5BMSA

Crystal structure of p21-activated kinase 4 in complex with an inhibitor compound 29
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Structure-Guided Design of Group I Selective p21-Activated Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bmsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bmsA01
4JR7A 2Y6OA 1LR4A 4HYIA 2JIIA 1TQMA 3ORXA 4XNEA 5BQ0A 1DM2A 5LMKA 1DI9A 2VNYA 1KV1A 3FZTA 3GEQA 3Q9XA 4X2KA 3SVVA 5KHXA 4LUDA 3HNGA 3WYYA 1MQBA 1OI9A 2YCQA 4FL3A 3HEGA 3UIBA 4IDVA 2PUUA 3D7TA 5T3QA 1JLUE 3WYXA 4A07A 3O7LD 4DYMA 2PMOX 3NCGA 3MB6A 4KIQA 4ZTQA 1HCKA 5BVFA 3BU5A 2X2LA 3IKAA 2IZUA 4M68A 4XBRA 3HUBA 1KE9A 2BRBA 1U5QA 5BVEA 4I23A 3FWQA 2QOIA 1H8FA 1PXNA 4JLCA 3DLZA 2QONA 4BKZA 1XHAA 4L3PA 3GU5A 3S1HA 2XNMA 4H36A 4IJPA 3PFQA 4E6CA 3PY1A 3LJ0A 1H26A 3ZO2A 4JRVA 4YZDA 3QD3A 3DNEA 1J91A 1W82A 2BZJA 3KRXA 3E8EA 4O0SA 5IKWA 4BICA 3VRZA 5EHYA 5M06A 4QTEA 3PXZA 2BAKA 4FVRA 4XH6A 4TW9A 2AUHA 5AV3A 4MWHA 3C4ZA 2R64A 4JAIA 4YJRA 4CRSA 3AG9A 3LOKA 5KNJA 5J95A 2IW6A 3LXNA 1IR3A 3P79A 5BMMA 2Y4IC 2Z7RA 4HGSA 4IAFA 1BMKA 3CQEA 4QP6A 4AGDA 4BL1A 1ND4A 5BYYA 2C1AA 3TKIA 2W4JA 3A4OX 3L9MA 3VBXA 4DINA 1YHWA 4EHGA 1OBGA 4F9WA 3V5TA 4RIWA 2VTNA 2DQ7X 2JAVA 3IDPA 5IQFA 3AT2A 3EL8A 2O64A 4QPAA 5FEDA 3CS9A 3FMJA 2PVFA 5HICA 5KMOA 3NSZA 3GGFA 1GIJA 2C4GA 3W2OA 2ITQA 2PK9A 2C3LA 3C9WA 4U44A 4YTHA 5L8KA 5M53A 2YDIA 3ZLSA 3W16A 3CD8A 3PVWA 3QZGA 3O51A 3PJ8A 4RPVA 2UW7A 3BIZA 2BILB 5HTIA 4BR3A 3MVJA 3N4VA 3LXPA 3RZFA 3DTWA 3R83A 4N70A 3OW3A 3T9TA 1M7NA 3R0TA 4PNIA 4EK5A 5IA2A 3NX8A 5HE3A 1OPKA 5DR9A 4RJ7A 2CKQA 1CSNA 1ERKA 4ONAA 3R9OA 4NM7A 4CZUA 2OIDA 2VWVA 4Y83A 4DBNA 5A4EA 5IUHA 3GB2A 4C2WA 2VTRA 4CFFA 2FA2A 3F7ZA 3PXFA 5F9EA 5M07A 5TO8A 2G1TA 3FMDA 5E9EA 3OXZA 5LVOA 5TR6A 3H0ZA 2B0QA 4HCUA 5LWMA 4EUTA 2R5TA 1W0XC 3CQUA 1R3CA 3A7HA 5J5SA 5AJQA 5AV1A 1SMHA 1SZMA 3PJ1A 3FL4A 4BCNA 4AT5A 4YU2A 4S33A 5AP2A 4QP3A 1IAHA 2ETMA 4X6QC 4MD9E 1TQIA 3QKKA 4FODA 5BVDA 4KUJA 1AD5A 2XKCA 4WBBB 5CNNA 3M2WA 2W9FB 3SHEA 4JOAA 2IW8A 2W05A 4U6RA 2R3IA 2ZOQA 3EN6A 4EH7A 3QZIA 4TRLA 3FI8A 4EBWA 4ACGA 3R7GA 4FTNA 2CN5A 4I5CA 4RWIA 4C34A 1QCFA 2Y9QA 3C4CA 2XJ0A 4B6LA 2YZLA 4OBPA 5ANIA 3ZH8A 2J50A 2VZ6A 3C5IA 4QO9A 4C8BA 4BCGA 3O2MA 2HXQA 2QURA 2CHLA 5IA3A 2CCHA 3AXWA 4PDYA 3D4QA 5CEOA 1VEBA 3AD6A 5HG9A 4YJUA 4EOIA 3HDMA 4HZRA 4XUFA 5GZ8A 5CI6A 2O65A 1IEPA 2PULA 2PVRA 3AC4A 4XG7A 2R3MA 3KA0A 4GUEA 4O96A 4UYNA 2RL5A 3FMLA 4GU9A 5JZNA 3AC1A 5HNGA 4CZTA 4YTCA 4HVHA 1Q8UA 4GV1A 4FKSA 4KRDA 4DGLC 4RJ3A 1GY3A 3QQFA 4G6LA 2HXLA 3LFNA 4RJ4A 4XOZA 5HEZA 3DBEA 3RPYA 3WBLA 4EHZA 5IH4A 2YHVA 1ZZ2A 2PZYA 3GUBA 4I41A 4W4VA 1YWNA 4TL0A 3KXMA 5HORA 2J51A 4GFOA 4X3FB 2J0KA 1T45A 4TYJA 4O7WA 2R3HA 3CKWA 3TNIA 2CGXA 2C6KA 5M57A 4EOMA 4IIRA 2JDVA 4XHKB 3I5ZA 1JBPE 2C68A 2WTWA 3HMNA 2OZAB 3NUNA 3DLSA 3E7OA 4O0VA 3JPVA 3TKUA 4C4EA 3TZMA 1XBBA 3GFWA 5CI7A 1Q8TA 4M8TA 2HW6A 3DXNA 5EDPA 5FM3A 2W7XA 3R7UA 2P33A 3UNJA 4ANBA 2XKFA 4PTEA 2VX0A 4D1SA 3OTUA 4NSTA 4OGRA 4QYGA 4GH2A 3RALA 3TCPA 5AUXA 3PY3A 5GZ9A 5AR7A 5T68A 4NK9A 3UIXA 4C3PA 4Y5HA 5CXZA 5LVPA 4M14A 5TOZA 3EYGA 2YWVA 2ETKA 1NT2A 4BGGA 3COIA 3DZOA 3R9RA 2YWPA 4N0SA 3RPRA 3OC1A 3RJCA 4ENXA 1OKYA 2CN8A 2OZOA 3LAUA 4MD7E 5IQGA 2NNWB 4GT4A 3DKGA 4IX6A 4U43A 3WE8A 2PZRA 4UMPA 3VHEA 4L68A 3U6IA 1UNHA 4FSRA 3KN6A 3MWUA 4R5YA 4ANMA 5LMBA 2PWLA 3QD0A 3G51A 1E1XA 2ETRA 3LM0A 5DR6A 4AAAA 3DK3A 4L7SA 5CAQA 3NNWA 3GP0A 3BYOA 1OIRA 1K3AA 2B53A 4E6DA 4X2GA 3IGOA 4HOKA 3JVRA 4J52A 3POZA 4FV8A 4BIBA 5BYLA 3IW7A 4GYGA 4MBLA 2CNQA 3R8MA 1XBAA 2PHKA 3TV7A 3KXNA 5AUTA 3PVUA 4F6WA 3KKVA 4JDJA 3S2PA 5BNJA 5JGBA 1H08A 2R3JA 3T3UA 4W8DA 3C4XA 2GNJA 2UW6A 3A60A 3R01A 2QNJA 4I5HA 2WMWA 4RX8A 4TNBA 5L2WA 2WQNA 4AZTA 2QLUA 4FX3A 2WD1A 4LI5A 5I5ZA 3DB6A 2RFSA 5E8ZA 4D1ZA 1FINA 5HU3A 3FAAA 4KIOA 4ZP5A 5GJGA 4NYEA 4C3RA 2Y4PA 3G33A 4OTQA 1RQQA 4S34A 4Y72A 5DA3A 5E8TA 5EG3A 5CAUA 5I9YA 2EVAA 3HGKA 4KNBA 3CPCA 3ZM4A 4BDAA 3QX4A 2IO6A 3EIDA 3WILA 4D4VA 3D0EA 2PVHA 4CT1A 4JIKA 2HELA 1ATPE 4H58A 5CEIA 1QPCA 5E8VA 1QPEA 3QKMA 2W5AA 2QHMA 4O2ZA 4D0XA 3C1XA 3BV3A 3PA4A 4FYOA 5F94A 1JVPP 1VYWA 4AGUA 1XKKA 5KMIA 2A4LA 4L01A 1E1VA 4FZAB 3VAPA 4H3BA 3MYGA 4XV2A 5EYMA 4BCMA 2A19B 3FZOA 4F6UA 5AIRA 1A9UA 3P7BA 3PPKA 5AR8A 3BHYA 4XJ0A 2NP8A 1Z9XA 2UV2A 2XCKA 3A99A 3VF8A 2H9VA 3OWKA 5E4HA 1W84A 2VWWA 3ALNA 3PLSA 3ULZA 3DQXA 2HOGA 2OW3A 5ETFA 5K9IA 3HZTA 4FTOA 3UMXA 3ZOSA 4EYMA 4R7BA 3PA5A 4PPCA 1Z5MA 3MN3A 3BHTA 5KUPA 1CM8A 3I0QA 2C3JA 3I7BA 1UU8A 1WBVA 3MSSA 4XMOA 4Z3VA 2OLCA 4BBMA 3KFAA 3QRTA 4B8LA 2WU7A 4V0GB 4BCIA 2WEVA 4QTDA 1KOAA 2XCHA 2ZV2A 3GOKA 5CEQA 5EKNA 3DNDA 3I6WA 1KV2A 3FZ1A 4RWKA 4W4WA 4IWPA 4ZJIA 3WF9A 3FY0A 2WQEA 3SXFA 3ZO3A 5BVWA 5A4CA 3LFSA 4O6EA 5BUJA 2GCDA 1DS5A 4LOOA 4IC8A 3HMIA 1WZYA 4II5A 3ZLXA 3U54A 4BY9E 3BYUA 4YPDA 2Q0BA 2XEYA 4MBJA 3KMWA 4YC3A 1IG1A 1XH6A 4MEDA 3UQGA 3UVQA 4TT7A 3DJ5A 3SXRA 3I81A 4PMMA 4BCPA 4FV0A 4U41A 2J0LA 3VO3A 4G16A 4AN2A 4HJOA 1M2RA 4C38A 5JH6A 4MXOA 1Q41A 5AV0A 1XH4A 2C5OA 3OUKA 4FMQA 4TYEA 5CU6A 5E91A 5CSPA 3MPTA 5C01A 3V5LA 5CWZA 5BVOA 3E3PA 2GTNA 4EORA 3IS5A 3OUNB 3ZZWA 4K6ZA 3QCQA 4I24A 4PDOA 4R77A 2O0UA 3F3UA 3IGGA 3S95A 3TZ8A 2G15A 3ANRA 4XG8A 4TWNA 3D5UA 4M15A 1U54B 3R63A 4CV9A 2WEIA 4OAVB 2UVXA 3AMBA 3CCNA 5HTBA 3NIZA 4U97A 5DBXA 3PSBA 4AGCA 4D9TA 2VTOA 4AGWA 2I0YA 4EWQA 4O27B 1WAKA 2DWBA 4YPSA 3COHA 5FQDC 4FL1A 4AW0A 5IZFA 2CNUA 3HAMA 4O7ZA 4RFZA 5E90A 2WOUA 4NU1A 3B8RA 2ERZE 3MPMA 5IUIA 5LOHA 4KS7A 2OXDA 3BHHA 4GCJA 4FZ7A 5CASA 4Y46A 3U8WA 3D94A 2P2HA 1G8AA 3BEAA 3P7AA 3P0MA 4NIFB 4KIKB 3I60A 4FKRA 5HKMA 2W1HA 5DVRA 5JFVA 4G5PA 3LMIA 4BZDA 4RGJA 2WTIA 4P4CA 1M14A 1OL1A 1GJOA 4IJ9A 2IZSA 3PLAE 5M4FA 3BYMA 4DBXA 4QMLA 1H0VA 1H1PA 5FTGA 1YXTA 3P5KA 4BDGA 2FH9A 1OECA 2W17A 4UWBA 5CANA 2X7GA 2ITXA 4QPSA 5FGKA 3VS1A 4CLIA 3QC9A 2REIA 4FSNA 5LQFA 4BFMA 4EH4A 1URWA 3GQIA 4ACHA 3MS9A 4EQMA 2EB2A 2A2AA 5E7RA 2GQSA 5EQEA 4YSMA 3OY1A 2FUMA 2J6MA 1J7UA 3I4BA 4A9UA 5J7BA 4YZNA 3TACA 2W4KA 3GC0A 4FIFA 1V1KA 5HVJA 5IQHA 5CT7A 4LM5A 3F5PA 4PNKA 3VVHA 4G3EA 1H0WA 3LW0A 4GVAA 1H1RA 3EOCA 4PMTA 4RQKA 4CD0A 2B9IA 3V3VA 5EW9A 4IB1A 5CVHA 3NUYA 4M0ZA 5AUYA 5CLPA 2XEZA 2YIRA 3HDNA 4NM5A 2J0JA 4O1PA 3LMHA 4PF4A 4AT4A 2BAJA 5IQAA 2XK4A 4P5QA 3D2IA 5HBJA 2BKZA 3ENHA 5I3OA 4FEWA 3FUPA 4BI0A 3NVMB 3FMKA 2WAJA 3W2RA 4NW6A 4E26A 3UJGA 1XH5A 4O7VA 2BIKB 4TNDA 2WIHA 4QP8A 3PZEA 3BGQA 3AC2A 3ORLA 4E20A 3QQKA 2VWBA 2XM8A 3A61A 4JG6A 4AW1A 3NDMA 1NW1A 5I0BA 2FO0A 1PHKA 5HBEA 4MNEB 2PZ5A 4F1MA 4I0TA 1SVGA 3ANQA 1Y91A 4EC8A 4FEXA 4ZTRA 3VS3A 5EK7A 3FKLA 5GHVA 3DGKA 4F70A 2RFNA 3MW1A 3QQUA 3QRKA 4GK2A 5GJFA 3OXIA 3U9NA 5DPVA 4HPTE 3R00A 5M51A 4PDSA 1YXSA 4FIJA 5EKOA 5KMJA 3GU4A 3S00A 5FG8A 4FIEA 1H27A 1ZOGA 1OL6A 2JAMA 1PXOA 2HY81 2QO7A 3GBZA 3C7QA 3LE6A 3OMVA 4BIDA 3W32A 3MFUA 5J79A 2VU3A 4YLLA 4IM3A 3JY9A 4DGOA 3W2PA 4KA3A 2B9JA 4IEBA 4BDKA 3CY2A 4FV7A 4EUUA 3ATTA 4YLKA 3Q2JA 2OK1A 4RIXB 4EYJA 3CGFA 4FSTA 3FHRA 2X2KA 2GNLA 5JRSA 2O5KA 2JKOA 3U51A 4M66A 4BWPA 2YJSA 1BYGA 3ELJA 3BELA 4DFLA 2OICA 4L8MA 5FDXA 4EH2A 1HCLA 3KK8A 4KB8A 5EHOA 3KN5A 2RSVA 3ORMA 2UUEA 5FEQA 3ZM9A 5KZIA 3H4JA 4KSQA 3AD5A 4AFEA 1S9IA 1PMNA 3QX2A 4LQMA 4Y5QA 4AE9A 4AW5A 5AM6A 4A9RA 2XJ1A 4KKEA 5CZHA 3UBDA 1OB3A 5C8NA 2QG5A 5IH5A 2XNBA 4L52A 3MPAA 5HVYA 4GKHA 3RINA 4QYYA 3VS2A 3O8PA 3QZFA 3RTPA 5E8YA 3VF9A 4DGMA 4ASZA 4UMUA 4PL5A 2ZM3A 4B7TA 5BVNA 2XNNA 3FXWA 1KWPA 2ZAZA 1GZKA 3E5AA 1PKDA 3IW5A 5ACBC 2X2MA 4NM3A 5CT0A 3MBLA 5F95A 4QT1A 1STCE 2X8DA 3KL8A 4M84A 5HBHA 4CFNA 3O8UA 2Y0AA 3SX9A 1KE7A 1SM2A 1PXMA 3IPHA 3JUHA 3Q5ZA 3QXOA 4XP2A 4CFXA 1BLXA 1FGKA 1KE6A 1YWVA 1Y6BA 1UU7A 4QMOA 3VRYA 4LRKA 3MIYA 2ZVAA 3SC1A 4EZ5A 3U4WA 2YCFA 3QRJA 2PVYA 5KZ0A 2WMRA 1F0QA 4A7CA 4BYJA 3EN7A 4PPAA 4LYNA 3FPQA 4IM0A 3CEKA 3FLNC 4FYNA 3C0HA 4B0GA 4FZ6A 2OU7A 3OBJA 4OTRA 4YHJA 1AQ1A 4LMNA 4UZDA 1KE8A 3S4QA 2C1BA 3OFMA 4BZOA 4O91A 5FP6A 5H8EA 3QF9A 1RW8A 4ANSA 4GJ2A 4GMYA 3EQCA 3PVGA 5HQ0A 2UW0A 2YAAA 5BUEA 3PWDA 1RDQE 2VX1A 4XLIA 4G3DA 4C4IA 5KMMA 3HRBA 5C4LA 1U54A 5KMLA 4CGAA 2IWIA 3FI3A 3OW4A 4K0YA 3WOWA 4MWIA 1YXUA 1ZARA 3FQEA 1YXVA 3NYNA 4RX5A 4UN0C 5H8BA 2QCSA 2FSTX 4YJTA 1ZWSA 5HNBA 2O2UA 2DYLA 5KE0A 2V22A 3DK6A 3SV0A 3UC4A 4ANQA 4EOSA 4F9BA 2YLFA 4FKUA 2QQ7A 5DHJA 5I9ZA 4OR5A 4BGQA 5FRIA 4BC6A 4RJ6A 4D9UA 4EOPA 3LPBA 2PL0A 4WOVA 5C1QB 2YM6A 4JX3A 4L3JA 1JPAA 1DAWA 5LARA 1PF8A 1L3RE 1SVHA 4DH5A 3L1SA 4FK3A 2QR7A 5DN3A 3OCTA 2CKPA 4ACDA 4XS2A 5L6OA 4CT2A 4BDHA 1U46A 3G5DA 4KIKA 2EUFB 1FBNA 4TPTA 3CE3A 1JQHA 4DEGA 3RCDA 2BFXA 4WNKA 4J7BA 4JDKA 3O71A 4ZIMA 2R3OA 5AM7A 2XK8A 4FUYA 1ZAOA 2AC5A 3R8ZA 3TTJA 4YBJA 4BKYA 1BUHA 2QI8A 2OIQA 2WXVA 3V5JA 5LXMA 4FKJA 4IFGA 4O0TA 1Y8GA 4UMQA 3RMFA 3V8WA 1GZOA 4O0UA 3GU8A 2GNIA 4C0TA 1YDTE 3EJ1A 3TZ7A 3DBFA 2W1ZA 2OG8A 4G6NA 3FLSA 1QMZA 3ZHPC 5LMKC 3EQIA 1VR2A 2W1EA 4FTTA 5C26A 3VIDA 4AP7A 2BFYA 2XNGA 3SW4A 2FGIA 3FMHA 2OI4X 2VO0A 3WIGA 3MGYA 4EQCA 3C13A 4LL0A 5ACKA 5ANDA 4F9AA 2GFCA 4FKGA 3KRLA 3QTUA 3SOCA 2VWZA 3HKOA 5AA9A 2OJGA 1XR1A 4PUZA 3RHKA 4G1WA 5M08A 1J7IA 2GS7A 3ZFMA 4TN6A 1P14A 4D2PA 3QFVA 3QQHA 5IQBA 2WMUA 4IW0A 4U7ZA 4HNIA 4I92A 4YTFA 5ANOA 4RZWA 3KGAA 4FZFB 2QD9A 2F7EE 4MBIA 5FBNC 3UOJA 1IRKA 4BDFA 3BKBA 4I1ZA 2GHMA 4IX4A 4IB0A 3EN5A 4YO6A 4V01A 1ZMWA 3WZJA 4RC3A 3HMOA 3LFEA 5AR3A 3U9CA 4JI9A 1X8BA 3JXWA 2C47A 4QMWA 3ZEPA 3LQ3A 2F7ZE 4BDIA 5ITAA 4XX9A 2QC6A 3UQFA 3TUCA 1OKZA 2F9GA 4CVAA 5HHWA 2XK3A 3BHVA 4U3ZA 5HIDA 5FD2A 4GUBA 2C6OA 1H07A 1VYZA 4YGAA 3OT8A 4MNEA 3QTQA 4BTKA 3QA0A 3FXZA 5F1ZA 3F7WA 3F5XA 4HVDA 4EEVA 1YQJA 3ZUVA 1Y8YA 4U80A 2IN6A 4TYIA 2XBJA 5EI8A 1OPJA 3PVBA 4O38A 4F63A 5HX8A 1Q3WA 4AW2A 4QMNA 1XH9A 1K9AA 1ZOEA 1ZYJA 5IDNA 3QBNA 3QCYA 5IA0A 4KINA 3GCUA 1YW2A 4V05A 3CY3A 5FDPA 4MX9A 3W10A 3N4TA 4EJ7A 4O7TA 4LUEA 4RIXA 4F1TA 4F09A 5TT7A 4O0YA 4FTLA 4J53A 5HG5A 5HG8A 2XK9A 2QOOA 1YDSE 4GYIA 4EOLA 2QU5A 3QA8A 3QCXA 1W98A 4BCHA 1MRVA 2C0TA 2R3LA 2VTPA 4PY1A 4XV1A 3UDBA 4EHVA 2ITZA 5CSHA 3DV3A 2OJIA 3VBQA 5B2LA 1GAGA 3PG1A 2HAKA 3TNPC 5JQ8A 1G3NA 4ACMA 3R9DA 1Q3DA 2H6DA 2B9FA 4OTHA 4OTIA 4R7HA 2OKRA 2G01A 2WNTA 2JDOA 4U5JA 2I0EA 1W8CA 1U5RA 3SAYA 3U4UA 4LL5A 4DFUA 4XLVA 4LGGA 3FZSA 3IO7A 2GS6A 2A27A 3QWJA 3UO4A 3U55A 3MTFA 3I79A 1ZYSA 1FVTA 2V55A 3MVHA 2R3PA 4Y85A 1OIUA 1YOJA 3NR9A 2VV9A 4Q5EA 5CVFA 3C4FA 2GFSA 5LVLA 1H1WA 1PY5A 4QRCA 3MA6A 4IVCA 3BBWA 2YDKA 4G34A 3Q60A 2PU8A 3V5QA 2C6IA 4GS6A 5JSMA 4OT5A 2HWOA 2CSNA 2C0IA 2XYNA 3LXLA 4J96A 3RK5A 3VWAA 4BI2A 2WQMA 3QL8A 2F57A 3ZZEA 4AF3A 4OTDA 1IA8A 3L8PA 2ZMDA 3FLWA 3FDNA 3PJCA 4CEGA 3BE9A 4ZSGA 3Q6WA 4AACA 2JDSA 2V0DA 3QHRA 4QMTA 3VUMA 4O0XA 5C4KA 1YRPA 3G0FA 5CVGA 1KOBA 2GQRA 4OT6A 5AIKA 4CCBA 2J0MB 3EH9A 4L45A 3V51A 3ZUTA 2WB8A 3FEGA 4DCEA 3UG1A 2QOLA 2PTKA 3F3TA 3O0GA 3K5VA 5D12A 3ZXZA 3HMMA 4J99A 2C6DA 3VW6A 4C4GA 4WSYA 5BVKA 4A4XA 3BRBA 3FYJX 4WHZA 4YNEA 1PXKA 3LFFA 4IADA 2IVTA 4M0YA 3SDJA 4RWJA 5A4QA 1MUOA 3IOPA 3MY5A 2I40A 4PMSA 4H1JA 3HV5A 4D2VA 3RBWA 4ZMEA 3DKFA 3K5UA 3QTZA 2UZOA 3OXTA 4ASXA 4E1ZA 5GIOE 4L43A 4AG8A 3VW8A 4WT6A 3PIYA 4FKIA 3H10A 3VS7A 2BTRA 2C30A 2XNPA 2YZAA 4R7IA 2H8HA 3SD0A 5F4NA 3R8UA 4O6LA 3DTCA 2QOBA 3CBLA 3F61A 4YHTA 1G8SA 3Q9YA 4EK4A 4BB4A 1I09A 4P2KA 5LJJA 4NWMA 1XBCA 3TV6A 3VS4A 3WF5A 3LFDA 3QTWA 3QAME 3R9NA 5EQPA 4IH8A 4F7LA 3KRWA 3VN9A 2YM4A 2P3GX 3LQ8A 4Q9ZA 5FM2A 3PE2A 4N6YA 5K3YA 3K2LA 4EZ7A 3PUPA 3ZBFA 1UNLA 3F2NA 5LVMA 2O3PA 3F88A 1JSTA 3COMA 1UKHA 2OH0E 4EONA 4O0RA 3PPJA 3DBDA 3IG7A 3ZLYA 4FIIA 1WBTA 3I0OA 3LFBA 4EOJA 5CEKA 5I4NA 2UZTA 2W9ZB 5IEXA 3JR1A 4FKTA 3QZHA 5IMEA 2VTJA 2WHBA 4UV0A 2UZEA 4OTGA 3PRFA 3VUKA 5AP6A 2WTCA 4ZJVA 3QLGA 3A7FA 4UB7A 4DFYA 4O7SA 4ASEA 5HNIX 5IA5A 1IA9A 3GU6A 4OAUC 2CNVA 3DAKA 4C4FA 3DKCA 3TIZA 5CXHA 5B0XA 3RHXA 3UO6A 3RAHA 3W2QA 3MJ2A 3PDTA 3HECA 5GJDA 2QOQA 1OITA 3CLYA 2CKOA 4EK6A 1U4DA 4G31A 2PVNA 2F49A 5AAFA 3A62A 1PKGA 4CNHA 1OL2A 3HV6A 2B4SB 3RWPA 3ZU7A 3B8QA 4XRLA 5EFQA 1ZXEA 3LFQA 3REPA 1CKJA 4KBKA 3O23A 4YZCA 1CTPE 4IQ6A 3VUGA 3UTOA 2EXMA 5AP7A 4Z16A 4G3GA 4FV9A 4AOIA 4FV3A 4FGRA 2GSFA 2WMVA 3CR0A 2PYWA 1H1QA 1S9JA 4R3RA 2BDFA 3DFCB 2WMBA 4FOCA 3GCVA 3HRFA 2BAQA 4NM0A 4HCVA 4NW5A 3CPBA 3PXKA 4HGTA 4IMYA 4APPA 1OMWA 4QP7A 3E3BX 1BX6A 5JRQA 4M7IA 4AZWA 3P86A 4EK3A 1YVJA 5B2MA 1T46A 5IQIA 4DF3A 5JGAA 1RE8A 5CEPA 4EBVA 4MAOA 3CQWA 2PVJA 2WMSA 3MFRA 5JQ5A 3D2KA 3EQGA 4F65A 4DT9A 3FKNA 3QXPA 4QYEA 2XIZA 3G90X 1JKSA 4H39A 3QRUA 5C03A 4RFMA 5AUWA 5CAVA 1OIQA 1XH7A 4L53A 4YLJA 3S3IA 4A9TA 3AQVA 1WBOA 3F6XA 4QMYA 2J5EA 2QU6A 3PTGA 4G6OA 4KBAA 4N6ZA 3Q32A 4J71A 2P2IA 2OGVA 5AR5A 2GNGA 4LRMA 2HENA 4D2WA 2XM9A 4APCA 2YFXA 4FTMA 4XP0A 3KXHA 4ZTHA 4IANA 4B9DA 2X6EA 5KBQA 1CKPA 1DAYA 5K4IA 4E4MA 2BDWA 2V5QA 1FQ1B 4YBKA 4HYSA 1B39A 3NW7A 3V8SA 2XIKA 2GTMA 3UP7A 3Q3BA 3TKHA 5C8MA 3FLYA 5A6NA 5IQCA 3ZRMA 4GKIA 2HZ4A 4BRXA 1BI7A 2VGPA 5IA4A 3KF4A 2B1PA 3O50A 4EWHA 4FTCA 1G5SA 4F0IA 3MFSA 3PG3A 2P0CA 4W9XA 1Q8ZA 3HA8A 5M56A 3UZRA 4QQTA 3FLQA 3BHUA 3EQBA 1CMKE 3OF0A 1AGWA 1J1CA 3FSKA 3E87A 3E92A 4IBMA 3H9FA 1H28A 2UZLA 3MY1A 2RIOA 1YWRA 2F7XE 5BMSA 5AV2A 2BVAA 1KE5A 4ACCA 3GC8A 1FMOE 4DFNA 3GCQA 4FV5A 4UX9A 3PE1A 4N57A 3K54A 4D5HA 2YJRA 4ERKA 5M44A 5J7HA 2HZIA 3WZDA 3ZEWA 4ALUA 4V04A 4EHEA 1UU3A 4ZSEA 4IAAA 4HPUE 5EOLA 3RPSA 1RJBA 4DEDA 4DE4A 4CFMA 4X2NA 4AX8A 4L9IA 4FTKA 3GOPA 3SGCA 3FY2A 2BRHA 2X1NA 4NKSA 3VUHA 2OJJA 1Y6AA 4KBCA 3CTQA 2QO9A 3E63A 4DA5A 4DG2E 3MTLA 5AP3A 2BZHB 2HZNA 4QQCA 3ZBXA 5FXRA 3N9XA 2QOCA 3R30A 5AP4A 4DT8A 3ROYA 3ZUUA 4BBFA 3QYWA 5CEMA 4WG3A 1I44A 2JKKA 4RX7A 4YZ9A 3QQLA 3HX4A 5A46A 4J1RA 4GW8A 4GIIA 4EI4A 5JGDA 4G17A 3UOKA 5FWKK 2ERKA 2XB7A 5M55A 5JFWA 3KULB 4E6AA 3QCSA 4G3FA 4MKCA 3LJ2A 4MF1A 2BDJA 5M4IA 2HWPA 2WELA 3A4PA 5EW3A 2X9FA 4CYJA 4M69B 3HA6A 4W4YA 2OXYA 4AZSA 3SW7A 2X39A 3ZO1A 5E8SA 3LCSA 3NWWA 3ACKA 3PZHA 4GFGA 4JJRA 4E7WA 4EJNA 3BX5A 3EQFA 3R02A 3DT1A 4JAJA 5C27A 4CMUA 4CZYB 4MQ2A 2UW9A 3P4KA 4YC8A 4CV8A 1FMKA 4AS0A 2R9SA 5IISA 2CDZA 1XH8A 3BE2A 4ZLYA 2PE1A 3P9JA 3NNUA 1V0PA 3TUDA 2XRUA 4ZXTA 3FQHA 4FTQA 3TJDA 5IA1A 3LCDA 3AGLA 4EQUA 5A9UA 2Z8CA 3Q2MA 5KBRA 1M52A 3HP2A 3C50A 1NA7A 1H24A 4FT7A 4I3ZA 4O7LA 3VBWA 2B54A 4MXXA 3LZBA 3DOGA 2BRMA 2YIQA 2HK5A 3RM7A 4DN5A 2SRCA 2OSCA 4PDPA 2WKMA 5CTPA 4C4JA 1YI6A 4YUQA 2A1AB 2UW5A 2G9XA 4L67A 2QOKA 5CZIA 1LUFA 2NRUA 5DT3A 4K77A 4RVMA 4TY1A 2YIYA 4U9AA 3RWQA 4ALWA 4EH5A 5M09A 3AT4A 5DWRA 2QO2A 4FG9A 5CS6A 3DCVA 1OBDA 2VTAA 4U79A 4DLJA 2QKRA 5I9WA 3PA3A 2YM8A 3EL7A 2PUIA 1ZY5A 2BHHA 5J1VA 4QP1A 2XMYA 4M12A 4NEUA 2CPKE 3ZMMA 4QMXA 2VNWA 5FEEA 3HL7A 3RPOA 4XCUA 2XH5A 4OW8A 4X21A 4Q5HA 4QYFA 4RC2A 3PSCA 5DEYA 4DC2A 2OFUA 3DJ6A 3JVSA 3EB0A 3OY3A 4QMMA 4IFCA 3R7YA 3UYSA 2HZ0A 3A8XA 2WOTA 1XO2B 5HG7A 4ZSAA 3F69A 2VTSA 5JEBA 3DXPA 1OPLA 2I6LA 3I6UA 3RK7A 2NPQA 2O63A 2Q0NA 4WKQA 4TYHB 2VTIA 3CJFA 2ZM1A 2HW7A 4LGDA 2R3FA 3IONA 2XRWA 3KMUA 3R1SA 4PX6A 4WSQA 3R1YA 4Y73A 5FLFA 4CFVA 1PRYA 3R1QA 1VZOA 4DTKA 3KRJA 3SRVA 3BLRA 3AGMA 4ARKA 3F66A 3LMGA 4HNFA 3EQHA 5ETAA 3R7OA 3P7CA 2EXEA 4K18A 4BDCA 3FHIA 2C0OA 4CTBA 4IX3A 4JVGA 4QTCA 4FOBA 5CAOA 3TDVA 1H4LA 3FMMA 5DIAA 5DMZA 2R0IA 1ZYCA 4JT3A 4IWDA 4OTWA 1PXJA 2PMLX 2EB3A 3QQJA 4IB5A 4JQEA 4NFNA 4JR3A 2QR8A 4AU8A 5D11A 4XG4A 3P1AA 2UW8A 4UYAA 4AOJA 1QPDA 1QPJA 2WQOA 3GNIB 4TWPA 3C4EA 2OBJA 3NUXA 4C02A 3COKA 3OWPA 4AA0A 2CMWA 4AA5A 3NYVA 3Q6UA 3QGWA 3VQHA 5D7VA 1R39A 3G15A 5HD4A 2GHGA 5EOBA 2ONLC 3WF6A 3FPMA 4DLIA 1FVVA 1WVWA 4D2TA 1TQPA 4DFZE 4QMZA 5CF4A 1IAJA 3UO5A 4BIEA 3R9HA 2VTQA 1U59A 2XK6A 3MDYA 4FSQA 4IM2A 4UWCA 4J95A 5AWMA 5L3AA 1TVOA 2KTYA 3LCKA 3A7IA 4PWNA 4CMTA 1YI4A 2ITTA 3AD4A 3ENMA 2JFMA 1Q5KA 4IAIA 3VULA 3NCZA 4GT3A 4D2SA 2XK7A 4CSVA 2Z2WA 3PY0A 3BWJA 3FQSA 4NL0A 2W96B 3EFWA 4FKQA 3QUPA 3ZSHA 5CU0A 4LGHA 1W83A 4K8AA 4ZTNA 4WUNA 1ZYDA 2X6DA 1IASA 4ZLOA 5JFSA 3E64A 2ONLA 3OD6X 3S0OA 1O6KA 2YM5A 4U40A 2VWUA 3AMYA 3IW8A 4M67A 4R3CA 1LP4A 4A4OA 4R1VA 2J90A 3G6HA 4IVAA 5G1XA 1VJYA 4FTJA 4USFA 4G9RA 3NYXA 5AX9A 3VQUA 4QP4A 2R4BA 2JEDA 5AP0A 4RSSA 3QYZA 3KQ7A 4C58A 2E2BA 3PXQA 3QHWA 1J1BA 4JQ8A 3MJ1A 3K3JA 5BPYA 1Q4LA 4QQJA 3R28A 4XP3A 4BYIA 5AAEA 3O96A 1JSVA 1BL7A 4OUCA 3BV2A 3R8VA 1YOMA 3H30A 4AZEA 5GINE 4ZEGA 1UVRA 4BCFA 5AV4A 4ORKA 4I0RA 5EW8A 3UMWA 4YZBA 1PXPA 4YTIA 2XUUA 1H1SA 4NJDA 4WBOA 2X8IA 3UVPA 4NFMA 3ZXTA 5L2SA 3TL8A 4EL9A 4WUAA 5AADA 4JBOA 5J9YA 3EN4A 4UEUA 2OJFE 4O83A 3NVKI 1UWHA 4EOQA 4TTHB 3ODZX 5KHWA 1BL6A 2PE0A 3AC3A 4MD8E 4O2PA 3BQRA 1PMVA 5EDRA 4I94A 2AYPA 2FSOX 3QALE 4QP2A 3V8TA 2OFVA 3DA6A 4GG7A 2VTTA 4AN9A 2PZIA 2Y7JA 3E8DA 3I7CA 4N4SA 3O7LB 5AMNA 3WE4A 4E73A 3A7GA 5EYDA 3RGFA 1L8TA 4YP8A 4ERWA 1Q99A 2VWIA 3BU3A 4MF0A 2IW9A 5AFVA 4S32A 4AT3A 1UKIA 4EH6A 3HVCA 3LIJA 3RKBA 4G2FA 4C33A 2LAVA 3L9LA 3ORNA 4MQ1A 2WPAA 3MH0A 3D15A 5DT4A 4QD6A 4DITA 3DY7A 2P4IA 3KULA 3ZCLA 4AWIA 5HZNA 3CKXA 4FNZA 2HYYA 4F4PA 5FBOA 2ZV9A 3HMPA 4Z9LA 5L6WL 3SKCA 1NVSA 3MESA 3WARA 2XA4A 2A0CX 4M69A 4JG7A 4HW7A 5IDPA 3U6HA 1REJA 4D2RA 4R8QA 5HLNA 4RA4A 3BCEA 3ORPA 3AT3A 5H9BA 3KB7A 3UNZA 4E93A 3NS9A 2C5VA 5DYJA 4IWOA 3LXKA 3NPCA 4TWCA 3TM0A 2R2PA 4KKGA 1V0BA 2WIPA 4BCQA 4GFMA 3OZ6A 2E9VA 2OWBA 5HI2A 4F7JA 5BUIA 4QMSA 5J87A 4C57A 2XYUA 1WBNA 3Q5IA 1K2PA 2UVZA 2F4JA 2UVYA 1J3HA 1APME 2PVMA 5HCZA 3ZONA 4E5WA 1YDRE 5E8UA 3GI3A 2VUWA 4GU6A 4IAZA 3WZKA 1E9HA 3F3WA 2J7TA 5CSXA 4WG4A 4S31A 3FMEA 3EYHA 3GFEA 4IXPA 4Y95A 5DNRA 1F5QA 2XIRA 3FC2A 4TKSA 3RAKA 3ORIA 1GIIA 4YMJA 4E5BA 1JOWB 1KSWA 2JITA 3G6GA 3IK3A 3OEFX 4ZSJA 2XJ2A 3LM5A 5E8XA 3U87A 4E4NA 2UZVA 4MK0A 3KK9A 2CCIA 3GT8A 5EDQA 3SOAA 4AFJA 1PYEA 4FV4A 3H3CA 4FNWA 1UV5A 3BGPA 4IAKA 2R3KA 4XYFA 4ZMFA 2C5XA 2OF4A 5LCKA 4HVIA 4FT5A 2ZDUA 4ZY6A 3QTRA 1PW2A 4DH1A 3MY0A 4OBQA 1QL6A 4KABA 4IACA 2HCKA 4PTCA 4BKJA 3C51A 3GQLA 5HO8A 3VHKA 1REKA 2JGZA 2EU9A 2XZSA 4JNWA 4MXYA 4GT5A 2G2HA 3R7EA 2NRYA 2OIBA 5K0KA 3RPVA 3DK7A 5AR2A 2UW4A 2W1DA 1WVYA 4L44A 5KKRB 3DDPA 3DZQA 5DRDA 4XOYA 2XKEA 5KMKA 2JFLA 2CKEA 4QTAA 3MFTA 3VS0A 2GU8A 4TYHA 4UMTA 4DFBA 3PP0A 1LEZA 4FKVA 2W5HA 3QD2B 2W99B 3UOHA 5IMXA 3V04A 4YNOA 5J9ZA 3LQ5A 2UZWE 3C0GA 2XIXA 3D14A 1OVEA 4FL2A 4IX5A 2IVUA 3OCSA 3FV8A 2BCJA 2J4ZA 3B2WA 4P90A 2YITA 3PJ2A 4HGLA 1OL5A 5CU3A 5ANKA 5EYCA 1SYKA 3RNYA 3IOKA 4FA2A 3PPZA 3DPKA 4C4HA 3NIEA 5K5NA 1OUKA 4FE2A 5M4UA 4ITJA 5T6KA 5DLSA 2RG5A 2PY3A 1PXIA 2J0IA 2VWXA 2RG6A 3EKKA 4FC0A 5DT0A 3RVGA 2X81A 2JBOA 2J9MA 3KMMA 2WTKC 5EYKA 2WTDA 2WZJA 3B2TA 4EH3A 3PXRA 4ZSLA 5AUZA 1M2QA 1TKIA 2YM7A 4G9CA 4BGHA 3KXGA 4RIYA 4XG3A 3UZTA 1P4FA 2YA9A 2JD5A 3IECA 4C35A 5CALA 2WMXA 4KKHA 4OBOA 4C59A 1LPUA 1WBPA 4PL4A 4KIPA 3ZSIA 4ZY4A 5AAGA 3IDCA 5CU4A 3BBTB 1XJDA 2ITOA 3UP2A 1O9UA 2RFEA 2F2CB 4IZ5A 3R1NA 4YJSA 3R04A 1NVRA 3F2RA 4LRJA 5AR4A 5EI6A 2YERA 2BR1A 4DAWA 4FT9A 1CDKA 1R78A 2GHLA 2OXXA 4RIOA 5A4TA 4PP7A 3TI1A 3L8VA 2BTSA 3I5NA 3NYOA 4QPMA 4YJPA 3P23A 3SQQA 4OLIA 3ETAA 3ALOA 4M97A 2Z7SA 4AZFA 3OVVA 5D1JA 4AOTA 4MHAA 5L8JA 1Y57A 4RVTA 3WZUA 4L6QA 4UMRA 4FEQA 2HIWA 4CFUA 4DTBA 2W1IA 5IEYA 5EM8A 4YC6A 3PWYA 4RJ5A 3L9NA 5HE0A 1V0OA 2AC3A 5HE1A 4F9YA 4PPBA 5D7AA 3SA0A 2BZKB 3K3IA 3NEWA 4A4LA 4D0WA 5FXQA 2IG7A 3ZC6A 4AA4A 2JKQA 4F99A 2VRXA 3UG2A 5EM6A 2VGOA 5FP5A 1JAMA 4HYUA 2X4FA 1R0PA 3MH2A 4HZSA 4EH8A 5KX8A 3O17A 2GPHA 4F7SA 3GC9A 1FOTA 3C4WA 4NJ3A 5L2TA 5HU9A 4CCUA 4ZY5A 3F5UA 5HVKA 1WBWA 3UQCA 3TJCA 4DGNA 4O0WA 4S2ZA 3Q4ZA 5B7VA 4U3YA 4ANOA 1ZMUA 3P78A 3H9RA 4CLJA 3BI6A 2EXCX 1P4OA 1SNXA 4JXFA 3D5XA 3G9NA 4FF8A 4KD1A 4FR4A 5EHLA 1FPUA 1MRUA 4FTIA 2QVSE 3QC4A 4ZZMA 5TKDA 2X4ZA 2XVDA 3FZRA 1UWJA 2GQGA 3HUCA 4NTTA 4LOQA 4YSJA 4YHFA 5HLWA 3NGAA 2VO3A 2WGJA 4JBQA 3R8LA 4FT0A 3NZ0A 3F2AA 3KCKA 4QMUA 3AC5A 2JIVA 2BALA 4JL9A 4RG0A 2X8EA 1A48A 2C3IB 4BDJA 2HY0A 3R22A 3BLHA 1JSUA 5L8LA 3RAIA 5AUUA 1ZYLA 3IDBA 4XBUA 1OGUA 2VTHA 4P5ZA 4BHNA 4ZJJA 1UA2A 3EFJA 5JKGA 4FVPA 4WRSA 4CQEA 1MQ4A 2WO6A 4WNOA 4ZZOA 1A06A 1O6YA 2R3RA 1XQZA 3Q96A 4X2JA 2FYSA 4FV6A 3F5GA 3ROCA 5A54A 4CKRA 3CD3A 4DEIA 4Z55A 3OT3A 3IW6A 4L46A 3MV5A 5HD7A 4F08A 4C36A 4HVSA 3JS2A 3W1FA 4CG9A 3KU2A 4OTPA 3LJ1A 2R7BA 5K5XA 4O7YA 5DRBA 4X0MA 3RCJA 5EQYA 2B7AA 1KUTA 4IVBA 2Z02A 4UALA 1GZ8A 4H05A 1M17A 3OCBA 2VO7A 2FSLX 3PP1A 3QQGA 5H2UA 4U0IA 4DEBA 5D10A 4FSYA 4ZAUA 4I0SA 5GNKA 4E4XA 1NY3A 4DH8A 2C5NA 3D83A 1NVQA 4FNYA 5A6OA 3DDQA 5E1SA 2WTVA 4TZRA 1GIHA 3TNWA 1Q61A 3RI1A 3TV4A 3OROA 3VS6A 4BCKA 3ATSA 4HGEA 2V7OA 4U8ZA 3RAWA 5IG1A 2OF2A 3UYTA 5A14A 2W1CA 4DFXE 4ZZNA 2E9OA 4WNMA 4AUAA 4OTFA 4X3JA 5K4JA 2ZMCA 1OIYA 3NW6A 1JNKA 3MVLA 2ZYBA 4FUXA 3VBVA 5KKRC 3FLZA 3KVWA 1GZNA 2QKWB 2LGCA 3EFLA 5CY3A 3GCPA 2ESMA 5B2KA 2B52A 3AOXA 3G0EA 5H3QA 5G6VA 2E9NA 3SRVB 1F3MC 4R1YA 1YKRA 3V01A 5ANJA 5DH3A 2Y6MA 2XNEA 3P08A 3TT0A 5GZAA 5JT2A 1PXLA 5GIPE 2R7IA 2PE2A 4FEVA 4QTBA 5LWNA 3U6JA 4GL9A 3RZBA 4MH7A 4KS8A 4MXAA 3V6SA 3PYYA 4BDBA 2E9UA 3EQPA 4KAOA 1HOWA 4K11A 2QLQA 3ZRLA 4TWOA 4NZWB 4BN1A 2UZNA 2H34A 3Q4TA 1J7LA 3RM6A 3NRMA 4H3QA 4C2VA 1YXXA 4JG8A 4UBAA 4WNPA 5DFPA 3WF7A 5L6PA 4RA5A 4RLLA 4RWLA 4MVFA 4QQ5A 4M13A 3QWKA 4EKLA 3A7JA 5LMAA 5CENA 3LHJA 3C0IA 4IC7A 3ZC5A 1YHVA 2JIUA 3V5WA 2G2IA 3IW4A 3VJOA 1Q97A 5IPJA 5DGZA 3OOMA 3BQCA 3D5VA 5C9CA 4K33A 4PV0A 1FGIA 5HCXA 4GVJA 4C7TA 4Z7HA 2JBPA 2YACA 2ZJWA 2C6MA 2WMTA 2Z7LA 4I4FA 4EKKA 5I3RA 2VO6A 2IPXA 4J8NA 4WO5A 5CAPA 4JDIA 3QRIA 2VN9A 5ETCA 3KVXA 2NO3A 3TUBA 4FI1A 4F0GA 1NXKA 4RMZA 3E7VA 4EK8A 4FZDB 3QGYA 4QMQA 4RVLA 4I5PA 3ZYAA 4KWPA 4XEYA 5DR2A 2O8YA 3W8QA 4JBPA 4JQ7A 4Q9SA 4QYHA 4WA9A 3TZ9A 3VUDA 3DAEA 4O7NA 2W06A 4YJVA 4CXAA 3F82A 2C6TA 4H1MA 5ANGA 4DGGA 4FKOA 1DI8A 3EZVA 3KXZA 3TN8A 4BDEA 5AP1A 3VUIA 2BRGA 2DUVA 3TNQB 2G2FA 1ZMVA 1H01A 3DFAA 4C62A 4D4YA 2CLQA 3W33A 3NW5A 3OWJA 4FTUA 4PP9A 4X2FA 2CGVA 4ZOGA 2RGPA 4D5KA 4WRGA 4GK4A 5AUVA 3H0YA 3TNHA 1JKKA 3A2CA 4FVQA 5HIBA 5DI1A 1MRYA 2QOHA 1PMUA 3KXXA 3PSDA 4U42A 4C3FA 4PMPA 1JWHA 1MP8A 3CP9A 3KREA 3UNKA 5FTQA 3ZDIA 2VTLA 5HX6A 4K1BA 4J8MA 4RC4A 2YIXA 3DKOA 4FGBA 4JBVA 4FEUA 2I0VA 3SG8A 3HP5A 2OJ9A 3QU0A 3UZPA 4PRJA 4RT7A 5HESA 2R0UA 3R8PA 2Z60A 5J5TA 2J2IB 4CG8A 4FSMA 2BUJA 3TG1A 3ZLWA 3D5WA 4BZNA 4ZTSA 4BTFA 3UPZA 3BU6A 3ITZA 4NCTC 3FL5A 1FVRA 3UPXA 5E1EA 2ITPA 3CIKA 4IVDA 5E8WA 1H00A 5A3XA 3OBGA 3GVUA 3L8SA 4R78A 3ZFXA 3Q04A 3WI6A 4ENYA 3EWHA 4I20A 1M2PA 3LFCA 5ANEA 3UODA 4O86A 4CTCA 5FXSA 3HV3A 2IZTA 2UZBA 4J97A 3ID6C 3HLLA 4IWQA 4USEA 4XG2A 4O1OA 2F2UA 5I9UA 4RX9A 2W5BA 1YOLA 2W4OA 1GNGA 4BCJA 3W18A 2VD5A 3HV4A 3M1SA 3CGOA 4JIAA 4NH1A 4E3CA 2FSMX 4NCTA 2IZRA 3FMNA 2WQBA 2XBAA 3HRCA 3ORKA 5IH6A 2GNHA 4DEAA 1P5EA 3D7ZA 4MNFA 3WF8A 1Q8WA 3CTJA 4B99A 4RFYA 5LCJA 4O81A 3AC8A 2OH4A 4IZAA 4UY9A 3EQRA 4EH9A 4QNYA 3ACJA 3ORZA 1H25A 2JLDA 3FYKX 2W1FA 2YABA 2ITWA 4IAYA 1OL7A 2VWYA 3HYHA 4L00A 4BDDA 4A9SA 1JKLA 3QUEA 4BF2A 3GCSA 3NMUF 4FV2A 4BTMA 4F9CA 3UOLA 4FBXA 2VTMA 2YLEA 3W2SA 1ZY4A 3MA3A 4FV1A 5FTOA 4D28A 3BLQA 4PL3A 4O21A 3JY0A 3TXOA 2BPMA 5L2IA 4JRNA 2GS2A 4X3FC 4BVUA 5LVNA 3T8OA 4F6SA 4O84A 2W1GA 3R6XA 4FK6A 2BKKA 4QP9A 3KEXA 2Y8OA 3CTHA 3QKLA 4FTRA 4D55A 3KCFA 3BGZA 4QOXA 3JYAA 5FUTA 4YURA 4ITIA 5HO7A 5CQUA 2C5YA 3BEGA 5ETIA 3E8NA 3MB7A 4R3PA 3V6RA 3WIKA 5HO6A 3DXQA 3TIYA 3EHAA 1R1WA 2OO8X 4U81A 2R3QA 4I6BA 3VNTA 4YO4A 3EMGA 3MI9A 2WTJA 3FSFA 2RKUA 2BROA 3FKOA 5CYIA 2PMIA 4CQGA 4ALVA 4X3FA 1OM1A 2XIYA 3Q53A 4L42A 4DHFA 2VAGA 3PIXA 2GDOA 1PYXA 3PRIA 4F1OA 5IQDA 2UZDA 4O22A 4IZ7A 2OZAA 3EFKA 3E62A 3PJ3A 1YI3A 2GMXA 2WMAA 4CMOA 4GG5A 4CRLA 4BHZA 5KO1A 3LKMA 2XKDA 4ZTMA 3O8TA 4AZVA 2X9EA 2YEXA 3DB8A 4E8AA 2V62A 4FG7A 4I21A 2W0JA 5AEPA 2QG7A 2ZDTA 3FBVA 3HV7A 3QLFA 3UGCA 2C3KA 3UE4A 4JDHA 3SLSA 2BHEA 4DH7A 3BPRA 1ZRZA 4D1XA 1WVXA 2JDRA 4NT4A 5EM7A 3UIUA 5E92A 5J9LA 4LOPA 2BIYA 3NUAA 3GU7A 3TDWA 4O82A 3D9VA 1EH4A 3RP9A 4RQVA 2RFDA 4BWXA 4W9WA 5DOSA 2PSQA 5M4CA 2QHNA 4M3QA 2CLXA 3MIAA 4DG0E 3D7TB 5JMSA 5I9VA 2KULA 4YJQA 4F7NA 1B38A 2JDTA 3FJQE 3GENA 5KMNA 3KF7A 4YZMA 4RIYB 1O6LA 5DEWA 4A06A 3CC6A 4L7FA 3EKNA 4DH3A 2C6EA 4G3CA 4HVGA 2Q83A 3FZPA 4IZYA 1Q62A 4LMUA 3NAYA 5ICPA 3QTSA 5KCVA 2CGWA 5A4LA 3FI2A 2IVSA 5HLPA 2IVVA 4W8EA 4BCOA 3QUDA 4RBLA 4XV9A 3PIZA 4E4LA 2ITVA 4XG6A 5H8GA 3ZDUA 4QNAA 3OS3A 4RVKA 2I0HA 1OKVA 4BTJA 2WTKB 4YJNA 3ZTXA 4ZS4A 3R73A 3W55A 4E5AX 3H9OA 2V7AA 2ZV8A 3L9PA 4QMPA 4TXCA 5HOAA 1R0EA 2DS1A 3NUPA 3T9IA 3A8WA 4EOOA 4IHPA 5F20A 5HIEA 2PUNA 4FIHA 1UU9A 2ZV7A 4LG4A 2XF0A 4KRCA 1GOLA 2YCRA 3V5PA 2QOFA 2YM3A 4I93A 4ANNA 3F9NA 4HYHA 4FT3A 4IE9A 4UWYA 4RIWB 3WZEA 4D58A 4FTAA 4ID7A 4IDTA 2J5FA 5IU2A 2X7OA 3UC3A 3KC3A 3BWFA 5C8KA 1BI8A 4X6RA 4L3LA 2P55A 3LCTA 5D9HA 5DE2A 3DQWA 4P7EA 4MCVA 4FIGA 5EI2A 4D4SA 3Q4CA 1W7HA 3NUSA 4MYGA 3NAXA 1ZOHA 1WMKA 5HCYA 1URCA 4B8MA 2FVDA 2C6LA 5DG5A 2BRNA 4MTAA 4ANLA 4LV8A 3VBYA 2B55A 2BZIB 2Z7QA 3ZRKA 4AE6A 1ZZLA 2Y4IB 5EH0A 4NUSA 2CJMA 4ZTLA 4FSZA 4DEEA 3R2YA 3ZSGA 5HGIA 4YR8A 3VBTA 3RK9A 3DAJA 4RZVA 1P2AA 3I1AA 3L8XA 3LCOA 4GK3A 2UW3A 2VX3A 4G5JA 4ZS0A 4CKIA 1OKWA 3UVRA 2PVKA 4ITHA 4DEHA 5CSWA 4RJ8A 3Q9ZA 4I6FA 3ORTA 4CKJA 2PZPA 1Q24A 2XS0A 5CF8A 1B6CB 3EN9A 3LLTA 4FNXA 4HCTA 3ZO4A 3EZRA 3FE3A 4C37A 4GSBA 2JKMA 2YISA 5J1WA 4IB3A 3LFAA 3OWLA 4V0GA 2IJMA 4RLKA 4MXCA 3FXXA 2GNFA 2FB8A 4ZK5A 4ASDA 2ITYA 4RRVA 4K2RA 3M11A 4WIHA 5JFXA 5L4QA 5D41A 2WU6A 1UNGA 3ULIA 3VC4A 2ITNA 5BX0A 3T3VA 3HAVA 2WFYA 3DU8A 3TWJA 3R7IA 4Y8DA 4A9YA 4I4EA 5CX9A 3R71A 4GEOA 2R3NA 4U45A 2X0GA 1M7QA 3ODYX 2X7FA 3DBCA 3MH1A 4FICA 3GXLA 3W8LA 2YAKA 3N51A 2ZB0A 4JX7A 1PJKA 3MVMA 3ZS5A 4CYIA 3BZ3A 3PXYA 4FSUA 5CNOA 4BBEA 3EQDA 2ZB1A 2YIWA 4DG3E 2C69A 5BYZA 3Q52A 5TF9A 4EZ3A 4F0FA 4NKAA 5TE0A 4USDA 2PUPA 2E9PA 4C61A 3FC1X 4FKLA 4H3PA 1YHSA 5CF6A 3NUUA 3FI4A 5JN2A 5I9XA 3SG9A 3CJGA 4GIHA 3ERKA 4B4LA 1OZ1A 4FSWA 4KSPA 3OP5A 3KY2A 4GRBA 4NTSA 4YJOA 1XWSA 3LLAA 4ZLZA 3Q4UA 1SNUA 1PMEA 4W4XA 3DJ7A 4XG9A 1SVEA 4BI1A 3MH3A 3VS5A 3RNIA 2YN8A 3BYVA 3DS6A 4I6QA 5CSVA 4F64A 3N4UA 3F3VA 1Z57A 2PVLA 2QODA 3SXSA 3CXWA 3NLBA 1JKTA 5J8IA 4AXAA 2ZM4A 3ET7A 3R21A 4I22A 5AA8A 3NNXA 5AP5A 3VJNA 5JZJA 3QTXA 4X7QA 3OHTA 1WFCA 4AN3A 4E6QA 3E93A 3Q9WA 5L2QA 2WMQA 4NIFA 3W2CA 5HTCA 2R3GA 1ZLTA 2ACXA 4GJ3A 4J98A 4XV3A 5EM5A 2I1MA 2PMNX 2YDJA 4K9YA 4I6HA 3OG7A 2JC6A 4Q2AA 4TYGA 2UZUE 3F3ZA 4S30A 3AMAA 3NNVA 2ITUA 2H96A 3M42A 2B9HA 2XP2A 3II5A 2EWAA 3QD4A 4PTGA 5CQWA 2YCSA 3TTIA 4D4RA 4CFWA 4EC9A 3C5UA 1WCCA 1OUYA 2RF9A 3IQ7A 4I5MA 2CGUA 3GC7A 4EOKA 3BYSA 3VUTA 2PPQA 3R7VA 3OTVA 2BMCA 3E8CA 5JK3A 4DCAA 1BKXA 3TEIA 3ZFYA 4BWKA 2I7QA 4R5SA 4FKPA 3POOA 4QMVA 4XRJA 3G2FA 4FG8A 4JS8A 5IUGA 5IF1A 3CSVA 4O7RA 4PQNA 3KRRA 1WBSA 4LFIA 5CF5A 4AQCA 3G9LX 4UZHA 3OCGA 4WG5A 3THBA 4FKWA 5IQEA 3UIMA 3OOGA 4R6VA 5HE2A 3DBQA 1Q8YA 4DTAA 4LV5A 4WD5A 3LVPA 2XNOA 3R2BA 5IEVA 4UXLA 4MXZA 5AX3A 3E88A 3OEZA 3QTIA 5CU2A 5K0XA 4UXQA 1LEWA 4Z7GA 1CKIA
chains in the Genus database with same CATH superfamily
4JR7A 2Y6OA 1LR4A 4HYIA 2JIIA 1TQMA 3ORXA 4XNEA 5BQ0A 1DM2A 5LMKA 1DI9A 2VNYA 1KV1A 3FZTA 3GEQA 3Q9XA 4X2KA 3SVVA 5KHXA 4LUDA 3HNGA 3WYYA 1MQBA 1OI9A 2YCQA 4FL3A 3HEGA 3UIBA 4IDVA 2PUUA 3D7TA 5T3QA 1JLUE 3WYXA 4A07A 3O7LD 4DYMA 2PMOX 3NCGA 3MB6A 4KIQA 4ZTQA 1HCKA 5BVFA 2AQXA 3BU5A 2X2LA 3IKAA 2IZUA 4M68A 4XBRA 3HUBA 1KE9A 2BRBA 1U5QA 5BVEA 4I23A 3FWQA 2QOIA 1H8FA 1PXNA 4JLCA 3DLZA 2QONA 4BKZA 1XHAA 4L3PA 3GU5A 3S1HA 2XNMA 4H36A 4IJPA 3PFQA 4E6CA 3PY1A 3LJ0A 1H26A 3ZO2A 4JRVA 4YZDA 3QD3A 3DNEA 1J91A 1W82A 2BZJA 3KRXA 3E8EA 4O0SA 5IKWA 4BICA 3VRZA 5EHYA 5M06A 4QTEA 3PXZA 2BAKA 4FVRA 4XH6A 4TW9A 2AUHA 5AV3A 4MWHA 3C4ZA 2R64A 4JAIA 4YJRA 4CRSA 3AG9A 3LOKA 5KNJA 5J95A 2IW6A 3LXNA 1IR3A 3P79A 5BMMA 2Y4IC 2Z7RA 4HGSA 4IAFA 1BMKA 3CQEA 4QP6A 4AGDA 4BL1A 1ND4A 5BYYA 2NYAA 2C1AA 3TKIA 2W4JA 3A4OX 3L9MA 3VBXA 4DINA 1YHWA 4EHGA 1OBGA 4F9WA 3V5TA 4RIWA 2VTNA 2DQ7X 2JAVA 3IDPA 5IQFA 3AT2A 3EL8A 2O64A 1W2DA 4QPAA 3CS9A 3FMJA 2PVFA 5FEDA 5HICA 3NSZA 5KMOA 3GGFA 1GIJA 2C4GA 3W2OA 2ITQA 2PK9A 2C3LA 3C9WA 4U44A 4YTHA 5L8KA 5M53A 2YDIA 3ZLSA 3W16A 3CD8A 3PVWA 3QZGA 3O51A 3PJ8A 3TMOA 4RPVA 2UW7A 3BIZA 2BILB 5HTIA 4BR3A 3MVJA 3N4VA 3LXPA 3RZFA 3DTWA 3R83A 4N70A 3OW3A 3T9TA 1M7NA 3R0TA 4PNIA 4EK5A 5IA2A 3NX8A 5HE3A 1OPKA 5DR9A 4RJ7A 2CKQA 1CSNA 3W0MA 1ERKA 4ONAA 3R9OA 4NM7A 4CZUA 2OIDA 2VWVA 4Y83A 4DBNA 5A4EA 5IUHA 3GB2A 4C2WA 2VTRA 4CFFA 2FA2A 3F7ZA 3PXFA 5F9EA 5M07A 5TO8A 2G1TA 3FMDA 5E9EA 3OXZA 5LVOA 5TR6A 3H0ZA 2B0QA 4HCUA 5LWMA 4EUTA 2R5TA 1W0XC 3CQUA 1R3CA 3A7HA 5J5SA 5AJQA 5AV1A 1SMHA 1SZMA 3PJ1A 3FL4A 4BCNA 4AT5A 4YU2A 4S33A 5AP2A 4QP3A 1IAHA 2ETMA 4X6QC 4MD9E 1TQIA 3QKKA 4FODA 5BVDA 4KUJA 1AD5A 2XKCA 4WBBB 5CNNA 3M2WA 2W9FB 3SHEA 4JOAA 2IW8A 2W05A 4U6RA 2R3IA 2ZOQA 3EN6A 4EH7A 3BLAA 3QZIA 4TRLA 3FI8A 4EBWA 4ACGA 1TZDA 3R7GA 4FTNA 2CN5A 4I5CA 4RWIA 4C34A 1QCFA 2Y9QA 3C4CA 2XJ0A 4B6LA 2YZLA 4OBPA 5ANIA 3ZH8A 2J50A 2VZ6A 3C5IA 4QO9A 4C8BA 4BCGA 3O2MA 2HXQA 2QURA 2CHLA 5IA3A 2CCHA 3AXWA 4PDYA 3D4QA 5CEOA 1VEBA 3AD6A 5HG9A 4YJUA 4EOIA 3HDMA 4HZRA 4XUFA 5GZ8A 5CI6A 2O65A 1IEPA 2PULA 2PVRA 3AC4A 4XG7A 2R3MA 3KA0A 4GUEA 4O96A 4UYNA 2RL5A 3FMLA 4GU9A 5JZNA 3AC1A 5HNGA 4CZTA 4YTCA 4HVHA 1Q8UA 4GV1A 4FKSA 4KRDA 4DGLC 4RJ3A 1GY3A 3QQFA 4G6LA 2HXLA 3LFNA 4RJ4A 4XOZA 5HEZA 3DBEA 3RPYA 3WBLA 4EHZA 5IH4A 2YHVA 1ZZ2A 2PZYA 3GUBA 4I41A 4W4VA 1YWNA 4TL0A 3KXMA 5HORA 2J51A 4GFOA 4X3FB 2J0KA 1T45A 4TYJA 4O7WA 2R3HA 3CKWA 4QDEA 3TNIA 2CGXA 2C6KA 5M57A 4EOMA 4IIRA 2JDVA 4XHKB 3I5ZA 1JBPE 2C68A 3W0RA 2WTWA 3HMNA 2OZAB 3NUNA 3DLSA 3E7OA 4O0VA 3JPVA 3TKUA 4C4EA 3TZMA 1XBBA 3GFWA 5CI7A 1Q8TA 4M8TA 2HW6A 3DXNA 5EDPA 5FM3A 2W7XA 3R7UA 2P33A 3UNJA 4ANBA 2XKFA 3AKKA 4PTEA 2VX0A 4D1SA 3W0SA 3OTUA 4NSTA 4OGRA 4QYGA 4GH2A 3RALA 3TCPA 5AUXA 3PY3A 5GZ9A 5AR7A 5T68A 4NK9A 3UIXA 4C3PA 4Y5HA 5CXZA 5LVPA 4M14A 5TOZA 3EYGA 2YWVA 2ETKA 1NT2A 4BGGA 3COIA 3DZOA 3R9RA 2YWPA 4N0SA 3RPRA 3OC1A 3RJCA 4ENXA 1OKYA 2CN8A 2OZOA 3LAUA 4MD7E 5IQGA 2NNWB 4GT4A 3DKGA 4IX6A 4U43A 3WE8A 2PZRA 4UMPA 3VHEA 4L68A 3U6IA 1UNHA 4FSRA 3KN6A 3MWUA 4R5YA 4ANMA 5LMBA 2PWLA 3QD0A 3G51A 1E1XA 2ETRA 3LM0A 5DR6A 4AAAA 3DK3A 4L7SA 5CAQA 3NNWA 3GP0A 3BYOA 1OIRA 1K3AA 2B53A 4E6DA 4X2GA 3IGOA 4HOKA 3JVRA 4J52A 3POZA 4FV8A 4BIBA 5BYLA 3IW7A 4GYGA 4MBLA 2CNQA 3R8MA 1XBAA 2PHKA 3TV7A 3KXNA 5AUTA 3PVUA 4F6WA 2IF8A 3KKVA 4JDJA 3S2PA 5BNJA 5JGBA 2X0PA 1H08A 2R3JA 3T3UA 4W8DA 3C4XA 2GNJA 2UW6A 3A60A 3R01A 2QNJA 4I5HA 2WMWA 4RX8A 4TNBA 5L2WA 2WQNA 4AZTA 2QLUA 4FX3A 2WD1A 4LI5A 5I5ZA 3DB6A 2RFSA 5E8ZA 4D1ZA 1FINA 5HU3A 3FAAA 4KIOA 4ZP5A 5GJGA 4NYEA 4C3RA 2Y4PA 3G33A 4OTQA 1RQQA 4S34A 4Y72A 5DA3A 5E8TA 5EG3A 5CAUA 5I9YA 2EVAA 3HGKA 4KNBA 3CPCA 3ZM4A 4BDAA 4DHIB 3QX4A 2IO6A 3EIDA 3WILA 4D4VA 3D0EA 2PVHA 4CT1A 4JIKA 2HELA 1ATPE 4H58A 5CEIA 1QPCA 5E8VA 1QPEA 3QKMA 2W5AA 2QHMA 4O2ZA 4D0XA 3C1XA 3TYKA 3BV3A 3PA4A 4FYOA 5F94A 1JVPP 1VYWA 4AGUA 1XKKA 5KMIA 2A4LA 4L01A 1E1VA 4FZAB 3VAPA 4H3BA 3MYGA 4XV2A 5EYMA 4BCMA 2A19B 3FZOA 4F6UA 3BL9A 5AIRA 1A9UA 3P7BA 3PPKA 5AR8A 3BHYA 4XJ0A 2NP8A 1Z9XA 2UV2A 2XCKA 3A99A 3VF8A 2H9VA 3OWKA 5E4HA 1W84A 2VWWA 3ALNA 3PLSA 3ULZA 3DQXA 2HOGA 2OW3A 3UDSA 5ETFA 5K9IA 3HZTA 4FTOA 3UMXA 3ZOSA 4EYMA 4R7BA 3PA5A 4PPCA 1Z5MA 3MN3A 3BHTA 5KUPA 1CM8A 3I0QA 2C3JA 3I7BA 4F78A 1UU8A 1WBVA 3MSSA 4XMOA 4Z3VA 2OLCA 4BBMA 3KFAA 3QRTA 4B8LA 2WU7A 4V0GB 4BCIA 2WEVA 4QTDA 1KOAA 2XCHA 2ZV2A 3GOKA 5CEQA 5EKNA 3DNDA 3I6WA 1KV2A 3FZ1A 4RWKA 4W4WA 4IWPA 4ZJIA 3WF9A 3FY0A 2WQEA 3SXFA 3ZO3A 5BVWA 5A4CA 3LFSA 4O6EA 5BUJA 2GCDA 1DS5A 4LOOA 4IC8A 3HMIA 1WZYA 4II5A 3ZLXA 3U54A 4BY9E 3BYUA 4YPDA 2Q0BA 2XEYA 4MBJA 3KMWA 4YC3A 1IG1A 1XH6A 4MEDA 3UQGA 3UVQA 4TT7A 3DJ5A 3SXRA 3I81A 4PMMA 4BCPA 4FV0A 4U41A 2J0LA 3VO3A 4G16A 4AN2A 4HJOA 1M2RA 4C38A 5JH6A 4MXOA 1Q41A 5AV0A 1XH4A 2C5OA 3OUKA 4FMQA 4TYEA 5CU6A 5E91A 5CSPA 3MPTA 5C01A 3V5LA 5CWZA 5BVOA 3E3PA 2IEWA 2GTNA 3P5JC 4EORA 3IS5A 3OUNB 3ZZWA 4K6ZA 3QCQA 4I24A 4PDOA 4R77A 2O0UA 3F3UA 3IGGA 3S95A 3TZ8A 2G15A 3ANRA 4XG8A 4TWNA 3D5UA 4M15A 1U54B 3R63A 4CV9A 2WEIA 4OAVB 2UVXA 3AMBA 3CCNA 5HTBA 3NIZA 4U97A 5DBXA 3PSBA 4AGCA 4D9TA 2VTOA 4AGWA 2I0YA 4EWQA 4O27B 1WAKA 2DWBA 4YPSA 3COHA 5FQDC 4FL1A 4AW0A 5IZFA 2CNUA 3HAMA 4O7ZA 4RFZA 5E90A 2WOUA 4NU1A 3B8RA 2ERZE 3MPMA 5IUIA 5LOHA 4KS7A 2OXDA 3BHHA 4GCJA 4FZ7A 5CASA 4Y46A 3U8WA 3D94A 2P2HA 1G8AA 3BEAA 3P7AA 3P0MA 4NIFB 4KIKB 3I60A 4FKRA 5HKMA 2W1HA 5DVRA 5JFVA 4G5PA 3LMIA 4BZDA 4AAYA 4RGJA 2WTIA 4P4CA 1M14A 1OL1A 1GJOA 4IJ9A 2IZSA 3PLAE 5M4FA 3BYMA 4DBXA 4QMLA 1H0VA 1H1PA 5FTGA 1YXTA 3P5KA 4BDGA 2FH9A 1OECA 2W17A 4UWBA 5CANA 2X7GA 2ITXA 4QPSA 5FGKA 3VS1A 4CLIA 3QC9A 2REIA 4FSNA 5LQFA 4BFMA 4EH4A 1URWA 3GQIA 4ACHA 3MS9A 4EQMA 2EB2A 2A2AA 5E7RA 2GQSA 5EQEA 4YSMA 3OY1A 2FUMA 2J6MA 1J7UA 3I4BA 4A9UA 5J7BA 4YZNA 3TACA 2W4KA 3GC0A 4FIFA 1V1KA 5HVJA 5IQHA 5CT7A 4LM5A 3F5PA 4PNKA 3VVHA 4G3EA 1H0WA 3LW0A 4GVAA 1H1RA 3EOCA 4PMTA 4RQKA 4CD0A 2B9IA 3V3VA 5EW9A 4IB1A 5CVHA 4DHZA 3W0PA 3NUYA 4M0ZA 5AUYA 5CLPA 2XEZA 2YIRA 3HDNA 4NM5A 2J0JA 4O1PA 3LMHA 4PF4A 4AT4A 2BAJA 5IQAA 2XK4A 4P5QA 3D2IA 5HBJA 4AXEA 2BKZA 3ENHA 5I3OA 4FEWA 3FUPA 4BI0A 3NVMB 3FMKA 2WAJA 3W2RA 4NW6A 4E26A 3UJGA 1XH5A 4O7VA 2BIKB 4TNDA 2WIHA 4QP8A 3PZEA 3BGQA 3AC2A 3ORLA 4E20A 3QQKA 2VWBA 2XM8A 3A61A 4JG6A 4AW1A 3NDMA 1NW1A 1XMMA 5I0BA 2FO0A 1PHKA 5HBEA 4MNEB 2PZ5A 4F1MA 4I0TA 1SVGA 3ANQA 1Y91A 4EC8A 4FEXA 4ZTRA 3VS3A 5EK7A 3FKLA 5GHVA 3DGKA 4F70A 2RFNA 3MW1A 3QQUA 3QRKA 4GK2A 5GJFA 3OXIA 3U9NA 5DPVA 4HPTE 3R00A 5M51A 4PDSA 1YXSA 4FIJA 5EKOA 5KMJA 3GU4A 3S00A 5FG8A 4FIEA 1H27A 1ZOGA 1OL6A 2JAMA 1PXOA 2HY81 2QO7A 3GBZA 3C7QA 3LE6A 3OMVA 4BIDA 3W32A 3MFUA 5J79A 2VU3A 4YLLA 4IM3A 3JY9A 4DGOA 3W2PA 4KA3A 2B9JA 4IEBA 4BDKA 3CY2A 4FV7A 4EUUA 3ATTA 4YLKA 3Q2JA 2OK1A 4RIXB 4EYJA 3CGFA 4FSTA 3FHRA 2X2KA 2GNLA 5JRSA 2O5KA 2JKOA 3U51A 4M66A 4BWPA 2YJSA 1BYGA 3ELJA 3BELA 4DFLA 2OICA 4L8MA 5FDXA 4EH2A 1HCLA 3KK8A 4KB8A 5EHOA 3KN5A 2RSVA 3ORMA 2UUEA 5FEQA 3ZM9A 5KZIA 3H4JA 4KSQA 3AD5A 4AFEA 1S9IA 1PMNA 3QX2A 4LQMA 4Y5QA 4AE9A 4AW5A 5AM6A 4A9RA 2XJ1A 4KKEA 5CZHA 3UBDA 1OB3A 5C8NA 2QG5A 5IH5A 2XNBA 4L52A 3MPAA 5HVYA 4GKHA 3RINA 4QYYA 2A98A 3VS2A 4QDVA 3O8PA 3QZFA 3RTPA 5E8YA 3VF9A 4DGMA 4ASZA 4UMUA 4PL5A 2ZM3A 4B7TA 5BVNA 2XNNA 3FXWA 1KWPA 2ZAZA 1GZKA 3E5AA 1PKDA 3IW5A 5ACBC 2X2MA 4NM3A 5CT0A 3MBLA 5F95A 4QT1A 1STCE 2X8DA 3KL8A 4M84A 5HBHA 4CFNA 3O8UA 2Y0AA 3SX9A 1KE7A 1SM2A 1PXMA 3IPHA 3JUHA 3Q5ZA 3QXOA 4XP2A 4CFXA 1BLXA 1FGKA 1KE6A 4AXDA 1YWVA 1Y6BA 1UU7A 4QMOA 3VRYA 4LRKA 3MIYA 2ZVAA 3NFGB 3SC1A 4EZ5A 3U4WA 2YCFA 3QRJA 2PVYA 5KZ0A 2WMRA 1F0QA 4A7CA 4BYJA 3EN7A 4PPAA 4LYNA 3FPQA 4IM0A 3CEKA 3FLNC 4FYNA 2ZFYA 3C0HA 4B0GA 4FZ6A 2OU7A 3OBJA 4OTRA 4YHJA 1AQ1A 4LMNA 4UZDA 1KE8A 3S4QA 2C1BA 3OFMA 4BZOA 4O91A 5FP6A 5H8EA 3QF9A 1RW8A 4ANSA 4GJ2A 4GMYA 3EQCA 3PVGA 5HQ0A 2UW0A 2YAAA 5BUEA 3PWDA 1RDQE 2VX1A 4XLIA 4G3DA 4C4IA 5KMMA 3HRBA 2XANA 5C4LA 1U54A 5KMLA 4CGAA 2IWIA 3FI3A 3OW4A 4K0YA 3WOWA 4MWIA 1YXUA 1ZARA 3FQEA 1YXVA 3NYNA 4RX5A 4UN0C 5H8BA 2QCSA 2FSTX 4YJTA 1ZWSA 5HNBA 2O2UA 2DYLA 5KE0A 2V22A 3DK6A 3SV0A 3UC4A 4ANQA 4EOSA 4F9BA 2YLFA 4FKUA 2QQ7A 5DHJA 5I9ZA 4OR5A 4BGQA 5FRIA 4BC6A 4RJ6A 4D9UA 4EOPA 3LPBA 2PL0A 4WOVA 5C1QB 2YM6A 4JX3A 4L3JA 1JPAA 1DAWA 5BV3A 5LARA 1PF8A 1L3RE 1SVHA 4DH5A 3L1SA 4FK3A 2QR7A 5DN3A 3OCTA 2CKPA 4ACDA 4XS2A 5L6OA 4O4FA 4CT2A 4BDHA 1U46A 3G5DA 4KIKA 2EUFB 1FBNA 4TPTA 3CE3A 3AKLA 1JQHA 4DEGA 3RCDA 2BFXA 4WNKA 4J7BA 4JDKA 3O71A 4AXCA 4ZIMA 2R3OA 5AM7A 2XK8A 4FUYA 1ZAOA 2AC5A 3R8ZA 3TTJA 4YBJA 4BKYA 1BUHA 2QI8A 2OIQA 2WXVA 3V5JA 5LXMA 4FKJA 4IFGA 4O0TA 1Y8GA 4UMQA 3RMFA 3V8WA 1GZOA 4O0UA 3GU8A 2GNIA 4C0TA 1YDTE 3EJ1A 3TZ7A 3DBFA 2W1ZA 2OG8A 4G6NA 3FLSA 1QMZA 1G8JA 4AQKA 3ZHPC 5LMKC 3EQIA 1VR2A 2W1EA 4FTTA 5C26A 3VIDA 4AP7A 2BFYA 2XNGA 3SW4A 2FGIA 3FMHA 2OI4X 2VO0A 3WIGA 3MGYA 4EQCA 3C13A 4LL0A 5ACKA 5ANDA 4F9AA 2GFCA 4FKGA 3KRLA 3QTUA 3SOCA 2VWZA 3HKOA 5AA9A 2OJGA 1XR1A 4PUZA 3RHKA 4G1WA 5M08A 1J7IA 2GS7A 3ZFMA 4TN6A 1P14A 4D2PA 3QFVA 3QQHA 5IQBA 2WMUA 4IW0A 4U7ZA 4HNIA 4I92A 4YTFA 5ANOA 4RZWA 3KGAA 4FZFB 2QD9A 2F7EE 4MBIA 5FBNC 3UOJA 1IRKA 4BDFA 3BKBA 4I1ZA 2GHMA 4IX4A 4IB0A 3EN5A 4YO6A 4V01A 1ZMWA 3WZJA 4RC3A 3HMOA 3LFEA 5AR3A 3U9CA 4JI9A 1X8BA 3JXWA 2C47A 4QMWA 3ZEPA 3LQ3A 2F7ZE 4BDIA 5ITAA 4XX9A 2QC6A 3UQFA 3TUCA 1OKZA 2F9GA 4CVAA 5HHWA 2XK3A 3BHVA 4U3ZA 5HIDA 5FD2A 4GUBA 2C6OA 1H07A 1VYZA 4YGAA 3OT8A 4MNEA 3QTQA 4BTKA 3QA0A 3FXZA 5F1ZA 3F7WA 3F5XA 3PFYA 4HVDA 4EEVA 1YQJA 3ZUVA 1Y8YA 4U80A 2IN6A 4TYIA 2XBJA 5EI8A 1OPJA 3PVBA 4O38A 4F63A 5HX8A 1Q3WA 4AW2A 4QMNA 1XH9A 1K9AA 1ZOEA 1ZYJA 5IDNA 3QBNA 3QCYA 5IA0A 4KINA 3GCUA 1YW2A 4V05A 3CY3A 5FDPA 4MX9A 3W10A 3N4TA 4EJ7A 4O7TA 4LUEA 4RIXA 4F1TA 4F09A 4LDTA 5TT7A 4O0YA 4FTLA 4J53A 5HG5A 5HG8A 2XK9A 2QOOA 1YDSE 4GYIA 4EOLA 3O5AA 2QU5A 3QA8A 3QCXA 1W98A 4BCHA 1MRVA 2C0TA 2R3LA 2VTPA 4PY1A 4XV1A 3UDBA 4EHVA 2ITZA 5CSHA 3DV3A 2OJIA 3VBQA 5B2LA 1GAGA 3PG1A 2HAKA 3TNPC 5JQ8A 1G3NA 4ACMA 3R9DA 1Q3DA 2H6DA 2B9FA 4OTHA 4OTIA 4R7HA 2OKRA 2G01A 2WNTA 2JDOA 4U5JA 2I0EA 1W8CA 1U5RA 3SAYA 3U4UA 4LL5A 4DFUA 4XLVA 4LGGA 3FZSA 3IO7A 2GS6A 2A27A 3QWJA 3UO4A 3U55A 3MTFA 3I79A 1ZYSA 2XAMA 1FVTA 2V55A 3MVHA 2R3PA 4Y85A 1OIUA 1YOJA 3NR9A 2VV9A 4Q5EA 5CVFA 3C4FA 2GFSA 5LVLA 1H1WA 1PY5A 4QRCA 3MA6A 4IVCA 3BBWA 2YDKA 4G34A 3Q60A 2PU8A 3V5QA 2C6IA 4GS6A 5JSMA 4OT5A 2HWOA 2CSNA 2C0IA 2XYNA 3LXLA 4J96A 3RK5A 3VWAA 4BI2A 2WQMA 3QL8A 2F57A 3ZZEA 4AF3A 4OTDA 1IA8A 3L8PA 2ZMDA 3FLWA 3FDNA 3PJCA 4CEGA 3BE9A 4ZSGA 3Q6WA 4AACA 2JDSA 2V0DA 3QHRA 4QMTA 3VUMA 4O0XA 5C4KA 1YRPA 3G0FA 5CVGA 1KOBA 2GQRA 4OT6A 5AIKA 4CCBA 2J0MB 3EH9A 4L45A 3V51A 3ZUTA 2WB8A 3FEGA 4DCEA 3UG1A 2QOLA 2PTKA 3F3TA 3O0GA 3K5VA 5D12A 3ZXZA 3HMMA 4J99A 2C6DA 3VW6A 4C4GA 4WSYA 5BVKA 4A4XA 3BRBA 3FYJX 4WHZA 4YNEA 2XAOA 1PXKA 3LFFA 4IADA 2IVTA 4M0YA 3SDJA 4RWJA 5A4QA 1MUOA 3IOPA 3MY5A 2I40A 4PMSA 4H1JA 3HV5A 4D2VA 3RBWA 4ZMEA 3DKFA 3K5UA 3QTZA 2UZOA 3OXTA 4ASXA 4E1ZA 5GIOE 4L43A 4AG8A 3VW8A 4WT6A 1G8KA 3PIYA 4FKIA 3H10A 3VS7A 2BTRA 2C30A 2XNPA 2YZAA 4R7IA 2H8HA 3SD0A 5F4NA 3R8UA 4O6LA 3DTCA 2QOBA 3CBLA 3F61A 4YHTA 1G8SA 3Q9YA 4EK4A 4BB4A 1I09A 4P2KA 5LJJA 4NWMA 1XBCA 3TV6A 3VS4A 3WF5A 3LFDA 3QTWA 3QAME 3R9NA 5EQPA 4IH8A 4F7LA 3KRWA 3VN9A 2YM4A 2P3GX 3LQ8A 4Q9ZA 5FM2A 3PE2A 4N6YA 5K3YA 3K2LA 4EZ7A 3PUPA 3ZBFA 1UNLA 3F2NA 5LVMA 2O3PA 4DDIA 3F88A 1JSTA 3COMA 1UKHA 2OH0E 4EONA 4O0RA 3PPJA 3DBDA 3IG7A 3ZLYA 4FIIA 1WBTA 3I0OA 3LFBA 4EOJA 5CEKA 5I4NA 2UZTA 2W9ZB 5IEXA 3JR1A 4FKTA 3QZHA 5IMEA 2VTJA 2WHBA 4UV0A 2UZEA 4OTGA 3PRFA 3VUKA 5AP6A 2WTCA 4ZJVA 3KIOC 3QLGA 3A7FA 4UB7A 4DFYA 4O7SA 4ASEA 5HNIX 5IA5A 1IA9A 3GU6A 4OAUC 2CNVA 3DAKA 4C4FA 3DKCA 3TIZA 5CXHA 5B0XA 3RHXA 3UO6A 3RAHA 3W2QA 3MJ2A 3PDTA 3HECA 5GJDA 2QOQA 1OITA 3CLYA 2CKOA 4EK6A 1U4DA 4G31A 2PVNA 2F49A 5AAFA 3A62A 1PKGA 4CNHA 1OL2A 3HV6A 2B4SB 3RWPA 3ZU7A 3B8QA 4XRLA 5EFQA 1ZXEA 3LFQA 3REPA 1CKJA 4KBKA 3O23A 4YZCA 1CTPE 4IQ6A 3VUGA 3UTOA 2EXMA 5AP7A 4Z16A 4G3GA 4FV9A 4AOIA 4FV3A 4FGRA 2GSFA 2WMVA 3CR0A 2PYWA 1H1QA 1S9JA 4R3RA 2BDFA 3DFCB 2WMBA 4FOCA 3GCVA 3HRFA 2BAQA 4NM0A 4HCVA 4NW5A 3CPBA 3PXKA 4HGTA 4IMYA 4APPA 1OMWA 4QP7A 3E3BX 1BX6A 5JRQA 4M7IA 4AZWA 3P86A 4EK3A 1YVJA 5B2MA 1T46A 5IQIA 4DF3A 5JGAA 1RE8A 5CEPA 4EBVA 4MAOA 3CQWA 2PVJA 2WMSA 3MFRA 5JQ5A 3D2KA 3EQGA 4F65A 4DT9A 3FKNA 3QXPA 4QYEA 2XIZA 3G90X 1JKSA 4H39A 3PUFC 3QRUA 5C03A 4RFMA 5AUWA 5CAVA 1OIQA 1XH7A 4L53A 4YLJA 3S3IA 4A9TA 3AQVA 2X0QA 1WBOA 3F6XA 4QMYA 2J5EA 2QU6A 3PTGA 4G6OA 4KBAA 4N6ZA 3Q32A 4J71A 2P2IA 2OGVA 5AR5A 2GNGA 4LRMA 2HENA 4D2WA 2XM9A 4APCA 2YFXA 4FTMA 4XP0A 3KXHA 4ZTHA 4IANA 4B9DA 2X6EA 5KBQA 1CKPA 1DAYA 5K4IA 4E4MA 2BDWA 2V5QA 1FQ1B 4YBKA 4HYSA 1B39A 3NW7A 3V8SA 2XIKA 2GTMA 3UP7A 3Q3BA 3TKHA 5C8MA 3FLYA 5A6NA 5IQCA 3ZRMA 4GKIA 2HZ4A 4BRXA 1BI7A 2VGPA 5IA4A 3KF4A 2B1PA 3O50A 4EWHA 4FTCA 1G5SA 4F0IA 3MFSA 3PG3A 2P0CA 4W9XA 1Q8ZA 3HA8A 5M56A 3UZRA 4QQTA 3FLQA 3BHUA 3EQBA 1CMKE 3OF0A 1AGWA 1J1CA 3FSKA 3E87A 1TFFA 3E92A 4IBMA 3H9FA 3NFFB 1H28A 2UZLA 3MY1A 2RIOA 1YWRA 2F7XE 5BMSA 4O4BB 5AV2A 2BVAA 1KE5A 4ACCA 3GC8A 1FMOE 4DFNA 3GCQA 4FV5A 4UX9A 3PE1A 4N57A 3K54A 4D5HA 2YJRA 4ERKA 5M44A 5J7HA 2HZIA 3WZDA 3ZEWA 4ALUA 4V04A 4EHEA 1UU3A 4ZSEA 4IAAA 4HPUE 5EOLA 3RPSA 1RJBA 4DEDA 4DE4A 4CFMA 4X2NA 4AX8A 4L9IA 4FTKA 3GOPA 3SGCA 3FY2A 2BRHA 2X1NA 4NKSA 3VUHA 2OJJA 1Y6AA 4KBCA 3CTQA 2QO9A 3E63A 4DA5A 4DG2E 3MTLA 5AP3A 2BZHB 2HZNA 4QQCA 3ZBXA 5FXRA 3N9XA 2QOCA 3R30A 5AP4A 4DT8A 3ROYA 3ZUUA 4BBFA 3QYWA 5CEMA 4WG3A 1I44A 2JKKA 4RX7A 4YZ9A 3QQLA 3HX4A 5A46A 4J1RA 4GW8A 4GIIA 4EI4A 5JGDA 4G17A 3UOKA 5FWKK 2ERKA 2XB7A 5M55A 5JFWA 3KULB 4E6AA 3QCSA 4G3FA 4MKCA 3LJ2A 4MF1A 3VONA 2BDJA 5M4IA 2HWPA 2WELA 3A4PA 5EW3A 2X9FA 4CYJA 4M69B 4DDGA 3HA6A 4W4YA