5BMSA

Crystal structure of p21-activated kinase 4 in complex with an inhibitor compound 29
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of Group I Selective p21-Activated Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 92
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bmsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bmsA01
2B9HA 2GS2A 3GBZA 4PL4A 4PTEA 4V0GA 3UIUA 4DFNA 2RL5A 2OLCA 4FKIA 4IZ5A 4L46A 5AM7A 5H8EA 5FWKK 2Y9QA 3OFMA 4QNYA 5EYCA 3KULA 3UGCA 4CXAA 3ZYAA 3PE2A 1WBSA 4I23A 4L45A 3A61A 2YIYA 3AC4A 2UV2A 4RG0A 1PXLA 4I21A 1PMEA 3EZRA 3MB6A 1Q8ZA 3NRMA 4HGEA 3BHHA 5KMIA 4FKPA 5HVKA 3UQGA 4BHNA 2WTKC 4U7ZA 2C5NA 4IAZA 4JLCA 4S31A 4IAKA 4MXAA 4BKZA 5J9ZA 2JGZA 2J5EA 5CI6A 4K18A 1Q99A 2YJRA 3F88A 3I79A 3R7VA 3QZIA 1OPJA 5B7VA 1WVXA 4V05A 3MY5A 3UIMA 4HPUE 3CS9A 4O7SA 3OWKA 5JRQA 3NVMB 1A9UA 2ZJWA 4ZJVA 3CBLA 3BHUA 4FSMA 2C6TA 3TUBA 5LMAA 2PVRA 4O83A 3W1FA 2CGWA 4QTBA 1QMZA 5IISA 1OZ1A 2YCSA 3AOXA 5ETFA 3OEZA 3QTUA 4FNYA 2WTCA 3EHAA 2FSTX 3EQDA 2C1BA 3R02A 4XH6A 2VTOA 4K33A 4WRSA 1LPUA 3F2NA 4M67A 3PSCA 4M14A 3E62A 4QPAA 2CN8A 2R3OA 3OHTA 4AWIA 4J52A 1NVRA 5CEPA 2GQRA 2Z7RA 3R22A 1URCA 3IK3A 2O64A 4ZZMA 4I5MA 2UVXA 2PULA 2RG6A 4HNFA 3F5UA 2VUWA 3HECA 3CIKA 4CG8A 2IZUA 3QTQA 3TKUA 4XJ0A 4DFZE 4GEOA 3FXWA 3ZO4A 4D0XA 1H00A 5TOZA 2BKKA 3LM0A 2JIIA 1MQBA 4FTLA 3B8RA 3D14A 2FH9A 4AS0A 3MGYA 2ITOA 2BR1A 1YVJA 4I5CA 3LAUA 2R2PA 4E73A 4DBXA 2DWBA 1PXOA 5L6WL 2ZDTA 3DKCA 3I6WA 3DPKA 5I9YA 1GZ8A 2OKRA 5IF1A 5CZHA 1DAWA 4UXLA 3K2LA 4GIHA 1XHAA 4F0IA 5L6OA 1S9JA 3QA8A 4M8TA 2QOCA 3DKGA 3VUKA 2JLDA 4BGGA 4B9DA 3DFAA 1BL6A 3TTIA 3C51A 4IZ7A 5EI2A 3QD3A 3RKBA 2C5VA 4FKJA 3QD4A 2OH0E 5FQDC 2P2IA 2AC5A 2WU6A 4QNAA 5EW3A 3DY7A 3D2IA 2VU3A 1YOMA 4IEBA 4QMOA 3PP1A 3LPBA 4LUEA 4BCFA 4IFCA 4L42A 3VHKA 1B38A 3PWDA 2WQEA 1KE8A 4MQ2A 3S4QA 4II5A 4D2TA 3H4JA 4DEIA 3FUPA 4X21A 3KRLA 4GVJA 2HZNA 4AT3A 4DBNA 5BUJA 3D7ZA 3I7CA 4GS6A 3SC1A 4IC7A 3PXRA 4EONA 4EYJA 3L9MA 4OTWA 4BCJA 3VUTA 1YXXA 2HW7A 4ZLOA 4G3FA 1PHKA 1MUOA 4FT9A 4MBLA 2GFCA 4ONAA 3ZO2A 3NUAA 3QCQA 1ZYDA 3L9NA 2GTNA 4RQVA 2WIPA 3JYAA 2GTMA 4JIAA 4X3JA 5BVDA 4FTKA 4BBFA 1JKTA 2BZKB 4YPDA 4D58A 2BHEA 3CPBA 5IPJA 2BZHB 1XBCA 3KN5A 2XK8A 3PIZA 3NPCA 3I5ZA 3QTIA 4QP7A 3SVVA 4BCKA 2UUEA 3RMFA 2V7AA 4A9YA 4I6HA 3MVJA 2CGUA 4NKAA 1M7QA 1PJKA 4Y95A 2Y4IB 1DI8A 5KBRA 2HZ4A 5LCKA 3GC8A 4BZOA 1KE5A 4ANNA 5A46A 4AFEA 1G8AA 4I92A 2X6DA 3R04A 1WBNA 2J0MB 4HGLA 1PXKA 3IS5A 3KFAA 5EYDA 1YWVA 2WMSA 3HUBA 1Q3WA 3ZUVA 4NM5A 4WHZA 3EFLA 4RLKA 3ALOA 4RVTA 5AJQA 5AP1A 2JDOA 4MXOA 2Z02A 1WCCA 5IA5A 2X7FA 1UV5A 2X81A 3FC1X 5DHJA 2A4LA 3MFTA 5CU4A 1PF8A 2V5QA 3AD5A 4BB4A 3OWPA 5BMMA 1ZYLA 3R63A 3T8OA 4C38A 2OJIA 2RIOA 4Z55A 5KUPA 2X9EA 1TVOA 5HIDA 3Q52A 5M07A 1GIJA 5AR3A 5CLPA 4IWDA 5J5TA 4XV1A 3HRBA 1ZOEA 3UO5A 2PZRA 2WU7A 3FAAA 4P7EA 5IA0A 2BVAA 4Y83A 4G2FA 1OM1A 3R7IA 2X8EA 1W8CA 2C30A 3ITZA 4GMYA 3QWKA 3R8VA 1OIQA 2Y8OA 3W2RA 5L2TA 3ACKA 2OU7A 3MVHA 5ANOA 2VTRA 3R8UA 3RWQA 4CSVA 3M11A 4FSRA 4MK0A 2XKDA 3HMMA 2JIUA 4U41A 3UMWA 3UOKA 2W06A 3JS2A 1JWHA 1VR2A 3G9NA 3QYZA 4GRBA 4FKQA 2EXMA 4FZAB 3O23A 5F94A 4FOBA 4Y46A 4ASZA 3LQ3A 4IVCA 4CMUA 1FBNA 2V62A 4E4LA 3F3ZA 1I44A 2JFMA 3ULIA 4AN9A 4EOOA 3RAHA 4OTHA 1OKYA 1Y8YA 4BDGA 4FTMA 2VWWA 1DI9A 4HCTA 1Q8TA 4RVKA 2RKUA 5IMEA 5LVLA 4QMZA 2B53A 4FIEA 3VBYA 3OG7A 1IAHA 2YACA 3EZVA 4FI1A 3EL7A 4L9IA 4MNFA 2PVHA 4FYOA 4U97A 3HMIA 4A9RA 4HCVA 3LW0A 4PPCA 4NM7A 3VIDA 3BE9A 3IKAA 3TV6A 5JFVA 4CCUA 5DNRA 4D2RA 5L3AA 4U43A 4FL1A 3QGWA 3OBJA 1BUHA 3H3CA 3QWJA 4FEQA 3QXOA 1UKIA 2C6KA 3MSSA 4JXFA 3RK5A 4IFGA 3ZZEA 5CASA 5CEKA 3NYVA 3DGKA 2QU5A 2XCHA 3KK9A 4WG5A 4G17A 1U4DA 2R3QA 3DZQA 4F7LA 1PMVA 4WA9A 4XV3A 4EHEA 3LFCA 2BTSA 1WVYA 1Y6BA 2NPQA 3LLTA 3OY3A 1H25A 4A07A 3BX5A 3LXKA 4EEVA 2XNEA 4D2SA 2VWXA 3QBNA 3EWHA 4FT0A 1YDRE 4GFGA 4BGQA 4IAFA 1OVEA 2ZYBA 3Q4CA 3KL8A 3ZUTA 4C59A 1FGIA 1PY5A 2OF4A 2JDTA 4OW8A 4CNHA 5DPVA 4MWHA 2WMQA 3FPMA 2ZB1A 2WMWA 3ZSHA 4BI0A 1YXUA 3IPHA 3QCSA 2WGJA 3W33A 4BL1A 3BPRA 3WYYA 2PUPA 1M2PA 4O0UA 3O2MA 3C4FA 3OOMA 1XR1A 2X0GA 2BDFA 1OI9A 5G6VA 4W8EA 4LV5A 3OVVA 2XM9A 4IDTA 3PLSA 4AQCA 4CKRA 5I9ZA 3CXWA 3CEKA 2W9FB 3C4WA 3FMLA 2OJ9A 4S2ZA 4Y8DA 3HMNA 3QTZA 4RX7A 4QP4A 3G0EA 4D28A 5FLFA 3TL8A 3EQPA 4M3QA 4QTDA 3C50A 1KOAA 5CVGA 5AP0A 4RIYB 3CTQA 4O7VA 1Q3DA 3EQCA 2W1ZA 3MV5A 5KCVA 4CFNA 3DNEA 2R64A 4EHGA 3K54A 2Z8CA 3PJ3A 3ZCLA 4FX3A 3EQFA 4A06A 4DE4A 4UX9A 3K3JA 4IB3A 2DUVA 3GC9A 4FIHA 4YJOA 5K3YA 5HLNA 3ZC5A 3U6JA 2KTYA 4H58A 3F3TA 4H36A 4IX6A 2XRUA 4MYGA 4DFBA 3Q9XA 3V5LA 3ODYX 4UYAA 4BBEA 4M15A 4C4IA 2C6MA 5FBNC 4ACMA 2BILB 4RX9A 1J91A 1J3HA 2WNTA 5M4IA 4AGUA 3LE6A 3NYXA 3KGAA 1FINA 4IM3A 1LEZA 1P2AA 3QQHA 4UMTA 3AMYA 4CT2A 4EJNA 4ENYA 2ZM3A 3IG7A 5AADA 3DBCA 4IWOA 3LFAA 4L6QA 3R71A 1OGUA 3D7TB 5LXMA 2XNPA 3SXRA 5KHXA 3G9LX 4HVDA 5IA4A 1ZMUA 4FTRA 5HG8A 3JY0A 5JN2A 5FXQA 2A1AB 1UVRA 1ZY5A 1A06A 3DS6A 3PE1A 4R3CA 3I1AA 3ZTXA 4ZTNA 2CLXA 3KRXA 2J0IA 4FV7A 3A99A 4NIFA 2I0VA 3D5WA 4LG4A 1O6YA 2GNIA 5IQEA 4HGSA 3P7CA 5BQ0A 2R4BA 2F2UA 3FKLA 3LCOA 5AR4A 5BYZA 3U54A 5M06A 4FVRA 2WTWA 1KUTA 1XH7A 2G1TA 5DT4A 5IQCA 4WBOA 3U6IA 3G2FA 2GDOA 4M66A 4IX5A 2R3IA 4M13A 4IX4A 5DH3A 5D10A 1FVTA 3PPKA 4JX3A 4QYYA 3WI6A 4YZBA 1HCKA 4TT7A 1OL1A 4LL0A 3SQQA 3GU7A 4XG2A 5L8KA 2ONLA 3EN4A 4FKLA 3QRTA 4I93A 4U80A 3CQWA 1ZMVA 3F9NA 5AR2A 5HKMA 4BRXA 3ANRA 3ATTA 4KIQA 3GNIB 3RPOA 2PVLA 4I94A 3RAIA 1V0BA 1JOWB 4ZS4A 1H08A 4X6RA 1NXKA 3BE2A 2QR7A 4LRJA 3WF9A 3L1SA 4QP8A 5B2MA 3NMUF 2VTLA 3HV7A 5C4KA 2CNVA 3VW8A 3EKKA 4ACGA 2OFVA 3O7LB 4ZY4A 4GG5A 4ANLA 4G3GA 4JAIA 2W4KA 2NP8A 2ERKA 1UWJA 1ZAOA 3ORXA 4ZXTA 3BHTA 4QYGA 3MESA 4C8BA 5A4TA 1U54A 4LMUA 2QOLA 4IMYA 1ZWSA 2VWIA 2XK4A 3DJ7A 3KVXA 4TWPA 3VQHA 3KXGA 4FKWA 3QC4A 4LL5A 4ASXA 3B2WA 2VWBA 3BU6A 3OW3A 5CSVA 2Q0BA 3GI3A 4RWJA 1MRUA 3QZFA 2VTNA 3E3BX 4HJOA 3ZDIA 1M52A 2WPAA 3F5GA 3RHKA 4TZRA 4PDPA 3CTJA 4FIFA 4DYMA 3ORKA 4X0MA 5LVOA 5EW9A 3DK7A 4X2NA 3HA6A 4XHKB 3ZEWA 4OTFA 3NLBA 5B2LA 3AC8A 2ITVA 2DYLA 2A0CX 2XNOA 4EI4A 3EFWA 3FDNA 3R00A 2IW8A 4CFUA 5I3RA 5EI8A 4PX6A 4IQ6A 5HI2A 1PKGA 2UW9A 4J98A 4KKHA 3RZFA 4DEEA 2BZJA 2V7OA 4G6OA 3QTRA 3EQHA 4K0YA 4U42A 3KC3A 4JR7A 1H28A 2XIRA 2ZVAA 3R7UA 5ETCA 4DH8A 3EH9A 4RC3A 2XEZA 2XK7A 4D4RA 2RFSA 2XKFA 2W96B 3VHEA 5JSMA 2E9NA 3FI4A 5B2KA 2VRXA 3VS0A 3U55A 3BQCA 2R0UA 2XKCA 3GOPA 3SG8A 5M09A 3VNTA 2REIA 3R1NA 1XJDA 3VULA 2CNQA 2XJ0A 2VTAA 4KABA 1OMWA 4O27B 4TYHA 5TF9A 3WILA 3Q5IA 4PUZA 3SX9A 1Q61A 3TUCA 2B54A 4RFZA 2PK9A 4W4WA 4IAIA 5D12A 3OUKA 4EBWA 4DGGA 5EOBA 5HTCA 5I9UA 3FE3A 4MBJA 4O7WA 2YN8A 3ZONA 2C1AA 4HYIA 2WMVA 4M68A 2FA2A 4AG8A 4AN2A 3C5UA 4BYIA 1W84A 4YP8A 5M51A 4L44A 4JG8A 5KO1A 3RGFA 5DRDA 5KNJA 4MNEB 1F3MC 4FNZA 3UPXA 4AW0A 4IACA 3TEIA 3Q5ZA 1YXVA 4ENXA 3BYSA 4KINA 4EH2A 4KIPA 5CT7A 5G1XA 4W4YA 1WBPA 4PF4A 5CAVA 3FL4A 5JFWA 2B9JA 1HCLA 2YM8A 4RWKA 4CFWA 4E6AA 4HVSA 3ZLSA 5CX9A 3A8XA 5HBHA 1JBPE 4L00A 1OKWA 4FSZA 3TZ8A 3IO7A 2P2HA 3ROCA 4CMTA 4PDYA 3UZRA 4D0WA 2YM5A 3D5UA 1AGWA 4KRDA 4U5JA 4FICA 4ZP5A 4UWCA 4Z9LA 2IVUA 4EKKA 4WD5A 5CENA 4IM2A 4NTSA 3NS9A 3CC6A 3RK7A 4BDDA 5JGAA 2UZOA 5DFPA 5KKRC 4PL5A 4NCTA 4S32A 5HCXA 5HVYA 5BVWA 4XG4A 5AR7A 3QQLA 5AUYA 5AAFA 4DGMA 5AA9A 3UZTA 4ANOA 3V01A 4LGHA 4MXCA 2VO7A 3U4UA 4QMSA 4BTFA 1JQHA 4JAJA 5D9HA 4Z7HA 4QYHA 5TE0A 4JDHA 3R0TA 1GZKA 4RJ7A 2W5HA 4KIOA 2GQSA 2PUIA 4BWKA 4QMTA 3V5QA 1H1SA 3F2RA 3MJ1A 2BZIB 4K9YA 5JH6A 3LCDA 4ZZOA 5LVMA 4FZ6A 2ZV8A 3H30A 3QA0A 4BDJA 3VBWA 4DCAA 5EI6A 4F4PA 1UNHA 4O2ZA 4OTIA 3HRCA 5ANJA 5EYMA 1I09A 5CF4A 3CLYA 3D83A 3QTSA 2HAKA 2F9GA 3QD0A 3Q9ZA 5HHWA 5KMNA 2VX0A 2ZV7A 5C9CA 3MA6A 2J7TA 5AX9A 3UOHA 4C3RA 2CGVA 2EB2A 2ZOQA 3LXPA 5AV3A 4DF3A 4DEBA 3R73A 4EOJA 2J50A 4EOSA 4A9TA 3VRYA 1YHVA 3JXWA 5H2UA 2EWAA 4AUAA 4AZWA 3JR1A 2C0TA 4O0XA 1KWPA 3EQGA 1OIUA 3HP5A 3KXNA 3LMIA 3TIYA 2YHVA 2WQBA 3O8TA 3PJ2A 4NM0A 4QQCA 3MH1A 4G3DA 2W1EA 1U46A 3VW6A 1PXPA 4ERWA 4I24A 5CSHA 1SM2A 1H24A 4DFXE 1JSVA 1WBTA 3PG1A 4MXXA 3BWFA 3WIKA 3WZDA 2HCKA 4RPVA 4AW5A 4F7JA 1S9IA 3PY3A 2YITA 4QQ5A 5GINE 3AGLA 4TL0A 3RALA 1FVRA 3ENMA 4FTIA 4Y73A 2E9OA 4R3RA 4PRJA 4TW9A 5T3QA 4NM3A 5LMBA 5JQ5A 5IG1A 1KE7A 4X2KA 3O50A 3DV3A 3RCDA 5C8KA 4O1PA 2HYYA 4PMPA 5C8NA 1CM8A 3W2QA 5C01A 4Q5HA 3G6GA 4PTGA 2BPMA 3TZMA 4A9UA 2XIKA 4LQMA 3QX4A 3W2CA 4JT3A 4ITHA 3R28A 2QG5A 3VUDA 2OG8A 3NW5A 4G3EA 3CKXA 3OROA 2WEVA 4KBAA 4NWMA 3SW7A 1ND4A 3UDBA 1P14A 5EW8A 4EBVA 4FR4A 3VN9A 4FV0A 4MVFA 2R3JA 2QLUA 4B8MA 4R78A 1PRYA 4JR3A 3OMVA 4W4VA 5EOLA 3L9PA 3E88A 4U3YA 4LYNA 3R8PA 5E4HA 2FGIA 3KN6A 3MIYA 2VGPA 3CP9A 4HW7A 3C4XA 3KK8A 4MTAA 4Z3VA 3C4EA 4QP3A 2ITQA 2IZRA 5FD2A 4BFMA 3TCPA 4E5AX 1KE9A 4PNKA 4P90A 3OBGA 5FBOA 1FMKA 2OFUA 5HE2A 4CGAA 5HLWA 3LCKA 3PVUA 1DAYA 2OZAA 4C36A 4DAWA 2X2KA 4G34A 4UMUA 4AX8A 5CQUA 2F7XE 4OTPA 5I9VA 5TO8A 3VRZA 2XNNA 3A7FA 4M97A 4BDCA 4BF2A 3ATSA 2A19B 4ZTSA 1E9HA 2R3GA 4M12A 4CVAA 1VZOA 3FMKA 3HEGA 3QRIA 1JKKA 3ANQA 4CQGA 3FC2A 4BI1A 3RAWA 2VWVA 3AT2A 4FNXA 3PXQA 5EM8A 5E91A 4EH7A 3MS9A 3IDPA 5HU9A 2I1MA 4RIWB 5A54A 4D5HA 4HCUA 4CD0A 4F0FA 4FEUA 2WFYA 3W55A 4CZUA 2E2BA 4IB5A 4IHPA 4TXCA 2HWPA 3NUNA 5CALA 2PSQA 3AG9A 3HV4A 1GJOA 1YRPA 4YC6A 3KCKA 3OCTA 4E26A 4CT1A 5E8SA 3BRBA 4E8AA 4F7NA 3VBQA 5IH4A 3V5TA 1KSWA 3BHYA 1M7NA 3N51A 3R01A 3MVMA 1Y6AA 3PFQA 4LMNA 4RIXB 3NCZA 3QQKA 4GT4A 4N70A 3U9NA 5FTGA 4QRCA 3COMA 5IA2A 5IA3A 5M4CA 5H8GA 2R3NA 4GG7A 4NFMA 2PE1A 3FHRA 3F3UA 4FVPA 4HYUA 4KBCA 5BVKA 3WZUA 4DGNA 3HV3A 3SRVA 4RFYA 5A4QA 3EN9A 5DEWA 2LGCA 3RNYA 3FSFA 4TTHB 4FTQA 2C6LA 3GC7A 5AR8A 3DOGA 3Q60A 4YJRA 4C3FA 2W1HA 4F70A 4BCPA 3PUPA 4EUTA 1GZNA 3DU8A 4TRLA 3CJGA 3SDJA 2F7EE 3RPVA 5HBEA 3OZ6A 3KY2A 4H1JA 3ZSIA 5HORA 1OBGA 4CLJA 4UBAA 4BY9E 4MNEA 2YIQA 5FP5A 3I6UA 4DEHA 4O21A 3MA3A 2XH5A 4KUJA 2QOKA 4FGBA 3F3WA 3ZM4A 3PA3A 2HK5A 3ERKA 4WBBB 5KZIA 4YSJA 5J7HA 3EKNA 2QCSA 3R1QA 4C35A 4CYJA 3RTPA 1Q4LA 4G6LA 2R3HA 4AGWA 3N4TA 3ORZA 3F69A 4BDHA 3BCEA 3LFDA 4ASDA 4DEDA 3ZLYA 4AP7A 3VQUA 4RIYA 3L8SA 3LFNA 5EFQA 4XP0A 5KKRB 4RJ4A 3NUYA 3R8MA 4FTAA 4UMPA 2BROA 3UQFA 2OH4A 3OEFX 3C1XA 2XK3A 4MEDA 4O0YA 2FO0A 2PL0A 2UW4A 4O96A 3PIXA 3V5WA 4R7BA 4TNBA 2RF9A 1ZYSA 4O38A 2R7IA 3HV6A 2QNJA 3ULZA 2ERZE 3FV8A 3LJ1A 2W99B 3QL8A 3VVHA 1TQPA 2QU6A 2YIWA 4XG8A 4BYJA 4C02A 4D2PA 2BRMA 3P7AA 4F9WA 4I0RA 5CXHA 2XZSA 4C4EA 3UYTA 4YJPA 1IEPA 1RQQA 3UP2A 4XG6A 5HNBA 3ZFMA 4CRSA 5FDXA 2E9VA 5EK7A 4FIGA 4X3FC 2PVMA 4RQKA 2OSCA 2YABA 3CJFA 4FT7A 4KRCA 4BKJA 2CJMA 5CSPA 3QXPA 5KHWA 4FA2A 3L9LA 3DXNA 3NNWA 3QQGA 2BALA 4UWYA 4EJ7A 4FTTA 4KA3A 3SOCA 5CXZA 3IOKA 2X6EA 3W16A 3SG9A 3A4PA 4I3ZA 3KXHA 2YCRA 4FTJA 2IZTA 1LP4A 2YAKA 2YEXA 3HZTA 3II5A 3Q4UA 1XBBA 5JRSA 4BIDA 3H0ZA 3MY0A 4G5JA 3QZGA 3V8WA 4CG9A 3BGZA 2PZ5A 2W1FA 4GYIA 1VYWA 3HLLA 2O0UA 3CY2A 3DAJA 4GU6A 1GIIA 5LWMA 4I22A 1G3NA 3HGKA 3NAXA 2WAJA 1QPCA 3PP0A 4EHZA 3PYYA 5HGIA 4NJ3A 4CFFA 2X9FA 3S3IA 1AD5A 4L01A 2VV9A 4JQ8A 3EFKA 4RVLA 4F6WA 3NGAA 3VBXA 4OTQA 3WYXA 2QONA 2Y7JA 3BI6A 4GVAA 4DT8A 2H9VA 3EIDA 3PXZA 3RPRA 2ETKA 3M2WA 3GXLA 3WF8A 3ZFXA 4C34A 3PXKA 1J7IA 2XB7A 5CTPA 4EOMA 4A4OA 4DCEA 3QTXA 3G51A 4APCA 3I7BA 2QKWB 1MRVA 4R3PA 5DMZA 2R3LA 3NUXA 2CKEA 2PVKA 4FZFB 2JDSA 4KD1A 4RX8A 5DT0A 3V3VA 4D2WA 4AA0A 4IANA 3Q2MA 1X8BA 4YZ9A 3RI1A 4CMOA 3FMEA 5FEEA 1SZMA 4UMRA 4C61A 3WZJA 5H3QA 3DJ6A 3QU0A 4E5WA 3FXXA 3NSZA 5EM5A 4DHFA 2VAGA 3IW6A 3AC3A 3PPZA 4NTTA 2OICA 4JOAA 4C3PA 5EKOA 4LFIA 3TWJA 5EG3A 3FZSA 4C2WA 3R9RA 5HO6A 1ATPE 4J53A 3OTUA 2HZ0A 3IW8A 3LOKA 5HU3A 5J1VA 2XK6A 2BUJA 1LUFA 1YOJA 3PSBA 2PYWA 1NT2A 4CFXA 2X2MA 4D9TA 3FEGA 3TACA 2R3RA 4QTCA 4YZNA 3OP5A 4ZZNA 3UG1A 4FEXA 3LVPA 4BI2A 2YM3A 3NVKI 3BLRA 3O96A 2NRYA 3FKOA 3KRJA 3BWJA 4FKVA 5CSWA 4BGHA 3TZ9A 3A7GA 3R7GA 5AUZA 1RJBA 4RGJA 2BFXA 4C0TA 4UY9A 1CKPA 1W7HA 4C7TA 5FM2A 2WO6A 2C3KA 3DB8A 4OBQA 4QMYA 4YJSA 2ZMCA 4R1YA 5JT2A 5D41A 3BV2A 3ALNA 3QRKA 5CEQA 3UMXA 4IZAA 3KXMA 3MWUA 3VUGA 4YJUA 2JAVA 5IEXA 4ARKA 1NVSA 2I7QA 5A14A 2VWUA 2IG7A 3SKCA 2UZDA 1T46A 4H1MA 5BVNA 3C13A 4PMTA 3OCSA 3COKA 4FK3A 2EVAA 5LARA 1Y57A 2CGXA 2G2FA 3ORIA 2YLFA 2XRWA 2G9XA 4JBOA 1Q62A 3MYGA 4EK3A 3FI8A 4EOLA 1ZY4A 2F4JA 2VX1A 4CV9A 4N57A 4XRJA 4C4HA 1Y91A 3C0IA 5J7BA 2AYPA 4YMJA 2W9ZB 5JFXA 3CSVA 2J6MA 2QVSE 3KU2A 5IKWA 4EKLA 4IB1A 4IWPA 2XIZA 4E4NA 1XQZA 3ZH8A 4F9CA 3PJCA 4MH7A 3JUHA 1R39A 3CY3A 5H9BA 2JD5A 4RJ6A 5AMNA 4J8NA 2GNFA 4NIFB 2WMBA 2W17A 1UU9A 5A9UA 4G9RA 4XP3A 3S00A 5J5SA 3WBLA 5LCJA 3KULB 3VUMA 3FMDA 4U3ZA 3Q9YA 4K8AA 4NK9A 3PG3A 4X7QA 2X4FA 4R5SA 4P5QA 2CKOA 4JJRA 2OXXA 2H6DA 1R0EA 1YI6A 3NUPA 2X7GA 5JZJA 2UVYA 3BYMA 1ZRZA 4BDBA 3R7EA 3HUCA 1J1BA 3DLZA 4F09A 5CANA 4RT7A 1IR3A 3ZRMA 4I0SA 4DT9A 5DT3A 3UVRA 4EL9A 3IGGA 2YAAA 4L7SA 4NSTA 5GZ9A 3V8SA 2R5TA 4CFMA 1MQ4A 1PMNA 3OT3A 4AGDA 2GNJA 2I0YA 2B52A 5AV2A 4J96A 3E92A 3TZ7A 4AGCA 2JIVA 4CCBA 4EC9A 2FSOX 4WNKA 4RIOA 3UVQA 2I0EA 3VUHA 4N4SA 3ZM9A 2BRBA 1P4OA 2GHLA 2PHKA 3GVUA 4TY1A 4FKGA 4DH7A 3ZOSA 1EH4A 4PP9A 1FOTA 4YHTA 3ZSGA 3D9VA 4H3BA 1OPKA 4PTCA 4ANMA 4QMPA 3ZLWA 4CKIA 3O8UA 4FKTA 4QYFA 4W8DA 2G15A 4PL3A 2C6EA 1OB3A 4XOZA 3RAKA 5AP2A 4D4SA 3CTHA 3L8VA 5IDPA 2PE2A 4BN1A 3LFBA 4M0YA 4DEAA 5IQIA 1W83A 3IW5A 2GU8A 4LGGA 1XH5A 3PRIA 4DC2A 4DFLA 2DS1A 3FZTA 4GIIA 3NNXA 5E8ZA 2WMUA 5EM7A 3IGOA 4ID7A 5HLPA 1QPJA 2JBOA 2OF2A 4FMQA 4O0SA 1M17A 2W5AA 3TUDA 3HAVA 3L8XA 3NDMA 2J4ZA 2IN6A 4H3PA 2HXLA 3TXOA 1V0PA 4QMNA 3ENHA 2J0JA 3CPCA 4FG7A 4DLIA 2UW0A 3NIEA 5J79A 4FTCA 5KE0A 4AE9A 5M4FA 4FSWA 2PU8A 4FGRA 4O6LA 2O63A 4JRVA 5K9IA 4MX9A 1V0OA 2GS6A 3I4BA 4IAAA 3R83A 4BVUA 4A4LA 1H1RA 4YNOA 2YIXA 2UW8A 3W10A 3IW7A 3H10A 2W4OA 4O0WA 5E8YA 2W1CA 3C5IA 1YOLA 4GL9A 4XP2A 3FQHA 1GOLA 2IVSA 1OUKA 3HMOA 3MDYA 5AV4A 3TKIA 4PP7A 5CYIA 1ZOGA 2YM7A 3E87A 4BZDA 3VAPA 5AV1A 4NH1A 3RJCA 3ZEPA 4B4LA 3EYHA 4YC3A 4L7FA 2CKQA 4HZSA 3BGPA 3FMMA 4K77A 3EJ1A 4IVAA 1JKLA 1TQIA 5TKDA 3VF8A 3ZRKA 2B1PA 4X2FA 3FMHA 2I6LA 4A9SA 2GMXA 2XBAA 1NVQA 5CVFA 4G3CA 4O7NA 1XKKA 2X1NA 3QUPA 4AOJA 5EQPA 2CSNA 3TT0A 2WQOA 4WUAA 2EXEA 4IXPA 1H0WA 3UC3A 2XF0A 4F63A 2HWOA 3A7JA 1BL7A 2HIWA 3GENA 3GFWA 3P5KA 2WTIA 4JL9A 4WG3A 5FRIA 3QZHA 2CMWA 5CU6A 3W8LA 2OJFE 4UWBA 3MJ2A 3SD0A 5GJDA 5HCZA 4GT3A 4UYNA 4N6YA 4ALWA 3LZBA 1SMHA 3LFQA 2XVDA 4Y5QA 3KVWA 4QTEA 5IQBA 3PJ8A 5KZ0A 3UJGA 4JI9A 4FSNA 4YBJA 3AMBA 3MPMA 5A4LA 5GIOE 5FP6A 4JBPA 3NR9A 2O3PA 1M2QA 1Z9XA 1Y8GA 5L4QA 4HYHA 5E90A 2C3LA 2IWIA 3PXFA 4XBUA 3SOAA 4RBLA 4BBMA 5GJGA 3V51A 4F0GA 5CAOA 3QX2A 4CZTA 2C5OA 3DNDA 3OCGA 3MFSA 4PDSA 3HKOA 3UOLA 3F82A 3FHIA 4GUEA 4EH4A 4FKUA 4QMLA 3LLAA 4DTAA 3Q3BA 2UZNA 5CT0A 3FPQA 1J1CA 2VTQA 3FZ1A 4YJVA 3VS3A 2OW3A 1JKSA 5IQHA 4YNEA 1TQMA 4HPTE 3MH0A 3VS5A 3VS4A 5A6NA 4NFNA 3UTOA 4QMMA 3VBTA 4YZCA 4E3CA 2WELA 4FK6A 3P4KA 4GFMA 1E1XA 4D4VA 5HNIX 1UU8A 2EB3A 3QHRA 5L2IA 3BU5A 3BV3A 3SRVB 2JBPA 3DT1A 5K0KA 4BDAA 2UW3A 3MY1A 4FKOA 4ALVA 2BMCA 4HGTA 2P55A 4IJ9A 4KS8A 4RJ8A 5AV0A 1REJA 1UU7A 2O2UA 1F0QA 2RFDA 4I5HA 4QMVA 4UZHA 2FB8A 3RCJA 5D7AA 4YR8A 5AUTA 5LQFA 1NY3A 2QO9A 3GU6A 3C0GA 1W98A 3P86A 3FLYA 2W7XA 4G1WA 4XX9A 4ZOGA 2WMRA 3T9TA 4I6FA 2IVTA 2OZOA 4L3PA 4OT6A 4FYNA 3U8WA 3I0QA 3R1YA 3V5PA 5FG8A 1OITA 5F1ZA 3GCUA 4DGLC 2YERA 2B7AA 4WRGA 3CGFA 4PNIA 2BIYA 1ZYCA 4BDIA 3V6RA 2UZLA 4C33A 4QO9A 5E8TA 3GCQA 4F6SA 5JQ8A 5K5NA 5M44A 1XBAA 2Z7SA 5CAUA 5IZFA 3R2BA 3LHJA 4IZYA 2R3PA 1GIHA 2B55A 3RM7A 5DN3A 4FTNA 5DR6A 4X3FA 3ROYA 5F20A 5DYJA 4B99A 4RZWA 1UNLA 4I4EA 5ANGA 3QKLA 1CTPE 2HENA 3MBLA 2J90A 5JEBA 2RGPA 3MH3A 4CYIA 4DG3E 4AA5A 2XNGA 3LM5A 2CNUA 3KB7A 3Q2JA 3F7WA 4Y85A 4AZEA 2OIDA 3IQ7A 5D7VA 4TN6A 4XG3A 2NRUA 3HAMA 2OZAB 5E8UA 3I81A 3BBWA 1ZYJA 3W2SA 2UZVA 4BCOA 3ZBXA 4C4FA 4E1ZA 5KMOA 4R77A 4YTFA 4Y5HA 3WF5A 1GAGA 1F5QA 4BKYA 4TKSA 3S0OA 2J51A 4LGDA 4BIBA 3AT4A 4EZ7A 5IUHA 3QTWA 4QQJA 1BMKA 2XYUA 2AUHA 2C5YA 4KIKA 4X6QC 2ITUA 2PPQA 3RINA 3E8EA 4MBIA 2WEIA 2JITA 4EQCA 1G8SA 3E5AA 3BQRA 2BFYA 5HESA 4FEVA 2IZSA 2F2CB 2P3GX 4GFOA 5C8MA 3RPYA 3UIXA 2YDKA 4FSUA 4YURA 3ZHPC 3NIZA 2JFLA 4ANQA 4GK3A 5EDRA 4YTCA 4I4FA 3QQUA 4BTMA 4TYEA 3F7ZA 5HVJA 3GFEA 4RWLA 5DRBA 4IH8A 4TYGA 4O7TA 4CV8A 2PZYA 5EYKA 4BTKA 3DBQA 4ZSLA 3NUSA 2JKMA 1BX6A 3DXPA 4S33A 4EWQA 1ZLTA 4ZIMA 3A2CA 3P23A 3VJNA 4N0SA 4OT5A 3R7YA 3I60A 1H26A 3JPVA 1Q8YA 4WG4A 3WE4A 1V1KA 3TDWA 4USDA 4LM5A 3U4WA 3B8QA 2IPXA 2BRNA 2IVVA 4AZVA 4GUBA 3JVRA 4RC4A 5LMKC 2OI4X 5A6OA 4FF8A 5AIRA 1APME 1IASA 2V55A 3NNVA 4NKSA 1R0PA 1UU3A 4LRMA 2ZAZA 2VO3A 4RMZA 3OW4A 2OJGA 2JC6A 1J7LA 3D15A 2XIYA 2ITTA 2PMOX 2VZ6A 4RX5A 3TNQB 3GOKA 2ACXA 3NYNA 2Q0NA 4WT6A 5KMJA 3O8PA 2YISA 4EOIA 5IU2A 3W2OA 3GB2A 4OBOA 3T9IA 2W1IA 4M69A 3R30A 3FBVA 3AMAA 2OWBA 5BUEA 2WMTA 3ELJA 3G33A 2CN5A 3FQEA 3Q4ZA 1Q97A 1OBDA 4ZLYA 1O9UA 4BWXA 4D9UA 2ZM1A 3S95A 4YO6A 4IADA 4LOPA 1BYGA 2HY0A 2WXVA 4YPSA 4U40A 4AN3A 3TNWA 5JKGA 1H4LA 4MQ1A 5K5XA 1BKXA 3NX8A 4ZJIA 4AA4A 4BTJA 3A7IA 3RHXA 4EK8A 1IA9A 2QO2A 4B7TA 1L3RE 4RWIA 3IONA 3VS7A 5DVRA 3FYJX 3KCFA 3ORMA 4L67A 1XH8A 2IW9A 3FYKX 4I6BA 2PMIA 2WTVA 2QOFA 3D0EA 3UNJA 3KQ7A 2ITWA 4RLLA 3R9HA 1JAMA 2ITPA 1VJYA 4WNMA 3RPSA 4EUUA 3K5VA 5IDNA 4MD8E 3ODZX 5HICA 2RG5A 3FLSA 2G2IA 3D5VA 3MTLA 3FY2A 3D4QA 4D5KA 4X2GA 3B2TA 5AAGA 5CF6A 2XNBA 3BU3A 3W32A 4EH3A 4L68A 1L8TA 4WUNA 2R3FA 5HIEA 1PMUA 2UZUE 4EK6A 5AFVA 3HYHA 5JK3A 4PWNA 3F2AA 2H96A 5CEOA 3AC2A 3PIYA 1JSUA 2YLEA 3BEAA 4MHAA 3EB0A 4R7IA 3QALE 5AM6A 2ITNA 5AP4A 1Z5MA 4ZLZA 1UWHA 3CCNA 5EH0A 3TNHA 4K6ZA 2XS0A 4NYEA 4BDEA 2F57A 2WMXA 4L8MA 3EFJA 4GKHA 2R9SA 5D11A 2WZJA 4S30A 3UP7A 4PDOA 4EYMA 3FY0A 3G15A 5I0BA 4JDJA 5ETAA 4O86A 3EQBA 2PVNA 3OS3A 3EYGA 2HXQA 4G31A 3O71A 4RJ5A 4ZTHA 3VBVA 4ZJJA 3VS6A 2CKPA 4M0ZA 5KMMA 3V6SA 4DLJA 4DGOA 3WE8A 5BYYA 3ETAA 3Q4TA 4QMXA 4CFVA 3PRFA 5FM3A 2CPKE 3FMNA 2GFSA 4JG7A 4TWNA 4GH2A 2PUNA 4HYSA 5DOSA 5AAEA 2WTKB 3PY1A 2OXDA 3COHA 4NT4A 4O0VA 4ZMFA 2ETMA 4Y72A 1Q8WA 4BCMA 1WAKA 5CY3A 2WD1A 4ZEGA 2O8YA 2Y4IC 3NUUA 3QUDA 3T3UA 3UC4A 5I3OA 5I9XA 3KKVA 4P4CA 4XUFA 5DIAA 2FVDA 2F49A 3ID6C 4BR3A 4RC2A 5FEQA 4WO5A 3DTWA 3FL5A 4BDFA 4XMOA 4DEGA 3EMGA 5FGKA 2I0HA 3D2KA 5L2QA 4EOPA 1YI3A 2B4SB 1XH9A 2PTKA 3PA4A 3C7QA 3POZA 4DH3A 3BBTB 5EKNA 3W18A 4AU8A 3FLNC 2Y4PA 2QD9A 2BRGA 2XBJA 1OUYA 3FZPA 3F66A 4U81A 5EHYA 2WQMA 5E1SA 2JAMA 2PE0A 2ESMA 5CF8A 2X7OA 4FL2A 2C69A 2CLQA 3FI3A 4F9AA 1YW2A 4LRKA 4JS8A 4MD7E 4V01A 2PZIA 4ZY5A 2C4GA 1XH4A 1H1PA 4JIKA 3PPJA 4WNPA 3UNZA 1DS5A 2Z7QA 4RSSA 5EQYA 4FV4A 4J99A 2GHMA 4ZTQA 3ZDUA 3QLGA 5EHOA 3D7TA 4YU2A 2YDIA 4DFUA 3QCYA 4CRLA 3F61A 3A62A 4MXYA 5GHVA 3U6HA 4J97A 3LJ2A 3HDNA 4DINA 1PYXA 4U8ZA 4O0RA 2YM4A 1OIRA 1STCE 2P0CA 2QHMA 2WKMA 4OTDA 4U45A 5CU3A 4DG0E 4QQTA 2VWZA 4TYIA 4AE6A 5GJFA 3E93A 5HE1A 3QCXA 4EZ5A 2UW7A 2VNYA 4BC6A 3C4ZA 3SXSA 2VWYA 3I5NA 4CTCA 4XYFA 5E8XA 3SXFA 2GCDA 5AWMA 4AW2A 5HTBA 3RVGA 2VX3A 1DM2A 3UIBA 4WSYA 4OAVB 3KF7A 3UODA 4I1ZA 3E7OA 3NNUA 2ZMDA 4O0TA 4XNEA 3CGOA 4KBKA 4ZSGA 2QKRA 4FT5A 2HY81 2OK1A 1WBWA 2VTMA 2X8DA 2QHNA 4FIIA 3ZXTA 2C3JA 2NNWB 5CNNA 4F9BA 4E20A 4MWIA 5C4LA 4O81A 3V8TA 2EXCX 4BIEA 4AOIA 3AD6A 3DBFA 4YJQA 2X8IA 4V0GB 1ZZLA 4B8LA 3KA0A 4NUSA 4HVGA 2HELA 4HVHA 4YSMA 1AQ1A 3IDCA 4KAOA 3Q53A 3ZBFA 2GNGA 3QC9A 5HTIA 3TM0A 3LXLA 1RE8A 3HV5A 5M55A 4IWQA 4RJ3A 3RK9A 5GIPE 5EHLA 2W4JA 3GT8A 3F5PA 2VTIA 4ANSA 3SLSA 1R3CA 5HOAA 5ANDA 3OWLA 5CZIA 5KX8A 4DA5A 4FG9A 5DG5A 4AZFA 3GCVA 2YIRA 4QT1A 4GW8A 4F65A 5HO8A 1UA2A 4Q9ZA 3R7OA 4A7CA 4YO4A 3DQWA 4NW5A 2XJ2A 4D1ZA 3GGFA 3VF9A 2GNLA 1XO2B 4D1XA 4ERKA 1REKA 3A4OX 4D2VA 1K2PA 1LEWA 3O0GA 2O65A 4J7BA 1OL6A 3UNKA 5A4CA 2HW6A 3H0YA 4C58A 4WNOA 3HMPA 3FZOA 3PVBA 5CS6A 3NW6A 3LIJA 3IDBA 5C27A 3QF9A 4BWPA 3R9OA 5IQDA 4BDKA 3TN8A 4F64A 5HE0A 3MFUA 4D1SA 5E8VA 5J9YA 4ZMEA 3M42A 3OCBA 2GSFA 1URWA 3L8PA 4JVGA 2UZBA 3UO4A 3DQXA 3HX4A 5M53A 3PY0A 4AZSA 3PZEA 4RFMA 5CAPA 4D4YA 3LXNA 3OOGA 4F7SA 1OIYA 3P79A 4CEGA 2QO7A 4TWOA 3EN6A 5FDPA 5CVHA 5LVNA 2VNWA 3BYUA 4E5BA 4PV0A 4FKRA 4XCUA 1YQJA 1K3AA 1XH6A 4UB7A 3SAYA 5HG5A 3VS1A 3FLWA 3ZO1A 4AT5A 4HZRA 4FEWA 2FUMA 4E4XA 2Y0AA 4PMSA 5C26A 3P78A 5EDPA 5ETIA 2PMLX 4OTRA 3FI2A 4JG6A 1W82A 5BPYA 4JQEA 3HP2A 1M2RA 3NWWA 5IH6A 3GQLA 1Z57A 4ORKA 3FZRA 2BDWA 4Q9SA 2C6OA 3WARA 4E6DA 4XS2A 3A7HA 3P9JA 4R1VA 2VTTA 3VWAA 2OJJA 4CKJA 3BIZA 4GU9A 4XBRA 5DI1A 1YDSE 2UW6A 4P2KA 2VTHA 1U5QA 3TNPC 4TPTA 3EN5A 2BAJA 2R7BA 3ZZWA 2ONLC 3EQRA 1FVVA 1YXTA 4NW6A 4YHJA 3MTFA 4E6CA 4EK5A 4FKSA 5E7RA 3SGCA 2C5XA 4QYEA 5CSXA 1ZXEA 5KBQA 5AP7A 4K11A 2W1DA 3VS2A 4XV2A 2LAVA 5K0XA 2RSVA 4FODA 3G0FA 3GQIA 2YCQA 2G01A 4EOKA 2VN9A 3KRRA 2A27A 1XWSA 4QP6A 3TJDA 4HNIA 3LFSA 4G16A 3QAME 1BLXA 3R2YA 5BVOA 4EH5A 4IDVA 4QMQA 2BDJA 4U79A 5AUUA 4D55A 3DK3A 1Q24A 1R78A 4FOCA 2WMAA 4G6NA 5L8JA 1ZOHA 3CQEA 3QQJA 4F1TA 2HZIA 5HEZA 5HNGA 4IW0A 3R9NA 3HA8A 4X3FB 1VEBA 4MD9E 3FWQA 2FSLX 1CKIA 2BAKA 4ZY6A 2PUUA 2QG7A 2ZV2A 5F4NA 4JBVA 4L43A 4LOOA 4PPBA 4IC8A 4RIWA 4M69B 5AP6A 4O7ZA 4YZDA 5M57A 2JKQA 4FNWA 4J71A 4BCQA 4QP9A 1PKDA 5LMKA 2C47A 5AEPA 3T3VA 5ICPA 3LCSA 1YXSA 4YLJA 3SV0A 4C62A 3LQ8A 3R8LA 4KKGA 4AACA 4TWCA 2ITYA 2F7ZE 4N6ZA 3PSDA 3TTJA 1YDTE 4R6VA 1Q41A 4QPMA 3MI9A 2YM6A 1K9AA 3K5UA 3C4CA 3CD8A 3NZ0A 3QLFA 3DDQA 3QFVA 4IIRA 4ZTLA 5E1EA 3GEQA 2EU9A 2PVFA 2QURA 4USFA 2VTJA 4ALUA 3QD2B 2WHBA 5AP5A 2Q83A 3KMWA 4UMQA 3U9CA 4KNBA 4XLVA 4XRLA 4QOXA 3OXTA 2UVZA 3S2PA 2P4IA 5BVEA 2VTPA 2QODA 1IRKA 5IQGA 5AUWA 2PVJA 3KXXA 3V04A 2WOUA 2GQGA 3NYOA 3ORNA 4O7RA 2XJ1A 4FSTA 1MP8A 4UN0C 4L3JA 3BEGA 3E64A 3KXZA 4RIXA 3P1AA 4C4GA 5JGBA 5ANKA 2B9IA 4X2JA 4APPA 5HO7A 4MAOA 1YHSA 3E3PA 3OY1A 2BTRA 1U54B 4FVQA 2SRCA 3R8ZA 4FZDB 2QOBA 4E93A 2PZPA 3Q04A 3VJOA 5CU0A 3FLQA 5HX6A 4GCJA 5A3XA 4ZSAA 3REPA 4OAUC 4FIJA 4FV3A 4FE2A 2V22A 5A4EA 4O82A 1SNXA 4LV8A 4S34A 3MB7A 3BLQA 3UOJA 3ORPA 4CZYB 4I5PA 3JY9A 3QHWA 4PQNA 5I5ZA 2WB8A 3LQ5A 5EQEA 1OL2A 1QPDA 2CCHA 4EORA 5BX0A 1WFCA 4RVMA 1WVWA 4Q2AA 3EOCA 1OL5A 4XEYA 4R7HA 4E6QA 2W5BA 3DAKA 3KRWA 4O22A 3RNIA 1M14A 3E8CA 4FV6A 2E9PA 4QMWA 2W0JA 3TJCA 4I6QA 2E9UA 1Q8UA 5DEYA 3VUIA 3ZC6A 2JDRA 5I9WA 5JMSA 4C57A 3G5DA 4YGAA 1O6KA 1SVHA 4W9XA 2A2AA 5IEYA 4MKCA 2PY3A 3HRFA 5M08A 3DB6A 2ETRA 3N4VA 1SYKA 4J8MA 3E7VA 2RFEA 3U87A 4UXQA 4GK2A 3UVPA 3GCSA 3KMMA 3VO3A 3COIA 4F08A 4FV9A 1P4FA 4MXZA 5AP3A 2UZEA 3DXQA 2FYSA 5IH5A 4FL3A 2VD5A 4AT4A 4MF1A 5ACBC 4Z16A 4ZSJA 3GU8A 1UKHA 2OO8X 3GCPA 3TV7A 4WKQA 3W2PA 4AAAA 3FSKA 4JDKA 2XP2A 3P7BA 5TR6A 3GU5A 3DLSA 4GSBA 3E8DA 5T6KA 5K4JA 3CD3A 3GUBA 4P5ZA 5J95A 3G6HA 4FV2A 4FZ7A 3ZS5A 1YWRA 3FJQE 1CSNA 3NCGA 4NEUA 3ACJA 5JGDA 4QD6A 4FC0A 3O51A 4GK4A 4QTAA 4M7IA 2ZV9A 4QP1A 4UALA 3QUEA 3ZXZA 1LR4A 1J7UA 3TDVA 4MCVA 4YLKA 1JLUE 5FXSA 4FBXA 3HL7A 3AC5A 5DGZA 5IQFA 2C6IA 2WTDA 3H9FA 3PLAE 4R8QA 3DTCA 4L3LA 2J0KA 2OIBA 3BELA 5HZNA 3UQCA 3FQSA 2DQ7X 2XMYA 3AQVA 4ZTRA 3AD4A 1RDQE 3D5XA 5LWNA 4DITA 1E1VA 4EHVA 5IEVA 3H9RA 1H1WA 1GNGA 5HQ0A 2B9FA 2UW5A 3MFRA 4R5YA 4CTBA 3HDMA 4E7WA 5LOHA 4WOVA 4E4MA 3DBDA 4U44A 4BCIA 2PMNX 4YZMA 4F6UA 4DN5A 2W05A 3QKKA 3NAYA 3OD6X 4UV0A 5J9LA 5KMLA 1IA8A 3MIAA 3GP0A 4QPSA 2ITZA 2UZTA 3Q96A 4IX3A 4J1RA 1H27A 3WF6A 4I0TA 4FSYA 4OTGA 4M84A 3F5XA 1TKIA 5HCYA 4O7LA 3Q32A 2UZWE 4GKIA 2GNHA 4A4XA 5LJJA 2YWPA 3POOA 4KSPA 4WIHA 4DH1A 5AA8A 4QP2A 2RFNA 4C4JA 1PXJA 4OR5A 4YTHA 5J1WA 3R1SA 2JKKA 3DJ5A 3ZUUA 4PY1A 3RP9A 5L8LA 4UZDA 4EH8A 2CHLA 5AIKA 2WTJA 3PJ1A 4DTKA 1FQ1B 4FV8A 4PMMA 3UYSA 4ANBA 5F9EA 5FUTA 3AGMA 3BKBA 3N9XA 3KEXA 1WBVA 5ANEA 3U51A 4GJ2A 4ACDA 2JDVA 1U59A 2NO3A 4KIKB 4Z7GA 5CF5A 5HD4A 4H3QA 4K1BA 3DBEA 3EQIA 4AW1A 3RZBA 4F1MA 4YTIA 4YHFA 5BYLA 4EH6A 3FMJA 2EUFB 2QR8A 3K3IA 3OWJA 4IAYA 3UBDA 3OF0A 4ZTMA 2X4ZA 3CR0A 4LUDA 3TV4A 3ZLXA 3TG1A 2C6DA 4F9YA 4ITJA 3GC0A 4AXAA 2YZAA 4LI5A 2YA9A 4Q5EA 5DA3A 3KREA 3V5JA 2Y6MA 3P08A 5CWZA 3WF7A 4ZK5A 5J87A 2H34A 5E92A 1PW2A 4V04A 1ZARA 1T45A 3BLHA 1Q5KA 4EC8A 1H0VA 2P33A 5T68A 3ZFYA 4H05A 1NW1A 3WOWA 4CLIA 5F95A 5DBXA 3WZEA 4H39A 5BUIA 3OXZA 3Q6WA 1G5SA 4IB0A 3QYWA 3JVSA 4U0IA 4DTBA 3S1HA 3PTGA 3R21A 2QQ7A 2X2LA 2Y6OA 4KS7A 4LOQA 3OT8A 4OUCA 2XKEA 5I4NA 3R6XA 2WIHA 2BRHA 3O17A 4J95A 5IQAA 1NA7A 2GHGA 3FLZA 1FPUA 4O84A 1OKVA 3TKHA 2XNMA 1JPAA 4AZTA 5CAQA 4IVBA 5HG7A 1SVGA 1VYZA 4U6RA 2XM8A 3IW4A 1R1WA 5HE3A 1B39A 5JFSA 4KKEA 5BNJA 4FUXA 5K4IA 4GV1A 5L2SA 5ACKA 4FT3A 2ZDUA 1SVEA 1QCFA 4G5PA 4UEUA 3SA0A 1H8FA 3RBWA 4DG2E 1BI8A 2ITXA 3ET7A 1KE6A 1MRYA 4XG7A 4XG9A 5ITAA 5DE2A 2J9MA 2CDZA 3OXIA 4MF0A 2G2HA 2IO6A 2V0DA 3THBA 4BCHA 3LKMA 2O5KA 2XK9A 2PVYA 3DK6A 4W4XA 1ZMWA 3TI1A 2ZB0A 1WZYA 2GPHA 4B0GA 4EQMA 4ACCA 2VTSA 5GZ8A 4F99A 1GY3A 4L52A 1ZZ2A 3WIGA 3FXZA 1ERKA 4HOKA 2XEYA 3C0HA 3AC1A 1KV1A 3LMGA 4NJDA 1H01A 2VO6A 2W1GA 3UE4A 5GZAA 2QOOA 2VGOA 2I40A 2QOQA 3A60A 3NW7A 5CNOA 1FGKA 1UNGA 5DLSA 5ANIA 5FXRA 1PXNA 4JNWA 2OXYA 5KMKA 2OBJA 1W0XC 2FSMX 4FTUA 3M1SA 2WOTA 4KB8A 3D94A 4NCTC 3UZPA 4RA4A 4EOQA 3KF4A 2OGVA 3EN7A 4QMUA 3N4UA 3BGQA 3CQUA 3MPTA 5AX3A 3F3VA 4AOTA 3MPAA 3PA5A 3PVGA 2YJSA 3QGYA 3RWPA 4ITIA 4JQ7A 2Z60A 1YWNA 5EM6A 5HG9A 4EH9A 3KMUA 3LJ0A 4IM0A 1WBOA 3E63A 1CDKA 4F1OA 5IUGA 2B0QA 1PXMA 2X39A 2R3MA 3BZ3A 3IOPA 4FTOA 1B6CB 3NEWA 3QRUA 3ORLA 4G9CA 5AUVA 4YBKA 5M4UA 4O2PA 5DR2A 3DA6A 3PZHA 4YJNA 2C68A 5HBJA 5DR9A 1O6LA 3UO6A 1JSTA 3BYVA 1YKRA 5B0XA 5EDQA 2BIKB 2GS7A 2Z7LA 4BICA 1OECA 4KSQA 1HOWA 2QOIA 5GNKA 3LMHA 2BHHA 4OBPA 3TIZA 4B6LA 4BCNA 4DH5A 4JX7A 2IJMA 2YDJA 3OC1A 2BCJA 3R9DA 1A48A 1P5EA 4C2VA 3H9OA 3W8QA 4O1OA 3A8WA 5HIBA 5HX8A 3GU4A 5L2WA 4NU1A 3DCVA 3DZOA 3MH2A 4W9WA 3F6XA 3QRJA 5FEDA 2QLQA 1GZOA 3MVLA 4YLLA 3O7LD 2J5FA 3PWYA 1WMKA 4IJPA 2PWLA 4RRVA 3E8NA 3AXWA 4NZWB 1FMOE 5H8BA 5FTQA 3PXYA 4FV1A 3QQFA 4FUYA 5IUIA 2YZLA 4ASEA 2JEDA 4EWHA 2XA4A 3QKMA 3Q9WA 4USEA 1PXIA 4RZVA 5HD7A 3ZO3A 2C3IB 3BYOA 4FV5A 1IAJA 1SNUA 4HVIA 2BKZA 4TYJA 2C0IA 4ZS0A 3ZRLA 1PYEA 5LVPA 3LFFA 2VO0A 5CEIA 3EL8A 4NL0A 4YJTA 5JZNA 4JRNA 4CQEA 1QPEA 2R3KA 2H8HA 4WSQA 4I41A 3ORTA 5CQWA 4IVDA 2JKOA 4JDIA 5E9EA 5D1JA 4BCGA 1CKJA 4EZ3A 3HNGA 4OGRA 3G90X 4TNDA 2BAQA 4ZAUA 2XUUA 4YUQA 2ZM4A 3OTVA 4O91A 4OLIA 5L6PA 4L53A 2QC6A 4XOYA 1H1QA 2IW6A 3DKOA 4O6EA 4ZSEA 5BVFA 3I0OA 3PVWA 5IMXA 5IA1A 2OIQA 2WQNA 4RA5A 2XIXA 4KWPA 4TYHB 3CKWA 2HOGA 4FG8A 2YFXA 3WZKA 5CI7A 4IE9A 3MN3A 3DDPA 3OUNB 3SW4A 5DWRA 2YWVA 4YC8A 5CEMA 2QOHA 1YHWA 3RM6A 2C0OA 3PDTA 4O7YA 4GYGA 1H07A 3P0MA 1OPLA 3LCTA 3C9WA 1KOBA 3UPZA 1OL7A 4I20A 4PPAA 2QI8A 2XYNA 3DKFA 4XLIA 4XV9A 2J0LA 3DAEA 3HVCA 4U9AA 3ZMMA 1U5RA 3MW1A 3TNIA 2J2IB 2R0IA 3AT3A 5AUXA 4FSQA 3BHVA 3IECA 2KULA 4JBQA 3Q6UA 4GJ3A 3ZU7A 1IG1A 4C37A 5BMSA 5C03A 3CE3A 4ACHA 1KV2A 5FTOA 5J8IA 4BHZA 1OKZA 1JVPP 4K2RA 1QL6A 3SHEA 4BZNA 4EK4A 1RW8A 2Z2WA 4DFYA 1YI4A 5TT7A 4IBMA 5E8WA 5AR5A 4AF3A 4EQUA 1CMKE 2AC3A 2YCFA 1BI7A 3DFCB 2CCIA 4GT5A 1JNKA 2XCKA 4AFJA 3VC4A 3FKNA 5C1QB 5M56A 3UG2A 3LFEA 5CU2A
chains in the Genus database with same CATH superfamily
2B9HA 2GS2A 3GBZA 4PL4A 4PTEA 4V0GA 3UIUA 4DFNA 2RL5A 2OLCA 4FKIA 4IZ5A 4L46A 5AM7A 5H8EA 5FWKK 2Y9QA 3OFMA 4QNYA 5EYCA 3KULA 3UGCA 4CXAA 3ZYAA 3PE2A 1WBSA 4I23A 4L45A 3A61A 2YIYA 3AC4A 2UV2A 4RG0A 1PXLA 4I21A 1PMEA 3EZRA 3MB6A 1Q8ZA 3NRMA 4HGEA 3BHHA 5KMIA 3NFFB 4FKPA 5HVKA 3UQGA 4BHNA 2WTKC 4U7ZA 2C5NA 4IAZA 4JLCA 4S31A 4IAKA 4MXAA 4BKZA 5J9ZA 2JGZA 2J5EA 5CI6A 4K18A 1Q99A 2YJRA 3F88A 3I79A 3R7VA 3QZIA 1OPJA 5B7VA 1WVXA 4V05A 3MY5A 3UIMA 4HPUE 3CS9A 4O7SA 3OWKA 5JRQA 3NVMB 1A9UA 2ZJWA 4ZJVA 3CBLA 3BHUA 4FSMA 2C6TA 3TUBA 5LMAA 2PVRA 4O83A 3W1FA 2CGWA 4QTBA 1QMZA 5IISA 1OZ1A 2YCSA 3AOXA 5ETFA 3OEZA 3QTUA 4FNYA 2WTCA 3EHAA 2FSTX 3EQDA 2C1BA 3R02A 4XH6A 2VTOA 4K33A 4WRSA 1LPUA 3F2NA 4M67A 3PSCA 4M14A 3E62A 4QPAA 2CN8A 2R3OA 3OHTA 4AWIA 4J52A 1NVRA 5CEPA 2GQRA 2Z7RA 3R22A 1URCA 3IK3A 2O64A 4ZZMA 4I5MA 2UVXA 2PULA 2RG6A 4HNFA 3F5UA 2VUWA 3HECA 3CIKA 4CG8A 2IZUA 3QTQA 3TKUA 4XJ0A 4DFZE 4GEOA 3FXWA 3ZO4A 4D0XA 1H00A 5TOZA 2BKKA 3LM0A 2JIIA 1MQBA 4FTLA 3B8RA 3D14A 2FH9A 4AS0A 3MGYA 2ITOA 2BR1A 1YVJA 1G8JA 4I5CA 3LAUA 2R2PA 4E73A 4DBXA 2DWBA 1PXOA 5L6WL 2ZDTA 3DKCA 3I6WA 3DPKA 5I9YA 1GZ8A 2OKRA 5IF1A 5CZHA 1DAWA 4UXLA 3K2LA 4GIHA 1XHAA 4F0IA 5L6OA 1S9JA 3QA8A 4M8TA 2QOCA 3DKGA 3VUKA 2JLDA 4BGGA 4B9DA 3DFAA 1BL6A 3TTIA 3C51A 4IZ7A 5EI2A 3QD3A 3RKBA 2C5VA 4FKJA 3QD4A 2OH0E 5FQDC 2P2IA 2AC5A 2WU6A 4QNAA 5EW3A 3DY7A 3D2IA 2VU3A 1YOMA 4IEBA 4QMOA 3PP1A 3LPBA 4LUEA 4BCFA 4IFCA 4L42A 3VHKA 1B38A 3PWDA 2WQEA 1KE8A 4MQ2A 3S4QA 4II5A 4D2TA 3H4JA 4DEIA 3FUPA 4X21A 3KRLA 4GVJA 2HZNA 4AT3A 4DBNA 5BUJA 3D7ZA 3I7CA 4DDIA 4GS6A 3SC1A 4IC7A 3PXRA 4EONA 4EYJA 3L9MA 4OTWA 4BCJA 3VUTA 1YXXA 2HW7A 4ZLOA 4G3FA 1PHKA 1MUOA 4FT9A 4MBLA 2GFCA 4ONAA 3ZO2A 3NUAA 3QCQA 1ZYDA 3L9NA 2GTNA 4RQVA 2WIPA 3JYAA 2GTMA 4JIAA 4X3JA 5BVDA 4FTKA 4BBFA 1JKTA 2BZKB 4YPDA 4D58A 3AKLA 2BHEA 3CPBA 5IPJA 2BZHB 1XBCA 3KN5A 2XK8A 3PIZA 3NPCA 3I5ZA 3QTIA 4QP7A 3SVVA 4BCKA 2UUEA 3RMFA 2V7AA 4A9YA 4I6HA 3MVJA 2CGUA 4NKAA 1M7QA 1PJKA 4Y95A 2Y4IB 1DI8A 5KBRA 2HZ4A 5LCKA 3GC8A 4BZOA 1KE5A 4ANNA 5A46A 4AFEA 1G8AA 4I92A 2X6DA 3R04A 1WBNA 2J0MB 4HGLA 1PXKA 3IS5A 3KFAA 5EYDA 1YWVA 2WMSA 3HUBA 1Q3WA 3ZUVA 4NM5A 4WHZA 3EFLA 4RLKA 3ALOA 4RVTA 5AJQA 5AP1A 2JDOA 4MXOA 2Z02A 1WCCA 5IA5A 3W0QA 2X7FA 1UV5A 2X81A 3FC1X 5DHJA 2A4LA 3MFTA 5CU4A 1PF8A 2V5QA 3AD5A 4BB4A 3OWPA 5BMMA 1ZYLA 3R63A 3T8OA 4C38A 2OJIA 2RIOA 4Z55A 5KUPA 2X9EA 1TVOA 5HIDA 3Q52A 5M07A 1GIJA 5AR3A 5CLPA 4IWDA 5J5TA 4XV1A 3HRBA 1ZOEA 3UO5A 2PZRA 2WU7A 3FAAA 4P7EA 5IA0A 2BVAA 4Y83A 4G2FA 1OM1A 3R7IA 2X8EA 1W8CA 2C30A 3ITZA 4GMYA 3QWKA 3R8VA 1OIQA 2Y8OA 3W2RA 5L2TA 3ACKA 2OU7A 3MVHA 5ANOA 2VTRA 3R8UA 3RWQA 4CSVA 3M11A 4FSRA 4MK0A 2XKDA 3HMMA 2JIUA 4U41A 3UMWA 3UOKA 2W06A 3JS2A 1JWHA 1VR2A 3G9NA 3QYZA 4GRBA 4FKQA 2EXMA 4FZAB 3O23A 5F94A 4FOBA 4Y46A 4ASZA 3LQ3A 4IVCA 4CMUA 1FBNA 2V62A 4E4LA 3F3ZA 1I44A 2JFMA 3ULIA 4AN9A 4EOOA 3RAHA 4OTHA 2XALA 1OKYA 2IEWA 1Y8YA 4BDGA 4FTMA 2VWWA 1DI9A 4HCTA 1Q8TA 4RVKA 2RKUA 5IMEA 5LVLA 4QMZA 2B53A 4FIEA 3VBYA 3OG7A 1IAHA 2YACA 3EZVA 4FI1A 3EL7A 4L9IA 4MNFA 2PVHA 4FYOA 4U97A 3HMIA 4A9RA 4HCVA 3LW0A 4PPCA 4NM7A 3VIDA 3BE9A 3IKAA 3TV6A 5JFVA 4CCUA 5DNRA 4D2RA 5L3AA 4U43A 4FL1A 4BJJB 3QGWA 3OBJA 1BUHA 3H3CA 3QWJA 4FEQA 3QXOA 1UKIA 2C6KA 3MSSA 4JXFA 3RK5A 4IFGA 3ZZEA 5CASA 5CEKA 3NYVA 3DGKA 2QU5A 2XCHA 3KK9A 4WG5A 4G17A 1U4DA 2R3QA 3DZQA 4F7LA 1PMVA 4WA9A 4XV3A 4EHEA 3LFCA 2BTSA 1WVYA 1Y6BA 2NPQA 3LLTA 3OY3A 1H25A 4A07A 3BX5A 3LXKA 4EEVA 2XNEA 4D2SA 2VWXA 3QBNA 3EWHA 4FT0A 1YDRE 4GFGA 4BGQA 4IAFA 1OVEA 2ZYBA 3Q4CA 3KL8A 3ZUTA 4C59A 1FGIA 1PY5A 2OF4A 2JDTA 4OW8A 4CNHA 5DPVA 4MWHA 2WMQA 3FPMA 2ZB1A 2WMWA 3ZSHA 4BI0A 1YXUA 3IPHA 3QCSA 2WGJA 3W33A 4BL1A 3BPRA 3WYYA 2PUPA 1M2PA 4O0UA 3O2MA 3C4FA 3OOMA 1XR1A 2X0GA 2BDFA 1OI9A 5G6VA 4W8EA 4LV5A 3OVVA 2XM9A 4IDTA 3PLSA 4AQCA 4CKRA 5I9ZA 3CXWA 3CEKA 2W9FB 3C4WA 3FMLA 2OJ9A 4S2ZA 4Y8DA 3HMNA 3QTZA 4O4FA 4RX7A 4QP4A 3G0EA 4D28A 5FLFA 3TL8A 3EQPA 4M3QA 4QTDA 3C50A 1KOAA 5CVGA 5AP0A 4RIYB 3CTQA 4O7VA 1Q3DA 3EQCA 2W1ZA 3MV5A 5KCVA 4CFNA 3DNEA 2R64A 4EHGA 3K54A 2Z8CA 3PJ3A 3ZCLA 4FX3A 3EQFA 4A06A 4DE4A 4UX9A 3K3JA 4IB3A 2DUVA 3GC9A 4FIHA 4YJOA 5K3YA 5HLNA 3ZC5A 3U6JA 2KTYA 4H58A 3F3TA 4H36A 4IX6A 2XRUA 3UDTA 4MYGA 4DFBA 3Q9XA 3V5LA 3ODYX 4UYAA 4BBEA 4M15A 4C4IA 2C6MA 5FBNC 4ACMA 2BILB 4RX9A 1J91A 1J3HA 2WNTA 5M4IA 4AGUA 3LE6A 3NYXA 3KGAA 1FINA 4IM3A 1LEZA 1P2AA 3QQHA 4UMTA 3AMYA 4CT2A 4EJNA 4ENYA 1W2FA 2ZM3A 3IG7A 5AADA 3DBCA 4IWOA 3LFAA 4L6QA 3R71A 1OGUA 3D7TB 5LXMA 2XNPA 3SXRA 5KHXA 3G9LX 4HVDA 5IA4A 1ZMUA 4FTRA 5HG8A 3JY0A 5JN2A 5FXQA 2A1AB 1UVRA 1ZY5A 1A06A 3DS6A 3PE1A 4R3CA 3I1AA 3ZTXA 4ZTNA 2CLXA 3KRXA 2J0IA 4FV7A 3A99A 4NIFA 2I0VA 3D5WA 4LG4A 1O6YA 2GNIA 3ML1A 5IQEA 4HGSA 3P7CA 5BQ0A 2R4BA 2F2UA 3FKLA 3LCOA 5AR4A 5BYZA 3U54A 5M06A 4FVRA 2WTWA 1KUTA 1XH7A 2G1TA 5DT4A 5IQCA 4WBOA 3U6IA 3G2FA 2GDOA 2ZFYA 4M66A 4IX5A 2R3IA 4M13A 4IX4A 5DH3A 5D10A 1FVTA 3PPKA 4JX3A 4QYYA 3WI6A 4YZBA 1HCKA 4TT7A 1OL1A 4LL0A 3SQQA 3GU7A 4XG2A 5L8KA 2ONLA 3EN4A 4FKLA 3QRTA 4I93A 4U80A 3CQWA 1ZMVA 3F9NA 5AR2A 5HKMA 4BRXA 3ANRA 3ATTA 4KIQA 3GNIB 3RPOA 2PVLA 4I94A 3RAIA 1V0BA 1JOWB 4ZS4A 1H08A 4X6RA 1NXKA 3BE2A 2QR7A 4LRJA 3WF9A 3L1SA 4QP8A 5B2MA 3NMUF 2VTLA 3HV7A 5C4KA 2CNVA 3VW8A 3EKKA 4ACGA 2OFVA 3O7LB 4ZY4A 4GG5A 4ANLA 4G3GA 4JAIA 2W4KA 2NP8A 2ERKA 4JMQA 1UWJA 1ZAOA 3ORXA 4ZXTA 3BHTA 4QYGA 3MESA 4C8BA 5A4TA 1U54A 2AQXA 4LMUA 2QOLA 4IMYA 1ZWSA 2VWIA 2XK4A 3DJ7A 3KVXA 4TWPA 3VQHA 3KXGA 4FKWA 3QC4A 4LL5A 4ASXA 3B2WA 2VWBA 3BU6A 3OW3A 5CSVA 2Q0BA 3GI3A 4RWJA 1MRUA 3QZFA 2VTNA 3E3BX 4HJOA 3ZDIA 1M52A 2WPAA 3F5GA 3RHKA 4TZRA 4PDPA 3CTJA 4FIFA 4DYMA 3ORKA 4X0MA 5LVOA 5EW9A 3DK7A 4X2NA 3HA6A 4XHKB 3ZEWA 4OTFA 3NLBA 5B2LA 3AC8A 2ITVA 2DYLA 2A0CX 2XNOA 4EI4A 3EFWA 3FDNA 3R00A 2IW8A 4CFUA 5I3RA 5EI8A 4PX6A 4IQ6A 5HI2A 1PKGA 2UW9A 4J98A 4KKHA 3RZFA 4DEEA 2BZJA 2V7OA 4G6OA 3QTRA 3EQHA 4K0YA 4U42A 3KC3A 4JR7A 1H28A 2XIRA 2ZVAA 3R7UA 5ETCA 4DH8A 3EH9A 4RC3A 2XEZA 2XK7A 4D4RA 2RFSA 2XKFA 2W96B 3VHEA 5JSMA 2E9NA 3FI4A 5B2KA 2VRXA 3VS0A 3U55A 3BQCA 2R0UA 2XKCA 3GOPA 3SG8A 5M09A 3VNTA 2REIA 3R1NA 1XJDA 3VULA 2CNQA 2XJ0A 2VTAA 4KABA 1OMWA 4O27B 4TYHA 5TF9A 3WILA 3Q5IA 4PUZA 3SX9A 1Q61A 3TUCA 2B54A 4RFZA 2PK9A 4W4WA 4IAIA 5D12A 3OUKA 4EBWA 4DGGA 5EOBA 5HTCA 5I9UA 3FE3A 4MBJA 4O7WA 2YN8A 3ZONA 2C1AA 4HYIA 2WMVA 4M68A 2FA2A 4AG8A 4AN2A 3C5UA 4BYIA 1W84A 4YP8A 5M51A 4L44A 4JG8A 5KO1A 3RGFA 5DRDA 5KNJA 4MNEB 1F3MC 4FNZA 3UPXA 4AW0A 4IACA 3TEIA 3Q5ZA 1YXVA 4ENXA 3BYSA 4KINA 4EH2A 4KIPA 5CT7A 5G1XA 4W4YA 1WBPA 4PF4A 5CAVA 3FL4A 5JFWA 2B9JA 1HCLA 2YM8A 4RWKA 4CFWA 4E6AA 4HVSA 3ZLSA 5CX9A 3A8XA 5HBHA 1JBPE 4L00A 1OKWA 4FSZA 3TZ8A 3IO7A 2P2HA 3ROCA 4CMTA 4PDYA 3UZRA 4D0WA 2YM5A 3D5UA 1AGWA 4KRDA 4U5JA 4FICA 4ZP5A 4UWCA 4Z9LA 5BV3A 2X0OA 2IVUA 4EKKA 4WD5A 5CENA 4IM2A 4NTSA 3NS9A 3CC6A 3RK7A 4BDDA 5JGAA 2UZOA 5DFPA 5KKRC 4PL5A 4NCTA 4S32A 5HCXA 5HVYA 5BVWA 4XG4A 5AR7A 3QQLA 5AUYA 5AAFA 4DGMA 5AA9A 3UZTA 4ANOA 3V01A 4LGHA 4MXCA 2VO7A 3U4UA 4QMSA 4BTFA 1JQHA 4JAJA 5D9HA 4Z7HA 4QYHA 5TE0A 4JDHA 3R0TA 1GZKA 4RJ7A 2W5HA 4KIOA 2GQSA 2PUIA 4BWKA 4QMTA 3V5QA 1H1SA 3F2RA 3MJ1A 2BZIB 4K9YA 5JH6A 3LCDA 4ZZOA 5LVMA 4FZ6A 2ZV8A 3H30A 3QA0A 4BDJA 3VBWA 4DCAA 5EI6A 4F4PA 1UNHA 4O2ZA 4OTIA 3HRCA 5ANJA 5EYMA 1I09A 5CF4A 3CLYA 3D83A 3QTSA 2HAKA 2F9GA 3QD0A 3Q9ZA 5HHWA 5KMNA 2VX0A 2ZV7A 5C9CA 3MA6A 2J7TA 5AX9A 3UOHA 4C3RA 2CGVA 2EB2A 2ZOQA 3LXPA 5AV3A 4DF3A 4DEBA 3R73A 4EOJA 2J50A 4EOSA 4A9TA 3VRYA 1YHVA 3JXWA 5H2UA 2EWAA 4AUAA 4AZWA 3JR1A 2C0TA 4O0XA 1KWPA 3EQGA 1OIUA 3HP5A 3KXNA 3LMIA 3TIYA 2YHVA 2WQBA 3O8TA 3PJ2A 4NM0A 4QQCA 3MH1A 4G3DA 2W1EA 1U46A 3VW6A 1PXPA 4ERWA 4I24A 5CSHA 1SM2A 1H24A 4DFXE 1JSVA 1WBTA 3PG1A 4MXXA 3BWFA 3WIKA 3WZDA 2HCKA 4RPVA 4AW5A 4F7JA 1S9IA 3PY3A 2YITA 4QQ5A 5GINE 3AGLA 4TL0A 3RALA 1FVRA 3ENMA 4FTIA 4Y73A 2E9OA 4R3RA 4PRJA 4TW9A 5T3QA 4NM3A 5LMBA 5JQ5A 5IG1A 1KE7A 4X2KA 3O50A 3DV3A 4O4DA 3RCDA 5C8KA 4O1PA 2HYYA 4PMPA 5C8NA 1CM8A 3W2QA 5C01A 4Q5HA 3G6GA 4PTGA 2BPMA 3TZMA 4A9UA 2XIKA 4LQMA 3QX4A 3W2CA 4JT3A 4ITHA 3R28A 2QG5A 3VUDA 2OG8A 3NW5A 4G3EA 3CKXA 3OROA 2WEVA 4KBAA 4NWMA 3SW7A 1ND4A 3UDBA 1P14A 5EW8A 4EBVA 4FR4A 3VN9A 4FV0A 4MVFA 2R3JA 2QLUA 4B8MA 4R78A 1PRYA 4JR3A 3OMVA 4W4VA 5EOLA 3L9PA 3E88A 4U3YA 4LYNA 3R8PA 5E4HA 2FGIA 3KN6A 3MIYA 2VGPA 3CP9A 4HW7A 3C4XA 3KK8A 4MTAA 4Z3VA 3C4EA 4QP3A 2ITQA 2IZRA 5FD2A 4BFMA 3TCPA 4E5AX 1KE9A 4PNKA 4P90A 3OBGA 5FBOA 1FMKA 2OFUA 5HE2A 4CGAA 5HLWA 3LCKA 3PVUA 1DAYA 2OZAA 4C36A 4DAWA 2X2KA 4G34A 4UMUA 4AX8A 5CQUA 2F7XE 4OTPA 5I9VA 5TO8A 3VRZA 2XNNA 3A7FA 4M97A 4BDCA 4BF2A 3ATSA 2A19B 4ZTSA 1E9HA 2R3GA 4M12A 4CVAA 1VZOA 3FMKA 3HEGA 3QRIA 1JKKA 3ANQA 4CQGA 3FC2A 4BI1A 3RAWA 2VWVA 3AT2A 4FNXA 3PXQA 5EM8A 5E91A 4EH7A 3MS9A 3IDPA 5HU9A 2I1MA 4RIWB 5A54A 4D5HA 4HCUA 4CD0A 4F0FA 4FEUA 2WFYA 3W55A 4CZUA 2E2BA 4IB5A 4IHPA 4TXCA 2HWPA 3NUNA 5CALA 2PSQA 3AG9A 3HV4A 1GJOA 1YRPA 4YC6A 3KCKA 3OCTA 4E26A 4CT1A 5E8SA 3BRBA 4E8AA 4F7NA 3VBQA 5IH4A 3V5TA 1KSWA 3BHYA 1M7NA 3N51A 3R01A 3MVMA 1Y6AA 3PFQA 4LMNA 4RIXB 3NCZA 3QQKA 4GT4A 4N70A 3U9NA 5FTGA 4QRCA 3COMA 5IA2A 5IA3A 5M4CA 5H8GA 2R3NA 4GG7A 4NFMA 2PE1A 3FHRA 3F3UA 4FVPA 4HYUA 4KBCA 5BVKA 3WZUA 4DGNA 3KIOC 3HV3A 3SRVA 4RFYA 5A4QA 3EN9A 5DEWA 2LGCA 3RNYA 3FSFA 4TTHB 4FTQA 2C6LA 3GC7A 5AR8A 3DOGA 3Q60A 4YJRA 4C3FA 2W1HA 4F70A 4BCPA 3PUPA 4EUTA 1GZNA 3DU8A 4TRLA 3CJGA 3SDJA 2F7EE 3RPVA 5HBEA 3OZ6A 3KY2A 4H1JA 3ZSIA 5HORA 1OBGA 4CLJA 4UBAA 4BY9E 4MNEA 2YIQA 5FP5A 3I6UA 4DEHA 4O21A 3MA3A 2XH5A 4KUJA 2QOKA 4FGBA 3F3WA 3ZM4A 3PA3A 2HK5A 3ERKA 4WBBB 5KZIA 4YSJA 5J7HA 3EKNA 2QCSA 3R1QA 4C35A 4CYJA 3RTPA 2AEGA 1Q4LA 4G6LA 2R3HA 4AGWA 3N4TA 3ORZA 3F69A 4BDHA 3BCEA 3LFDA 4ASDA 4DEDA 3ZLYA 4AP7A 3VQUA 4RIYA 3L8SA 3LFNA 5EFQA 4XP0A 5KKRB 1W2CA 4RJ4A 3NUYA 3R8MA 4FTAA 4UMPA 2BROA 3UQFA 2OH4A 3OEFX 3C1XA 2XK3A 4MEDA 4O0YA 2FO0A 2PL0A 2UW4A 4O96A 3PIXA 2IF8A 3V5WA 4R7BA 4TNBA 2RF9A 1ZYSA 4O38A 2R7IA 3HV6A 2QNJA 3ULZA 2ERZE 3FV8A 3LJ1A 2W99B 3QL8A 3VVHA 2XAMA 1TQPA 2QU6A 2YIWA 4XG8A 4BYJA 4C02A 4D2PA 2BRMA 3P7AA 4F9WA 4I0RA 5CXHA 2XZSA 4C4EA 3UYTA 4YJPA 1IEPA 1RQQA 3UP2A 4XG6A 5HNBA 3ZFMA 4CRSA 5FDXA 2E9VA 5EK7A 4FIGA 4X3FC 2PVMA 4RQKA 2OSCA 2YABA 3CJFA 4FT7A 4KRCA 4BKJA 2CJMA 5CSPA 3QXPA 5KHWA 4FA2A 3L9LA 3DXNA 3NNWA 3QQGA 2BALA 4UWYA 4EJ7A 4FTTA 4KA3A 3SOCA 5CXZA 3IOKA 2X6EA 3W16A 3SG9A 3A4PA 4I3ZA 3KXHA 2YCRA 4FTJA 2IZTA 1LP4A 2YAKA 2YEXA 3HZTA 3II5A 3Q4UA 1XBBA 5JRSA 4BIDA 3H0ZA 3MY0A 4G5JA 3QZGA 3V8WA 4CG9A 3BGZA 2PZ5A 2W1FA 4GYIA 1VYWA 3HLLA 2O0UA 3CY2A 3DAJA 4GU6A 1GIIA 5LWMA 4I22A 1G3NA 3HGKA 3NAXA 2WAJA 1QPCA 3PP0A 4EHZA 3PYYA 5HGIA 4NJ3A 4CFFA 2X9FA 3S3IA 1AD5A 4L01A 2VV9A 4JQ8A 3EFKA 4RVLA 4F6WA 3NGAA 3VBXA 4OTQA 3WYXA 2QONA 2Y7JA 3BI6A 4GVAA 4O4CA 4DT8A 2H9VA 3EIDA 3PXZA 3RPRA 2ETKA 3M2WA 3GXLA 3WF8A 3ZFXA 4C34A 3PXKA 1J7IA 2XB7A 5CTPA 4EOMA 4A4OA 4DCEA 3QTXA 3G51A 4APCA 3I7BA 2QKWB 1MRVA 4R3PA 5DMZA 2R3LA 3NUXA 2CKEA 2PVKA 4FZFB 2JDSA 4KD1A 4RX8A 5DT0A 3V3VA 4D2WA 4AA0A 4IANA 3Q2MA 1X8BA 4YZ9A 3RI1A 4CMOA 3FMEA 5FEEA 1SZMA 4UMRA 4C61A 3WZJA 5H3QA 3DJ6A 3QU0A 4E5WA 3FXXA 3NSZA 5EM5A 4DHFA 2VAGA 3IW6A 3AC3A 3PPZA 1ST4A 4NTTA 2OICA 4JOAA 4C3PA 5EKOA 3UDSA 4LFIA 3TWJA 5EG3A 3FZSA 4C2WA 3R9RA 3W0RA 5HO6A 1ATPE 4J53A 3OTUA 2HZ0A 3IW8A 3LOKA 5HU3A 5J1VA 2XK6A 2BUJA 1LUFA 1YOJA 3PSBA 2PYWA 1NT2A 4CFXA 2X2MA 4D9TA 3FEGA 3TACA 2R3RA 4QTCA 4YZNA 3OP5A 4ZZNA 3UG1A 4FEXA 3LVPA 4BI2A 2YM3A 3NVKI 3BLRA 3O96A 2NRYA 3FKOA 3KRJA 3BWJA 4FKVA 5CSWA 4BGHA 3TZ9A 3A7GA 3R7GA 5AUZA 1RJBA 4RGJA 2BFXA 4C0TA 4UY9A 1CKPA 1W7HA 4C7TA 5FM2A 2WO6A 2C3KA 3DB8A 4OBQA 4QMYA 4YJSA 2ZMCA 4R1YA 5JT2A 5D41A 3BV2A 3ALNA 3QRKA 5CEQA 3UMXA 4IZAA 3KXMA 3MWUA 3VUGA 4YJUA 2JAVA 5IEXA 4ARKA 1NVSA 2I7QA 5A14A 2VWUA 2IG7A 3SKCA 4AXCA 2UZDA 1T46A 4H1MA 5BVNA 1TZDA 4LDTA 3C13A 4PMTA 3OCSA 3COKA 4FK3A 2EVAA 5LARA 1Y57A 2CGXA 2G2FA 3ORIA 2YLFA 2XRWA 2G9XA 4JBOA 1Q62A 3MYGA 4EK3A 3FI8A 4EOLA 1ZY4A 2F4JA 2VX1A 4CV9A 4N57A 4XRJA 4C4HA 1Y91A 3C0IA 5J7BA 2AYPA 4YMJA 2W9ZB 5JFXA 3CSVA 2J6MA 2QVSE 3KU2A 5IKWA 4EKLA 4IB1A 4IWPA 2XIZA 4E4NA 1XQZA 3ZH8A 4F9CA 3PJCA 4MH7A 3JUHA 1R39A 3CY3A 5H9BA 2JD5A 4RJ6A 5AMNA 4J8NA 2GNFA 4NIFB 2WMBA 2W17A 1UU9A 5A9UA 4G9RA 4XP3A 3S00A 5J5SA 3WBLA 5LCJA 3KULB 3VUMA 3FMDA 4U3ZA 3Q9YA 4K8AA 4NK9A 3PG3A 4X7QA 2X4FA 4R5SA 4P5QA 2CKOA 4JJRA 2OXXA 2H6DA 1R0EA 1YI6A 3NUPA 2X7GA 5JZJA 2UVYA 3BYMA 1ZRZA 4BDBA 3R7EA 3HUCA 1J1BA 3DLZA 4F09A 5CANA 4RT7A 1IR3A 3ZRMA 4I0SA 4DT9A 5DT3A 3UVRA 4EL9A 3IGGA 2YAAA 4L7SA 4NSTA 5GZ9A 3V8SA 2R5TA 4CFMA 1MQ4A 1PMNA 3OT3A 4AGDA 2GNJA 2I0YA 2B52A 5AV2A 4J96A 3E92A 3TZ7A 4AGCA 2JIVA 4CCBA 4EC9A 2FSOX 4WNKA 4RIOA 3UVQA 2I0EA 3VUHA 4N4SA 3ZM9A 2BRBA 1P4OA 2GHLA 2PHKA 3GVUA 4TY1A 4FKGA 4DH7A 3ZOSA 1EH4A 4PP9A 1FOTA 4YHTA 3ZSGA 3D9VA 4H3BA 1OPKA 4PTCA 4ANMA 4QMPA 3ZLWA 4CKIA 3O8UA 4FKTA 4QYFA 4W8DA 2G15A 4PL3A 2C6EA 1OB3A 4XOZA 3RAKA 5AP2A 4D4SA 3CTHA 3L8VA 5IDPA 2PE2A 4BN1A 3LFBA 4M0YA 4DEAA 5IQIA 1W83A 3IW5A 2GU8A 4LGGA 1XH5A 3PRIA 4DC2A 4DFLA 2DS1A 3FZTA 4GIIA 3W0MA 3NNXA 5E8ZA 2WMUA 5EM7A 3IGOA 4ID7A 5HLPA 1QPJA 2JBOA 2OF2A 4FMQA 4O0SA 1M17A 2W5AA 3TUDA 3HAVA 3L8XA 3NDMA 2J4ZA 2IN6A 4H3PA 2HXLA 3TXOA 1V0PA 4QMNA 3ENHA 2J0JA 3CPCA 4FG7A 4DLIA 2UW0A 3NIEA 5J79A 4FTCA 5KE0A 4AE9A 5M4FA 4FSWA 2PU8A 4FGRA 4O6LA 2O63A 4JRVA 5K9IA 4MX9A 1V0OA 2GS6A 3I4BA 4IAAA 3R83A 4BVUA 4A4LA 1H1RA 4YNOA 2YIXA 2UW8A 3W10A 3IW7A 3H10A 2W4OA 4O0WA 5E8YA 2W1CA 3C5IA 1YOLA 4GL9A 4XP2A 3FQHA 1GOLA 2IVSA 1OUKA 3HMOA 3MDYA 5AV4A 3TKIA 4PP7A 5CYIA 1ZOGA 2YM7A 3E87A 4BZDA 3VAPA 5AV1A 4NH1A 3RJCA 3ZEPA 4B4LA 3EYHA 4YC3A 4L7FA 2CKQA 4HZSA 3BGPA 3FMMA 4K77A 3EJ1A 4IVAA 1JKLA 1TQIA 5TKDA 3VF8A 3ZRKA 2B1PA 4X2FA 3FMHA 2I6LA 4A9SA 2GMXA