M09A 2JAVA 3BLQA 4DGMA 1MQ4A 4RT7A 4RC2A 3DAKA 4ITJA 3ORIA 1PXOA 3R22A 4IIRA 2G2FA 4CEGA 4UMTA 2J4ZA 5EDRA 1OKZA 4FICA 3CQWA 4QMPA 5IA3A 4BF2A 3WILA 4AA0A 2QR7A 5CU6A 2H8HA 5JQ5A 5IEVA 2CGUA 2GHGA 4MD9E 4F9WA 5I4NA 2B9FA 3SQQA 4EL9A 3HVCA 4AU8A 3FZTA 3IW8A 2XAMA 1SYKA 2F7ZE 3A99A 3VS6A 2B53A 3KQ7A 4F6UA 4D5HA 3UO5A 3W33A 4AZEA 4XG9A 5A4QA 5HNBA 4DEIA 1UWHA 4HYHA 3DLSA 5DA3A 4IM3A 4UMQA 5FP5A 4AXDA 1JSUA 3R1SA 4NH1A 3FZRA 4QQ5A 4WNPA 5BNJA 2PL0A 4B7TA 4F0FA 4IWDA 2YM3A 3ZOSA 4DT8A 5M07A 5HIEA 2Q0BA 3R28A 3JXWA 2QURA 4FZ7A 5CQWA 1R0PA 3OXZA 3EL7A 4EH2A 3UVPA 5CEPA 4FSZA 3OCSA 4GYIA 3LZBA 2GNJA 5KO1A 4FSWA 4QTCA 3PFYA 4QNYA 4LL0A 4RIOA 3GCSA 3PXQA 2UW0A 4FV9A 4YTHA 3TIZA 3VJNA 3NIEA 3ID6C 5IQIA 3CCNA 5LMKC 2W1CA 3ORLA 5ANEA 4EH8A 2GHLA 5EDQA 2XKFA 5GJDA 3AGMA 3QYZA 4C58A 3QCYA 3AT4A 3BIZA 2XF0A 4H3BA 4N6ZA 3WBLA 4OTWA 4F1TA 4Q9ZA 1QPJA 3BLRA 2UW6A 3FI3A 4KAOA 3F7ZA 3QUDA 4U40A 4L3JA 3R2YA 4EUTA 4DFYA 4UXQA 4AGWA 2W0JA 3F2NA 4CCUA 3LXPA 4I94A 4PMMA 5CI6A 5IQEA 2YERA 2J5EA 4KIKB 4EH3A 4GU9A 4XH6A 1TKIA 4ZZMA 2GTMA 2XVDA 3NIZA 3QXOA 4IH8A 4RWKA 5CAUA 4FR4A 3OP5A 4EC9A 3F5XA 1ZY4A 4PP7A 2WHBA 3GVUA 1Q4LA 1Q8UA 3COHA 3LIJA 3NFFB 1WBWA 5HNGA 1OUYA 4X3FA 2E9PA 2AEGA 1K9AA 3F66A 4AT4A 3GENA 3Q96A 3CGOA 4FT9A 4RX8A 4P5ZA 4E4LA 3IQ7A 3PP1A 3COIA 4IAKA 4F0IA 1NW1A 1ST0A 4K9YA 3BHUA 3HV3A 4FTMA 4PWNA 4RLKA 2VO6A 4XG4A 3DFCB 3LFQA 5AP0A 5BVFA 1H07A 5E8UA 4CRSA 3REPA 3PRFA 2BZIB 2PVJA 4TNDA 3WZDA 4CVAA 5AFVA 4QTEA 1OL5A 1H0WA 3VUKA 4EKLA 3Q4UA 4J95A 3DQXA 5FWKK 4XG6A 2JGZA 5LCJA 2UZOA 2Y4PA 4M7IA 3TV7A 3VWAA 1QPCA 1I09A 3BI6A 3P78A 1XMLA 4X2FA 4TL0A 5A4EA 2BHHA 4RJ8A 1KOBA 2HW6A 3BHYA 3BYUA 1BYGA 3IDCA 5AUXA 4R3CA 3JVSA 2BPMA 1LUFA 2WQEA 3PRIA 5IQCA 4U8ZA 5JFSA 4F63A 1PMVA 4MH7A 2HY81 5BVEA 3V8SA 5BQ0A 1Y8GA 3TV6A 4CMTA 4RJ5A 3BELA 3Q9XA 2C68A 4AZVA 3FL4A 2QNJA 3U6IA 2PVLA 3D14A 4RC4A 4IWPA 3ZBFA 3FBVA 4F99A 3WIGA 5HGIA 4O4DA 4ZIMA 4J96A 3UPZA 4YJSA 2ITPA 4Z7GA 4JMQA 3LHJA 2XYNA 3O51A 3R71A 2PZ5A 5C8MA 2C6KA 2CPKE 3QX2A 2NO3A 4JI9A 2W4KA 2R0IA 4TYJA 1PHKA 1REKA 2R3IA 4B0GA 3QGYA 2HY0A 2YDKA 2AC5A 4RIXA 5CAOA 1W82A 2WTDA 4FIJA 1ZYSA 5GJFA 4IXPA 4F7JA 4KUJA 2OIBA 3ZSGA 1MP8A 1URWA 1UWJA 1ZMUA 1JPAA 2QCSA 1YOLA 1UNHA 3OWKA 4FYNA 3QCXA 2R4BA 1TQPA 2UVYA 3QQGA 4F7LA 4GW8A 3LE6A 4QYFA 4C02A 5CSPA 1DI8A 1PW2A 2SRCA 3DU8A 4IANA 3R1QA 3PPZA 3RWQA 5K0KA 3GNIB 4BTKA 4AQKA 5CSVA 4YHTA 1CDKA 5HTBA 3DK7A 3EJ1A 2GQSA 4IWQA 4YO4A 3TN8A 4ZK5A 1ATPE 5CYIA 5IDPA 1OECA 5FXQA 2B9JA 4RZWA 4CYJA 3UIMA 1NVQA 3IGOA 4QMXA 4ZMFA 4DFZE 2RL5A 4U42A 4G31A 3BE9A 5HO7A 2R64A 3ML1A 4HNFA 4FL1A 1CSNA 4CKRA 4CFMA 3EFKA 3NUUA 4EHGA 1M52A 4FTIA 4I0SA 3A7FA 4O0UA 4F0GA 3R6XA 4EI4A 3PY1A 4QYHA 4QP3A 3IPHA 2X0OA 3CBLA 3NS9A 4G9CA 4B99A 5JGDA 2XCKA 4Z55A 3IG7A 2VWXA 2XIZA 4DH1A 1FMKA 1GIHA 3W2QA 1WZYA 4FG9A 1BL7A 3I6UA 4QMNA 3PJCA 2XNOA 2RIOA 3G6HA 4YJUA 1CKIA 4C4EA 4I5HA 2IW8A 5HD4A 4QMOA 4O82A 1H25A 3Q9ZA 3VS4A 4X2JA 3HP5A 1X8BA 3MH3A 3HA8A 1QPDA 4PTGA 2VTPA 5CWZA 4DEBA 2C1BA 3UOJA 4F1MA 1OITA 2FA2A 3UDTA 3QZGA 4FZDB 4FTUA 2WMAA 3FYKX 5AV2A 3WE8A 4U44A 4J71A 3MVHA 3E8CA 4OTDA 3G0EA 3K54A 4ZTSA 3VS5A 3WZJA 4KWPA 3NR9A 4ZSJA 4IEBA 5GIPE 4H39A 4M13A 3UODA 4TYHA 1B39A 5M4UA 2IG7A 3O8PA 3VS2A 3NEWA 4AQCA 2QVSE 4GU6A 4FTRA 3DXNA 4LQMA 3NUXA 2B7AA 5CZHA 3ZRLA 4NW6A 4TZRA 4Y73A 3V6SA 4EK6A 2BAJA 4ITHA 3VBXA 4EORA 5CEOA 3FAAA 4G9RA 1UA2A 3OWJA 5J87A 3DPKA 2PUPA 4BICA 3W0QA 3RPOA 3LKMA 1H8FA 5AUTA 4CT1A 1YDTE 4TYIA 4CYIA 3W0RA 2WTCA 2BZJA 4FOCA 4KBKA 1IAJA 3E8DA 3MN3A 4BDJA 1UU9A 4KS8A 4BHZA 3V5PA 5HIDA 3R73A 3HV4A 4JQEA 3BL9A 4Z16A 3QQFA 2YIXA 3V8TA 4M69A 3RBWA 3U55A 1YQJA 5IQAA 4PL4A 3F3VA 3I6WA 3FLSA 3QTUA 4FNXA 4I23A 4BI1A 3G0FA 1U46A 5HESA 4Y46A 4MWHA 4WSQA 3RKBA 3ORTA 1PF8A 2WELA 4C35A 4AT3A 4UX9A 3I5ZA 3R7OA 4YHJA 2EB2A 3OWPA 3W18A 1H1QA 2JKQA 2P3GX 3EWHA 3E7VA 4KABA 3QCQA 3PG1A 2UVZA 1YI3A 3R30A 4Z9LA 2CCIA 2C5NA 4BY9E 4JRNA 4MNEA 5JRQA 4I0TA 3GUBA 2JDRA 3NUAA 1KWPA 2R3RA 3S00A 3NW7A 3A8WA 2PY3A 3CE3A 3Q4ZA 3RZFA 3SKCA 2ITOA 1M17A 3KCKA 2BR1A 4GUEA 4GK3A 2GNFA 3CEKA 5DEYA 5CT0A 4WBOA 3D5UA 3PXYA 3TNIA 5EHOA 4CZUA 4ASZA 2E9VA 3FEGA 1OIQA 4IADA 3HP2A 5EHYA 4Y8DA 4FGRA 3LXLA 3VW6A 2EU9A 4O2ZA 1QPEA 3FHRA 4FSTA 3N4TA 5KMKA 4RSSA 2XEYA 5ANKA 4G3CA 3QXPA 2VTQA 4O96A 5HX8A 3TTJA 2O2UA 5C4KA 1P2AA 5L2TA 4LV8A 3GCUA 5A6OA 2W7XA 4O4BB 1Q8TA 4OUCA 4U3YA 3GU5A 4XMOA 3ZU7A 3CS9A 3CY3A 5C1QB 4APCA 1J1CA 3WOWA 3NSZA 5M44A 2XA4A 2GNIA 3U9CA 5EKNA 4JVGA 4X0MA 4EOJA 3HMPA 4R3PA 2WMVA 3UO6A 1WBPA 4YNOA 4BBFA 5LWNA 3HAMA 4OTPA 3TWJA 3LJ1A 4BN1A 3BHTA 5H8BA 2X2MA 3QLGA 3UDBA 3OCTA 4DEGA 2B55A 3BX5A 3D5WA 1OL2A 4XBUA 5IA4A 4P4CA 3UDSA 3TUCA 1OVEA 2P33A 4GJ2A 5H2UA 2VN9A 5HG9A 5JFVA 4KSPA 4IBMA 4LI5A 4NFMA 4QP1A 2UW3A 3SG8A 3FKOA 2DQ7X 4OTFA 2PUNA 1YOJA 3VW8A 1WFCA 5LMKA 5JH6A 2QI8A 3HEGA 3SLSA 3IS5A 2R3NA 1YHSA 3A4OX 5AX9A 2ITQA 3QRUA 3S3IA 2A0CX 3DFAA 4FV4A 4IAFA 3MWUA 4OGRA 3PSBA 4KIPA 3R8UA 5M55A 4YP8A 3GU4A 4S32A 4QMTA 4U43A 2BDWA 3ORKA 3LMGA 5AJQA 5AX3A 3GC0A 3FPMA 1FMOE 1ZZ2A 2VTIA 4GFMA 4B8LA 4R7BA 1Q61A 3II5A 4YLJA 5D41A 3UC4A 2GQGA 5KBRA 5KX8A 4QEBA 2XRUA 3R9RA 4LL5A 1WCCA 1GIJA 3PE1A 5DG5A 4BHNA 2CDZA 4KKEA 5DFPA 3WF9A 1MQBA 5CNNA 4E5BA 4UWBA 3QRTA 3V01A 4P2KA 4LGDA 3FMMA 3HV5A 4LYNA 3SG9A 3BWFA 3OTVA 4IX5A 4QMLA 2YM6A 2XK6A 3D15A 2RFSA 3WIKA 2J0LA 4O4EA 5E7RA 4C3RA 4E93A 3PXFA 3U6JA 1H1PA 2ZV7A 5J7HA 1VYWA 4USFA 1CM8A 3B8RA 4YGAA 2ZMDA 2WKMA 3AC1A 3QYWA 2JBPA 4A9UA 2Y6OA 2YIWA 4L7FA 1MRUA 3LJ2A 5D11A 3R2BA 2Y8OA 3LMIA 3FY0A 3NNXA 4YC3A 3DZOA 4D2RA 5HBEA 3S1HA 2ZFYA 3POOA 2V62A 3QA8A 1PKDA 5J9YA 2AQXA 4EQMA 1Q62A 3FLNC 4HZSA 4A4XA 1H0VA 3ZHPC 4C36A 4R1YA 3DLZA 3MH1A 4RA4A 5HU3A 5GNKA 2UZTA 4H36A 4JAIA 4KIOA 2IVTA 4A4OA 5AV4A 1XMMA 1HOWA 3EQCA 4K11A 3OOMA 1YDRE 4BKYA 3H0ZA 5EFQA 3W1FA 3H3CA 2OJJA 4EK5A 4PMPA 3IGGA 4PPBA 4FMQA 4IVCA 3WI6A 2CKQA 2O5KA 3SXSA 4DH8A 4MVFA 3CTJA 4LMNA 5TF9A 3AC2A 3RGFA 2XARA 5AEPA 4AN3A 4YJQA 5J7BA 3R9DA 2W1DA 3EH9A 3EN6A 4WO5A 3G9LX 5H8EA 4BCGA 5J79A 3DBFA 5TE0A 4X3FB 2I7QA 3VUGA 3OWLA 5CY3A 4ERKA 2B1PA 3VNTA 3KULA 5EM8A 4DGOA 3ATTA 3RHXA 3LFDA 5IQBA 3PTGA 3RAHA 2OF2A 5KNJA 1PMNA 5F20A 3LFNA 4JOAA 3O50A 3IOKA 4EH5A 5EI6A 4OTRA 4CQEA 1E1XA 3VBVA 2ZV8A 2CGWA 4NYEA 4OW8A 5ACKA 5EYDA 3PUPA 3EKNA 4DTKA 3P9JA 3W8QA 5CAPA 3V5JA 3SDJA 2PVMA 2R3OA 1OIRA 3T9IA 1PKGA 1PYXA 3V5LA 3R0TA 2UW4A 3F5PA 4M8TA 4C4IA 1G8SA 2PZRA 3KC3A 3R1NA 2ZJWA 3D5XA 5CSHA 4XLVA 2A98A 3UMXA 3R7UA 3KVWA 2UW9A 4LOPA 3DBQA 5F4NA 5CTPA 5HVYA 4GS6A 5A4LA 4PL5A 3QUEA 4DCAA 3A60A 2X2KA 3KU2A 1H26A 2HENA 5DR6A 4ACCA 5CVHA 4BBMA 1IA9A 3E64A 3JUHA 5L2SA 3DA6A 4DGLC 5B0XA 1URCA 4FV2A 5CVFA 3PXZA 3G51A 1FBNA 4U97A 4UMRA 5K3YA 3OTUA 1WBNA 3IW5A 3RNYA 4BDHA 3OHTA 4I1ZA 3KEXA 4BCPA 2VTSA 5IH6A 2C5YA 3OT8A 4FEWA 4CCBA 2PULA 2X2LA 4X2NA 2A2AA 3TCPA 3UGCA 4J98A 3LFEA 1UKIA 2ZOQA 4J53A 5HEZA 4D55A 4DEHA 2XS0A 4L52A 3V8WA 4ZTLA 1UKHA 4YMJA 4DG3E 3EN7A 3VJOA 1LP4A 2VNYA 4TWNA 4JR3A 3P5JC 3A4PA 4EONA 4F7NA 4IVBA 2GCDA 1GNGA 4F6SA 5FGKA 4DGGA 4FTQA 3AMAA 2CKPA 3GOKA 2UZNA 4KD1A 5F9EA 5DR2A 3OBGA 3UOKA 4R8QA 5GINE 3ROYA 4XP3A 3RPYA 2VX0A 5ETIA 3QQJA 4GK4A 3EKKA 3BEAA 4AA5A 2WPAA 4UWYA 3VIDA 3QLFA 4BDKA 4GKHA 3EYHA 4D0WA 2P55A 4GKIA 3COMA 2OBJA 4E4NA 4IJPA 2PVYA 3ZO3A 3VS3A 4K77A 4DYMA 5DOSA 3QKLA 1MRYA 3BQCA 2VTHA 4FT3A 5ITAA 4A07A 2F4JA 2HZIA 4QPSA 5CXZA 2RFEA 4Q5HA 4BJJA 2BZKB 2QU5A 5EW3A 4PL3A 3NW6A 3QQUA 5ANOA 4XUFA 3I0OA 5IQFA 3UVQA 5JT2A 5L6OA 4OLIA 3NYVA 4HYUA 4GIHA 4H1MA 5LARA 3T8OA 3UTOA 1KSWA 1REJA 3CQEA 4JNWA 4C4HA 1ZWSA 4JG7A 4DG2E 5E9EA 3ZM9A 3DGKA 2A19B 1KV1A 1YXVA 1MRVA 3QZHA 2C6TA 4FSYA 3G33A 4QD6A 4L43A 4G6LA 2FUMA 1R3CA 1TQIA 3NZ0A 4J1RA 4RLLA 4X2KA 5AV0A 5LVLA 4YPDA 2YACA 5DIAA 4GSBA 3LM0A 5JSMA 5KCVA 5AIRA 4TYHB 4XRLA 2CN5A 1Z9XA 4JX7A 4GV1A 4U7ZA 3L9NA 2XP2A 4WRGA 3AC5A 3Q5IA 4FL3A 4NSTA 2XK9A 4TN6A 4BCQA 5A14A 2YCSA 1OL6A 4IAZA 4AE6A 5GIOE 2C0TA 4L00A 1OMWA 1UU8A 2NP8A 1SVHA 4ZSEA 3NAXA 3O2MA 1DAWA 1LEZA 3BU3A 2BIYA 3VHKA 5LMAA 4RPVA 2OW3A 4F9CA 4F9YA 5JEBA 4OAUC 1B38A 3R01A 3HMMA 4ZLYA 5CEIA 4L01A 1WVWA 1T46A 2QONA 3TNHA 3VUMA 4RMZA 4BDFA 5HI2A 4FKQA 4A9TA 3MY1A 4C62A 4R3RA 4S31A 2DS1A 5BVKA 4M69B 2RFDA 3BWJA 2W4OA 3A61A 4UMUA 5JKGA 3L1SA 1YHWA 4QMUA 3BE2A 4NTTA 3MFUA 2YZAA 1M14A 3HV7A 2VTTA 4TNBA 3TUBA 3MFTA 3V51A 4TWOA 5CS6A 5AAGA 4MXXA 1O6LA 4MHAA 2OIQA 4RIYA 4BDEA 3FHIA 5I9ZA 2XAOA 2E9NA 3DTWA 4IAAA 5I5ZA 4FRFA 1JAMA 1YOMA 2C5XA 3AQVA 4QTAA 3IW4A 3NUSA 3WYXA 5IA1A 2WTWA 5F94A 1KV2A 3NDMA 3OROA 2IN6A 1JVPP 4MNEB 5G1XA 1SVGA 3VBTA 3CIKA 4EOQA 3GQLA 2VZ6A 4G6NA 2BAKA 4X21A 4CGAA 3ZSIA 4NFNA 3QD3A 5AAFA 5HLWA 1JBPE 4ALVA 4ANOA 4EKKA 3N51A 3PA3A 3DAEA 4MCVA 1RE8A 4YUQA 3QRKA 4XJ0A 3TL8A 3QWKA 3DB8A 3ZUVA 4M12A 4FIHA 4I4FA 4M14A 2C5OA 3FLWA 1FVVA 5D9HA 2IW9A 3HLLA 4EK8A 4WOVA 5CU0A 4AX8A 2HZ4A 1OM1A 4DFLA 4BIBA 2VO7A 3PJ1A 4J97A 3RPVA 2Q0NA 3BU5A 3UO4A 4B4LA 3P5KA 4IWOA 3ENMA 3D2IA 4BKZA 3O7LB 3HX4A 4C4GA 4D2TA 3MESA 3ALNA 4R78A 4FTCA 3UIUA 5LMBA 4LRMA 2F49A 1VR2A 2XNBA 4J52A 3K5VA 3NUNA 5CNOA 3EQGA 1ZMVA 4FG7A 4C59A 4E6AA 3PIXA 4TYGA 3ZO1A 4M0ZA 3Q4CA 3ZFYA 2XJ1A 2WNTA 4NKAA 1IAHA 1IA8A 4W8EA 4CZYB 3ETAA 4UN0C 1AQ1A 4QP7A 2JDVA 3U4UA 1YVJA 3BQRA 2BMCA 3P7CA 1Q99A 3NGAA 4W8DA 3UQGA 1SM2A 4RC3A 4F4PA 4YURA 3HV6A 4LV7A 1QL6A 5CX9A 3EOCA 1JSVA 1XBCA 2BFYA 4EZ7A 4IQ6A 4ZZOA 3R04A 4I6BA 3DQWA 3WF6A 3UQFA 3KRWA 4JDHA 4APPA 3R8PA 3DV3A 3ZUUA 1KOAA 3MY5A 4FKIA 4D0XA 3UE4A 4BZNA 2WEVA 3I4BA 3G6GA 3OUNB 1KE6A 5LVOA 1CMKE 2UVXA 2CMWA 2ESMA 2NRUA 2VO3A 4NIFA 2YWPA 4CQGA 4U0IA 5IMEA 4ZJJA 2XUUA 3OW3A 4GFOA 4C61A 4MAOA 5E8SA 5IDNA 1OI9A 5EDPA 3FMLA 3N4VA 3KRLA 2REIA 3TZ9A 1PMUA 3HRBA 4AUAA 2Z60A 3D7TA 4RJ4A 3WF5A 3ZYAA 4ALUA 3EFWA 4R7IA 5ETAA 4ITIA 4IC8A 3W2PA 1ZOEA 1H1RA 4AF3A 4L9IA 4FTAA 4N4SA 4PMSA 4AZWA 2P0CA 4C7TA 4I6LA 2CKEA 3FKLA 2BRMA 2FO0A 3ZLSA 1UVRA 3A8XA 4AXCA 5CEKA 2EXCX 3ERKA 2QHMA 1W83A 2JIVA 4QTBA 3Q9WA 4PNIA 3OMVA 2X8DA 3QKKA 4D4RA 4F9AA 3QAME 4XOZA 2XZSA 3KGAA 2ITXA 4YJPA 4O81A 2QG5A 2YITA 5EM6A 1V1KA 2IZTA 3BLHA 4AE9A 2YA9A 4IM2A 1W2CA 3MI9A 4AFJA 4Y95A 4FA2A 3UDZA 2XIXA 3E7OA 4FIIA 4UZDA 4C57A 4EWHA 2BIKB 1ZY5A 2Z7RA 5IF1A 1JOWB 3AKJA 2C47A 3C50A 1YWVA 2C5VA 2ITVA 5DLSA 4AA4A 2WGJA 5FDXA 4GT3A 4IAYA 3QZIA 5EYKA 3MS9A 5J5TA 1IG1A 3BCEA 3GB2A 5HVJA 3W2SA 5HTCA 5BVDA 4DC2A 4ZEGA 4EOIA 4PNKA 2WOTA 2W5AA 2YISA 3DDPA 3LOKA 1J7UA 5IH4A 1GJOA 2JKOA 1NA7A 2JD5A 2IZRA 1WAKA 3H9OA 3K3IA 4IJ9A 5KZ0A 5K0XA 4ZTRA 4IW0A 3F3UA 3FQSA 3H10A 5T6KA 3D94A 1JKKA 3ZC5A 3MJ1A 5DT0A 2F2CB 3OEFX 4OBQA 3VC4A 5AUUA 4IZAA 5A4CA 4PDYA 4J8MA 1FGKA 5D1JA 5AUVA 2Z7SA 5FBOA 4XRJA 3CJGA 4O0RA 4ANMA 3Q6UA 4RX7A 5AR3A 3GP0A 2QOBA 3VBYA 1T45A 4OR5A 5C4LA 4IB5A 2YEXA 4XX9A 4M67A 4BCOA 3PJ3A 4FKGA 3VUIA 3UOLA 1R78A 3NYXA 3KULB 3TKUA 3UZTA 3A7IA 4NZWB 4FKUA 5EOBA 3GFWA 4ACGA 4PUZA 4FX3A 2EWAA 2RG6A 4RJ3A 2WEIA 3NNVA 4DEAA 4PV0A 4DH5A 5FXRA 4R7HA 4RRVA 4YJOA 2VV9A 3NUPA 2PVKA 3QTZA 4TTHB 2J2IB 1XBBA 4QMWA 5DRBA 4O7LA 2EUFB 4EOPA 3C7QA 3FXWA 1ERKA 2Z2WA 3FLZA 4QQJA 3QTIA 3I0QA 4O38A 5AUYA 3ENHA 3DB6A 1OBDA 3GU6A 4BGQA 2IEWA 4RFZA 4YZDA 4NJDA 4NWMA 4JG8A 4ONAA 4O21A 3H4JA 2YJSA 4QRCA 4GYGA 4GJ3A 1SVEA 4JQ8A 4ZJVA 4O0WA 5L6WL 1XH6A 4UY9A 1DS5A 3ZO2A 4PMTA 4Q9SA 5HE1A 4UMPA 3LXNA 4GVAA 4XYFA 2Q83A 2JEDA 2IPXA 4TWCA 2GNHA 3FE3A 4RQKA 4JXFA 5BX0A 3QTXA 2I0YA